4Z4PA

Structure of the mll4 set domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
b'TLHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHEIPCHCGAWNCRKWMKGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase 2D
publication title Evolving Catalytic Properties of the MLL Family SET Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4z4pA00
3VV0A 5T0MA 5CCLA 5JIYA 3DB5A 3IHXA 3M54A 3CBMA 4RZ0A 5CPRB 3OPEA 5F6LA 2RFIA 3DALA 5KJLA 3PDNA 3HNAA 4JLGA 1MT6A 4YNPA 1H3IA 5LSXA 5TEGA 4H12A 3M56A 4QENA 1ML9A 3CBPA 1N6CA 2QPWA 3QWWA 1ZKKA 3M57A 5EG2A 4E47A 5TH7A 1XQHA 5F59A 3QWPA 1N6AA 4MI5A 3S7BA 3M59A 3MEKA 3SW9A 4J83A 3MO0A 3TG4A 2W5YA 5TTFA 4C1QA 3F9WA 3RQ4A 5JINA 5CCMA 5ARFA 2R3AA 5F5EA 4LDGA 4QEOA 5LSZA 4MI0A 5HI7A 2G46A 3MO5A 4O30A 5EX0A 3S7JA 4BUPA 4IJDA 4YNDA 4I51A 4YPAA 4FMUA 3S7DA 4YPEA 5T0KA 3F9ZA 3F9XA 5ARGA 5EX3A 3CBOA 3M58A 3OXGA 3MO2A 4YPUA 5F6KC 2O8JA 5KJNA 3F9YA 3OOIA 4J7IA 4J7FA 1N3JA 1MVXA 3OXLA 3EP0A 1MUFA 3RJWA 4QEPA 3OS5A 5AYFA 5JHNA 4J8OA 3K5KA 4IJ8A 2BQZA 3N71A 2IGQA 1PEGA 4O6FA 3TG5A 3KMTA 3M55A 2JV0A 3VUZA 1O9SA 4Z4PA 3KMAA 3FPDA 2F69A 3S7FA 3RAYA 3QWVA 5JJ0A 2W5ZA 5HQ8A 3RIBA 3KMJA 5KJMA 3RU0A 4WUYA 3M5AA 4NJ5A 3M53A 3OXFA 3BO5A 3S8PA 4NVQA 4JDSA 5KJKA 3SWCA 5T5GA 4AU7A 4YNMA 1MVHA
chains in the Genus database with same CATH superfamily
3VV0A 5T0MA 5CCLA 5JIYA 3DB5A 3IHXA 3M54A 3CBMA 4RZ0A 5CPRB 3OPEA 5F6LA 2RFIA 3DALA 5KJLA 3PDNA 3HNAA 4JLGA 1MT6A 4YNPA 1H3IA 5LSXA 5TEGA 4H12A 3M56A 4QENA 1ML9A 3CBPA 1N6CA 2QPWA 3QWWA 1ZKKA 3M57A 5EG2A 4E47A 5TH7A 1XQHA 5F59A 3QWPA 1N6AA 4MI5A 3S7BA 3M59A 3MEKA 3SW9A 4J83A 3MO0A 3TG4A 2W5YA 5TTFA 4C1QA 3F9WA 3RQ4A 5JINA 5CCMA 5ARFA 2R3AA 5F5EA 4LDGA 4QEOA 5LSZA 4MI0A 5HI7A 2G46A 3MO5A 4O30A 5EX0A 3S7JA 4BUPA 4IJDA 4YNDA 4I51A 4YPAA 4FMUA 3S7DA 4YPEA 5T0KA 3F9ZA 3F9XA 5ARGA 5EX3A 3CBOA 3M58A 3OXGA 3MO2A 4YPUA 5F6KC 2O8JA 5KJNA 3F9YA 3OOIA 4J7IA 4J7FA 1N3JA 1MVXA 3OXLA 3EP0A 1MUFA 3RJWA 4QEPA 3OS5A 5AYFA 5JHNA 4J8OA 3K5KA 4IJ8A 2BQZA 3N71A 2IGQA 1PEGA 4O6FA 3TG5A 3KMTA 3M55A 2JV0A 3VUZA 1O9SA 4Z4PA 3KMAA 3FPDA 2F69A 3S7FA 3RAYA 3QWVA 5JJ0A 2W5ZA 5HQ8A 3RIBA 3KMJA 5KJMA 3RU0A 4WUYA 3M5AA 4NJ5A 3M53A 3OXFA 3BO5A 3S8PA 4NVQA 4JDSA 5KJKA 3SWCA 5T5GA 4AU7A 4YNMA 1MVHA
chains in the Genus database with same CATH topology
