4Z54A

High resolution human septin3 gtpase domain with alpha-zero helix in complex with gdp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
273
Chain Sequence
KKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Human Septin3 GTPase domain with alpha-zero helix in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Neuronal-specific septin-3
total genus 84
structure length 273
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4z54A00
5G3YA 3GEHA 1Q1BA 3BH0A 3DKPA 3W8NA 3AKEA 5DIFA 1II8B 1OFUX 2AHOA 4POAA 4OL0A 2IXFA 4D0GA 3VR5A 2P2LA 3LBHA 1GNRA 3MGCA 4O2LA 4TMVA 4CT4B 4II7A 2A5GA 1DAMA 2HLDD 4RD1A 1SHZA 2VTKA 1HYQA 4LBVA 4CEJA 1JR6A 3WHKA 3I92A 2ZJZA 1XXHB 4GMDA 4LJ7A 3T35A 1T5LA 3ZJYA 3GLHA 4LYFA 1R7RA 3QXXA 4IDQA 2IHBA 4AIIA 3NHBA 3SBDA 3R9IA 5P21A 4BZXA 3ZD7A 3CF6R 3EPJA 4B3BA 4PZYA 1UF9A 1IOZA 1TUEA 4QM6A 2GAOA 2BKUA 3ASZA 2IYLD 3R20A 3OE7D 3TVTA 4EFNA 2QPTA 3RS7A 3BIFA 1ZUHA 5FOWA 3B5JA 3W8RA 3B1YA 2QY9A 4HDQB 3B13B 3O8DA 4GOXA 4UJ3A 3ZQ6A 3LLMA 2C78A 2ZYTX 3U4QB 1CR0A 5TY0A 3EA5A 5AJZA 3ZD6A 2OEPA 1E79A 4LHYA 3FKQA 2O5VA 3CBQA 4LJAA 5FBVB 5GADl 1D5CA 521PA 2QROA 1YZKA 1S8FA 2OAP1 3NBXX 1ESMA 1EXMA 4JL8A 4RCYA 3ND9A 3RANA 1XPRA 3PUZA 4M1KA 2ZSDA 1GFIA 2EVWX 2CCGA 3R7WA 1F2TB 1S3SA 2NOAA 3D31A 1E9SA 4XJXA 5HE8A 1ZNWA 2CBZA 2DHRA 2ZSAA 3I4LA 2ATXA 5HZKA 4BLOA 2J0SA 1VCOA 3E1SA 2GF9A 3ZS8A 2YV5A 3FDIA 2WV9A 5FUXA 1XXHA 1P9RA 1KDOA 4DDUA 4L15A 3RHFA 4HAZA 4Q21A 3NEYA 2QQEA 4OQXA 1SKYB 1KDPA 2I4IA 2W0SA 1CKEA 4CDGA 2HEIA 2OFXA 4LRWA 1ZYUA 1P2SA 2H18A 1E6CA 2YINC 2XZOA 3X1ZA 1NLYA 5CDFA 4LC1A 2ZS8A 4XTCS 1IHUA 1MOZA 3PCRB 1KZ7B 1NBMD 1M2OB 2C04A 4MGKR 4IVQA 5E7JA 1MR3F 1XCPA 4TQUS 4WBSA 4D2IA 3QKSA 1CRQA 1RYHA 2O0JA 2QZ4A 2PBRA 3GP8A 4AKIA 1F60A 2NGRA 1ZP6A 4A15A 1OV4A 3SJCA 1QG4A 3LXRA 4MRVA 3KJIA 4BFYA 3K70D 1CULC 3VR6A 3ADBA 3WYAA 1IBRA 2WWGA 4QGGA 4FW9A 2H7VA 2GXAA 2VP5A 1DO0A 2R6FA 4ZV4A 2IT1A 3EARA 1PUIA 4PQRA 3ZZTA 5A5GA 4CGZA 4C2TA 1VMAA 4EQ6A 4DLSA 2QRZA 1RJ9A 2OM2A 3N5CA 3BC1A 4JYBA 4D6PA 1GP2A 2J3EA 4Q18A 1RC8A 3HDTA 3TUZC 621PA 4D0LB 1J7KA 3AVPA 1G7SA 2CHGA 3LAWA 1ETUA 1OXXK 3B9PA 4W7SA 2CE7A 4NYMQ 5JBQA 3DDCA 4WZ6A 3OEED 4BFVA 3EC1A 3W6PA 1OXSC 4F4IA 3VTKA 2D7CA 1OH5A 1N25A 1KKMA 3QXJA 1TEXA 4OHVA 1DAGA 5FBWB 2IS1A 4PC7A 5DI9A 3GFPA 1M7GA 1GNPA 3MD0A 1D2MA 1KSJA 2WKPA 5TXGA 2JDIA 2JLZA 1FUUA 5TB5A 2PLFA 2IYXA 2ZRCA 1W46A 2GXUA 2AK3A 2CLCX 2Q0HA 3NBYC 3W5JA 1BIFA 3BK7A 1U9IC 2B7BA 3ASYA 5JJLA 5KNBA 3SBEA 4AYTA 1E2GA 3QEJA 1KIMA 1T4GA 2ZJYA 2QN6A 2ZRAA 3UATA 2X1VA 3SR0A 4NP6A 5CLLA 2CK3D 4LHVA 3AVVA 1G1MA 3ECCA 3OEEA 2CCKA 1KOFA 1L4UA 1FL9A 3NBFA 3RSOA 2OUKA 3KTAA 4IFBA 4DKXA 1Z22A 4QBGB 1OLOA 3A1TA 4JMPA 4P4UA 4Z1MA 1FUKA 1E9RA 1UDXA 4KITB 1II9A 5KPJA 2O8EA 4TTPA 1Q20A 3IBYA 1E0KA 4C7OB 3CRVA 2QORA 3UMSA 1DAKA 1RRPA 2ECKA 4Q7MB 3Q3JB 3FKSA 4GOJA 1GVNB 3K9GA 4CIDA 2IX3A 1GL9B 2ZRKA 3K0SA 3U3OA 1RPZA 3TLXA 4IRUB 2P0EA 4KAXA 4CEJB 2GJAA 3AVWA 1KSHA 4Q1FA 1HE1C 2ZVQX 1BYUA 3LBIA 4JVLA 2FH5B 4FMCF 4Y0VA 4IDOA 1U94A 721PA 4YMVA 2GAAA 4TTQA 1N6KA 1OF1A 2RH5A 3F3YA 1JR3E 1KGDA 4JLMA 4PC3A 4ZDIA 4A8JC 1ZUIA 1G21E 1NRJB 1XMSA 1GL6A 1MO6A 2G77B 1RFLA 4GP7A 2RCNA 2H92A 4PO1A 2CL0X 4IHQA 4DEXA 4P31A 3LD9A 3PUYA 5LBIA 4C0QC 4PC6A 1GUAA 1RE0A 1NMYA 3KJGA 2O0KA 2QP3A 3Q5EA 4M2LA 2GBLC 1CRPA 1PVOA 2BBTA 2OCAA 1NBME 2NPIA 3GEIA 2RHDA 5FPSA 1J70A 3ZH9B 2ODBA 5JJKA 1XEWX 4G5QA 5JI2E 3BFVA 1R8QA 1ANKA 2ONKA 3P26A 3IQXA 3DZDA 1KI6A 1N5IA 1NMXA 3A4NA 4ZI3A 4OBEA 3T1TA 2X77A 4BRUA 3FOZA 1IJFA 2XOKD 3CRQA 5BYKA 4CEIA 4DLYA 1SVLA 1XDBA 5FTMA 1E94E 3MJHA 2J59A 1UEIA 4AURA 2A78A 4D4MA 4ESVA 2PZGA 2QNRA 4B3CA 5HKKD 3TGPA 3PV0A 3TR0A 2R44A 4Q4HA 2OT3B 4RVCA 1FMLA 1KK1A 2GTPA 4RD0A 1OB2A 1KMQA 5HTKA 4NHOA 4UXIA 3FFBA 2NZ8A 1PLKA 1WCV1 2ODEA 3IHWA 4JKIA 5DH9A 4HLUC 4DDVA 2AR7A 2QAGC 1E9FA 1ZVQA 5DGXA 1YU9A 3BB4A 2ZUCA 5KOYA 3U7HB 3VKGA 1E1QD 5A0FA 2D74A 4Z1MD 2FJUA 2CXXA 2DY1A 4MKGA 3IO5A 4GZMA 2IS6A 2XAUA 4B71A 4B44A 4XVUA 2N1BA 4HATA 4V0OA 2R6AA 5JRJA 5ANRB 2JIZD 2KBFA 2QBYA 1ZD9A 2OCPA 4KYIB 3RVBA 4G5SA 1EX6A 2X2FA 2QPAA 3T34A 4A36A 2OCBA 4JL5A 3I62A 3UMFA 4I1VA 3D7MA 2WWIA 1N5KA 4RD6A 2HLDA 2F9LA 2WOOA 2QAGA 3HJNA 2ZR9A 4XWAA 3SI7A 4F38A 5JEEA 2UZIR 4LV5B 4BZQA 3OE7A 2V6JA 1ZC3A 2QSZA 4JJZA 2PEZA 1U8AA 4A2QA 4DLTA 5FTNA 1JQLB 1XF9A 3HP1A 1VHLA 1R0WA 4JKYA 4EDHA 1NN3A 2KBEA 1LS6A 2XEXA 4KVGA 5BW8A 3RAPR 2AN9A 5JS7A 1N5LA 2W2VA 4V03A 1D9XA 1P5ZB 5DO9A 2XB4A 5HKKA 2REOA 2OSBA 1BYIA 3AVQA 2ZITA 4B43A 3WXMA 4Z8XA 1NF3A 4IEIA 4Q1EA 1JR3D 3W34A 3C7KA 2ANCA 3I8XA 2H5EA 3AUYA 3FGNA 3CW2A 2GEDA 4G5OA 2RHMA 2DFTA 4V0MA 1ZRHA 2RB4A 2JLYA 5TDHA 2GK6A 3ICQB 1A4RA 4KFUA 4M1TA 4TLEA 4EQ6B 5GJCA 4TYNA 2Q21A 4OJQA 4N0DA 4EKDA 2IF0A 1E9CA 2ZANA 2DWQA 4QG7A 1G291 2WJVA 1JQJC 2YYZA 3F0TA 4B3GA 5EUMA 1OFIA 2MSCB 1Z2AA 4ACBA 3BS4A 5B57C 3EPKA 2WWYA 1Z5ZA 2FGKA 2YOFA 2PMKA 4QJ4A 2ZRGA 1NIJA 2WWFA 3CRW1 1CR2A 4R7ZA 3B85A 4XWOA 1P7CA 4JYCA 1U98A 1G3RA 4FI3C 2WOJA 3THYB 1MRNA 1RZ3A 5EXTA 4HB3A 4TMKA 4KU4A 2GBLA 2IS2A 1QBKC 1IY0A 4HSEA 3WBJA 4V02A 1E0AA 