4Z5HA

Hipb(s29a)-o2 20mer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
SFQKIYSPTQLANAMKLVRQQNGWTQAELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism on hipBA gene regulation.
rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Antitoxin HipB
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4z5hA00
3ZHIA 1NERA 1PRVA 2JCGA 2BNMA 3OMTA 3SCGA 4F8DA 1VPWA 3TRBA 2WIUB 3OP9A 2HINA 4Z5DA 1OSLA 1PNRA 1UTXA 4X4EA 1HF0A 2PUEA 2AXZA 2LYLA 2PUBA 3KXAA 1ZZCA 4I8TA 4J1WA 2PIJA 1ZVVA 1BDHA 4I6UA 1ZS4A 2ICPA 3OQMA 2PUCA 4GQMA 1S7EA 2AW6A 1ADRA 1E3OC 4Z5CA 2R1JL 3JXCL 3UFDA 3B7HA 1ZZBA 3G7DA 1Y9QA 2EBYA 2IU7A 4I6RA 4JCYA 3O9XA 5A7LA 1O4XA 3QQ6A 3PXPA 3CROL 1X2LA 2GRLA 3IVPA 3L1PA 2PPXA 2IVGA 2LYPA 2IV1A 3BD1A 2GRMA 3QWGA 4Y42A 4YARA 2KEJA 1IC8A 4Z5HA 3OQOA 2OFYA 2LCVA 2R63A 3GN5A 4MCXA 4PU7A 1QP4A 1QP7A 3OQNA 1DWKA 2L8NA 1RPEL 1AU7A 3EUSA 1JWLA 1JH9A 3F52A 1ZUGA 1QQBA 3JXBC 2XJ3A 2BNOA 3QYXA 2JVLA 1CJGA 4MCTA 1NEQA 2HSGA 2MQKA 3LFPA 4FN3A 2KPJA 3VK0A 4IWRA 2WUSR 3FYAA 4J1XA 2LYKA 2AUWA 2LYQA 1LCDA 3HZIB 2ICTA 4FBIA 2KZ8A 3KZ3A 1PRAA 4PU3C 3JXDL 1WH6A 3F6WA 2IVQA 2XIUA 3BDNA 2PUAA 2KEIA 3GBFA 3G5GA 3LISA 1X57A 1B0NA 2IVBA 2H8RA 4X4DA 4JQDA 3FMYA 3RZZA 3SCFA 2XI8A 4YG7B 2GZUA 1UXDA 4X4FA 4JCXA 1QPZA 4NDWA 1LMB3 2EF8A 2BJCA 4O8BA 2D5VA 1ZZ8A 2O4AA 3R1FA 4PU4C 2MEZA 2PUFA 4X4HA 3MLFA 1QP0A 3U3WA 4OB4A 2OR1L 2O49A 3ZKCA 2XSDC 1QQAA 4Z59A 4IA8A 1R69A 3CLCA 1UXCA 1ZZ9A 1RZRD 2BNNA 1WIZA 1ZZ6A 1LCCA 1DW9A 2CROA 4YG1A 3S8QA 1WETA 1PRUA 1L1MA 3D1NI 1R63A 1ZPQA 4YG4A 1OCTC 1SQ8A 1YSEA 2IUOA 1JFTA 1ZAYA 2EWTA 4IVZA 4GHJA 2B5AA 1RZRA 1RIOA 1LLIA 1LQCA 1POUA 1WH8A 1EFAA 4X4IA 2AXUA 3FYMA 2A6CA 2PUGA 2FJRA 2LYSA 3CECA 3QF3A 3SCHA 1ZZ7A 2KEKA 2LYRA 4Z58A 3ZHMA 2PUDA 1JFSA 1PERL 2O38A 3KJXA 2LYJA 4X4BA 3BS3A 2PE5A 2CSFA 1BDIA 4X4GA 1CQTA 2AWIA 1GT0C 3DNVB 3H5TA 4X4CA 4PU8A 2AXVA 3GN5B 3F51A 2XCJA 4YBAA 1XWRA 4I6TA 1RZSA 2L49A 5K98B 1Y7YA
chains in the Genus database with same CATH superfamily
