4Z59A

Hipb-o4 20mer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
71
structure length
71
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism on hipBA gene regulation.
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Antitoxin HipB
total genus 25
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4z59A00
1POUA 2CROA 1UXDA 4YG4A 4PU8A 1RZRA 2B5AA 3FYMA 2O38A 3OQMA 1OCTC 2LYJA 4Z5HA 1RPEL 1QP7A 1BDHA 3CLCA 2XSDC 1QPZA 1ZZ6A 3CROL 3VK0A 3OP9A 3F52A 1ZZCA 2AWIA 3G5GA 2MQKA 4X4HA 2JVLA 1PRVA 2KEJA 3F51A 4MCXA 3FMYA 1L1MA 3QQ6A 2OR1L 2LYKA 2LYSA 2LYQA 1UXCA 4IVZA 4Z58A 2XIUA 1ZUGA 2EWTA 1OSLA 3QF3A 2IUOA 2WIUB 3D1NI 1QQBA 2PPXA 4NDWA 3SCHA 3O9XA 3UFDA 1QP0A 4X4EA 3R1FA 4J1XA 4X4GA 2BNOA 2KPJA 3KJXA 4PU7A 3CECA 2HSGA 2XJ3A 2PUAA 4I6UA 1CJGA 3S8QA 2AXUA 1EFAA 1Y9QA 1NERA 1QQAA 3SCGA 1ZPQA 2ICTA 2BJCA 3H5TA 4IWRA 2AW6A 4GHJA 2IVQA 4O8BA 4JCXA 1WIZA 3G7DA 2ICPA 3BD1A 2IU7A 3DNVB 3GBFA 1PERL 1X2LA 3LISA 3OQOA 1PRUA 4X4BA 2PUCA 1ZZ9A 2XI8A 3F6WA 2OFYA 1RZSA 3RZZA 2O4AA 1UTXA 2LCVA 2MEZA 3TRBA 1ZZBA 3PXPA 4F8DA 4X4DA 3HZIB 1ZS4A 3U3WA 1WETA 4PU3C 2L8NA 1WH6A 2AXVA 3MLFA 2KZ8A 4YG7B 3BS3A 2JCGA 1E3OC 1AU7A 4JQDA 2PUFA 2H8RA 4YBAA 4JCYA 1LQCA 4I6TA 2O49A 1XWRA 1O4XA 1JFSA 2PE5A 1PRAA 3JXBC 2L49A 4MCTA 1SQ8A 3QWGA 3LFPA 2FJRA 1LCDA 2PUDA 4I8TA 1WH8A 4YG1A 1B0NA 4GQMA 4FBIA 1JFTA 2XCJA 3OMTA 3OQNA 2PUGA 3GN5A 2LYLA 5A7LA 3BDNA 1S7EA 1VPWA 4OB4A 1ZZ8A 1X57A 3ZHMA 2PUBA 3KXAA 1R69A 2EBYA 3IVPA 3ZHIA 3ZKCA 3QYXA 4J1WA 1ZAYA 2D5VA 3L1PA 1R63A 1JWLA 4Z5CA 1LLIA 1Y7YA 1LMB3 3GN5B 4Z59A 1RZRD 2GZUA 2WUSR 1ADRA 2HINA 1CQTA 2PUEA 3B7HA 2EF8A 4X4CA 4FN3A 1LCCA 2LYPA 4X4IA 2KEKA 2IVGA 2R63A 1DWKA 2A6CA 2IVBA 3KZ3A 2AXZA 2LYRA 1NEQA 4IA8A 4X4FA 2GRLA 2IV1A 4PU4C 1QP4A 1DW9A 5K98B 1IC8A 2R1JL 1PNRA 3JXCL 1YSEA 4I6RA 1BDIA 2BNMA 1JH9A 4Y42A 2AUWA 1RIOA 1GT0C 1ZVVA 3SCFA 2PIJA 2CSFA 2GRMA 4YARA 2BNNA 3EUSA 2KEIA 1HF0A 4Z5DA 3FYAA 3JXDL 1ZZ7A
chains in the Genus database with same CATH superfamily