4MRRA 1E98A 4Q1AA 4DCUA 1G3MA 1UKYA 4M9ZA 3VR2A 4RFSB 1XEWY 421PA 4QGHA 2VHQA 1EK0A 3IBGA 1M74A 3OZXA 1LF5A 2LKDA 1ZNZA 3AF0A 3LRPA 4PQFA 4JLNA 4ZCIA 1VYTA 4PAMA 1U90A 5C1BA 3MWYW 3K70C 2QMOA 3NH9A 5BN5A 2EW1A 4WA7A 1G8HA 1C4OA 3SHWA 3R9WA 4PZZA 2KE5A 4OQMA 2BMEA 5IK2A 3TQCA 4DDWA 4BGDA 1SVKA 3U60B 1W47A 4E22A 5L3RA 4HEJA 3GLHE 5DLQC 4JL6A 4D4JA 1ZD8A 4G5RA 3QUSA 4J0QA 4B2PA 1U9IA 2IYYA 2GEVA 2W83A 3OIYA 1KTVA 1N0VC 4TSFA 2PMDA 2QBYB 1KI9A 1G3UA 5KSOA 3CRRA 4ON9A 3AH8A 1NP6A 1KO5A 2FEOA 3BORA 1JXOA 2FFHA 4FXPA 4IJMA 4RY2A 3QPUA 4OJKA 4FCWA 1MRSA 4BFXA 4JSTA 3KJHA 5KDDA 1W1WA 2Q9AA 1HH4A 4YMWA 5LDDC 2ZRDA 4JIMA 3SYLA 1EFCA 4XSGA 1KAGA 2NO0A 3QI2A 5AWFC 3CH5A 4Q7JB 1ESNA 5SZKB 5KDOA 3M0EA 2PX3A 4ZO4A 1G5PA 4BPBA 1TF7A 3R9XA 1N0WA 1KK2A 3PUVA 1ZUNB 1TQDA 2Q3HA 5B2ZA 1NSTA 5BN3A 1IY2A 1B23P 2ASEA 2BC9A 4UQOA 2BJWA 2NO7A 4H1UA 4UNQA 2REBA 2FF7A 2LWIA 5K8TA 1SVWA 2AD5A 3KQHA 4TL7A 1Z0KA 3C5CA 4G0NA 3R7WB 3PIRA 5CITA 4NH0A 1S0UA 3QVVA 3CX7A 2VYFA 1TTTA 4ARZA 2JA1A 2RMKA 1T9HA 2VHJA 2EYQA 4M1WA 2TMKA 4W5WA 2W00A 5IRCD 1JAHA 2VA8A 1TMKA 1XX6A 3EPLA 2NPFA 3LLUA 2CNWD 1V43A 3Q72A 4CEHB 3FHOA 2YNMA 4PQYA 1K5DA 1NG1A 2WWXA 1XU4A 2CLDX 2OILA 5DI3A 5FTKA 3W3AA 1YE8A 2AD1A 1FTNA 4TYQA 3NH6A 1XMVA 2JLWA 3N2IA 1J2JA 1R2QA 1X8JA 4AK9A 2ZSEA 4LSGA 3U4QA 2LCFA 2FPKA 2V9PA 3CZPA 2QE7D 2A30A 2REXB 2IYWA 4F93B 1L4YA 3THYA 1N6RA 4QL3A 2AFHE 4FD2A 4OI1A 4QNMA 2G6BA 2VQSA 5UKDA 5FBLB 1W0KA 3PEUA 2PH1A 3GJ5A 4RFSA 1OH8A 4B32A 1SVIA 2Q9CA 2ZJBA 1NLZA 4FWIB 4JLVA 3T5DA 3KJEA 4TYWA 2JJ2D 2ZI6A 4DLVA 2CCJA 3RC3A 1E0JA 4GI7A 3HR8A 1KHTA 5CK4A 1IM2A 4RD4A 4KO8A 4LHWA 3RRNA 3WRYC 3UXMA 2AL7A 4Q9HA 4O3MA 2DYKA 2GJ9A 4URWR 2RGGA 2IEYA 3LX5A 2ZI5A 2OXRA 3LNCA 5GJVC 2VO1A 4KYUA 1MH1A 2QI9C 1W5TA 2FN4A 3R8CA 2QRNA 2W6JD 3WNBA 5K8LA 3VU9A 1OW3B 5CYOA 2KB0A 5EE3A 2ZU0C 3KKPA 5G41A 1UADA 2KI5A 4D25A 2Z83A 4FWTA 1KNXA 4A8JB 2PZFA 4DUGA 4Q47A 2OFWA 4QFMA 2N42A 3ZVRA 4DRZA 3A1VA 3FHCB 2J0UA 2WKRA 3PITA 3P1JA 4UNSA 1U81A 2DFLA 1GITA 1E69A 1YHNA 2OHFA 1OPXA 3MWKA 1Q22A 1P62B 1RW4A 2XNDA 4DCTA 5LD2C 2ODWA 1XJCA 4U02A 4Q9JA 4PAOA 3QBTA 3G82C 3K0EA 5HCNA 5BXQC 5CK5A 3VNUA 2WHXA 2FNAA 3QJYA 5IHPA 3DM5A 3AKDA 4TLBA 1N6OA 3CF2A 2IEZA 4A1FA 1IXRC 2Q6TA 4LV6A 4OQNA 3U44B 3QIAA 1KDRA 4ITRC 2FGJA 4KFTA 3NWJA 3ZIAD 1NKSA 1SGWA 5GVSA 4DUGD 5KHOC 2FFBA 3VKHA 1Q12A 2H57A 1WF3A 4RZUA 3T5GA 3BFKA 2OBNA 3OFND 1GL7A 1I4DD 1PV4A 1G9XA 4JLKA 4C0HA 4M0LA 4OKSA 1ZU5A 1UBGA 2Z0MA 3SZRA 4MYHA 4CEHA 1DO2A 1NY5A 3EA0A 4BFSA 4DBLC 1XTSA 2FSIA 3OIVA 1X1RA 2IW3A 3KQNA 3VHXA 1US8A 2QTVB 4AKEA 1G5RA 3JVUA 5J5CA 6Q21A 1KMHA 4B74A 3LH5A 3Q7QA 1Y3AA 4TYYA 1Z0IA 3SDZA 3UG7A 3TJZA 4QM7A 1GRQA 5DN6D 2PT5A 5J4LA 2R2AA 1KK0A 1RRGA 2W6IA 1GM5A 1AS3A 2X2EA 1TEVA 1VCIA 4QBFA 4AKHA 4ZKDA 4B75A 3IPXA 4DLUA 821PA 3KUDA 3DPUA 1FNNA 3PENA 5GJBA 2V55B 5JECA 2GEUA 1G19A 1W49A 1TF5A 2F1JA 4IDPA 5H1YA 4BRWA 3REFA 4Q7KA 1Q0UA 4MITA 2ZI3A 3B1WA 3CONA 4HAXA 4CEIB 1SZPA 2OBLA 1KI4A 1X86B 5KTYA 2V7QA 4NU0A 1XEFA 3B2EA 5EXXA 1JEDA 2GXQA 1E96A 2NTYC 2GK7A 2ORWA 4M1MA 2YWGA 2QPOA 2CL7X 3AGPA 2I1QA 5FOUA 4D82A 3GCGA 3G5UA 1EWQA 5E7MA 3WMEA 1QHIA 1E9DA 4K8OA 1P75A 1WA5A 2B8TA 5B30A 3K9LA 3PEVA 3IPYA 2V1XA 1YR6A 4UNPA 3RYTC 1FNMA 3KZ1E 3SE0A 3TSWA 4LHZA 1NBMA 2QUZA 4C9BA 3UPUA 3EZFA 4TLCA 2JLRA 3U2QA 2F7SA 3MUFA 1XEXB 2BOVA 4GSYA 2CMKA 2DWPA 2HYDA 1CEEA 3SQXA 3AUXA 1GIAA 5IT5A 4PXAA 1Z0AA 3BXZA 3EZ6A 2X8AA 3GLGA 1G8GA 3B6EA 4U00A 1T3SA 1NI3A 1M1YE 1Z63A 1X6VA 2RGNA 2J5XA 5E4FA 2XSZD 3A1WA 4ACAA 3DZ8A 4DCNA 1DG1G 1NKTA 4ZCMA 4YXWD 2QP4A 4URVR 2ZQ5A 1GKIA 4E09A 2JLUA 3U7GA 4PO9A 4NYJR 5E7IA 1CXZA 3RS3A 3I5XA 1ZNYA 3BJIC 1IN8A 3Q7PA 4F91B 1M8PA 1MO5A 1KSFX 1XD9A 1YZGA 3QOFA 3TH5A 4BEJA 1Q21A 1YZUA 4ZDJA 5J4VA 1FX0A 2YC4C 3LA6A 4BE7B 2VHUA 1A82A 3CPJB 3P4XA 4BFWA 1VTKA 1CS4C 1UDWA 4LYAA 4DIEA 2O8BA 2EFCB 4AYXA 2FMXA 3IGFA 5F2EA 3I61A 2CJWB 3FFAA 1N6HA 1XTIA 3AP2A 4IKEA 4A82A 1XD8A 2GZDA 4D80A 1Q1QA 2J9RA 2NG1A 3KKMA 3U7EB 4BWYA 2VSXA 5M04A 2VHCA 2MSEB 1N6LA 2BBWA 2QQ0A 1DVRA 1E32A 3TW4A 5JHGB 1OIWA 4C3ZA 3CX6A 4GOKA 1OHHD 4P4SB 2EFDB 3LFUA 1Z07A 2ZYUX 5C4GB 3ZDQA 3GLFB 2O8FB 2EFEB 3QE0A 3P20A 1S4QA 2IXEA 4MKFA 3RWOA 3PEYA 2MSDB 1UM8A 4Q9IA 3ZQJA 2GCOA 4IDHA 1ZBDA 2A2ZA 5JWOA 5J4HA 2Q9BA 2D4HA 3NC1C 2GA8A 3EC2A 1GILA 4C30A 2VSOA 3VQTA 2WJJA 4NONA 4DZZA 1XMIA 2GNOA 4XWKA 2CVHA 4JBWA 4Q4HB 4Q00A 5EE0A 2GWHA 3U3KA 3K9HA 4P32A 2V3CC 4Y0AA 4URYR 3RS5A 2VP4A 5EP4A 1NNEA 4C0KA 3SN6A 4PSVA 4FN5A 3X1XA 1HQYE 1E2PA 4MKIA 4S35A 2CNWA 4F4CA 1T8TA 1COWA 2G1JA 4DJTA 2IYQA 4HI0E 3U3JA 3UANA 2WAXA 4DLRA 4G5GA 3AP3A 1I4LD 2C95A 2GESA 1E2MA 1SQ5A 4LPSA 3GJ6A 3KQKA 3K09A 1TQ6A 3S1AA 1FP7A 4TZ6A 2A5DA 5HE9A 4LX0A 1KKLA 4TT3D 2MMCA 5EE5B 2O8DA 2C77A 2ZYVX 3NBZC 4Q9KA 2IUUA 4OI2A 1G8YA 5D3MB 2WAYA 4CRWB 3L0PA 2J0QA 1S2MA 1U2RA 2FZ4A 2IYSA 5J40A 3U61B 4PPQA 1XCGB 3AVXA 3LVRE 3VKWA 4OK6A 3MFYA 3O47A 2ZJAA 1C9KA 3DMNA 2AX4A 1QRAA 4LCBA 4Q01A 5KPDA 3FTQA 1OYWA 3ONWA 3NTUA 2ZRLA 2QEQA 4ILEA 2Q3MA 1N3BA 1YZQA 4A2PA 1VG0B 1COWD 2FE4A 2QSYA 1P2VA 2XZLA 2ZRPA 4F7WA 