4Z5TB

The nucleosome containing human h3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tB00
5GT3D 3WA9B 5AV5C 1P3AA 4X23A 5CP6D 1P3GA 1ID3B 1M19B 1BH9A 3AZIA 2F8NH 1P3FD 2NQBD 5CPIB 2CV5A 4HGAB 4QLCD 1P3MC 1F66C 3W97D 2F8NA 3REHC 1JFIA 3X1UD 3UTAB 2BYKA 1P3OC 2NZDB 4KHAA 5B2JA 4KGCB 4EO5C 2CV5D 3AV2C 4Z2MH 1AOIA 1ULYA 2F8ND 5GSUA 3MGQA 2HUEC 3MGSA 1HQ3C 5B32C 3MGRC 1U35C 5B1MC 5G49B 3AZND 3WAAD 2BYMA 3AN2C 4J8XB 4CSRA 3UTBA 3REIB 5AVBB 4YM6A 4XUJB 5F99A 5GSUD 3AYWA 5AY8A 3MGQD 1EQZB 3MGPC 3B6GB 4H9NA 3AV1C 1KX5A 3AZKA 1ZLAB 5E5AC 3TU4C 5JRGD 4CAYB 1KX4C 2YFVA 5BNVA 3MVDD 4H9RB 2YFWA 1P3MA 1F66A 1KX5D 3AZKD 4E44A 5KDMB 3REHA 3W98D 3KWQB 1M1AB 4J8UB 1P3OA 3MNNC 1P3KD 1TZYC 4Z66D 3W99B 3X1VA 4J8WB 1N1JB 3AV2A 4NE3A 1TAFB 3VH5A 3X1TB 2F8NK 3VH5T 5B33D 1S32D 3UT9B 5B31D 1P3OD 5B0YB 4XZQB 5FUGB 5B32A 3MGRA 5B1MA 5B40B 3REJB 3AZFC 1P3BB 3X1VD 2HIOC 3AV2D 5GT3C 5B2JB 1P34B 5CP6C 1KX3D 3NQUA 3C1BD 4G91B 2FJ7B 3MGPA 5B31G 3AV1A 1P3FC 2NQBC 3AFAB 4QLCC 5E5AA 3TU4A 3W97C 3X1SC 2JSSA 5BO0A 3LZ1A 3KUYB 3RELD 4ZBJC 3X1UC 4H9QA 4KUDB 3KXBB 4E45A 3AZLB 3AV1D 5BS7C 5AV8A 5AV9D 4M6BA 3C1CB 3NQJB 3A6NC 3MNNA 3VH6W 3WTPD 3LZ1D 3LELB 1TZYA 5AV5B 3AZNC 1M19D 3WAAC 5AV8D 3B0CW 3MNND 3AZJA 1P3IA 3W96A 1TZYD 3AZFA 3REHB 2HIOA 5GT3A 3AZMB 4YS3A 3O62B 5CP6A 5JRGC 5B24C 2NZDD 5B0ZB 4KGCD 1P3FA 3B0BA 4WNNB 2NQBA 3MVDC 3AZJD 1P3ID 3W96D 3V9RB 5GXQA 2HUEB 2HIOD 4ZUXC 3X1SA 3AZKC 1HQ3B 3REKB 1U35B 4YS3D 3W98C 4WU9B 3X1UA 4WZSB 4J8VD 3AN2B 4G92C 1P3KC 5C3IB 5JA4B 4Z66C 1B6WA 5BS7A 3LZ0B 4JJNB 1WWSA 5GT0C 5GXQD 4WU8B 5AVBD 5DNNB 3X1SD 3A6NA 5B33C 1S32C 5AV6C 3AZHC 3B6FA 5B31C 2AROB 5DNMA 3R45A 1KX4B 5AVCB 3AZNA 1H3OB 3WAAA 3X1VC 3A6ND 3LJAB 3AZGA 1KX3C 3C1BC 3WKJB 3AZEB 3B6FD 4LD9B 5DNMD 5B1LB 5CPJB 1M1AD 5JRGA 5B24A 3RELC 3AZGD 1P3LB 3MVDA 1BH8B 5B2IC 3X1TD 4ZUXA 1P3PB 4UUZA 5AV9C 4WV4B 3W98A 5B0YD 5B24D 5B40D 1P3KA 3WTPC 3LZ1C 4Z66A 