2JCGA 3OMTA 3KL4A 3TRBA 2HINA 4Z5DA 1OSLA 1PNRA 1ZZCA 4I8TA 5DRYA 1ZVVA 3NXHA 4GQMA 3UFDA 2XXQA 2EBYA 3PXPA 3LQXA 4Y42A 2IV1A 3BD1A 5GAHi 4Z5HA 2LCVA 2PUFA 4HRAA 1NW3A 4MCXA 4PU7A 2PXBA 3OQNA 4EQZA 1JWLA 2VEOA 4MCTA 5JUWA 1NEQA 2PXVA 4EKIA 2WUSR 4J1XA 2LYQA 1LCDA 2ICTA 2KZ8A 4EZIA 2IVQA 2PXEA 3GBFA 1B0NA 2PXDA 2XI8A 2HFZA 2GZUA 4X4FA 4JCXA 2M4HA 4NDWA 1LMB3 2EF8A 2BJCA 2PXKA 2O4AA 4PU4C 3TFLA 4X4HA 1QP0A 2MXDA 4OB4A 2XSDC 4Z59A 1UXCA 3S8QA 1PRUA 4YG4A 3A9XA 1SQ8A 2EWTA 1POUA 2PUGA 2LYSA 3NROA 3SCHA 2O38A 1BDIA 2AWIA 4PU8A 3GN5B 4I6TA 3ZHIA 3SCGA 2BNMA 4F8DA 2PXPA 3OP9A 2L1PA 1UTXA 5DTRA 2AXZA 2PXLA 1BDHA 2ICPA 1ADRA 4JCYA 1O4XA 2IVGA 4YARA 1IC8A 4DE8A 3OQOA 2R63A 1QP4A 1QQBA 3JXBC 2JVLA 3DM5A 2MQKA 2KPJA 3UWPA 5DTMA 4FBIA 3KZ3A 3F6WA 2PUAA 3BDNA 1QB2A 2H8RA 4JQDA 3RZZA 3SCFA 4O8BA 3M9LA 2MEZA 3U3WA 2OR1L 4OBMA 1QQAA 4IA8A 1RZRD 1WIZA 1ZZ6A 1DW9A 2CROA 2FFHA 1ZAYA 4GHJA 2B5AA 1EFAA 2AXUA 3FYMA 3GZDA 4Z58A 1JFSA 3KJXA 2PXTA 2LYJA 4ER5A 4EKGA 2PE5A 2CSFA 4X4GA 3DNVB 4YBAA 2LLVA 1RZSA 3TELA 1NERA 1PRVA 2HCNA 1VPWA 2ODRD 2WIUB 2PUEA 2LYLA 3KXAA 4J1WA 2PIJA 4I6UA 3OQMA 3NDBB 1S7EA 2J7UA 3MEJA 4Z5CA 1HQ1A 3JXCL 1ZZBA 1Y9QA 4I6RA 3O9XA 3CROL 2GRLA 3IVPA 3L1PA 3ZPXA 3ME5A 2OFYA 3GN5A 3CLCA 1QP7A 1RPEL 2L8NA 1AU7A 3EUSA 3A9ZA 1ZUGA 4ER7A 2XJ3A 5GAGi 4FN3A 3LFPA 3VK0A 4IWRA 2LYKA 2AUWA 3HZIB 3R09A 1WH6A 2XIUA 2KEIA 3SR4A 3A9YA 3G5GA 2IVBA 4X4DA 3FMYA 1DULA 4YG7B 1UXDA 2J7WA 5DT2A 1MFQC 3QFIA 1ZZ8A 3VWSA 3R1FA 2PXFA 3OWQA 2O49A 3ZKCA 5DSXA 1R69A 4DE9A 1ZZ9A 1WETA 4YG1A 1L1MA 3D1NI 1R63A 1ZPQA 2PXQA 2IUOA 1JFTA 3TEPA 3GZDC 1RIOA 1LLIA 1LQCA 1WH8A 4Q2JA 2LLWA 2A6CA 3QF3A 2LYRA 3ZHMA 2PUDA 3OKZA 3BS3A 1GT0C 4X4CA 1U2ZA 3F51A 2XCJA 5DTQA 2PXUA 5K98B 3GUUA 4X4EA 1HF0A 2PUBA 2V3CC 1ZS4A 2PUCA 2AW6A 1E3OC 5DRTA 2R1JL 3B7HA 3G7DA 1QZXA 2IU7A 5A7LA 3GZCA 3QQ6A 1X2LA 4WVLA 2PPXA 2LYPA 3QWGA 2GRMA 2KEJA 1DWKA 3QOXA 1JH9A 3F52A 2BNOA 3QYXA 1CJGA 2HSGA 3FYAA 4PU3C 1PRAA 3JXDL 2XXAA 2JQEA 2LNMA 3LISA 1X57A 3SX0A 4ER6A 1QPZA 2D5VA 2XXPA 2YBDA 3NZLA 3MLFA 2BNNA 1LCCA 1OCTC 1YSEA 4ER0A 4IVZA 1RZRA 3PE5A 4X4IA 2HCSA 2FJRA 3CECA 3G0TA 1ZZ7A 2KEKA 1PERL 4X4BA 4ER3A 1CQTA 3H5TA 2AXVA 4EK9A 1XWRA 3QOWA 2L49A 1Y7YA