2WSMA 2D06A 3B8HA 3C14C 4WW0A 3THXB 2G3YA 3HWSA 3KKQA 4TZ0A 1UEJA 3AB3A 3AF1A 1U0JA 1QHSA 1QHGA 4MUBA 5AJYA 3K09C 4KFSA 3ZVNA 1UFQA 3T1VA 1LV7A 1OFHA 2FPMA 3L8YA 2Q3FA 4TQAA 5FBRB 2NMVA 3QG1A 2NIPA 3MJRA 4Q1DA 3THWB 4A0HA 3QQ5A 1X1SA 2GJ8A 2H8KA 2J7PD 4M21A 4LBYA 2C98A 3FKSD 1W44A 1HURA 2J1LA 4PC2A 3FYHA 4BECA 2J0VA 2AWNA 1G7RA 2K5UA 4DHEA 1OIXA 3JZMA 2AXNA 1GRNA 4I4LA 4MRPA 5TARA 1DBSA 2ZAOA 1ZW6A 2KSQA 4PZLA 3QKRB 2X19A 3FMFA 3WRXC 1DE0A 2ZRMA 3CB4A 2FWRA 2A7QA 3E70C 3U3RA 4B3FX 2OESA 4TT3A 3JZAA 1FMJA 3THXA 4PAQA 4FIDA 4JVNA 2B92A 4NZYA 5FBQB 3L8ZA 1WDTA 1W0JA 2N46A 4QGFA 2B7CA 2O8FA 1S1MA 3RWMB 4ARZB 3KUCA 2QP9X 3QXSA 2ZSBA 1AQYA 1P61B 2YWFA 3BERA 4OI4A 1IY1A 1FW6A 4V0LA 5EXPA 3RNLA 4US2R 4ESHA 3B1XA 3KQLA 2XJ9A 1LFDB 2FOLA 1HTWA 5KU1A 2ERYA 4CW7A 1HT1E 2YC2C 5AR1A 2IUSA 3EZ2A 1R5NA 3OFNA 4ABYA 3MCAA 3U6BA 2GETA 3UK6A 1UKZA 4A4DA 4KV9A 4Q02A 2F6RA 2J87A 2FPLA 4Q03A 4WOPA 3TQFA 1JXMA 1Z29A 1LY1A 4MGZR 4KSCA 2O8BB 3EIQA 4IOMA 1OH6A 2F1RA 4MYUA 2IWHA 2XXAA 1I4TD 2D2FA 4M1YA 1E2EA 2VP0A 2C9CA 3TE6A 1ZM4A 2ZM5A 1PLJA 2EWWA 1VYVA 3RSLA 1P73A 2FSHA 4TMZA 4UKDA 2HYIC 1NG9A 5AUOB 1P9WA 2NO6A 2PJRA 1IN4A 1IAQA 2SHKA 2F3TA 1AZSC 4NCNA 2W2XA 3REGA 3KKOA 2GJSA 3PQCA 4KBGA 4V0NA 3SU8A 5CDFE 3KL4A 4LUCA 2ZAMA 1KYIA 2W6ID 4D0NA 1IN6A 1PUJA 2IXGA 3X2SA 4XVQA 5AUQA 3FMPB 3EPHA 1VG9B 4FINA 2ORIA 3DM9B 1YRAA 2WJHA 2ZI4A 5B64A 2BHRA 4WAUA 1A5TA 4Q4AB 4XH9B 1KI2A 1D2EA 2W6JA 3L0IB 4TMWA 2WSSD 4NKRA 4ASUD 1XPOA 4PFSA 4B48A 3KFVA 1RRCA 2V7QD 2WPDD 3C5HA 4LBZA 1W0JD 1YR8A 1DOAA 2C99A 3PJRA 2OLJA 3VR3A 4M9SA 4UNRA 1G18A 1OXTA 4AG6A 1HV8A 4OQFA 5FPYA 2ZE7A 5AJXA 1OIVA 1CLUA 3AQ4A 1G7TA 2KWIA 3K0CA 1FTSA 4B2IA 1V5WA 3K8YA 1WBBA 4NDZA 1G6HA 2GVDC 3A4LA 5A4JA 4I1OA 1DARA 2RKOA 3UWOA 1GOTA 1UJ2A 2CHVA 3A6PC 2JEOA 1GNQA 1I2MA 4KXFB 2EFHB 5L8VA 4O25A 1WBDA 3QF4A 3AVYA 2PT7A 3HPRA 1RIFA 4EFMA 1VPLA 2ZI9A 3TKLA 3CWQA 4DVGA 3RDPA 3NIBA 1E0SA 2QM8A 2YOGA 3QENA 1R6BX 4FCVA 4TL6A 1WP9A 4GDFA 2IYRA 1RYFA 2EQBA 1AA9A 2ZS7A 3MG9A 3OAAA 2R65A 5FTLA 4EPXA 2G9NA 3A37A 2JAQA 3N2EA 1XXHE 4PHTA 4DSOA 3RS2A 1HA3A 5JCZA 3GEEA 4DLWA 1FOEB 1G16A 4NCHA 3VX3A 1ZIPA 4HZIA 3KFXA 4Q48A 2ZR0A 4PTLA 2EFGA 1LW7A 1XJ0A 4DSNA 1Q44A 2HJVA 2ZREA 5IF9A 1C1YA 1X3SA 3WNDA 2QMEA 2QG6A 2VH5R 4B3DA 3EXAA 5CIQA 1W36C 5DSZA 3L2OB 5E95A 3AVTA 3ZLJA 3O8RA 2WMNB 2IS4A 4JT2A 1SVSA 3ICEA 4EPVA 5J4YA 5JWHA 5LPNA 3BH7A 2YZ2A 4PR0A 5CJ2A 2HDNB 1UBFA 4M22A 4K81B 3N70A 4P33A 3I73A 1ZD1A 3V00A 2H16A 3PFIA 2G0TA 3CUEF 1QHHB 3A36A 3V9PA 3W9YA 3NKVA 1NIPA 4MGIR 3KX2A 2VPPA 3LW7A 1E9BA 1IN5A 4KSBA 5FL7D 1U8YA 1BMFA 2QTHA 4YQFA 4IDNA 4HDCA 4R9UC 5KDLA 4EIWA 3H4MA 1KI1A 2ZRJA 5SZHB 2V4ZA 1W48A 1E2JA 2OV2A 2BBSA 4G1UC 1ZM7A 2GKSA 4BFZA 1H65A 4YMUA 4URXR 5F9HA 2D3WA 2J7PA 2OZEA 1DG3A 2HCJB 4M9QA 1F2TA 3GLIE 1M34E 5EP1A 1W4RA 4D26A 1M6NA 3CO5A 3NDPA 1LF0A 3GPLA 2IL1A 5C4MA 1W5SA 3QKUA 1AZTA 1E9EA 4GPTA 4B33A 3ZIAA 4DT1A 1LNZA 2B8WA 2BWJA 4MDEA 5TV2A 1N5JA 1CJTC 1AN0A 2RGXA 2IYVA 5IDVA 3KKNA 1AK2A 2CHQA 3MLEA 4UXJA 5CB8A 1B0UA 3HU1A 1OT3A 4R2IA 2P6RA 5KO2A 1P4SA 3KQUA 3B9QA 2FDCA 4NCJA 1LVGA 1NJGA 3DMDA 1QZXA 3AVOA 4YDHB 4TN1A 2XXAB 4I1UA 5FPHA 4EPRA 1SXJE 3F8TA 5EQTA 1GDDA 4IOLA 1R5BA 4X8LA 5DHFA 4Q4JA 2OBMA 2VBCA 2Y8EA 2YWEA 1CJUC 3B1ZA 2AKAB 4YXWA 4C0BA 1LB1B 1KY2A 4C7OA 1GG2A 1VG8A 2ZJ8A 1F2UA 1MO4A 1VIAA 4MRNA 1QHXA 1FFHA 1E2DA 2QMHA 1VG1A 3ZZ0A 1YJ5A 2O0HA 1T3LA 5HCIA 1W36D 3U3MA 1HT2E 1SKYE 2XX3A 1T5IA 2B21A 3DOFA 3UWKA 1Z47A 2VP2A 2WIBA 2WZQA 2ZI7A 2BV3A 4L8GA 2F9MA 1P2TA 1Z6GA 2IA5A 1NN5A 2ZIAA 2NQ2C 5FUVA 5K8UA 2ZUDA 2UZ3A 1Z0FA 3I1FA 3MMPA 5FPKA 3U5ZB 3KB1A 3TW8B 3MAAC 1H8EA 1WXQA 2OAQ1 2PCLA 2ZJ5A 3CKLA 5C2JB 2O8CB 4BLSA 4NMMA 1WE2A 4GNKA 1NN0A 1NJFA 4GMXA 4O0MA 2QA5A 1KO1A 4WXRA 4Q4JB 2R6CA 2VIIA 4ZPXA 3GD7A 1EG7A 1XFAA 3VAAA 1XTQA 3H0KA 3A1UA 3TK1A 2F43B 1GSIA 3AF3A 4L4UA 3WNCA 3T12A 3A1SA 4BLTA 5H68A 1CP2A 4U5XA 4JBYA 3P4YA 4DWJA 1G4UR 1TF2A 2BBOA 3CWZA 1JBKA 4FMCB 1IJEA 1QHNA 4LOAA 1RJ9B 4CZ2A 4E03A 5C46F 3SYKA 1P9NA 3CPHA 1H8ED 1JALA 1E2NA 1AQUA 3K9NA 4NYIQ 2D62A 1UKVY 1XZPA 3SFZA 4GZLA 5BN4A 2F3RA 2GRJA 5EZ5A 1DEKA 4KJZA 3IHLA 5LB4A 1NVXQ 4XSHA 4Q1CA 1AGRA 4LY6A 1KY3A 3OEHD 4MA4A 3A8TA 2ZRFA 3RRYA 3WYFA 3WYGA 3B82A 1D9ZA 2DPXA 5L3QB 4HYYA 2YWHA 1XCMA 3O8CA 4RKFA 5IK2D 3NXSA 4PHFA 4GL2A 3TSOA 2IHYA 4BEBA 1XZQA 1W4CA 4LJ6A 3SJAA 4NCIA 4DIDA 2WTUA 5F98A 3BGWA 1L7VC 2ZU6A 1VDZA 2ODNA 3M4YA 1GTVA 1ELOA 3KTAB 2DBYA 1DELA 1JPJA 3GJ4A 1FP6A 5G53C 4QBHA 3L43A 2F55A 4NBSA 3WBKA 1XEXA 2FFQA 1LS1A 5D3QA 1PLLA 2A9KA 2RGAA 4B76A 1JB1A 4PANA 1JEEA 1K5GA 1SULA 1G64A 3VFDA 4WXPA 1UAAA 4L9WA 4L16A 4QXAA 2XTMA 1WMSA 4Q1BA 3QKTA 4IEEA 4JT4A 1QDEA 4GBMA 2HXSA 4KODA 1CBUA 2CE2X 4CYMA 1KSGA 3Q85A 1G3QA 1Z3IX 3PEWA 1U99A 3OHMA 4EJSA 5AJWA 4FMBB 4JLJA 1CJMA 3P27A 4M1OA 1ZIOA 3AF2A 1S96A 1ZM2A 2C96A 1GAJA 1T3HA 2CK3A 2VP9A 1M7HA 3T06B 3C8UA 3CNLA 3BH6A 2GJKA 2IK8A 5J47A 2P6NA 3SEAA 4TSFD 4YONB 3AEZA 1HE8B 5FH9A 4LJYA 3DEFA 4GRAA 4HLQB 3OIWA 2FEMA 3TVDA 1NVWQ 1N0UA 2IBMA 3SJZA 3T1OA 2QU8A 2V6IA 1EFRA 1Z08A 4AWXA 2J41A 