4Z4PA

Structure of the mll4 set domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
161
Chain Sequence
TLHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHEIPCHCGAWNCRKWMKGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evolving Catalytic Properties of the MLL Family SET Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase 2D
total genus 39
structure length 161
sequence length 161
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4z4pA00
3MEKA 3M57A 2QPWA 3DB5A 1O9SA 3S8PA 3M58A 3M5AA 5CCLA 3M56A 3IHXA 4J8OA 4NVQA 4YNDA 4J83A 1MVXA 4QENA 4LDGA 2G46A 3S7DA 3KMJA 5LSXA 5ARFA 3F9WA 2BQZA 4IJDA 3CBOA 5F6KC 3S7BA 4O6FA 3M59A 3OXFA 1ML9A 1XQHA 4IJ8A 5HI7A 3S7FA 5TH7A 5TTFA 5KJMA 5KJKA 5CCMA 3VUZA 1PEGA 3KMAA 5F5EA 3OPEA 3MO2A 3RAYA 4AU7A 2JV0A 1ZKKA 1N3JA 1N6AA 4MI0A 5JINA 4BUPA 1N6CA 5JJ0A 5JIYA 3RIBA 5T5GA 4QEPA 5AYFA 3MO0A 4YPAA 3RJWA 3OS5A 5T0MA 4J7FA 3RQ4A 5JHNA 4O30A 3OXGA 5EX0A 3HNAA 4Z4PA 5TEGA 3OXLA 3F9ZA 3F9YA 2F69A 3CBPA 3PDNA 3TG5A 1MUFA 5F6LA 5CPRB 3QWVA 4JLGA 1MVHA 2O8JA 3MO5A 3N71A 2R3AA 4YPUA 4YPEA 3S7JA 3K5KA 4H12A 3M53A 4QEOA 3QWWA 3DALA 5KJNA 4YNPA 4NJ5A 3QWPA 5EX3A 4WUYA 5LSZA 3EP0A 4J7IA 1H3IA 3CBMA 3M54A 4MI5A 3VV0A 3KMTA 1MT6A 3SW9A 5F59A 5KJLA 3RU0A 5T0KA 3FPDA 4E47A 5HQ8A 3SWCA 4JDSA 4FMUA 3OOIA 4C1QA 5ARGA 2W5YA 3BO5A 4I51A 2W5ZA 2IGQA 3M55A 3F9XA 2RFIA 5EG2A 3TG4A 4YNMA 4RZ0A
chains in the Genus database with same CATH superfamily
3MEKA 3M57A 2QPWA 3DB5A 1O9SA 3S8PA 3M58A 3M5AA 5CCLA 3M56A 3IHXA 4J8OA 4NVQA 4YNDA 4J83A 1MVXA 4QENA 4LDGA 2G46A 3S7DA 3KMJA 5LSXA 5ARFA 3F9WA 2BQZA 4IJDA 3CBOA 5F6KC 3S7BA 4O6FA 3M59A 3OXFA 1ML9A 1XQHA 4IJ8A 5HI7A 3S7FA 5TH7A 5TTFA 5KJMA 5KJKA 5CCMA 3VUZA 1PEGA 3KMAA 5F5EA 3OPEA 3MO2A 3RAYA 4AU7A 2JV0A 1ZKKA 1N3JA 1N6AA 4MI0A 5JINA 4BUPA 1N6CA 5JJ0A 5JIYA 3RIBA 5T5GA 4QEPA 5AYFA 3MO0A 4YPAA 3RJWA 3OS5A 5T0MA 4J7FA 3RQ4A 5JHNA 4O30A 3OXGA 5EX0A 3HNAA 4Z4PA 5TEGA 3OXLA 3F9ZA 3F9YA 2F69A 3CBPA 3PDNA 3TG5A 1MUFA 5F6LA 5CPRB 3QWVA 4JLGA 1MVHA 2O8JA 3MO5A 3N71A 2R3AA 4YPUA 4YPEA 3S7JA 3K5KA 4H12A 3M53A 4QEOA 3QWWA 3DALA 5KJNA 4YNPA 4NJ5A 3QWPA 5EX3A 4WUYA 5LSZA 3EP0A 4J7IA 1H3IA 3CBMA 3M54A 4MI5A 3VV0A 3KMTA 1MT6A 3SW9A 5F59A 5KJLA 3RU0A 5T0KA 3FPDA 4E47A 5HQ8A 3SWCA 4JDSA 4FMUA 3OOIA 4C1QA 5ARGA 2W5YA 3BO5A 4I51A 2W5ZA 2IGQA 3M55A 3F9XA 2RFIA 5EG2A 3TG4A 4YNMA 4RZ0A
chains in the Genus database with same CATH topology