1RZRA 5DSXA 3TFLA 1QZXA 2PXPA 3CROL 2JQEA 2PXFA 3MEJA 2JVLA 1PRVA 4MCXA 1L1MA 4OBMA 2XIUA 1OSLA 1QQBA 3SCHA 3G0TA 3O9XA 4X4EA 3TEPA 5DTMA 4X4GA 3CECA 2HSGA 2XJ3A 1CJGA 3S8QA 1ZPQA 2ICTA 3H5TA 4IWRA 3DM5A 4O8BA 3G7DA 4ER5A 1X2LA 3LISA 3OQOA 2LCVA 3U3WA 1WETA 4PU3C 2L8NA 2AXVA 3BS3A 1AU7A 3R09A 1XWRA 1O4XA 1PRAA 2L49A 1SQ8A 4Q2JA 2PXTA 2PXLA 4DE9A 2HCNA 2FJRA 4FBIA 3OQNA 2PXBA 2LYLA 5A7LA 3SR4A 1DULA 2D5VA 3IVPA 3QOXA 1ADRA 2J7WA 2L1PA 1CQTA 2FFHA 1LCCA 2PXQA 4IA8A 4X4FA 4PU4C 5K98B 1JH9A 4Y42A 2AUWA 1RIOA 4ER0A 4YARA 2PIJA 3EUSA 2KEIA 3GZCA 3KL4A 2CROA 1UXDA 3FYMA 2O38A 1OCTC 4Z5HA 1QP7A 5GAGi 2XSDC 3VK0A 2MQKA 2PXDA 3QQ6A 2LYKA 2LYSA 1UXCA 2WIUB 3D1NI 4NDWA 3NDBB 3R1FA 2KPJA 3TELA 2AW6A 4GHJA 2XXAA 5JUWA 3QOWA 4JCXA 2IU7A 2ODRD 4X4BA 2XI8A 3F6WA 2OFYA 2MEZA 4ER3A 4YG7B 2JCGA 1E3OC 2PUFA 2H8RA 2J7UA 3NZLA 3GUUA 2PE5A 5GAHi 3JXBC 1WH8A 1VPWA 1S7EA 3ZKCA 1ZAYA 1JWLA 3GN5B 2PUEA 4X4CA 2LYPA 2A6CA 2AXZA 2LYRA 3OWQA 3A9YA 2R1JL 3JXCL 1YSEA 4I6RA 2GRMA 2LLWA 4Z5DA 3JXDL 1ZZ7A 4PU8A 1MFQC 1RPEL 1BDHA 3F52A 3G5GA 4X4HA 3F51A 3FMYA 2OR1L 4Z58A 1ZUGA 2EWTA 3QF3A 2IUOA 2PPXA 4J1XA 2MXDA 2HFZA 3KJXA 4PU7A 4I6UA 3SX0A 2AXUA 4ER6A 1Y9QA 1NERA 2PXUA 3VWSA 2BJCA 2VEOA 2IVQA 1QB2A 2ICPA 3DNVB 3GBFA 2O4AA 1RZSA 3RZZA 2V3CC 3HZIB 1ZZBA 4F8DA 2PXKA 3A9XA 5DT2A 4DE8A 4JQDA 3GZDA 4YBAA 4JCYA 4I6TA 1JFSA 4MCTA 3QWGA 4I8TA 4WVLA 2XCJA 3OMTA 4EK9A 3GN5A 3UWPA 3QFIA 1X57A 1R69A 3ZHIA 3OKZA 3L1PA 4Z5CA 1Y7YA 2PXEA 1RZRD 2GZUA 2EF8A 3KZ3A 1NEQA 1QP4A 2M4HA 2IV1A 1DW9A 3NXHA 3M9LA 2BNMA 3A9ZA 1HF0A 2BNNA 4EZIA 3ME5A 1POUA 4YG4A 2B5AA 3OQMA 2LYJA 3CLCA 1QPZA 1ZZ6A 1NW3A 3OP9A 2XXQA 1ZZCA 2AWIA 2PXVA 2KEJA 4EKGA 5DRYA 2LYQA 5DTQA 4IVZA 1QP0A 3PE5A 3UFDA 2LLVA 3GZDC 2BNOA 3NROA 2PUAA 4ER7A 1HQ1A 2XXPA 1EFAA 1QQAA 3SCGA 1WIZA 3BD1A 1PERL 1PRUA 2PUCA 1ZZ9A 1UTXA 3TRBA 4X4DA 3PXPA 1ZS4A 1WH6A 3MLFA 2KZ8A 5DRTA 4EKIA 1LQCA 2O49A 1U2ZA 3LFPA 1LCDA 2PUDA 4HRAA 4YG1A 1B0NA 4GQMA 1JFTA 3BDNA 4EQZA 4OB4A 1ZZ8A 3ZHMA 2PUBA 3KXAA 2EBYA 3QYXA 4J1WA 1R63A 1LLIA 1LMB3 2LNMA 4Z59A 2WUSR 2HINA 5DTRA 3ZPXA 3B7HA 3LQXA 4FN3A 4X4IA 2KEKA 2IVGA 2R63A 1DWKA 2IVBA 2YBDA 2GRLA 2HCSA 1IC8A 1PNRA 1BDIA 1ZVVA 1GT0C 3SCFA 2CSFA 3FYAA 2PUGA