3BFXA 2AXPA 3RS0A 2GCOB 2Z43A 3OAAD 4BQSA 1FPMA 3EG5A 1TU4A 2F1IA 4Q4AA 2VRWA 4IOJA 4HB4A 1W36B 3WMFA 2OO7A 1PJRA 1MV5A 3CIOA 1N6IA 1F5NA 4EJSC 3EIHA 3NC0C 2ZTSA 2BM0A 2OFOA 1F2UB 2BMFA 4G3XA 3UG6A 1NVVQ 2IF2A 3LY5A 4V0ME 2QGZA 1G7CA 3E5HA 4WIAA 2ZRIA 2XZPA 4X8HA 4QGAA 4BLRA 3QSYA 2J45A 1WRBA 5H8WA 2JLQA 4RSGA 1JECA 1E2QA 2CLSA 3TAHA 4OK3A 1ONBA 2FG5A 2YHSA 2Z6VA 1G4AE 1NVVR 1OYYA 3BWDD 4GFDA 3RS4A 1EFRD 2NZJA 5FL3A 1SKQA 3KB2A 3GFOA 1EFHA 1ZINA 4LYJA 3X1YA 2FSGA 1KI8A 3K0AA 3R8FA 4EUNA 2VP6A 1ZCBA 3AF4A 3CRMA 1AGPA 2RAPA 4UNNA 4E07A 1W2GA 4NL4H 1E99A 3BB1A 3LQRA 5FOVA 1IQPA 1JAIA 3TR5A 2IYUA 3EW9A 4RJLA 4P0TA 1SXJD 2HUPA 3TMKA 5TMPA 3CPEA 4A92A 1L8QA 3W6OA 5CLQA 1ZCAA 3SOPA 2A5YB 2WJYA 3K53A 1Z0JA 2ZS9A 2JJ1A 3EAQA 1QF9A 4IXNA 1T91A 4RFVA 1YR9A 4R71A 5D3MA 3FE2A 4Z54A 3CH4B 2P6UA 4H1VA 1GKYA 1KI6B 4HAUA 4M8NE 1OHHA 3FVQA 3HU3A 2L0XA 1TPZA 2W0MA 3ZGXA 3SFVA 4MGYR 1Z0DA 3H86A 1NY6A 2ATVA 4IVRA 1Z8FA 2PZEA 2XITA 1YR7A 4JLAA 5EJEA 5F3WB 4US0R 1G8FA 5LD2B 1W4AA 4YC7A 1VCNA 3C41J 1KJZA 5FOTA 1F48A 4D4KA 3ZYCA 3Q5DA 2GCNA 2F1HA 1JI0A 3BBPA 4IFEA 4PHHA 5FPTA 1CR4A 1F6BA 1E1RA 2OLKA 1KAOA 4D81A 3AGQA 4ZDWA 3QVUA 2BEJA 4MRSA 2GILA 4M1SA 4M53A 1Y63A 5CYPA 1Z6TA 4JLDA 2CJWA 4OYHA 3I72A 1E79D 5ELXA 4URZR 4B6EA 3I5YA 2WJIA 2WBLC 2ZE6A 3K0FB 4KLNA 1Z6YA 3RC8A 1IONA 1O87A 2EWVA 3BE4A 2ZXUA 5AJVB 5JI3E 2WICA 2QM7A 1J99A 3TAUA 1MABA 1J8YF 3EIEA 2RGDA 3Q9LA 3IEUA 1QHHA 4CT5A 3VHLB 5DNYB 2JLVA 8OHMA 2O52A 4LJ8A 1D8TA 4QHYA 1T6NA 4JLPA 5CIWA 1ZU4A 4Q5IA 4B35A 3GJXC 4A0RA 2VF7A 1R0YA 4B34A 5KSZA 4OHXA 2J7KA 3ADKA 4XOIA 1KI3A 5JHHB 1QG2A 3CNNA 4ZKEA 5JS8A 4NYIR 3RLFA 3HYTA 2KJQA 5E3HA 3DVLA 3GLGE 4HAVA 4LV8B 3QG5A 1OH7A 2R6DA 2WIAA 3FPAA 5BQ5A 2WSSA 4ASUA 1FQJA 3ND8A 3HYRA 3CR8A 3VU9B 2BMJA 2QENA 1OXVA 5FUWA 3P32A 1G17A 3AKYA 3B7GA 3CX8A 1T0HB 3IIMA 1EFUA 3LXXA 3WHLA 4FMDB 4EPYA 4M9XA 3GQBA 2E87A 4EPTA 1BMFD 4KHZA 1CJVC 4US1R 1W7AA 2V54A 5BWMA 1Z6AA 1VYUA 3LVQE 4Q7LA 3GLFA 4TL9A 1Q57A 3QPVA 5JSZB 1SXJC 1E1RD 2C9OA 2JATA 3OEHA 4LGMA 4RKEA 1DAIA 3WMGA 5EE1A 1OFTA 4B3XA 3C15C 4LHXA 4N3NA 3L0SA 2HV8A 4PO8A 1J8MF 2W2TA 2DWOA 3LWNA 4URUR 3DOEA 1WB9A 2O8EB 1TU3A 2OG2A 2VEDA 2C03A 4H9GA 3SC3A 4TWZA 2PLRA 4JLBA 3NHAA 4RCZA 4N0EA 1M7BA 1YKSA 3CZQA 5JFGA 1KJWA 3ADCA 2P3SA 4A6XA 4DC9A 3OF5A 3PVSA 2AKYA 1TNDA 1Z6XA 1XMJA 2A5FA 2Z4SA 2JJ2A 3LO5A 4HZUA 4NTZA 4RD3A 1E4YA 1VKJA 4LJ5A 1YVDA 1A2BA 2DCUA 2ZEJA 2JDID 3GLHB 1SXJB 3SHFA 3UKDA 1N2CE 2PCJA 1JPNA 4F92B 1FZQA 2HF8A 3EWAA 2R8RA 2ZRBA 3AV0B 1AS2A 1CU1A 1G6OA 4AYWA 4OHZA 1SVMA 2UVQA 5CB6A 5EE9A 4WVFA 3M6AA 4LJ4A 1BO6A 1K8RA 3NG1A 3DL0A 2AK2A 2QGNA 3QKRA 3Q8XB 1E2KA 1QVAA 1Z06A 2AFIE 2HT6A 3IILA 4L5BA 4TLAA 1E3MA 1EWRA 3QEOA 4LWZA 2D2EA 1G3IA 3I8SA 4YMSA 4W5HA 2RGNC 3IQWA 2DR3A 5CM8B 4O2RA 2QL6A 1P6XA 3VR4A 2GVZC 2HJGA 5KNDA 1EX7A 1A1VA 4IOKA 4X8MA 4EFLA 4R98A 2Z4RA 1XWIA 5CJPA 3WY9A 1Q1EA 2ZVPX 2ZUBA 4OK5A 3ZVMA 3IIKA 1SVOA 2E9SA 1MABB 1DPFA 2XNDD 5L3SA 3WP1B 1N6PA 2JCSA 2XGJA 4C4PA 3KXKA 2I3BA 3GLFE 2PEYA 4QJ3A 2XJ4A 2ZJOA 3T61A 1Z28A 3BAFA 2A5JA 2XTZA 2V1UA 1OE0A 2FU5C 2E1RA 3NDBB 4YDSA 1XTRA 1XD2A 1IXZA 1S1CA 4HLDA 4U7DA 2XSZA 4BUJA 1F3OA 1OJLA 1MT0A 5GVRA 2JGNA 1FX0B 4QRHA 1S3GA 1E2FA 1ZMXA 1I2DA 3IIJA 1DAFA 1A2KC 1KO4A 4JZKA 4MQBA 4TTRA 4XD7D 2BCJQ 4B6FA 4CVNA 5FI0B 4RZ3A 5J4KA 3QBVA 4JVMA 4DB2A 3E2IA 4AY2A 2JIZA 1DTSA 1RRFA 1YQTA 2FV8A 4HUTA 2BJVA 2R9VA 4A0FA 1OKKA 2GDJA 2V8OA 2HF9A 4B47A 4JLOA 3EZ9A 4C2UA 2PJZA 1PZNA 2ZSFA 3PXGA 2ZR7A 1R0XA 3I32A 4PSAA 4M4SA 2CDNA 1BOFA 3QXHA 5FUYA 1W4BA 1ZAKA 2G83A 2W58A 4QHTA 2C8VA 3KXLA 3PG5A 5GJWC 2HT1A 1XTKA 3B1VA 4DSUA 3HR7A 1AJEA 4EPWA 2GCPA 3U44A 2XOKA 2FA9A 5G3ZA 4NE2A 2LKCA 1A7JA 5DI3B 1XRJA 5KSPA 5KUTA 3CM0A 4QC2A 3AVUA 1XJQA 5DYGA 2NO9A 1GZSA 1P3JA 1QVRA 2Z5FA 3AM1A 1NN1A 3SYNA 2IYZA 221PA 5DHAA 3GFTA 3WP0A 4AKGA 1DAEA 1ZM9A 4RD2A 5EUQB 1GRRA 4DCSA 5AUPB 2G88A 3KDSE 4JS0A 3UIEA 4DT1B 5K8IA 1MKYA 3EZ7A 1KNQA 4KCGA 2JJ1D 4YLGA 1G20E 4TYPA 2G1KA 3K0FA 1R0ZA 3QF4B 3OESA 1H8HA 1LTQA 2JJ8A 2A3RA 5FL7A 3D6TB 2BIFA 4MYTA 2GXSA 4HAYA 2QT0A 2ANBA 1O3YA 2EU8A 1Z83A 4OHWA 4LPKA 4QBIA 2BEKA 4UXHA 2VL7A 3BOSA 3HU2A 4KI0A 2C9YA 4WZAE 4XD7A 1YRBA 3LX8A 5JRZA 1L2TA 1YZNA 4CF7A 2OXCA 3EWSA 3EASA 4ZCLA 1ZNXA 1JNYA 3K0AB 1XTJA 2BDTA 3ZS9A 5JMTA 3FMOB 3TIFA 3BB3A 3CF0A 5DISB 5H70A 4MKHA 3L82B 2IUTA 3LBNA 1E4VA 1N6NA 4TQ9A 4KVAA 1CJKC 4D4LA 1RVDA 1FQKA 4HDOB 1ZJ6A 4PHGA 2D7DA 3C16C 1VIYA 1W2HA 1HY3A 2IWRA 2H1LA 4HUQB 1AIPA 3DKVA 1XBTA 3DO6A 3S1AB 2ZE5A 4NPHA 1DADA 1E2HA 2C2HA 4X8OA 3JVVA 1NSFA 3DHWC 4W5JA 5FFMA 3TUJC 1II0A 3W90A 4KBFA 2RGCA 1KO8A 1TL7C 1W0KD 2BVNA 4OQLA 3RRMA 3TSZA 4XIGS 5JWRA 1MO3A 3V4FA 3G0HA 2ZRNA 4ZIRA 1KMHB 4TL8A 1BS1A 3QPWA 5AK0A 1TQ4A 4BZPA 3LV8A 4L9SA 1D2NA 2PX0A 2ZYWX 2O8CA 4LC0A 2JASA 5F9FA 2CVFA 3MWJA 2NO1A 4LJ9A 4PX9A 1KI7A 3MRSA 2WKQA 5JLJA 1GWNA 1T8UA 5LB2A 3M1IA 1S9DA 1P60A 1YZLA 3IDQA 1K6MA 1T0JB 4TMXA 2IC5A 3O8BA 1VHTA 1II8A 3TUIC 4AC9A 4IXMA 4TLDA 2HXYA 4PPFA 3TNFA 3GLGB 2YJTD 5C18A 1VCMA 1KK3A 3EX7C 2OCYC 1KO7A 4A0GA 1UPTA 2GZAA 2HCBA 2VF8A 