4H9PA 3WA9C 5BNXA 5GT0A 1ID3C 4ZUXD 1M18B 1M19C 5AV8C 2FJ7D 5B33A 1S32A 5AV6A 3AZHA 4QLCB 5CPIC 3W97B 4R8PB 5B31A 4HGAC 1P3AB 4X23B 4ZBJB 1P3GB 5GT0D 1BH9B 3AZIB 3UTAC 4KUDD 1KX3A 4H9OA 3C1BA 2NZDC 2CV5B 5AV6D 3AZHD 4KGCC 2F8NB 3AZJC 1P3IC 3W96C 3C1CD 1JFIB 2BYKB 3LELD 4AWLC 3RELA 4DRBA 4KHAB 4YS3C 1KU5A 4J8VC 5B2IA 1AOIB 2L5AA 4J8XC 5AV9A 5GSUB 3MGQB 5GXQC 3REIC 5AVBC 3MGSB 5CPKA 3WTPA 1EQZC 3B6GC 2RVQC 1B67A 2BYMB 3WA9A 5B2ID 4Z5TD 4CSRB 3O62D 3UTBB 1ID3A 1M19A 4YM6B 3AYWB 5F99B 5AY8B 2PYOD 5CPIA 4H9NB 5CPKD 1KX5B 3AZKB 3B6FC 5DNMC 3WA9D 3REKD 2YFVB 1P3KB 3KWQC 1ID3D 1M1AC 3UTAA 4H9SC 4J8UC 5BNVB 2NZDA 2YFWB 4KGCA 3W99C 5CPID 1P3MB 1F66B 3LZ0D 4J8WC 3AZGC 4WU8D 3X1TC 3VH5W 1P3OB 1Q9CA 5BT1C 3UTAD 3UT9C 2AROD 5B0YC 4EO5B 4XZQC 3X1VB 4J8VA 3AV2B 3REJC 5B40C 5G49A 4J8XA 3B0DC 3C1BB 3REIA 1P34C 5AVBA 1EQZA 5B32B 3MGRB 2FJ7C 3B6GA 5B1MB 3WKJD 4LD9D 5B1LD 1ZLAA 4J8XD 4CAYA 3NQUB 3KUYC 3REID 3MGPB 4XUJD 1P3LD 4KUDC 3AV1B 4H9RA 1EQZD 3KXBC 3B6GD 3AZLC 2RVQD 5E5AB 3TU4B 5KDMA 1ZLAD 5BO0B 3LZ1B 3KWQA 3C1CC 1M1AA 4H9SA 4J8UA 4H9QB 3LELC 3W99A 2LY8A 4J8WA 1N1JA 5AV8B 1TAFA 1M18D 3X1TA 3MNNB 3KWQD 1R4VA 1TZYB 3UT9A 4R8PD 4J8UD 5B0YA 4XZQA 5FUGA 3REJA 5B40A 1P3BA 3W99D 1P3AD 4X23D 4J8WD 1P3GD 3AZID 4Z5TC 3AZMC 4NE6A 3O62C 1P34A 2FJ7A 5CHLB 5BT1D 5B0ZC 3AZJB 3UT9D 1P3IB 3AZFB 3W96B 2PYOC 4XZQD 2HIOB 5CPKC 3REJD 5GT3B 4AWLB 1P3BD 3AFAA 4YS3B 2IO5C 5CP6B 3KUYA 3REKC 4J8VB 5B2JD 1P34D 4WU9C 4KUDA 1P3FB 2NQBB 3KXBA 3AZLA 1AOID 5C3IC 5GXQB 1A7WA 3LZ0C 2F8NG 4JJNC 3X1SB 3AFAD 4WU8C 3C1CA 5DNNC 3NQJA 3MGSD 3X1UB 3KUYD 3LELA 5AV5A 2AROC 3KXBD 3AZLD 5AVCC 3UTBD 1HTAA 4YM6D 3VH6A 5F99D 3A6NB 3VH6T 3AYWD 5AY8D 4Z2MG 3LJAC 3B6FB 5DNMB 3R45B 3WKJC 5AV5D 3AZEC 3AZNB 4LD9C 4DRAA 3B0CT 5B1LC 3WAAB 5CPJC 4Z5TA 3AZMA 3O62A 3AZGB 5B0ZA 1P3MD 1F66D 4WNNA 2PYOA 4XUJC 1P3LC 3V9RA 3REHD 1P3PC 1HQ3A 4NFTA 5B24B 5JRGB 3REKA 1U35A 3AZMD 1ZLAC 