chains in the Genus database with same CATH topology
3ZHIA 1NERA 1PRVA 2JCGA 2BNMA 3OMTA 3SCGA 4F8DA 1VPWA 3TRBA 2WIUB 3OP9A 2HINA 4Z5DA 1OSLA 1PNRA 1UTXA 4X4EA 1HF0A 2PUEA 2AXZA 2LYLA 2PUBA 3KXAA 1ZZCA 4I8TA 4J1WA 2PIJA 1ZVVA 1BDHA 4I6UA 1ZS4A 2ICPA 3OQMA 2PUCA 4GQMA 1S7EA 2AW6A 1ADRA 1E3OC 4Z5CA 2R1JL 3JXCL 3UFDA 3B7HA 1ZZBA 3G7DA 1Y9QA 2EBYA 2IU7A 4I6RA 4JCYA 3O9XA 5A7LA 1O4XA 3QQ6A 3PXPA 3CROL 1X2LA 2GRLA 3IVPA 3L1PA 2PPXA 2IVGA 2LYPA 2IV1A 3BD1A 2GRMA 3QWGA 4Y42A 4YARA 2KEJA 1IC8A 4Z5HA 3OQOA 2OFYA 2LCVA 2R63A 3GN5A 4MCXA 4PU7A 1QP4A 1QP7A 3OQNA 1DWKA 2L8NA 1RPEL 1AU7A 3EUSA 1JWLA 1JH9A 3F52A 1ZUGA 1QQBA 3JXBC 2XJ3A 2BNOA 3QYXA 2JVLA 1CJGA 4MCTA 1NEQA 2HSGA 2MQKA 3LFPA 4FN3A 2KPJA 3VK0A 4IWRA 2WUSR 3FYAA 4J1XA 2LYKA 2AUWA 2LYQA 1LCDA 3HZIB 2ICTA 4FBIA 2KZ8A 3KZ3A 1PRAA 4PU3C 3JXDL 1WH6A 3F6WA 2IVQA 2XIUA 3BDNA 2PUAA 2KEIA 3GBFA 3G5GA 3LISA 1X57A 1B0NA 2IVBA 2H8RA 4X4DA 4JQDA 3FMYA 3RZZA 3SCFA 2XI8A 4YG7B 2GZUA 1UXDA 4X4FA 4JCXA 1QPZA 4NDWA 1LMB3 2EF8A 2BJCA 4O8BA 2D5VA 1ZZ8A 2O4AA 3R1FA 4PU4C 2MEZA 2PUFA 4X4HA 3MLFA 1QP0A 3U3WA 4OB4A 2OR1L 2O49A 3ZKCA 2XSDC 1QQAA 4Z59A 4IA8A 1R69A 3CLCA 1UXCA 1ZZ9A 1RZRD 2BNNA 1WIZA 1ZZ6A 1LCCA 1DW9A 2CROA 4YG1A 3S8QA 1WETA 1PRUA 1L1MA 3D1NI 1R63A 1ZPQA 4YG4A 1OCTC 1SQ8A 1YSEA 2IUOA 1JFTA 1ZAYA 2EWTA 4IVZA 4GHJA 2B5AA 1RZRA 1RIOA 1LLIA 1LQCA 1POUA 1WH8A 1EFAA 4X4IA 2AXUA 3FYMA 2A6CA 2PUGA 2FJRA 2LYSA 3CECA 3QF3A 3SCHA 1ZZ7A 2KEKA 2LYRA 4Z58A 3ZHMA 2PUDA 1JFSA 1PERL 2O38A 3KJXA 2LYJA 4X4BA 3BS3A 2PE5A 2CSFA 1BDIA 4X4GA 1CQTA 2AWIA 1GT0C 3DNVB 3H5TA 4X4CA 4PU8A 2AXVA 3GN5B 3F51A 2XCJA 4YBAA 1XWRA 4I6TA 1RZSA 2L49A 5K98B 1Y7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHI A;  1NER A;  1PRV A;  2JCG A;  2BNM A;  3OMT A;  3SCG A;  4F8D A;  1VPW A;  3TRB A;  2WIU B;  3OP9 A;  2HIN A;  4Z5D A;  1OSL A;  1PNR A;  1UTX A;  4X4E A;  1HF0 