3D8BA 3CLVA 4HZUB 1ZM3A 1G5TA 4DXAA 4HLUA 3I3SR 4DLXA 1OXUA 4PC1A 121PA 2R62A 3V4RA 4ZI2A 2GF0A 3GJ0A 3BRWD 3IO3A 3GJ7A 5KYKA 4RZ2A 2QAGB 4I1SA 1J90A 3LQQA 4NYMR 3ZZUA 1TQ2A 1EGAA 5FI1B 4UJ5A 4W9MC 3LDAA 1G41A 5BYJA 3L0OA 1X8KA 3QNUA 4PPNA 3PR1A 4I81A 4LI0A 3VX4A 4BFTA 1CF4A 5HPYB 1QHYA 2DFNA 3OIUA 5HR5A 4DLZA 4G01B 3U7FB 3QF7A 1BH2A 3IUYA 3FB4A 4TMTA 1JJ7A 4QKQA 4BASA 2FZLA 1OB5A 1KDTA 5EXSA 2YVUA 4QJ5A 3H1TA 1HEIA 2XTNA 2ZJ2A 1HUQA 2AWOA 4Q9LA 4BLQA 4S2EA 4BLPA 4EJSB 5FR1A 1AKYA 5FOSA 2H17A 2RGBA 3BD9A 4P3YA 4Q4LA 3RABA 5DYIA 3TRFA 3U6KA 1R5OA 4B73A 1UBEA 1AS0A 3GMTA 3MSXA 3UMRA 4BFUA 3NVAA 1CR1A 5FR2A 2P67A 5G40A 3J81k 2BCGY 4N1AA 2WJGA 4Z51A 1ODFA 2ORVA 4FCTA 4RZXA 2DB3A 1IN7A 4EAQA 5JEDA 2QT1A 1KZGB 2FSFA 4P4TA 1E2IA 3H84A 1XNJA 4OI0A 4IVPA 1XB2A 1OSNA 1XP8A 1YZTA 3AKCA 4HB2A 1BKDR 2JLSA 1DAHA 3B78A 1Q3HA 3QKSB 4A8JA 2WPDA 4Z8YA 3SNHA 3F5FA 3A4MA 5CM9C 4KLZA 4A9AA 1Q3TA 1RKBA 2GZHA 2J0UB 3GJ8A 2MMGA 4MUAA 5AUNB 2QTFA 4F4JA 4AI6A 2VHTA 1E1QA 5SZJA 5KSYA 4LK2A 1UKEA 3MWLA 2ZPTX 3H2YA 3VR1A 1E2LA 1R10A 1CTQA 3AP1A 3C4JA 4XTRA 4A6PA 4B2LA 5HZHA 2BMDA 1TX4B 2QMUA 2YKGA 5SZIA 3RRZA 1HQCA 4JBXA 2ONJA 5EP2A 1EESA 1U0HC 3FWYA 5DE3A 4Q19A 4IW3B 3X1WA 5B58C 5KNCA 2EYUA 1Z2CA 3GJ3A 3W3ZB 2I1VB 2UKDA 3THOA 2P5SA 4XVRA 3QY0A 3IKJA 4OHYA 1US8B 1AKEA 1EFTA 1UBCA 1VECA 3SJBA 1SHKA 2ZRHA 1XPUA 1NMZA 4LBWA 5EP3A 2C5LA 4PSKA 4DB4A 1TADA 2IYTA 2G0NA 3GLIB 2PL3A 4YMTA 1P2UA 2GHIA 3W5IA 2BM1A 2J46A 2VSFA 3THWA 5L3QA 4C0SA 4C0JA 4LDJA 4LZZA 2QAJA 3ZVLA 1G8PA 4K46A 2WM9B 2O8DB 1NLFA 4I99A 1P72A 2WMOB 2YOHA 4ZDKA 1S9HA 4DCVA 1U0LA 1E9AA 2XNSA 2ERXA 2QE7A 3T1QA 1AM4D 4R2HA 1CIPA 3K0CC 4ZIRB 4P4SA 4FMDF 1NL3A 1KJYA 1ZC4A 4C0AC 1R4AA 3T15A 3ADDA 4QHSA 5JSZA 4HB0A 1OKKD 1WQ1R 3VNVA 1JJVA 4PPGA 3NEJA 4MYCA 2OE2A 4NCKA 2DFKB 4MH0R 1JR3A 3FHTA 2BKEA 4WZBE 1D6JA 1XD2B 4AD8A 3IEVA 3X1DA 5JZVA 1GKUB 3B60A 1R8SA 3FMIA 2ZE8A 3KXIA 4LYHA 2XB2A 5FTJA 2F43A 4Q66C 4DDTA 2FFAA 5FOXA 1U8ZA 4NYJQ 5L3SB 2WWHA 4V0KA 5TVKA 3SS8A 4DEYA 3GLIA 1TAGA 4HUQA 2VLIA 3VMFA 3SQWA 1X8LA 3TBKA 2P5TB 4QOSA 2B6HA 3W6NA 4MDFA 2R6GA 3CNOA 5JJIA 3PUXA 1SXJA 4JVSB 4GT1A 5JCPA 3HPQA 3K1JA 4GP6A 2ZETA 4E5UA 3D3QA 3K70B 4A2WA 1NVUQ 5DN6A 1H8HD 2CL6X 2ZROA 4HAWA 1IXSB 2P65A 1Q1ZA 3ETLA 2WWWA 2FX3A 3A58B 5EZ6B 2WVJA 2JLXA 4QNRA 4AG5A 3QXCA 4JSYA 2CEAA 5L3VA 1DS6A 4JJKA 4C0LA 4DSTA 3CR7A 1TUIA 4HLCA 4ERNA 3PUWA 2RGEA 3LW8A 4KFRA
chains in the Genus database with same CATH superfamily
2R00A 3P0EA 4N82A 4YBZA 2FRDC 4CM8A 2ECFA 5ICSA 2VPYA 1Z7WA 3AR9A 1II8B 2AHOA 4EJ0A 4KPFC 3OO0A 4POAA 4KIUA 5JXHA 2RHOA 2P27A 2Q2NA 4C06A 5D8DA 3UCFA 4KKVA 4D0GA 1J56A 1NUAA 2P2LA 3LBHA 1YO6A 3MGCA 1FYDA 1BX1A 2CLKB 3EGXA 3V4PB 3WKAA 1JEOA 1D8AA 4II7A 1ADYA 2GBGA 2Q4TA 3CX4A 4QU9A 2VPWA 4QREA 3Q8MA 1ZI9A 1PYDA 4DCGA 4IZOA 2ASVA 3UH1A 4LBVA 3A2LA 5JC8A 3I92A 1E7YA 3U9LA 2ENWA 1XXHB 3MCWA 4LJ7A 5KTPA 1TM4E 1IU9A 1R18A 3GLHA 4JP5A 1BQ4A 2BFBA 4IDQA 1S4MA 1T25A 3P94A 5LLDA 3NHBA 1HNNA 5H59A 5P21A 4BZXA 3REOA 3TQQA 3ZE7A 4YO8A 4B3BA 3K32A 4PZYA 4GGMX 3UK7A 5HQ3B 3KPWA 3TFQA 1H66A 3OE7D 4YP0A 3HJBA 4EFNA 3FYDA 3BIFA 4J1NA 4EKGA 4ESOA 5KQGA 5HFJA 2A14A 4D8XA 4HDQB 4HRVA 3WKEA 5DX1A 2R5FA 5LQDA 4IV0A 3SD7A 2C78A 3TTYA 3VR0A 2FW9A 5L7WA 1P4JA 3ZD6A 1E79A 1F0PA 4OKNA 3AONB 4KQJA 4LJAA 5FBVB 4G0UA 4B40A 4FJ2A 4FOOA 3I9KA 3M3HA 1YZKA 1WW3A 5I9TA 1EXMA 2D54A 3ND9A 3RANA 1C8KA 2Y71A 4HY3A 5DMXA 4CQMD 4BNLA 1XPRA 1GFIA 3I9OA 2EVWX 1KERA 3USZA 1VDMA 2ST1A 3OPNA 2NOAA 3EIOA 1ULZA 1M6VB 2BKVA 3D7KA 4PSUA 5IAKA 5JISA 5KOHA 1V11A 3LHFA 4B3RB 1RYEA 3HG7A 4Q4DA 5HE8A 1H6CA 2DHRA 3N86A 2PH5A 4EJ2A 1DCMA 1GCIA 4BLOA 1XRMA 3E1SA 2BFCB 1UBJS 2GF9A 5HIMA 2CFIA 3ZWQA 4CN8A 3UHOA 4K2HA 4KYTA 1NXTA 2F1KA 3HUEA 1ZRNA 4HAZA 4KBYA 3RHFA 4RDXA 2HA2A 1LJUA 3EMKA 3UT0A 1HRDA 3IAS6 3NEYA 1FFBA 3T8YA 2DLNA 1U1FA 3WKDA 4FZVA 1GQYA 2DUJA 1IN1A 4DXDA 1MPXA 4HPJB 1Q19A 1EMDA 3HLKA 5CT4A 2QX9A 1WVMA 2OFXA 2HL6A 2PWZA 1ZG3A 2GZMA 1AV6A 3D7RA 3KTOA 4WIAA 4DIOA 4REOA 1YDHA 4DA0A 1H6BA 1QHFA 4LC1A 5CDFA 3JATB 3TDMA 3UWPA 4TZTA 2HF2A 4JYMA 1TK3A 1UMBB 2C04A 2HA7A 4U3JA 4NSNA 4OQDA 4YUAA 2CEKA 2XY4A 3WXBA 1E3TA 4WFIA 1CRQA 5JMWA 4QQKA 1YJBA 5T64A 3FIJA 1OV4A 4UAJA 1QG4A 3SJCA 4R6XA 3KJIA 3K70D 4JUFA 4MCHA 1ESDA 5D84A 3NAQA 4E1AA 3WYAA 2JRLA 2YRFA 2ZB3A 1WU8A 1BDMA 1Z39A 2GXAA 1DO0A 4BMNA 2IT1A 3G5AA 1H2EA 3MT7A 3KJQA 1GGKA 2GK3A 3PNMA 1WDKA 3ZCRA 3H5AA 4DLSA 2OM2A 3HB4X 2FXIA 3BC1A 4JYBA 4NMLA 5GGXA 3UMCA 1RC8A 3VDXA 4EENA 4NV3A 3BYZA 1MX5A 2WNIA 3RBAA 4RJJA 1WCWA 3AVPA 1BJTA 1IB6A 1OXXK 4IX1A 4Z9XA 1NTOA 2CE7A 1UFVA 2VTBB 1UJBA 1M8JA 2OPBA 1BWPA 3HM2A 4NDNE 1H9BA 3MC1A 1AGNA 1X7XB 3EC1A 3R6LA 2CFOA 3LY7A 3R7BA 4GC9A 3TIVA 2CVOA 2HQBA 4ZYWA 3SXUB 2D7CA 1O08A 4QOGA 3QUTA 1KKMA 3OOEA 2NU9A 3D8RA 2BFEA 3IUMA 3N8GA 4HTFB 4KQXA 2PVSA 4OHVA 4PLCA 4QPZA 1Q0QA 2FW0A 5FBWB 2XCQA 3GFPA 3NOVA 3GGDA 1UJNA 1XTZA 1M7GA 3CURA 4B4VA 3ZQUA 1D2MA 3JASB 5TXGA 4B5KA 1Z38A 4BAGA 1E77A 2E6UX 1PYOA 2O7QA 2J5BA 1FXWA 2Q49A 2Q27A 2VG8A 3EVEA 1N8NA 2Q8QA 4PLGA 1YIDA 2A7XA 4IGAA 