3VV0A 5T0MA 5CCLA 5JIYA 3DB5A 3IHXA 3M54A 3CBMA 4RZ0A 5CPRB 3OPEA 5F6LA 2RFIA 3DALA 5KJLA 3PDNA 3HNAA 4JLGA 1MT6A 4YNPA 1H3IA 5LSXA 5TEGA 4H12A 3M56A 4QENA 1ML9A 3CBPA 1N6CA 2QPWA 3QWWA 1ZKKA 3M57A 5EG2A 4E47A 5TH7A 1XQHA 5F59A 3QWPA 1N6AA 4MI5A 3S7BA 3M59A 3MEKA 3SW9A 4J83A 3MO0A 3TG4A 2W5YA 5TTFA 4C1QA 3F9WA 3RQ4A 5JINA 5CCMA 5ARFA 2R3AA 5F5EA 4LDGA 4QEOA 5LSZA 4MI0A 5HI7A 2G46A 3MO5A 4O30A 5EX0A 3S7JA 4BUPA 4IJDA 4YNDA 4I51A 4YPAA 4FMUA 3S7DA 4YPEA 5T0KA 3F9ZA 3F9XA 5ARGA 5EX3A 3CBOA 3M58A 3OXGA 3MO2A 4YPUA 5F6KC 2O8JA 5KJNA 3F9YA 3OOIA 4J7IA 4J7FA 1N3JA 1MVXA 3OXLA 3EP0A 1MUFA 3RJWA 4QEPA 3OS5A 5AYFA 5JHNA 4J8OA 3K5KA 4IJ8A 2BQZA 3N71A 2IGQA 1PEGA 4O6FA 3TG5A 3KMTA 3M55A 2JV0A 3VUZA 1O9SA 4Z4PA 3KMAA 3FPDA 2F69A 3S7FA 3RAYA 3QWVA 5JJ0A 2W5ZA 5HQ8A 3RIBA 3KMJA 5KJMA 3RU0A 4WUYA 3M5AA 4NJ5A 3M53A 3OXFA 3BO5A 3S8PA 4NVQA 4JDSA 5KJKA 3SWCA 5T5GA 4AU7A 4YNMA 1MVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VV0 A;  5T0M A;  5CCL A;  5JIY A;  3DB5 A;  3IHX A;  3M54 A;  3CBM A;  4RZ0 A;  5CPR B;  3OPE A;  5F6L A;  2RFI A;  3DAL A;  5KJL A;  3PDN A;  3HNA A;  4JLG A;  1MT6 A;  4YNP A;  1H3I A;  5LSX A;  5TEG A;  4H12 A;  3M56 A;  4QEN A;  1ML9 A;  3CBP A;  1N6C A;  2QPW A;  3QWW A;  1ZKK A;  3M57 A;  5EG2 A;  4E47 A;  5TH7 A;  1XQH A;  5F59 A;  3QWP A;  1N6A A;  4MI5 A;  3S7B A;  3M59 A;  3MEK A;  3SW9 A;  4J83 A;  3MO0 A;  3TG4 A;  2W5Y A;  5TTF A;  4C1Q A;  3F9W A;  3RQ4 A;  5JIN A;  5CCM A;  5ARF A;  2R3A A;  5F5E A;  4LDG A;  4QEO A;  5LSZ A;  4MI0 A;  5HI7 A;  2G46 A;  3MO5 A;  4O30 A;  5EX0 A;  3S7J A;  4BUP A;  4IJD A;  4YND A;  4I51 A;  4YPA A;  4FMU A;  3S7D A;  4YPE A;  5T0K A;  3F9Z A;  3F9X A;  5ARG A;  5EX3 A;  3CBO A;  3M58 A;  3OXG A;  3MO2 A;  4YPU A;  5F6K C;  2O8J A;  5KJN A;  3F9Y A;  3OOI A;  4J7I A;  4J7F A;  1N3J A;  1MVX A;  3OXL A;  3EP0 A;  1MUF A;  3RJW A;  4QEP A;  3OS5 A;  5AYF A;  5JHN A;  4J8O A;  3K5K A;  4IJ8 A;  2BQZ A;  3N71 A;  2IGQ A;  1PEG A;  4O6F A;  3TG5 A;  3KMT A;  3M55 A;  2JV0 A;  3VUZ A;  1O9S A;  4Z4P A;  3KMA A;  3FPD A;  2F69 A;  3S7F A;  3RAY A;  3QWV A;  5JJ0 A;  2W5Z A;  5HQ8 A;  3RIB A;  3KMJ A;  5KJM A;  3RU0 A;  4WUY A;  3M5A A;  4NJ5 A;  3M53 A;  3OXF A;  3BO5 A;  3S8P A;  4NVQ A;  4JDS A;  5KJK A;  3SWC A;  5T5G A;  4AU7 A;  4YNM A;  1MVH A; 
#chains in the Genus database with same CATH topology