4WU9A 3AN2A 3B0DB 3MVDB 5B0ZD 5JA4A 3LZ0A 4ZUXB 4JJNA 4UUZB 4WU8A 5DNNA 1M18C 3W98B 3WTPE 1HQ3D 5B32D 3MGRD 1U35D 5B1MD 4G92B 4WU9D 4Z66B 4H9PB 4R8PC 3AN2D 2AROA 1KX4A 1F1EA 5AVCA 2CWEA 5BNXB 5GT0B 1H3OA 1P3AC 4X23C 1P3GC 4JJND 3MGPD 5DNND 5B33B 3AZIC 1S32B 5AV6B 3LJAA 3AZHB 5B32G 5B31B 2CV5C 3WKJA 3AZEA 5E5AD 3TU4D 4LD9A 5B1LA 1KX4D 5AVCD 5CPJA 1P3BC 1KX3B 4H9OB 5B2JC 3LJAD 1WWIA 4XUJA 1P3LA 1BH8A 4G91C 3AZED 1AOIC 1P3PA 5CPJD 5GSUC 3MGQC 3AFAC 3RELB 3MGSC 4NE5A 5B2IB 4Z5TB 1BFMA 5AV9B 3UTBC 1P3PD 1M18A 2PYOB 4YM6C 3AYWC 5F99C 5CPKB 5AY8C 3KSYA 3WTPB 3AZFD 3W97A 4QLCA 4R8PA 2IO5B 1KX5C
chains in the Genus database with same CATH superfamily
5GT3D 1W2EA 3WA9B 5AV5C 1P3AA 2W8SA 5CP6D 4X23A 1P3GA 1M19B 1ID3B 1BH9A 3AZIA 2F8NH 1P3FD 2NQBD 5CPIB 2CV5A 4HGAB 4QLCD 2Y2OA 4DQYB 1P3MC 1F66C 3W97D 2F8NA 3REHC 1JFIA 3X1UD 3UTAB 2BYKA 1P3OC 2NZDB 4KHAA 5B2JA 4KGCB 4EO5C 2CV5D 3AV2C 4Z2MH 1AOIA 3FDDA 1ULYA 2F8ND 5GSUA 3MGQA 2HUEC 3MGSA 1HQ3C 5B32C 3MGRC 1U35C 5B1MC 5G49B 3AZND 3WAAD 2BYMA 3AN2C 4J8XB 4CSRA 3UTBA 3REIB 1PZRA 5AVBB 4YM6A 4XUJB 5F99A 5GSUD 3AYWA 5AY8A 3MGQD 1EQZB 3MGPC 3B6GB 4H9NA 3AV1C 1KX5A 3AZKA 2Y2NA 1ZLAB 5E5AC 3TU4C 5JRGD 4CAYB 1KX4C 2YFVA 5BNVA 3MVDD 2ZM5A 4H9RB 2YFWA 1P3MA 3H0MC 1F66A 1KX5D 3AZKD 2XD5A 3A1KA 4E44A 5KDMB 3REHA 3W98D 3KWQB 2Y2MA 1M1AB 4J8UB 1P3OA 3MNNC 1P3KD 1TZYC 4Z66D 3W99B 3X1VA 4J8WB 1N1JB 3AV2A 4NE3A 1TAFB 3VH5A 3X1TB 2F8NK 3VH5T 5B33D 1S32D 3UT9B 5B31D 1P3OD 5B0YB 4XZQB 5FUGB 5B32A 3MGRA 5B1MA 5B40B 3H0LC 3REJB 3AZFC 1P3BB 3X1VD 2HIOC 3AV2D 5GT3C 5B2JB 1P34B 5CP6C 1KX3D 3NQUA 3C1BD 2JCHA 4G91B 2FJ7B 2Y2KA 3MGPA 5B31G 3AV1A 1P3FC 2NQBC 3AFAB 4QLCC 5E5AA 3TU4A 3W97C 3X1SC 2JSSA 5BO0A 3LZ1A 3KUYB 3RELD 4ZBJC 3X1UC 4H9QA 4KUDB 1T3UA 3KXBB 4E45A 3AZLB 2FFFB 3AV1D 5BS7C 5AV8A 5AV9D 4M6BA 3C1CB 3NQJB 3A6NC 3MNNA 3VH6W 3WTPD 3LZ1D 3LELB 1TZYA 5AV5B 3AZNC 1M19D 3WAAC 5AV8D 3B0CW 3MNND 