chains in the Genus database with same CATH topology
1POUA 2CROA 1UXDA 4YG4A 4PU8A 1RZRA 2B5AA 3FYMA 2O38A 3OQMA 1OCTC 2LYJA 4Z5HA 1RPEL 1QP7A 1BDHA 3CLCA 2XSDC 1QPZA 1ZZ6A 3CROL 3VK0A 3OP9A 3F52A 1ZZCA 2AWIA 3G5GA 2MQKA 4X4HA 2JVLA 1PRVA 2KEJA 3F51A 4MCXA 3FMYA 1L1MA 3QQ6A 2OR1L 2LYKA 2LYSA 2LYQA 1UXCA 4IVZA 4Z58A 2XIUA 1ZUGA 2EWTA 1OSLA 3QF3A 2IUOA 2WIUB 3D1NI 1QQBA 2PPXA 4NDWA 3SCHA 3O9XA 3UFDA 1QP0A 4X4EA 3R1FA 4J1XA 4X4GA 2BNOA 2KPJA 3KJXA 4PU7A 3CECA 2HSGA 2XJ3A 2PUAA 4I6UA 1CJGA 3S8QA 2AXUA 1EFAA 1Y9QA 1NERA 1QQAA 3SCGA 1ZPQA 2ICTA 2BJCA 3H5TA 4IWRA 2AW6A 4GHJA 2IVQA 4O8BA 4JCXA 1WIZA 3G7DA 2ICPA 3BD1A 2IU7A 3DNVB 3GBFA 1PERL 1X2LA 3LISA 3OQOA 1PRUA 4X4BA 2PUCA 1ZZ9A 2XI8A 3F6WA 2OFYA 1RZSA 3RZZA 2O4AA 1UTXA 2LCVA 2MEZA 3TRBA 1ZZBA 3PXPA 4F8DA 4X4DA 3HZIB 1ZS4A 3U3WA 1WETA 4PU3C 2L8NA 1WH6A 2AXVA 3MLFA 2KZ8A 4YG7B 3BS3A 2JCGA 1E3OC 1AU7A 4JQDA 2PUFA 2H8RA 4YBAA 4JCYA 1LQCA 4I6TA 2O49A 1XWRA 1O4XA 1JFSA 2PE5A 1PRAA 3JXBC 2L49A 4MCTA 1SQ8A 3QWGA 3LFPA 2FJRA 1LCDA 2PUDA 4I8TA 1WH8A 4YG1A 1B0NA 4GQMA 4FBIA 1JFTA 2XCJA 3OMTA 3OQNA 2PUGA 3GN5A 2LYLA 5A7LA 3BDNA 1S7EA 1VPWA 4OB4A 1ZZ8A 1X57A 3ZHMA 2PUBA 3KXAA 1R69A 2EBYA 3IVPA 3ZHIA 3ZKCA 3QYXA 4J1WA 1ZAYA 2D5VA 3L1PA 1R63A 1JWLA 4Z5CA 1LLIA 1Y7YA 1LMB3 3GN5B 4Z59A 1RZRD 2GZUA 2WUSR 1ADRA 2HINA 1CQTA 2PUEA 3B7HA 2EF8A 4X4CA 4FN3A 1LCCA 2LYPA 4X4IA 2KEKA 2IVGA 2R63A 1DWKA 2A6CA 2IVBA 3KZ3A 2AXZA 2LYRA 1NEQA 4IA8A 4X4FA 2GRLA 2IV1A 4PU4C 1QP4A 1DW9A 5K98B 1IC8A 2R1JL 1PNRA 3JXCL 1YSEA 4I6RA 1BDIA 2BNMA 1JH9A 4Y42A 2AUWA 1RIOA 1GT0C 1ZVVA 3SCFA 2PIJA 2CSFA 2GRMA 4YARA 2BNNA 3EUSA 2KEIA 1HF0A 4Z5DA 3FYAA 3JXDL 1ZZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POU A;  2CRO A;  1UXD A;  4YG4 A;  4PU8 A;  1RZR A;  2B5A A;  3FYM A;  2O38 A;  3OQM A;  1OCT C;  2LYJ A;  4Z5H A;  1RPE L;  1QP7 A;  1BDH A;  3CLC A;  2XSD C;  