3MEKA 3M57A 2QPWA 3DB5A 1O9SA 3S8PA 3M58A 3M5AA 5CCLA 3M56A 3IHXA 4J8OA 4NVQA 4YNDA 4J83A 1MVXA 4QENA 4LDGA 2G46A 3S7DA 3KMJA 5LSXA 5ARFA 3F9WA 2BQZA 4IJDA 3CBOA 5F6KC 3S7BA 4O6FA 3M59A 3OXFA 1ML9A 1XQHA 4IJ8A 5HI7A 3S7FA 5TH7A 5TTFA 5KJMA 5KJKA 5CCMA 3VUZA 1PEGA 3KMAA 5F5EA 3OPEA 3MO2A 3RAYA 4AU7A 2JV0A 1ZKKA 1N3JA 1N6AA 4MI0A 5JINA 4BUPA 1N6CA 5JJ0A 5JIYA 3RIBA 5T5GA 4QEPA 5AYFA 3MO0A 4YPAA 3RJWA 3OS5A 5T0MA 4J7FA 3RQ4A 5JHNA 4O30A 3OXGA 5EX0A 3HNAA 4Z4PA 5TEGA 3OXLA 3F9ZA 3F9YA 2F69A 3CBPA 3PDNA 3TG5A 1MUFA 5F6LA 5CPRB 3QWVA 4JLGA 1MVHA 2O8JA 3MO5A 3N71A 2R3AA 4YPUA 4YPEA 3S7JA 3K5KA 4H12A 3M53A 4QEOA 3QWWA 3DALA 5KJNA 4YNPA 4NJ5A 3QWPA 5EX3A 4WUYA 5LSZA 3EP0A 4J7IA 1H3IA 3CBMA 3M54A 4MI5A 3VV0A 3KMTA 1MT6A 3SW9A 5F59A 5KJLA 3RU0A 5T0KA 3FPDA 4E47A 5HQ8A 3SWCA 4JDSA 4FMUA 3OOIA 4C1QA 5ARGA 2W5YA 3BO5A 4I51A 2W5ZA 2IGQA 3M55A 3F9XA 2RFIA 5EG2A 3TG4A 4YNMA 4RZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEK A;  3M57 A;  2QPW A;  3DB5 A;  1O9S A;  3S8P A;  3M58 A;  3M5A A;  5CCL A;  3M56 A;  3IHX A;  4J8O A;  4NVQ A;  4YND A;  4J83 A;  1MVX A;  4QEN A;  4LDG A;  2G46 A;  3S7D A;  3KMJ A;  5LSX A;  5ARF A;  3F9W A;  2BQZ A;  4IJD A;  3CBO A;  5F6K C;  3S7B A;  4O6F A;  3M59 A;  3OXF A;  1ML9 A;  1XQH A;  4IJ8 A;  5HI7 A;  3S7F A;  5TH7 A;  5TTF A;  5KJM A;  5KJK A;  5CCM A;  3VUZ A;  1PEG A;  3KMA A;  5F5E A;  3OPE A;  3MO2 A;  3RAY A;  4AU7 A;  2JV0 A;  1ZKK A;  1N3J A;  1N6A A;  4MI0 A;  5JIN A;  4BUP A;  1N6C A;  5JJ0 A;  5JIY A;  3RIB A;  5T5G A;  4QEP A;  5AYF A;  3MO0 A;  4YPA A;  3RJW A;  3OS5 A;  5T0M A;  4J7F A;  3RQ4 A;  5JHN A;  4O30 A;  3OXG A;  5EX0 A;  3HNA A;  4Z4P A;  5TEG A;  3OXL A;  3F9Z A;  3F9Y A;  2F69 A;  3CBP A;  3PDN A;  3TG5 A;  1MUF A;  5F6L A;  5CPR B;  3QWV A;  4JLG A;  1MVH A;  2O8J A;  3MO5 A;  3N71 A;  2R3A A;  4YPU A;  4YPE A;  3S7J A;  3K5K A;  4H12 A;  3M53 A;  4QEO A;  3QWW A;  3DAL A;  5KJN A;  4YNP A;  4NJ5 A;  3QWP A;  5EX3 A;  4WUY A;  5LSZ A;  3EP0 A;  4J7I A;  1H3I A;  3CBM A;  3M54 A;  4MI5 A;  3VV0 A;  3KMT A;  1MT6 A;  3SW9 A;  5F59 A;  5KJL A;  3RU0 A;  5T0K A;  3FPD A;  4E47 A;  5HQ8 A;  3SWC A;  4JDS A;  4FMU A;  3OOI A;  4C1Q A;  5ARG A;  2W5Y A;  3BO5 A;  4I51 A;  2W5Z A;  2IGQ A;  3M55 A;  3F9X A;  2RFI A;  5EG2 A;  3TG4 A;  4YNM A;  4RZ0 A; 
#chains in the Genus database with same CATH topology