5JAQA 4EB0A 5C5CA 5IH7A 4KQ6A 3GZNB 1OROA 3BK7A 5JJLA 3SBEA 5KYGA 4AYTA 4FDUA 1E2GA 1QCCA 1NF9A 3SMVA 3RF7A 3JQ8A 5E2BA 3SR0A 5CLLA 4RORA 4LHVA 4HGQA 3AVVA 4IS2A 3ECCA 5ESXA 1KPIA 2SKDA 2P4EA 5DRYA 3SOZA 3WQSB 4GNRA 5HOQA 3HP7A 1KRWA 1M75A 4LF5B 1YI8A 3EFHA 4DBLE 4DKXA 5AVTA 5JY1A 1T2NA 4G0YA 4MA0A 1WXXA 3KD3A 4JMPA 4RV9A 3EDRA 4PRLA 4QUAA 4Z1MA 4DR3B 1UDXA 2B4KA 3H2JA 2WM8A 4FEAA 3QE3A 4LQDA 3DA8A 3IBYA 5FF9A 1E0KA 1I2ZA 4GYYA 2QORA 4PFQA 1DAKA 1RRPA 2ECKA 3OOJA 4G65A 3ZJ4A 1T35A 4GOJA 4CIDA 3K9GA 4ZU3A 2IX3A 2RHTA 4O5AA 4GYWA 2ZRKA 4ZVRA 4AF8A 4PGFA 4MKZA 4R1UA 3U3OA 5CB0A 4CM1A 1RPZA 3UUWA 4IRUB 3SYTA 2PKCA 4KAXA 1XK7A 1SH7A 1I9GA 3EXEA 4Q1FA 2CNKA 3HVRA 2ZVQX 4O2AB 1UEXC 3ZWXA 5H02A 2JIQA 3KQQA 721PA 5PNTA 2VQ3A 3R40A 5J2TA 1WUIS 4JELA 2JLBA 2HHAA 3BE5A 3PT5A 5C8VA 1JR3E 2A1TS 3BHJA 4FFLA 1RC1A 3ECAA 1G21E 4HD8A 1NRJB 1GL6A 3OC0A 1GYRA 2NUBA 3WNQA 4MVCA 4WERA 1UPUA 2OORA 4U63A 4DEXA 3AILA 3N75A 3LD9A 5JDIC 4C0QC 1PKXA 1PJBA 2R4QA 3TLGA 1JSXA 1NMYA 2FQQA 3KJGA 4ZARA 4QWWA 3WLEA 3MVEA 4M2LA 4IIJF 4QVKA 3PLAE 1K8YB 2O3UA 4D8TA 1WUYA 3FDZA 1TIBA 1Z8HA 2MR5A 3ESDA 1DBWA 3CH6A 3KTDA 3JZIA 4TN5A 5FPSA 3RK0A 3RS8A 4U2EA 1BFUA 4I0WB 5D6NA 3RUFA 3ZH9B 5JS6A 1SG0A 3K6SB 1B15A 4ZV7A 5AUNB 1XEWX 3G89A 4G5QA 1R8QA 1ANKA 3IQXA 3I5UA 1N5IA 3RSGA 4DHWA 3EY9A 2YFQA 1Z88A 3OMXA 3BWYA 3QPDA 3IMEA 4JEMA 4N7JA 4OBEA 2X77A 4WEQA 5AI4A 3W2GA 5B7QA 4CEIA 2JH3A 4YT4A 1MAWA 2G9ZA 1E94E 2Y76A 1WKCA 4OQPA 4B87A 2XVYA 2A78A 4D4MA 1E1YA 2XB9A 3GRPA 2PZGA 4MIEA 3IVRA 1R0RE 3TR0A 4CDNA 1D2AA 1UDRA 3INGA 3ISVA 1EXWA 3L1VA 1TFRA 4G0OA 1GDTA 3K96A 4YRQA 4Z0PA 3UK1A 5JW6A 4ERXA 2L19A 3ZLUA 3AT1A 3FAKA 4X1OA 4HNRA 4NHOA 4GPIB 3RIXA 2ODEA 4JKIA 2IV3A 2CSXA 2V7TA 3NYIA 1NW4A 1KR2A 3NBMA 2QAGC 4WCFB 4MWEA 2P6PA 2LVBA 1YIOA 3O1HB 4X6LA 4EA6A 4WLUA 1YMVA 1JR6A 5LWQA 4M38A 2ID4A 3VKGA 2E0IA 2D74A 1L5HB 3LPLA 1MB4A 4XGKA 1CY2A 2FJUA 1T2EA 1EZ4A 4F72A 1OTXA 3JQ7A 3WNZA 5DV9A 1Z5NA 2R66A 3OMLA 5EZYB 4B71A 1J2YA 4XVUA 2JB9A 4HATA 1C1DB 2UUCB 4HDKA 2GMWA 4TRJA 1GZ4A 3OU7A 3WGYA 4F46A 1R0BA 2ZBEA 5ANRB 1QWOA 1SCBA 2IOQA 2SECE 2V5AA 3HB7A 4MR7A 5GONA 1ZD9A 2NYRA 5GIOE 4BX0A 2EDCA 3B36A 4PBRA 3IMFA 1SUBA 1LLDA 5KCZA 2WF6A 4B31A 3BHNA 1RWWA 2O7NA 4IV8A 1J00A 3KPVA 2LGJA 5EAIA 4RSHA 2PPVA 2WOOA 2XMGA 2HMYB 2DGDA 2QAGA 2ZR9A 3KOWA 3BE6A 4LIPD 2FZWA 5DNWA 4BIIA 2CSUA 2ZTMA 2I6SA 4XRGA 4A2QA 3I0MA 4DLTA 4UVDA 5FTNA 5E8JA 3FPHA 1IY8A 2HPAA 4PG4A 1QX4A 4PR3A 4JKYA 3RNOA 4R41A 3DP9A 4EDHA 3DMPA 3BFPA 6REQA 2XMSA 4YR9A 1XAGA 2XEXA 4KVGA 5B1YA 1NQWA 3I2YX 5JS7A 1ZIYA 2W2VA 5L7YA 4KWEA 5BMVF 5DO9A 3CVYA 3M8KA 1V96A 1HNXB 3FTDA 4ZQFA 2REOA 4D6YA 5DCYA 1IM8A 2FUG6 3GZNA 3KOYA 3V32A 3WXMA 4AY3A 2MINB 1TJYA 4IEIA 4Q1EA 1D6SA 1JR3D 3LOUA 4HQNA 4KXQA 3UM9A 3ID6C 4F6RA 2VEOA 2H5EA 4G5OA 2GEDA 2RHMA 1ZITA 4Z4HA 2JBAA 1APBA 3IALA 3HXOA 4L75A 2UDPA 4B85A 1XRPA 2GHQA 2QN9A 4ND7A 4BO5A 4UTPA 3OT1B 1EWVA 4OJQA 4N0DA 4PSDA 4EKDA 5BSKA 1E9CA 3KB8A 4RM2A 5AW4A 3IVXA 5BV2P 2DHDA 1G291 1U2DA 1WO8A 5G1OA 2HJRA 3CKKA 2YYZA 3FDFA 3I9V1 4M36A 5CYFA 3GQVA 3BX1A 3N3AC 3DVAA 3JYNA 1OFIA 4B3GA 3M4ZA 3B8EA 3GPBA 4YJGA 3ZGZA 4YI3A 2AMJA 3GN2A 3ZCUA 3EVAA 5B57C 3NPAA 2YOFA 1BMTA 4DILA 1ZJYA 2LRHA 2ZRGA 4BBPA 4FC7A 3AO0B 1M0WA 2GR9A 4R7ZA 3N2KB 2BMWA 2Y68A 3C8DA 2ZUSA 3FCEA 3O73A 1Y0BA 4Z99A 2B0JA 3BRSA 4FI3C 2WOJA 5EXTA 3KZOA 3HCPA 2OD2A 1ILWA 4M7OA 5FULA 3LTEA 1OC2A 1QBKC 3R1IA 2QB5A 3IP7A 4HSEA 3VR4D 3WBJA 4Z9YA 4F1JA 1SC4A 1TYAE 5H16A 5F52A 4F7DA 1VBFA 1SELA 4M9ZA 1OWLA 1WOYA 3OZUA 4XYMA 3PXDA 4Z4GA 4WX2B 1XEWY 3HVIA 5AK4A 1EK0A 4K2AA 4YRDA 3MMNA 1CVRA 1DRVA 3OZXA 1ZNZA 1E3LA 5HDBB 4BGVA 4BE4A 3QNWA 1C3XA 5AESA 3S2IA 4BIMA 1K0UA 2DTEA 4WA7A 4WOCA 1IMOA 3GT4A 5LC1A 5BN5A 3UTDA 1RCUA 2DG2A 1TAUA 4HCJA 2KE5A 2ZJ1A 3HJGA 3WGUA 1QB7A 3FLAA 1SZDA 3GLHE 2IP2A 2ZJ3A 4ZO8A 1ZD8A 2CHEA 3BJRA 4ER5A 2V4MA 1L7EA 1E2UA 1IC6A 1N0VC 5CJJA 3ADOA 3FBGA 4KR3A 1TTPB 4MW9A 1KI9A 1G3UA 3V48A 5ITVA 2I4NA 4DV7B 4ON9A 1TZCA 4IICA 1WMEA 4NEGA 1KO5A 2FEOA 1WOMA 3OSUA 1PBNA 2CNBA 3RKUA 3BORA 1ZJJA 1VP9A 4FXPA 5ER6A 1YS6A 2AJCA 4L3WA 4CIBA 4JSTA 1MU0A 3IP8A 4AWBA 4YMWA 3DE4X 2ZRDA 3H5NA 2VF4X 1WS6A 4MS4A 3QI2A 5ESDA 4AJIA 4Q7JB 1ESNA 1RI4A 3HWX1 1KJJA 3Q6NA 4LVOA 3WNVA 4BPBA 3NBAA 2PQ6A 3OCCA 1TU0A 4KN9S 4OXNA 3ZDBA 5LYYA 2XWJI 1J9EA 1RFGE 2WR8A 3LHIA 2KM1A 3FCSB 4MQUA 4ER7A 5BN3A 4A1OA 3G7NA 3KP1A 2ASEA 4WJKB 2AR9A 3E5RA 1TIKA 3OQBA 2VS1A 4H1UA 1UR5A 4HNAB 1LDMA 1TMGE 5JYBA 2ON6A 2REBA 3F90A 2LWIA 1OGJA 4DBZA 5K8TA 1ZMOA 4TL7A 2IP4A 2QE6A 3X44A 3ZCQA 4DMUB 4G0NA 3HVJA 3R7WB 2OENG 4GM1A 2HJHA 4OYRA 1UZUA 4XB6B 4YT5A 4YS6A 2WTBA 3RHSA 1MA3A 1SBIA 3AW9A 1T9HA 1XTUA 2IDKA 4HVAA 1HETA 3FCUB 2W00A 2PRKA 2OQVA 3KSAC 7MDHA 1TMKA 1E62A 3LZDA 3LLUA 3L7DA 2H85A 2CNWD 1TIPA 2AOXA 3FHOA 2GM9A 2YNMA 4RELA 2WWXA 3D6JA 1XU4A 1NUTA 2DUNA 4YB8A 4H6VA 4BTEA 2OILA 5FTKA 5ULLA 3HO8A 4P8RA 2OZPA 1IIRA 3A6EA 2D13A 3EGVA 4INPA 4J07A 2GYYA 4L2IA 1D7OA 2HXGA 4O59O 2OPHA 3QU5A 2JLWA 1VQ1A 3N2IA 2YBEA 5KJEA 1O94C 4FYKA 5CT9A 4KGZA 4KPEC 1CHDA 1RKUA 2NVOA 3WQRA 