1QPZ A;  1ZZ6 A;  3CRO L;  3VK0 A;  3OP9 A;  3F52 A;  1ZZC A;  2AWI A;  3G5G A;  2MQK A;  4X4H A;  2JVL A;  1PRV A;  2KEJ A;  3F51 A;  4MCX A;  3FMY A;  1L1M A;  3QQ6 A;  2OR1 L;  2LYK A;  2LYS A;  2LYQ A;  1UXC A;  4IVZ A;  4Z58 A;  2XIU A;  1ZUG A;  2EWT A;  1OSL A;  3QF3 A;  2IUO A;  2WIU B;  3D1N I;  1QQB A;  2PPX A;  4NDW A;  3SCH A;  3O9X A;  3UFD A;  1QP0 A;  4X4E A;  3R1F A;  4J1X A;  4X4G A;  2BNO A;  2KPJ A;  3KJX A;  4PU7 A;  3CEC A;  2HSG A;  2XJ3 A;  2PUA A;  4I6U A;  1CJG A;  3S8Q A;  2AXU A;  1EFA A;  1Y9Q A;  1NER A;  1QQA A;  3SCG A;  1ZPQ A;  2ICT A;  2BJC A;  3H5T A;  4IWR A;  2AW6 A;  4GHJ A;  2IVQ A;  4O8B A;  4JCX A;  1WIZ A;  3G7D A;  2ICP A;  3BD1 A;  2IU7 A;  3DNV B;  3GBF A;  1PER L;  1X2L A;  3LIS A;  3OQO A;  1PRU A;  4X4B A;  2PUC A;  1ZZ9 A;  2XI8 A;  3F6W A;  2OFY A;  1RZS A;  3RZZ A;  2O4A A;  1UTX A;  2LCV A;  2MEZ A;  3TRB A;  1ZZB A;  3PXP A;  4F8D A;  4X4D A;  3HZI B;  1ZS4 A;  3U3W A;  1WET A;  4PU3 C;  2L8N A;  1WH6 A;  2AXV A;  3MLF A;  2KZ8 A;  4YG7 B;  3BS3 A;  2JCG A;  1E3O C;  1AU7 A;  4JQD A;  2PUF A;  2H8R A;  4YBA A;  4JCY A;  1LQC A;  4I6T A;  2O49 A;  1XWR A;  1O4X A;  1JFS A;  2PE5 A;  1PRA A;  3JXB C;  2L49 A;  4MCT A;  1SQ8 A;  3QWG A;  3LFP A;  2FJR A;  1LCD A;  2PUD A;  4I8T A;  1WH8 A;  4YG1 A;  1B0N A;  4GQM A;  4FBI A;  1JFT A;  2XCJ A;  3OMT A;  3OQN A;  2PUG A;  3GN5 A;  2LYL A;  5A7L A;  3BDN A;  1S7E A;  1VPW A;  4OB4 A;  1ZZ8 A;  1X57 A;  3ZHM A;  2PUB A;  3KXA A;  1R69 A;  2EBY A;  3IVP A;  3ZHI A;  3ZKC A;  3QYX A;  4J1W A;  1ZAY A;  2D5V A;  3L1P A;  1R63 A;  1JWL A;  4Z5C A;  1LLI A;  1Y7Y A;  1LMB 3;  3GN5 B;  4Z59 A;  1RZR D;  2GZU A;  2WUS R;  1ADR A;  2HIN A;  1CQT A;  2PUE A;  3B7H A;  2EF8 A;  4X4C A;  4FN3 A;  1LCC A;  2LYP A;  4X4I A;  2KEK A;  2IVG A;  2R63 A;  1DWK A;  2A6C A;  2IVB A;  3KZ3 A;  2AXZ A;  2LYR A;  1NEQ A;  4IA8 A;  4X4F A;  2GRL A;  2IV1 A;  4PU4 C;  1QP4 A;  1DW9 A;  5K98 B;  1IC8 A;  2R1J L;  1PNR A;  3JXC L;  1YSE A;  4I6R A;  1BDI A;  2BNM A;  1JH9 A;  4Y42 A;  2AUW A;  1RIO A;  1GT0 C;  1ZVV A;  3SCF A;  2PIJ A;  2CSF A;  2GRM A;  4YAR A;  2BNN A;  3EUS A;  2KEI A;  1HF0 A;  4Z5D A;  3FYA A;  3JXD L;  1ZZ7 A; 