A;  2PUE A;  2AXZ A;  2LYL A;  2PUB A;  3KXA A;  1ZZC A;  4I8T A;  4J1W A;  2PIJ A;  1ZVV A;  1BDH A;  4I6U A;  1ZS4 A;  2ICP A;  3OQM A;  2PUC A;  4GQM A;  1S7E A;  2AW6 A;  1ADR A;  1E3O C;  4Z5C A;  2R1J L;  3JXC L;  3UFD A;  3B7H A;  1ZZB A;  3G7D A;  1Y9Q A;  2EBY A;  2IU7 A;  4I6R A;  4JCY A;  3O9X A;  5A7L A;  1O4X A;  3QQ6 A;  3PXP A;  3CRO L;  1X2L A;  2GRL A;  3IVP A;  3L1P A;  2PPX A;  2IVG A;  2LYP A;  2IV1 A;  3BD1 A;  2GRM A;  3QWG A;  4Y42 A;  4YAR A;  2KEJ A;  1IC8 A;  4Z5H A;  3OQO A;  2OFY A;  2LCV A;  2R63 A;  3GN5 A;  4MCX A;  4PU7 A;  1QP4 A;  1QP7 A;  3OQN A;  1DWK A;  2L8N A;  1RPE L;  1AU7 A;  3EUS A;  1JWL A;  1JH9 A;  3F52 A;  1ZUG A;  1QQB A;  3JXB C;  2XJ3 A;  2BNO A;  3QYX A;  2JVL A;  1CJG A;  4MCT A;  1NEQ A;  2HSG A;  2MQK A;  3LFP A;  4FN3 A;  2KPJ A;  3VK0 A;  4IWR A;  2WUS R;  3FYA A;  4J1X A;  2LYK A;  2AUW A;  2LYQ A;  1LCD A;  3HZI B;  2ICT A;  4FBI A;  2KZ8 A;  3KZ3 A;  1PRA A;  4PU3 C;  3JXD L;  1WH6 A;  3F6W A;  2IVQ A;  2XIU A;  3BDN A;  2PUA A;  2KEI A;  3GBF A;  3G5G A;  3LIS A;  1X57 A;  1B0N A;  2IVB A;  2H8R A;  4X4D A;  4JQD A;  3FMY A;  3RZZ A;  3SCF A;  2XI8 A;  4YG7 B;  2GZU A;  1UXD A;  4X4F A;  4JCX A;  1QPZ A;  4NDW A;  1LMB 3;  2EF8 A;  2BJC A;  4O8B A;  2D5V A;  1ZZ8 A;  2O4A A;  3R1F A;  4PU4 C;  2MEZ A;  2PUF A;  4X4H A;  3MLF A;  1QP0 A;  3U3W A;  4OB4 A;  2OR1 L;  2O49 A;  3ZKC A;  2XSD C;  1QQA A;  4Z59 A;  4IA8 A;  1R69 A;  3CLC A;  1UXC A;  1ZZ9 A;  1RZR D;  2BNN A;  1WIZ A;  1ZZ6 A;  1LCC A;  1DW9 A;  2CRO A;  4YG1 A;  3S8Q A;  1WET A;  1PRU A;  1L1M A;  3D1N I;  1R63 A;  1ZPQ A;  4YG4 A;  1OCT C;  1SQ8 A;  1YSE A;  2IUO A;  1JFT A;  1ZAY A;  2EWT A;  4IVZ A;  4GHJ A;  2B5A A;  1RZR A;  1RIO A;  1LLI A;  1LQC A;  1POU A;  1WH8 A;  1EFA A;  4X4I A;  2AXU A;  3FYM A;  2A6C A;  2PUG A;  2FJR A;  2LYS A;  3CEC A;  3QF3 A;  3SCH A;  1ZZ7 A;  2KEK A;  2LYR A;  4Z58 A;  3ZHM A;  2PUD A;  1JFS A;  1PER L;  2O38 A;  3KJX A;  2LYJ A;  4X4B A;  3BS3 A;  2PE5 A;  2CSF A;  1BDI A;  4X4G A;  1CQT A;  2AWI A;  1GT0 C;  3DNV B;  3H5T A;  4X4C A;  4PU8 A;  2AXV A;  3GN5 B;  3F51 A;  2XCJ A;  4YBA A;  1XWR A;  4I6T A;  1RZS A;  2L49 A;  5K98 B;  1Y7Y A; 