 3MEK A;  3M57 A;  2QPW A;  3DB5 A;  1O9S A;  3S8P A;  3M58 A;  3M5A A;  5CCL A;  3M56 A;  3IHX A;  4J8O A;  4NVQ A;  4YND A;  4J83 A;  1MVX A;  4QEN A;  4LDG A;  2G46 A;  3S7D A;  3KMJ A;  5LSX A;  5ARF A;  3F9W A;  2BQZ A;  4IJD A;  3CBO A;  5F6K C;  3S7B A;  4O6F A;  3M59 A;  3OXF A;  1ML9 A;  1XQH A;  4IJ8 A;  5HI7 A;  3S7F A;  5TH7 A;  5TTF A;  5KJM A;  5KJK A;  5CCM A;  3VUZ A;  1PEG A;  3KMA A;  5F5E A;  3OPE A;  3MO2 A;  3RAY A;  4AU7 A;  2JV0 A;  1ZKK A;  1N3J A;  1N6A A;  4MI0 A;  5JIN A;  4BUP A;  1N6C A;  5JJ0 A;  5JIY A;  3RIB A;  5T5G A;  4QEP A;  5AYF A;  3MO0 A;  4YPA A;  3RJW A;  3OS5 A;  5T0M A;  4J7F A;  3RQ4 A;  5JHN A;  4O30 A;  3OXG A;  5EX0 A;  3HNA A;  4Z4P A;  5TEG A;  3OXL A;  3F9Z A;  3F9Y A;  2F69 A;  3CBP A;  3PDN A;  3TG5 A;  1MUF A;  5F6L A;  5CPR B;  3QWV A;  4JLG A;  1MVH A;  2O8J A;  3MO5 A;  3N71 A;  2R3A A;  4YPU A;  4YPE A;  3S7J A;  3K5K A;  4H12 A;  3M53 A;  4QEO A;  3QWW A;  3DAL A;  5KJN A;  4YNP A;  4NJ5 A;  3QWP A;  5EX3 A;  4WUY A;  5LSZ A;  3EP0 A;  4J7I A;  1H3I A;  3CBM A;  3M54 A;  4MI5 A;  3VV0 A;  3KMT A;  1MT6 A;  3SW9 A;  5F59 A;  5KJL A;  3RU0 A;  5T0K A;  3FPD A;  4E47 A;  5HQ8 A;  3SWC A;  4JDS A;  4FMU A;  3OOI A;  4C1Q A;  5ARG A;  2W5Y A;  3BO5 A;  4I51 A;  2W5Z A;  2IGQ A;  3M55 A;  3F9X A;  2RFI A;  5EG2 A;  3TG4 A;  4YNM A;  4RZ0 A; 
#chains in the Genus database with same CATH homology
 3MEK A;  3M57 A;  2QPW A;  3DB5 A;  1O9S A;  3S8P A;  3M58 A;  3M5A A;  5CCL A;  3M56 A;  3IHX A;  4J8O A;  4NVQ A;  4YND A;  4J83 A;  1MVX A;  4QEN A;  4LDG A;  2G46 A;  3S7D A;  3KMJ A;  5LSX A;  5ARF A;  3F9W A;  2BQZ A;  4IJD A;  3CBO A;  5F6K C;  3S7B A;  4O6F A;  3M59 A;  3OXF A;  1ML9 A;  1XQH A;  4IJ8 A;  5HI7 A;  3S7F A;  5TH7 A;  5TTF A;  5KJM A;  5KJK A;  5CCM A;  3VUZ A;  1PEG A;  3KMA A;  5F5E A;  3OPE A;  3MO2 A;  3RAY A;  4AU7 A;  2JV0 A;  1ZKK A;  1N3J A;  1N6A A;  4MI0 A;  5JIN A;  4BUP A;  1N6C A;  5JJ0 A;  5JIY A;  3RIB A;  5T5G A;  4QEP A;  5AYF A;  3MO0 A;  4YPA A;  3RJW A;  3OS5 A;  5T0M A;  4J7F A;  3RQ4 A;  5JHN A;  4O30 A;  3OXG A;  5EX0 A;  3HNA A;  4Z4P A;  5TEG A;  3OXL A;  3F9Z A;  3F9Y A;  2F69 A;  3CBP A;  3PDN A;  3TG5 A;  1MUF A;  5F6L A;  5CPR B;  3QWV A;  4JLG A;  1MVH A;  2O8J A;  3MO5 A;  3N71 A;  2R3A A;  4YPU A;  4YPE A;  3S7J A;  3K5K A;  4H12 A;  3M53 A;  4QEO A;  3QWW A;  3DAL A;  5KJN A;  4YNP A;  4NJ5 A;  3QWP A;  5EX3 A;  4WUY A;  5LSZ A;  3EP0 A;  4J7I A;  1H3I A;  3CBM A;  3M54 A;  4MI5 A;  3VV0 A;  3KMT A;  1MT6 A;  3SW9 A;  5F59 A;  5KJL A;  3RU0 A;  5T0K A;  3FPD A;  4E47 A;  5HQ8 A;  3SWC A;  4JDS A;  4FMU A;  3OOI A;  4C1Q A;  5ARG A;  2W5Y A;  3BO5 A;  4I51 A;  2W5Z A;  2IGQ A;  3M55 A;  3F9X A;  2RFI A;  5EG2 A;  3TG4 A;  4YNM A;  4RZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...