#chains in the Genus database with same CATH topology
 1RZR A;  5DSX A;  3TFL A;  1QZX A;  2PXP A;  3CRO L;  2JQE A;  2PXF A;  3MEJ A;  2JVL A;  1PRV A;  4MCX A;  1L1M A;  4OBM A;  2XIU A;  1OSL A;  1QQB A;  3SCH A;  3G0T A;  3O9X A;  4X4E A;  3TEP A;  5DTM A;  4X4G A;  3CEC A;  2HSG A;  2XJ3 A;  1CJG A;  3S8Q A;  1ZPQ A;  2ICT A;  3H5T A;  4IWR A;  3DM5 A;  4O8B A;  3G7D A;  4ER5 A;  1X2L A;  3LIS A;  3OQO A;  2LCV A;  3U3W A;  1WET A;  4PU3 C;  2L8N A;  2AXV A;  3BS3 A;  1AU7 A;  3R09 A;  1XWR A;  1O4X A;  1PRA A;  2L49 A;  1SQ8 A;  4Q2J A;  2PXT A;  2PXL A;  4DE9 A;  2HCN A;  2FJR A;  4FBI A;  3OQN A;  2PXB A;  2LYL A;  5A7L A;  3SR4 A;  1DUL A;  2D5V A;  3IVP A;  3QOX A;  1ADR A;  2J7W A;  2L1P A;  1CQT A;  2FFH A;  1LCC A;  2PXQ A;  4IA8 A;  4X4F A;  4PU4 C;  5K98 B;  1JH9 A;  4Y42 A;  2AUW A;  1RIO A;  4ER0 A;  4YAR A;  2PIJ A;  3EUS A;  2KEI A;  3GZC A;  3KL4 A;  2CRO A;  1UXD A;  3FYM A;  2O38 A;  1OCT C;  4Z5H A;  1QP7 A;  5GAG i;  2XSD C;  3VK0 A;  2MQK A;  2PXD A;  3QQ6 A;  2LYK A;  2LYS A;  1UXC A;  2WIU B;  3D1N I;  4NDW A;  3NDB B;  3R1F A;  2KPJ A;  3TEL A;  2AW6 A;  4GHJ A;  2XXA A;  5JUW A;  3QOW A;  4JCX A;  2IU7 A;  2ODR D;  4X4B A;  2XI8 A;  3F6W A;  2OFY A;  2MEZ A;  4ER3 A;  4YG7 B;  2JCG A;  1E3O C;  2PUF A;  2H8R A;  2J7U A;  3NZL A;  3GUU A;  2PE5 A;  5GAH i;  3JXB C;  1WH8 A;  1VPW A;  1S7E A;  3ZKC A;  1ZAY A;  1JWL A;  3GN5 B;  2PUE A;  4X4C A;  2LYP A;  2A6C A;  2AXZ A;  2LYR A;  3OWQ A;  3A9Y A;  2R1J L;  3JXC L;  1YSE A;  4I6R A;  2GRM A;  2LLW A;  4Z5D A;  3JXD L;  1ZZ7 A;  4PU8 A;  1MFQ C;  1RPE L;  1BDH A;  3F52 A;  3G5G A;  4X4H A;  3F51 A;  3FMY A;  2OR1 L;  4Z58 A;  1ZUG A;  2EWT A;  3QF3 A;  2IUO A;  2PPX A;  4J1X A;  2MXD A;  2HFZ A;  3KJX A;  4PU7 A;  4I6U A;  3SX0 A;  2AXU A;  4ER6 