#chains in the Genus database with same CATH topology
 2JCG A;  3OMT A;  3KL4 A;  3TRB A;  2HIN A;  4Z5D A;  1OSL A;  1PNR A;  1ZZC A;  4I8T A;  5DRY A;  1ZVV A;  3NXH A;  4GQM A;  3UFD A;  2XXQ A;  2EBY A;  3PXP A;  3LQX A;  4Y42 A;  2IV1 A;  3BD1 A;  5GAH i;  4Z5H A;  2LCV A;  2PUF A;  4HRA A;  1NW3 A;  4MCX A;  4PU7 A;  2PXB A;  3OQN A;  4EQZ A;  1JWL A;  2VEO A;  4MCT A;  5JUW A;  1NEQ A;  2PXV A;  4EKI A;  2WUS R;  4J1X A;  2LYQ A;  1LCD A;  2ICT A;  2KZ8 A;  4EZI A;  2IVQ A;  2PXE A;  3GBF A;  1B0N A;  2PXD A;  2XI8 A;  2HFZ A;  2GZU A;  4X4F A;  4JCX A;  2M4H A;  4NDW A;  1LMB 3;  2EF8 A;  2BJC A;  2PXK A;  2O4A A;  4PU4 C;  3TFL A;  4X4H A;  1QP0 A;  2MXD A;  4OB4 A;  2XSD C;  4Z59 A;  1UXC A;  3S8Q A;  1PRU A;  4YG4 A;  3A9X A;  1SQ8 A;  2EWT A;  1POU A;  2PUG A;  2LYS A;  3NRO A;  3SCH A;  2O38 A;  1BDI A;  2AWI A;  4PU8 A;  3GN5 B;  4I6T A;  3ZHI A;  3SCG A;  2BNM A;  4F8D A;  2PXP A;  3OP9 A;  2L1P A;  1UTX A;  5DTR A;  2AXZ A;  2PXL A;  1BDH A;  2ICP A;  1ADR A;  4JCY A;  1O4X A;  2IVG A;  4YAR A;  1IC8 A;  4DE8 A;  3OQO A;  2R63 A;  1QP4 A;  1QQB A;  3JXB C;  2JVL A;  3DM5 A;  2MQK A;  2KPJ A;  3UWP A;  5DTM A;  4FBI A;  3KZ3 A;  3F6W A;  2PUA A;  3BDN A;  1QB2 A;  2H8R A;  4JQD A;  3RZZ A;  3SCF A;  4O8B A;  3M9L A;  2MEZ A;  3U3W A;  2OR1 L;  4OBM A;  1QQA A;  4IA8 A;  1RZR D;  1WIZ A;  1ZZ6 A;  1DW9 A;  2CRO A;  2FFH A;  1ZAY A;  4GHJ A;  2B5A A;  1EFA A;  2AXU A;  3FYM A;  3GZD A;  4Z58 A;  1JFS A;  3KJX A;  2PXT A;  2LYJ A;  4ER5 A;  4EKG A;  2PE5 A;  2CSF A;  4X4G A;  3DNV B;  4YBA A;  2LLV A;  1RZS A;  3TEL A;  1NER A;  1PRV A;  2HCN A;  1VPW A;  2ODR D;  2WIU B;  2PUE A;  2LYL A;  3KXA A;  4J1W A;  2PIJ A;  4I6U A;  3OQM A;  3NDB B;  1S7E A;  2J7U A;  3MEJ A;  4Z5C A;  1HQ1 A;  3JXC L;  1ZZB A;  1Y9Q