 3VV0 A;  5T0M A;  5CCL A;  5JIY A;  3DB5 A;  3IHX A;  3M54 A;  3CBM A;  4RZ0 A;  5CPR B;  3OPE A;  5F6L A;  2RFI A;  3DAL A;  5KJL A;  3PDN A;  3HNA A;  4JLG A;  1MT6 A;  4YNP A;  1H3I A;  5LSX A;  5TEG A;  4H12 A;  3M56 A;  4QEN A;  1ML9 A;  3CBP A;  1N6C A;  2QPW A;  3QWW A;  1ZKK A;  3M57 A;  5EG2 A;  4E47 A;  5TH7 A;  1XQH A;  5F59 A;  3QWP A;  1N6A A;  4MI5 A;  3S7B A;  3M59 A;  3MEK A;  3SW9 A;  4J83 A;  3MO0 A;  3TG4 A;  2W5Y A;  5TTF A;  4C1Q A;  3F9W A;  3RQ4 A;  5JIN A;  5CCM A;  5ARF A;  2R3A A;  5F5E A;  4LDG A;  4QEO A;  5LSZ A;  4MI0 A;  5HI7 A;  2G46 A;  3MO5 A;  4O30 A;  5EX0 A;  3S7J A;  4BUP A;  4IJD A;  4YND A;  4I51 A;  4YPA A;  4FMU A;  3S7D A;  4YPE A;  5T0K A;  3F9Z A;  3F9X A;  5ARG A;  5EX3 A;  3CBO A;  3M58 A;  3OXG A;  3MO2 A;  4YPU A;  5F6K C;  2O8J A;  5KJN A;  3F9Y A;  3OOI A;  4J7I A;  4J7F A;  1N3J A;  1MVX A;  3OXL A;  3EP0 A;  1MUF A;  3RJW A;  4QEP A;  3OS5 A;  5AYF A;  5JHN A;  4J8O A;  3K5K A;  4IJ8 A;  2BQZ A;  3N71 A;  2IGQ A;  1PEG A;  4O6F A;  3TG5 A;  3KMT A;  3M55 A;  2JV0 A;  3VUZ A;  1O9S A;  4Z4P A;  3KMA A;  3FPD A;  2F69 A;  3S7F A;  3RAY A;  3QWV A;  5JJ0 A;  2W5Z A;  5HQ8 A;  3RIB A;  3KMJ A;  5KJM A;  3RU0 A;  4WUY A;  3M5A A;  4NJ5 A;  3M53 A;  3OXF A;  3BO5 A;  3S8P A;  4NVQ A;  4JDS A;  5KJK A;  3SWC A;  5T5G A;  4AU7 A;  4YNM A;  1MVH A; 
#chains in the Genus database with same CATH homology
 3VV0 A;  5T0M A;  5CCL A;  5JIY A;  3DB5 A;  3IHX A;  3M54 A;  3CBM A;  4RZ0 A;  5CPR B;  3OPE A;  5F6L A;  2RFI A;  3DAL A;  5KJL A;  3PDN A;  3HNA A;  4JLG A;  1MT6 A;  4YNP A;  1H3I A;  5LSX A;  5TEG A;  4H12 A;  3M56 A;  4QEN A;  1ML9 A;  3CBP A;  1N6C A;  2QPW A;  3QWW A;  1ZKK A;  3M57 A;  5EG2 A;  4E47 A;  5TH7 A;  1XQH A;  5F59 A;  3QWP A;  1N6A A;  4MI5 A;  3S7B A;  3M59 A;  3MEK A;  3SW9 A;  4J83 A;  3MO0 A;  3TG4 A;  2W5Y A;  5TTF A;  4C1Q A;  3F9W A;  3RQ4 A;  5JIN A;  5CCM A;  5ARF A;  2R3A A;  5F5E A;  4LDG A;  4QEO A;  5LSZ A;  4MI0 A;  5HI7 A;  2G46 A;  3MO5 A;  4O30 A;  5EX0 A;  3S7J A;  4BUP A;  4IJD A;  4YND A;  4I51 A;  4YPA A;  4FMU A;  3S7D A;  4YPE A;  5T0K A;  3F9Z A;  3F9X A;  5ARG A;  5EX3 A;  3CBO A;  3M58 A;  3OXG A;  3MO2 A;  4YPU A;  5F6K C;  2O8J A;  5KJN A;  3F9Y A;  3OOI A;  4J7I A;  4J7F A;  1N3J A;  1MVX A;  3OXL A;  3EP0 A;  1MUF A;  3RJW A;  4QEP A;  3OS5 A;  5AYF A;  5JHN A;  4J8O A;  3K5K A;  4IJ8 A;  2BQZ A;  3N71 A;  2IGQ A;  1PEG A;  4O6F A;  3TG5 A;  3KMT A;  3M55 A;  2JV0 A;  3VUZ A;  1O9S A;  4Z4P A;  3KMA A;  3FPD A;  2F69 A;  3S7F A;  3RAY A;  3QWV A;  5JJ0 A;  2W5Z A;  5HQ8 A;  3RIB A;  3KMJ A;  5KJM A;  3RU0 A;  4WUY A;  3M5A A;  4NJ5 A;  3M53 A;  3OXF A;  3BO5 A;  3S8P A;  4NVQ A;  4JDS A;  5KJK A;  3SWC A;  5T5G A;  4AU7 A;  4YNM A;  1MVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...