A;  1Y9Q A;  1NER A;  2PXU A;  3VWS A;  2BJC A;  2VEO A;  2IVQ A;  1QB2 A;  2ICP A;  3DNV B;  3GBF A;  2O4A A;  1RZS A;  3RZZ A;  2V3C C;  3HZI B;  1ZZB A;  4F8D A;  2PXK A;  3A9X A;  5DT2 A;  4DE8 A;  4JQD A;  3GZD A;  4YBA A;  4JCY A;  4I6T A;  1JFS A;  4MCT A;  3QWG A;  4I8T A;  4WVL A;  2XCJ A;  3OMT A;  4EK9 A;  3GN5 A;  3UWP A;  3QFI A;  1X57 A;  1R69 A;  3ZHI A;  3OKZ A;  3L1P A;  4Z5C A;  1Y7Y A;  2PXE A;  1RZR D;  2GZU A;  2EF8 A;  3KZ3 A;  1NEQ A;  1QP4 A;  2M4H A;  2IV1 A;  1DW9 A;  3NXH A;  3M9L A;  2BNM A;  3A9Z A;  1HF0 A;  2BNN A;  4EZI A;  3ME5 A;  1POU A;  4YG4 A;  2B5A A;  3OQM A;  2LYJ A;  3CLC A;  1QPZ A;  1ZZ6 A;  1NW3 A;  3OP9 A;  2XXQ A;  1ZZC A;  2AWI A;  2PXV A;  2KEJ A;  4EKG A;  5DRY A;  2LYQ A;  5DTQ A;  4IVZ A;  1QP0 A;  3PE5 A;  3UFD A;  2LLV A;  3GZD C;  2BNO A;  3NRO A;  2PUA A;  4ER7 A;  1HQ1 A;  2XXP A;  1EFA A;  1QQA A;  3SCG A;  1WIZ A;  3BD1 A;  1PER L;  1PRU A;  2PUC A;  1ZZ9 A;  1UTX A;  3TRB A;  4X4D A;  3PXP A;  1ZS4 A;  1WH6 A;  3MLF A;  2KZ8 A;  5DRT A;  4EKI A;  1LQC A;  2O49 A;  1U2Z A;  3LFP A;  1LCD A;  2PUD A;  4HRA A;  4YG1 A;  1B0N A;  4GQM A;  1JFT A;  3BDN A;  4EQZ A;  4OB4 A;  1ZZ8 A;  3ZHM A;  2PUB A;  3KXA A;  2EBY A;  3QYX A;  4J1W A;  1R63 A;  1LLI A;  1LMB 3;  2LNM A;  4Z59 A;  2WUS R;  2HIN A;  5DTR A;  3ZPX A;  3B7H A;  3LQX A;  4FN3 A;  4X4I A;  2KEK A;  2IVG A;  2R63 A;  1DWK A;  2IVB A;  2YBD A;  2GRL A;  2HCS A;  1IC8 A;  1PNR A;  1BDI A;  1ZVV A;  1GT0 C;  3SCF A;  2CSF A;  3FYA A;  2PUG A; 
#chains in the Genus database with same CATH homology
 1POU A;  2CRO A;  1UXD A;  4YG4 A;  4PU8 A;  1RZR A;  2B5A A;  3FYM A;  2O38 A;  3OQM A;  1OCT C;  2LYJ A;  4Z5H A;  1RPE L;  1QP7 A;  1BDH A;  3CLC A;  2XSD C;  1QPZ A;  1ZZ6 A;  3CRO L;  3VK0 A;  3OP9 A;  3F52 A;  1ZZC A;  2AWI A;  3G5G A;  2MQK A;  4X4H A;  2JVL A;  1PRV A;  2KEJ A;  3F51 A;  4MCX A;  3FMY A;  1L1M A;  3QQ6 A;  2OR1 L;  2LYK A;  2LYS A;  2LYQ A;  1UXC A;  4IVZ A;  4Z58 A;  2XIU A;  1ZUG