A;  4I6R A;  3O9X A;  3CRO L;  2GRL A;  3IVP A;  3L1P A;  3ZPX A;  3ME5 A;  2OFY A;  3GN5 A;  3CLC A;  1QP7 A;  1RPE L;  2L8N A;  1AU7 A;  3EUS A;  3A9Z A;  1ZUG A;  4ER7 A;  2XJ3 A;  5GAG i;  4FN3 A;  3LFP A;  3VK0 A;  4IWR A;  2LYK A;  2AUW A;  3HZI B;  3R09 A;  1WH6 A;  2XIU A;  2KEI A;  3SR4 A;  3A9Y A;  3G5G A;  2IVB A;  4X4D A;  3FMY A;  1DUL A;  4YG7 B;  1UXD A;  2J7W A;  5DT2 A;  1MFQ C;  3QFI A;  1ZZ8 A;  3VWS A;  3R1F A;  2PXF A;  3OWQ A;  2O49 A;  3ZKC A;  5DSX A;  1R69 A;  4DE9 A;  1ZZ9 A;  1WET A;  4YG1 A;  1L1M A;  3D1N I;  1R63 A;  1ZPQ A;  2PXQ A;  2IUO A;  1JFT A;  3TEP A;  3GZD C;  1RIO A;  1LLI A;  1LQC A;  1WH8 A;  4Q2J A;  2LLW A;  2A6C A;  3QF3 A;  2LYR A;  3ZHM A;  2PUD A;  3OKZ A;  3BS3 A;  1GT0 C;  4X4C A;  1U2Z A;  3F51 A;  2XCJ A;  5DTQ A;  2PXU A;  5K98 B;  3GUU A;  4X4E A;  1HF0 A;  2PUB A;  2V3C C;  1ZS4 A;  2PUC A;  2AW6 A;  1E3O C;  5DRT A;  2R1J L;  3B7H A;  3G7D A;  1QZX A;  2IU7 A;  5A7L A;  3GZC A;  3QQ6 A;  1X2L A;  4WVL A;  2PPX A;  2LYP A;  3QWG A;  2GRM A;  2KEJ A;  1DWK A;  3QOX A;  1JH9 A;  3F52 A;  2BNO A;  3QYX A;  1CJG A;  2HSG A;  3FYA A;  4PU3 C;  1PRA A;  3JXD L;  2XXA A;  2JQE A;  2LNM A;  3LIS A;  1X57 A;  3SX0 A;  4ER6 A;  1QPZ A;  2D5V A;  2XXP A;  2YBD A;  3NZL A;  3MLF A;  2BNN A;  1LCC A;  1OCT C;  1YSE A;  4ER0 A;  4IVZ A;  1RZR A;  3PE5 A;  4X4I A;  2HCS A;  2FJR A;  3CEC A;  3G0T A;  1ZZ7 A;  2KEK A;  1PER L;  4X4B A;  4ER3 A;  1CQT A;  3H5T A;  2AXV A;  4EK9 A;  1XWR A;  3QOW A;  2L49 A;  1Y7Y A; 
#chains in the Genus database with same CATH homology
 3ZHI A;  1NER A;  1PRV A;  2JCG A;  2BNM A;  3OMT A;  3SCG A;  4F8D A;  1VPW A;  3TRB A;  2WIU B;  3OP9 A;  2HIN A;  4Z5D A;  1OSL A;  1PNR A;  1UTX A;  4X4E A;  1HF0 A;  2PUE A;  2AXZ A;  2LYL A;  2PUB A;  3KXA A;  1ZZC A;  4I8T A;  4J1W A;  2PIJ A;  1ZVV A;  1BDH A;  4I6U A;  1ZS4 A;  2ICP A;  3OQM A;  2PUC A;  4GQM A;  1S7E A;  2AW6 A;  1ADR A;  1E3O C;  4Z5C A;  2R1J L;  3JXC L;  3UFD A;  3B7H A;  1ZZB