1E5VA 3U4QA 1I5RA 2FPKA 2LCFA 2V9PA 3H05A 4KV7A 4N9WA 1D0IA 3NUQA 3OTWA 1H9AA 3GFRA 4S3MA 1L4YA 1TZBA 4F93B 4ARCA 2FZEA 4FD2A 2D0DA 4N4AA 3HSSA 3FJOA 6ABPA 5F33A 2L17A 5GAJA 2ISQA 1XWWA 1E3SA 4LGYA 3DTVA 4BMSA 5FBLB 4NLLA 1P4GA 4AX8A 3GGGA 1D09A 2YMMA 1V41E 4RFSA 4WCDA 4V1CB 5LMZA 1XVUA 1SVIA 2Q9CA 5BMVA 3ME5A 4Z9FA 3JD2A 4Z0NA 1KBZA 3T5DA 4BKQA 1PGPA 5LXTA 4CKYA 2ZI6A 4FKBA 4DV0B 2Z98A 1KJ9A 4QPJC 1VMIA 1CZOA 2FQYA 4GI7A 4KE7A 3IAM1 2XQJA 1MT3A 1KHTA 2F90A 3DVQX 5CK4A 3SYRA 4F9EA 3OTOB 2HLNA 3SIWA 3FNFA 1V7PC 2J8ZA 2Q46A 2RGGA 2F8LA 1F0KA 5H7XA 4QT0A 2COEA 4UDXX 1UZMA 3LNCA 3PL1A 4RM3A 4Y2RA 2NP7A 1R4MB 1K7CA 3U49A 3IQIX 1BXGB 4IZ6A 1K97A 3LC0A 4UOZA 1JQBA 3RSZA 4H18A 3L7MA 3SVLA 1WKVA 2JJYA 2OHXA 2W6JD 3WNBA 4LVCA 4GL4A 3GJTA 1R4NB 2P4QA 1OW3B 3LLSA 5CYOA 4N01A 3VU9A 2KB0A 2XNKA 2YVLA 3FOFC 1OX5A 1BE8A 3RG2A 1PYGA 1U9CA 1XQVA 2Z83A 1KNXA 4IDCA 4A8JB 1M6HA 2ZVDA 4BVJA 1RLIA 2OFWA 4I4TF 3R3ZA 4B83A 5BR4A 2N42A 3ZVRA 3QW2A 2ZPUA 3RT1A 3FHCB 3GFFA 4KMSA 1G5IA 3E82A 2IHVA 2JFOA 3KM0A 3OBBA 4MQ5A 5HQ3A 1U81A 2DFLA 4NNJA 2OHFA 1H6DA 3MWKA 2QJTA 4GBGA 4YRFA 2VXOA 3UYLA 1RWQA 2WP8J 1L8OA 4UBLA 3VOAA 4DCTA 3ONVA 5LD2C 3KQVA 3EPLA 3URMA 3T9BA 4YAUA 4HRYA 1PCXA 4PAOA 1AV7A 4JYZA 2R11A 5HCNA 2LUOA 5BXQC 4WASA 1SURA 2CVQA 3PYLA 4XVHA 4TKLA 5KWSA 1VSTA 3BILA 5IHPA 5JNVA 3AKDA 4INAA 4TLBA 1GPUA 3KPUA 5EHNA 4XPIB 1CZLA 1KARA 3CF2A 4L7QA 3TX6A 4A23A 3DPIA 1OZFA 4HH0A 4CQJA 1X2EA 1DHRA 3PB3A 4WXYB 4YREA 3LGSA 2FGJA 3R3XA 3K9WA 4A8TA 2ZSUA 3QVGA 1GNVA 4EB3A 3ZIAD 1KWGA 5KNLA 3U0BA 1YBAA 3RYFA 2IXBA 3SY8A 3AM4A 2OWDA 1I30A 2BPOA 3H3FA 1NQUA 1H1LA 2X5XA 4UDYX 2IEIA 1FP2A 3RRBA 5E8RA 3SJUA 3VVBA 4AN1A 5A5DA 2MOKA 4CLOA 1NPYA 1U63A 3IBTA 5T67A 1EFLA 1QANA 2HFJA 1YB2A 1FUYB 3BXEA 3FPGA 5K7SA 3PYXA 4MRMB 4POOA 4RZSA 5IJ9B 3Q3IA 4OKSA 4LNAA 5T4HA 3P0HA 3DW3X 4J0DA 1H0HA 1GG8A 3QUBA 1X1QA 2IW3A 3VHXA 2QTVB 3P2OA 4D74A 2FSVA 3Q8KA 3LH5A 1V5EA 4HTAA 2QOEA 4XEUA 2Q4OA 2R1ZA 3GXBA 3SDZA 2OY0A 5CGZA 4AJKA 3NO4A 2ZIUB 2IU0A 3IXLA 3T7IA 1CUUA 1WPGA 5F4ZA 3WX0A 2PAFA 2QD3A 3SLRA 1RRGA 3E7WA 1JH9A 3IUPA 1VCIA 4QBFA 5TE9A 4B75A 4TMFA 2IZ6A 4AX4A 3GMSA 4YY3B 2I1WA 2N3ZA 3MTQA 4MS3A 2X8BA 1FNNA 4I1PA 2H08A 5CTAA 4HC4A 3TZCA 4DV6B 1UM9B 2VJDA 1W49A 3O8OB 2AZDA 1VRVA 2F1JA 1UPFA 1OVGA 4M8IA 4Q7KA 5ERXA 3X43A 1Q95A 3FI0A 4G89A 1IVSA 4MITA 3VPFA 2ZI3A 1Y8CA 1GPAA 1Y6RA 2D8AA 3NHWA 4HAXA 4MWCA 5EJ9A 3CSDA 3VC7A 4UMVA 5ICCA 1YA4A 4BY9E 3WRXA 4BLUA 3MB5A 2IUEA 1WQ3A 3W05A 1XEFA 4EB6B 1E3DA 1QS0B 1V48A 2FW1A 3DDHA 1YA8A 4JR1A 4DV3B 1UJCA 4RK4A 1KQNA 2WWVD 2HZ7A 1GTG1 2NTYC 4UHFA 2ZYDA 2WJZB 4M1MA 2EX0A 2QPOA 3E0QA 4DA4A 4S1VA 1PWEA 5DWDA 2B1RA 3TWOA 3G5UA 2FPXA 2LTAA 4L02A 3M89A 1WA5A 1YFZA 2B8TA 3A4IA 2R47A 3R75A 2YYYA 1VJ5A 2M1XA 3T3DA 2VN8A 4UNPA 4JDPA 3RYTC 5L40A 1FNMA 4K03A 1XF1A 3TSWA 4EEKA 1I1OA 1NBMA 1U3WA 1C8LA 2GZSA 1WXDA 2IJGX 3EZFA 4R68A 5ES3A 5BT9A 3U2QA 4DAOA 4DNXA 3M1LA 2RBKA 2XE8A 3BZBA 3ELUA 5GMOA 4MVJI 1L1FA 5JMOA 4GWLA 3EQZA 3K1ZA 1UK7A 3N7TA 2XUAA 5KOJB 1NNUA 1FU4A 1WDLA 4BJ6A 5TQVA 4MQ6A 4Y2SA 1YRQA 1Z0AA 4EG6A 4S04A 2X8AA 3EGDB 1G8GA 2QQGA 3B6EA 4JWKA 4MB2A 5TRTA 3GJQA 5K05A 3R7AA 4BGUA 4KR7A 2J48A 3AM3A 4QNNA 4MWBA 4TGLA 5DVZA 2RGNA 2WU1A 3H17A 2EV9A 5E4FA 1Z4MA 4DCNA 1DC4A 5LR6A 4B3IA 2PNFA 4D0SA 1J7JA 1QBGA 1EA5A 3VSDA 4YAWA 4MS1A 2HIGA 4NYJR 2C7PA 1XC7A 2JVJA 3I5XA 5SYMA 3OU2A 4F91B 2GCGA 2ZWMA 5TMDA 1NQAO 4D3ZA 4EG7A 1KAEA 3AR7A 1B0ZA 1KEPA 1E8NA 1Q21A 5K2OA 4JUAA 2OV6A 1PGNA 4ZDJA 3SC2A 1FNDA 1O0SA 5HS6A 4BFWA 2XD9A 4IY1A 5F1KA 1XHEA 2AJ8A 5ALKA 3G17A 5IP5A 2EFCB 4MWZA 4YRAA 5DLEA 4Z7NB 3DO8A 4YMLA 3LL4A 3B3QA 4DLNA 1RHUA 3OZVA 3AP2A 4ZI3A 2OCKA 1XD8A 4UBJA 3ROXA 4D80A 1PJCA 1ST2A 2Q5IA 3KKMA 5CMLA 1AVTA 3JQ7B 1N2SA 1D03A 2JFQA 2VHCA 5E9QA 5KOJA 4KWTA 2BBWA 5AVJA 3SHTA 1DVRA 4XQGA 4QXOA 3EFEA 4HXEB 1CQPA 2AI3A 3AJ9A 4QTXA 2D2XA 5CLJA 1XCJA 5JZMA 1WQ4A 5CUQA 4C6SA 2O8FB 2EFDB 3SQOA 3OOSA 5C31A 5CDTA 1SY7A 3T5TA 1WB5A 3P20A 1S4QA 3KO8A 4MKFA 5D87A 2MSDB 4KYVA 4L5AA 3F2IA 2UYOA 3MF4A 3PHLA 4BQFA 2E3JA 4G4SP 2A2ZA 4KW7A 3MS4A 2Q0SA 4P0QB 4F6CA 2GA8A 1GILA 1IAVA 2FCAA 2VSOA 3A9TA 3BGIA 3DBIA 4NONA 2HB6A 2GNOA 2IVFA 2QMYA 3Q2IA 2CVHA 4DZZA 1TEHA 3CZ9A 1FLAA 5EE0A 5I7VA 3V8BA 1N1MA 1K63A 1CIJA 4Y0AA 3RBZA 4E51A 4EX6A 2QTAA 3KQTA 3RJMA 2UUBB 2X0NA 1PWZA 4PSVA 4FN5A 4QJBA 5C0OE 3X1XA 2CNWA 2GN6A 1COWA 1V8ZA 4LN1A 2I6UA 3RYIA 5EKXA 4DLRA 3JWGA 5MF6A 3HA5A 1GY8A 1SQ5A 1V37A 3GJ6A 3LY8A 3K09A 3PEEA 2V8BA 3PXXA 3S1AA 1GAXA 2YY7A 2XUHA 4TZ6A 1MEEA 1DUSA 1Z5OA 1ULUA 2IY9A 3E48A 1W8IA 2CY0A 5HE9A 5I9SA 2OAEA 1ILEA 3KE8A 1FP1D 3NAGA 3NJ8A 2CFTA 1QGZA 1R16A 1HNWB 5EE5B 1QC5B 1IPHA 1R8XA 4BLWA 2RGWA 2QRVA 3H2HA 3FWPA 3L0PA 2J0QA 2FXVA 2C2KA 3U61B 4J1TC 5MGBA 3KCQA 2YWRA 3LVRE 3AVXA 3L6EA 1NXQA 3O47A 2B4YA 4ZO9A 5SICE 1KDVA 1KOLA 4MIKA 3COVA 2FN7A 1HGXA 1NJ5A 5IS2A 2WFLA 1NW5A 3C5VA 1A96A 2QEQA 4ILEA 5JY6A 5BN5B 3QPBA 2OLEA 3GI1A 4A2PA 2GEKA 3V80A 3K7EA 1CUXA 1W5EA 3N2YA 1IOWA 4M1EA 5T3UA 5JSFA 1ZVVA 4L72A 1W6UA 1TXGA 1AF7A 3OM1A 1EWYA 3R6WA 3CUWA 3OFVA 5A7HA 