A;  2EWT A;  1OSL A;  3QF3 A;  2IUO A;  2WIU B;  3D1N I;  1QQB A;  2PPX A;  4NDW A;  3SCH A;  3O9X A;  3UFD A;  1QP0 A;  4X4E A;  3R1F A;  4J1X A;  4X4G A;  2BNO A;  2KPJ A;  3KJX A;  4PU7 A;  3CEC A;  2HSG A;  2XJ3 A;  2PUA A;  4I6U A;  1CJG A;  3S8Q A;  2AXU A;  1EFA A;  1Y9Q A;  1NER A;  1QQA A;  3SCG A;  1ZPQ A;  2ICT A;  2BJC A;  3H5T A;  4IWR A;  2AW6 A;  4GHJ A;  2IVQ A;  4O8B A;  4JCX A;  1WIZ A;  3G7D A;  2ICP A;  3BD1 A;  2IU7 A;  3DNV B;  3GBF A;  1PER L;  1X2L A;  3LIS A;  3OQO A;  1PRU A;  4X4B A;  2PUC A;  1ZZ9 A;  2XI8 A;  3F6W A;  2OFY A;  1RZS A;  3RZZ A;  2O4A A;  1UTX A;  2LCV A;  2MEZ A;  3TRB A;  1ZZB A;  3PXP A;  4F8D A;  4X4D A;  3HZI B;  1ZS4 A;  3U3W A;  1WET A;  4PU3 C;  2L8N A;  1WH6 A;  2AXV A;  3MLF A;  2KZ8 A;  4YG7 B;  3BS3 A;  2JCG A;  1E3O C;  1AU7 A;  4JQD A;  2PUF A;  2H8R A;  4YBA A;  4JCY A;  1LQC A;  4I6T A;  2O49 A;  1XWR A;  1O4X A;  1JFS A;  2PE5 A;  1PRA A;  3JXB C;  2L49 A;  4MCT A;  1SQ8 A;  3QWG A;  3LFP A;  2FJR A;  1LCD A;  2PUD A;  4I8T A;  1WH8 A;  4YG1 A;  1B0N A;  4GQM A;  4FBI A;  1JFT A;  2XCJ A;  3OMT A;  3OQN A;  2PUG A;  3GN5 A;  2LYL A;  5A7L A;  3BDN A;  1S7E A;  1VPW A;  4OB4 A;  1ZZ8 A;  1X57 A;  3ZHM A;  2PUB A;  3KXA A;  1R69 A;  2EBY A;  3IVP A;  3ZHI A;  3ZKC A;  3QYX A;  4J1W A;  1ZAY A;  2D5V A;  3L1P A;  1R63 A;  1JWL A;  4Z5C A;  1LLI A;  1Y7Y A;  1LMB 3;  3GN5 B;  4Z59 A;  1RZR D;  2GZU A;  2WUS R;  1ADR A;  2HIN A;  1CQT A;  2PUE A;  3B7H A;  2EF8 A;  4X4C A;  4FN3 A;  1LCC A;  2LYP A;  4X4I A;  2KEK A;  2IVG A;  2R63 A;  1DWK A;  2A6C A;  2IVB A;  3KZ3 A;  2AXZ A;  2LYR A;  1NEQ A;  4IA8 A;  4X4F A;  2GRL A;  2IV1 A;  4PU4 C;  1QP4 A;  1DW9 A;  5K98 B;  1IC8 A;  2R1J L;  1PNR A;  3JXC L;  1YSE A;  4I6R A;  1BDI A;  2BNM A;  1JH9 A;  4Y42 A;  2AUW A;  1RIO A;  1GT0 C;  1ZVV A;  3SCF A;  2PIJ A;  2CSF A;  2GRM A;  4YAR A;  2BNN A;  3EUS A;  2KEI A;  1HF0 A;  4Z5D A;  3FYA A;  3JXD L;  1ZZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...