A;  3G7D A;  1Y9Q A;  2EBY A;  2IU7 A;  4I6R A;  4JCY A;  3O9X A;  5A7L A;  1O4X A;  3QQ6 A;  3PXP A;  3CRO L;  1X2L A;  2GRL A;  3IVP A;  3L1P A;  2PPX A;  2IVG A;  2LYP A;  2IV1 A;  3BD1 A;  2GRM A;  3QWG A;  4Y42 A;  4YAR A;  2KEJ A;  1IC8 A;  4Z5H A;  3OQO A;  2OFY A;  2LCV A;  2R63 A;  3GN5 A;  4MCX A;  4PU7 A;  1QP4 A;  1QP7 A;  3OQN A;  1DWK A;  2L8N A;  1RPE L;  1AU7 A;  3EUS A;  1JWL A;  1JH9 A;  3F52 A;  1ZUG A;  1QQB A;  3JXB C;  2XJ3 A;  2BNO A;  3QYX A;  2JVL A;  1CJG A;  4MCT A;  1NEQ A;  2HSG A;  2MQK A;  3LFP A;  4FN3 A;  2KPJ A;  3VK0 A;  4IWR A;  2WUS R;  3FYA A;  4J1X A;  2LYK A;  2AUW A;  2LYQ A;  1LCD A;  3HZI B;  2ICT A;  4FBI A;  2KZ8 A;  3KZ3 A;  1PRA A;  4PU3 C;  3JXD L;  1WH6 A;  3F6W A;  2IVQ A;  2XIU A;  3BDN A;  2PUA A;  2KEI A;  3GBF A;  3G5G A;  3LIS A;  1X57 A;  1B0N A;  2IVB A;  2H8R A;  4X4D A;  4JQD A;  3FMY A;  3RZZ A;  3SCF A;  2XI8 A;  4YG7 B;  2GZU A;  1UXD A;  4X4F A;  4JCX A;  1QPZ A;  4NDW A;  1LMB 3;  2EF8 A;  2BJC A;  4O8B A;  2D5V A;  1ZZ8 A;  2O4A A;  3R1F A;  4PU4 C;  2MEZ A;  2PUF A;  4X4H A;  3MLF A;  1QP0 A;  3U3W A;  4OB4 A;  2OR1 L;  2O49 A;  3ZKC A;  2XSD C;  1QQA A;  4Z59 A;  4IA8 A;  1R69 A;  3CLC A;  1UXC A;  1ZZ9 A;  1RZR D;  2BNN A;  1WIZ A;  1ZZ6 A;  1LCC A;  1DW9 A;  2CRO A;  4YG1 A;  3S8Q A;  1WET A;  1PRU A;  1L1M A;  3D1N I;  1R63 A;  1ZPQ A;  4YG4 A;  1OCT C;  1SQ8 A;  1YSE A;  2IUO A;  1JFT A;  1ZAY A;  2EWT A;  4IVZ A;  4GHJ A;  2B5A A;  1RZR A;  1RIO A;  1LLI A;  1LQC A;  1POU A;  1WH8 A;  1EFA A;  4X4I A;  2AXU A;  3FYM A;  2A6C A;  2PUG A;  2FJR A;  2LYS A;  3CEC A;  3QF3 A;  3SCH A;  1ZZ7 A;  2KEK A;  2LYR A;  4Z58 A;  3ZHM A;  2PUD A;  1JFS A;  1PER L;  2O38 A;  3KJX A;  2LYJ A;  4X4B A;  3BS3 A;  2PE5 A;  2CSF A;  1BDI A;  4X4G A;  1CQT A;  2AWI A;  1GT0 C;  3DNV B;  3H5T A;  4X4C A;  4PU8 A;  2AXV A;  3GN5 B;  3F51 A;  2XCJ A;  4YBA A;  1XWR A;  4I6T A;  1RZS A;  2L49 A;  5K98 B;  1Y7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...