2ZJ0A 3AF1A 2NZUG 5BV8A 1FRNA 1QHSA 4MUBA 5AJYA 4DL9A 3K09C 3UB4A 1A72A 4WLFA 2XUDA 1LV7A 1OFHA 1RRMA 3MAGA 5I5EA 3OPVA 2NIPA 3IJPA 2RE8A 2LDBA 4ICIA 4MB0A 1B00A 2GJ8A 2H8KA 1OU0A 2WMYA 2C98A 3KLBA 1V5FA 4S0XA 2J1LA 4PC2A 4FB5A 2QJFA 3Q6MA 5G2OA 1P1IA 1JDUA 3OIFA 3S2YA 4DHEA 1W25A 3HYSA 2ZGVA 3QMPA 2YQZA 1U7OA 3VO1A 2AXNA 3MGBA 1KEUA 5B36A 3I9MA 4I4LA 4O02B 4MRPA 1M6YA 3NB0A 3GP5A 4R40A 2ZTHA 3CINA 1XRQA 5FLYA 2ZAOA 5TARA 3F9CA 2A67A 3RAJA 1ZW6A 1DC6A 4TTIA 3QKRB 3OHPA 2X19A 1JF8A 3KU1A 1JIUA 2BGJA 3OT1A 6REQB 2ZRMA 1SQ0A 1KQ3A 1DOZA 3NHZA 4PE5B 3E70C 5IEJA 2WNSA 1ZSYA 1JKXA 4BDSA 5JRDS 2OESA 2YW2A 1CY1A 2WB4A 4TT3A 2PFKA 3JZAA 5EGNA 1FMJA 3JQGB 1X9IA 4HX5A 2OBBA 2B92A 4RPKA 2Y2UA 5TQJA 4F86A 1JHMA 1WSAA 2N46A 1WP4A 1WUJS 2B7CA 3HKBA 4XQEA 2XYPA 1SBTA 2I6TA 3BMOB 4N5MA 3IR7A 5TJHA 2X0DA 4AJPA 1KTIA 3KUCA 3GFSA 4AB1A 2J07A 5BNZA 3M6UA 2WAMA 2ZSBA 1PJAA 3ZHBA 3RK1A 3BERA 2YWFA 2O1WA 4WDQA 2G5PA 1Z18A 3RNLA 1DKOA 2H63A 3B1XA 4BO4A 3JAMA 2XJ9A 3PZBA 1N2CB 1X7DA 2NAFA 2Z9BA 1ENPA 1MHPA 1PNTA 4DANA 5JV5A 3GFVA 2ECOA 2HIAA 3I52A 4E2YA 4DA6A 1I2BA 1XN4A 1MB3A 3NTOA 4I6GA 5EZYF 4N76A 3U6BA 2IODA 4MTCA 3UK6A 4COKA 1KU6A 3HNRA 1QDUA 4GAEA 1SC6A 4FZ5A 1Y33E 10MHA 4O4IA 1UC5B 2F6RA 1HK7A 2MIIA 1Z29A 2ODTX 3JALA 2PL5A 3IESA 4HYTA 2GFHA 3O8QB 3F6CA 3GRZA 2I2BA 2OORC 2YZGA 3CNHA 2XGGA 2D2FA 4IKPA 3C5EA 4M1YA 5CPFA 5L6LB 2ZM5A 5FOQA 1PR0A 1VYVA 1YGPA 3RSLA 1P73A 3CLTD 5AOAA 3UFBA 1NG9A 3QHQA 1P9WA 2NO6A 2ZB2A 2A1TR 4KPUA 4Y1FA 1IAQA 3VH4A 1F20A 4YYEA 3MHPA 1AZSC 4AT1A 4NCNA 5KYTA 3KKOA 2DY0A 3SU8A 4HN2A 3KL4A 3UJCA 3P9XA 4LUCA 4N03A 1R6TA 2ZAMA 3COYA 4ZVPA 3SVZA 3ZE1B 1RRVA 1RWVA 3PQ8A 1IN6A 1PUJA 3A1FA 3M6IA 1KY5A 5HQJA 1B42A 4IIEA 1NZDA 5HMMA 4XVQA 1H4QA 3FZQA 1FXSA 4X84A 3GA5A 4K6OA 4QTZA 5FWXA 4D97A 1J97A 4G07A 4GI2A 3BKWA 5JXWA 1DEXA 2QTZA 1XN1A 3L0IB 4B6JA 3JWEA 3OCWA 2RONA 3FG9A 3R09A 4ASUD 4AMUA 3DC7A 1A4UA 2J30A 5ICMA 4QVGA 4B48A 3KFVA 1HDOA 5E4YA 3C5HA 1UMDB 2FJ0A 3VYUB 4UNRA 5D1NA 4YP9A 3ZZ1A 5HVNA 4E70A 4PU0A 2ZE7A 1RWXA 4J0JA 4JFRA 3B1KA 3H4VA 1REQB 4ONEA 4GYKA 2YVAA 4U7WA 1WBBA 2I9KA 5LKAA 1G6HA 5HYVA 4MGHA 1QYCA 3ETCA 5A4JA 5K0EA 1ISHA 3W2FA 3FUVA 3D54D 3NYWA 4Y9SA 3OICA 1C30B 1NX9A 3MOIA 1WBDA 3WLHA 3QF4A 4UTVA 4ZCSA 1XA0A 2FX5A 2PT7A 2RG1A 1HT0A 3HPRA 4X85A 3X0DA 3LF1A 2W43A 1N8KA 3ZD8A 4DVGA 1NXSA 4G97A 4PLZA 3NIBA 1E0SA 1ZDMA 4OMUA 3NI2A 1T10A 2XNCA 3EBPA 2V74B 1WP9A 4GVPA 4JJIA 4PGAA 1J2EA 5JSQA 4QEZA 2ZS7A 1ZI6A 3A9WA 3RVMA 2IQ5A 2D00A 2W2LD 1KEVA 4TMYA 3VNQA 3MERA 1P2GA 1G2PA 1Y98A 1XNGA 2CLLB 2R65A 4HGPA 4YRGA 3GMDA 3K2QA 1P1CA 4EPXA 5EIEA 1U04A 1YS9A 2FEKA 4KN8A 3N2EA 4DSOA 4NI5A 1HA3A 2XLCA 4WL0A 3EGEA 2W6MA 1GZUA 5EEHA 1CEQA 1ODIA 1LK0A 2IDJA 4OQZA 4DLWA 5JZSA 3BTOA 5AVYA 3PNQA 3A70A 5JSYA 2JD0A 3EGCA 2QUHA 2M6LA 1XJ0A 2IOFK 2JH9A 3M6XA 3NIDB 3MT8A 4MUHA 3WGQA 3TS1A 1X3SA 2FHPA 3T3MB 4DRYA 1JN0A 1QIHA 3CEPB 3LLVA 3QLJA 3QUQA 4JD5A 4P83A 3AOGA 5CVTA 2EJBA 4O2AA 1Q74A 3EXAA 4D9CA 4HK4A 2B3TA 3L2OB 3JQ6A 2J3KA 1C1XB 2P2YA 4IHJA 3BA6A 4X93A 5IVKA 2I55A 3SEQA 1JAYA 1SVSA 4ABTA 2EKPA 2O23A 5H81A 1AUPA 5J4YA 2H9IA 3H6GA 3W04A 1Z0SA 1SCDA 3GRVA 4L8FA 4M22A 4C04A 1SU7A 1PJ8A 2GJ4A 2XQIA 4WNIA 1ZD1A 4XQ0A 1TYEB 1XQXA 1PUXA 3A36A 3V9PA 4A91A 1EUCB 1RWKA 2GRUA 1W85A 1XDZA 2VPPA 3Q7RA 4OM7A 5K0GA 4L5JA 2LE0A 3CVVA 1BMFA 2QTHA 3BF8A 3QJGA 4B4WA 4R8LA 4YQFA 3GN1A 3KYDA 3DYVA 3RTBA 1VL8A 4CM8B 3QLVA 1KI1A 1FE8A 2HEGA 4GE0A 3R3WA 1W48A 4ZAFA 2OV2A 2YJ3A 2C2ZA 4DYHA 5HX7A 4DMGA 3DBLB 4FOSA 1H65A 3PXUA 5GIPE 1ADJA 1ZK1A 2WHPA 3C1AA 3HKBB 1JQKA 2DSTA 2GPTA 1F2TA 3Q7IA 3TXAA 5JDIA 5KQRA 1M34E 5JAIA 3GBSA 3H6KA 3QWHA 1W4RA 4OXRA 3RJ5A 4H0NA 3I2HA 4D26A 1LF0A 2E1PA 1GU7A 3B3JA 3N2KA 3ULKA 4GPTA 1XDUA 3I9V6 4JKOA 4EBBA 3T7CA 1DXOA 1BVHA 3DDWA 2G04A 2OA0A 1V3UA 2PV0A 3JQFA 3WMXA 1XIVA 1CJTC 2RGXA 2IYVA 2IZZA 2P78A 4N9QA 1PNVA 5IDVA 3VZDA 4B0OA 3ZCSA 4NE9A 3C6MA 5NULA 5JO0A 2AG6A 5CB8A 1Q0PA 1BHQ1 1B0UA 3FJ1A 4TX1A 4TRNA 4X65B 4R2IA 4GF5A 3L7CA 5KO2A 1D0SA 2A0XA 1T8WA 4YH1A 4RLFA 3B9QA 2FDCA 2FWMX 1RMQA 5ALDA 3W1WA 1MA0A 1R8YA 1LVGA 3DMDA 3NQ41 4G1BA 4LMPA 5IYZF 3AVOA 4YDHB 3O2NA 3SXPA 4DIUA 3ROQA 1GQQA 4TLMB 4ALLA 2XXAB 4I1UA 3MJVA 4UUQA 4EPRA 4R0MA 4IOLA 1QO0A 4MW1A 3WLOA 5DHFA 5BR7A 2X9GA 5JH7A 3AHFA 5D5HA 2VBCA 3P4UA 2QG4A 1NW9B 3B1ZA 4BQNA 4C0BA 1JMYA 2G63A 4CG3A 2WLTA 3ONNA 2VDWB 3DXFA 3T4EA 3PICA 4D4IA 1WB4A 2D7JA 4M89A 4B82A 1O57A 4Z4QA 2UUPA 4WOKA 5CFNA 4HXYA 2VQEB 3R5KA 1CY0A 4E5DA 2V58A 3CLSC 1VG1A 4EF6A 1ODJA 1YJ5A 5HCIA 1N2BA 1T3LA 3CQ9A 4HNHA 5LBUA 3U3MA 4EATA 1RHRA 1SKYE 4G2NA 4KOEC 2BLNA 2XX3A 4ZQHA 4TWIA 4U9IS 2VNKA 4H3SA 4DQ0A 1KZ1A 3MMXA 3DOFA 3O6VA 4II2A 4X95A 4HV4A 4G09A 2ZUEA 1AZLA 4BKOA 4PRYA 5MN6A 1U1DA 1KQFA 2QXYA 4H7FA 5AHRA 2VDJA 3ND5A 1AK9A 5T57A 1ZLXA 2B4TO 2JAXA 1NN5A 3ELYA 1EM8A 2NQ2C 4CM6A 5CCXA 4A16A 4AXXA 3O95A 5CVVA 4N7BA 2KQUA 2UZ3A 3NR2A 4KIFA 5ELMA 2HJWA 3QU7A 2B2CA 1YQUA 1NR7A 3I1FA 4QQNA 1U5BA 4IH1A 5KYYA 3U5ZB 2EEPA 3MINA 4YJ3A 2H29A 1PT6A 3CKLA 4CLOB 3KSUA 4U7PB 3A6LA 3ZYZA 4BLSA 3H0EA 4XX1A 1WE2A