3AZJA 1P3IA 3W96A 1TZYD 3AZFA 3REHB 2HIOA 5GT3A 3AZMB 4YS3A 3O62B 5CP6A 5JRGC 5B24C 2NZDD 5B0ZB 4KGCD 1P3FA 3B0BA 4WNNB 2NQBA 3MVDC 3AZJD 1P3ID 3W96D 3V9RB 5GXQA 2HUEB 2HIOD 4ZUXC 3X1SA 2Y2JA 3AZKC 1HQ3B 3REKB 1U35B 4YS3D 3W98C 4WU9B 3EPJA 3X1UA 4WZSB 4J8VD 3AN2B 4G92C 1P3KC 5C3IB 5JA4B 4Z66C 1B6WA 5BS7A 3LZ0B 4JJNB 3F6TA 1WWSA 5GT0C 5GXQD 4WU8B 5AVBD 5DNNB 3X1SD 3A6NA 5B33C 1S32C 5AV6C 3AZHC 3B6FA 5B31C 2AROB 5DNMA 3R45A 1KX4B 3EPHA 5AVCB 3AZNA 1H3OB 3WAAA 3X1VC 3A6ND 3LJAB 3AZGA 1KX3C 3C1BC 3WKJB 3AZEB 3B6FD 4LD9B 5DNMD 5B1LB 2BG1A 5CPJB 1M1AD 5JRGA 5B24A 3RELC 3AZGD 1P3LB 3MVDA 1BH8B 5B2IC 3X1TD 4ZUXA 1P3PB 4UUZA 5AV9C 4WV4B 3W98A 5B0YD 5B24D 2ZY5A 5B40D 1P3KA 3WTPC 3LZ1C 4Z66A 4H9PA 3WA9C 5BNXA 5GT0A 1ID3C 4ZUXD 1M18B 1M19C 5AV8C 2FJ7D 5B33A 1S32A 3IP4C 5AV6A 3AZHA 4QLCB 5CPIC 3W97B 4R8PB 5B31A 4HGAC 1P3AB 4X23B 4ZBJB 1P3GB 5GT0D 1BH9B 3AZIB 3UTAC 4KUDD 1KX3A 4H9OA 3C1BA 2NZDC 2CV5B 5AV6D 3AZHD 2DF4C 4KGCC 2F8NB 3AZJC 1P3IC 3W96C 2ZY2A 3C1CD 1JFIB 2BYKB 3LELD 4AWLC 3RELA 4DRBA 4KHAB 4YS3C 1KU5A 4J8VC 5B2IA 1AOIB 2L5AA 4J8XC 5AV9A 5GSUB 3MGQB 5GXQC 3REIC 5AVBC 3MGSB 5CPKA 2Y2HA 3WTPA 1EQZC 3B6GC 2RVQC 1B67A 2BYMB 3WA9A 5B2ID 4Z5TD 4CSRB 3O62D 3UTBB 1ID3A 1M19A 2F2AC 4YM6B 3AYWB 5F99B 5AY8B 2PYOD 5CPIA 4H9NB 5CPKD 1KX5B 3AZKB 3B6FC 5DNMC 3WA9D 3REKD 2YFVB 1P3KB 3KWQC 1ID3D 1M1AC 3UTAA 4H9SC 4J8UC 5BNVB 2NZDA 2YFWB 4KGCA 3W99C 5CPID 2Y2QA 1P3MB 3LZ0D 1F66B 4J8WC 3AZGC 4WU8D 2G5IC 2ZY4A 4UPKA 3X1TC 3VH5W 1P3OB 1Q9CA 5BT1C 3UTAD 3UT9C 2AROD 5B0YC 4EO5B 4XZQC 3X1VB 4J8VA 3AV2B 3REJC 5B40C 5G49A 4J8XA 3B0DC 3C1BB 3REIA 1P34C 5AVBA 1EQZA 5B32B 3MGRB 2FJ7C 3B6GA 5B1MB 3WKJD 4LD9D 5B1LD 3P5JB 1ZLAA 4J8XD 4CAYA 3NQUB 3KUYC 3REID 3MGPB 4XUJD 1P3LD 4KUDC 3AV1B 3AL0C 4H9RA 1EQZD 2Y2IA 3KXBC 3B6GD 3AZLC 2RVQD 5E5AB 3TU4B 5KDMA 2Y2PA 1ZLAD 5BO0B 3LZ1B 3KWQA 3C1CC 1M1AA 4H9SA 4J8UA 2G5HC 4H9QB 3LELC 3W99A 2LY8A 4J8WA 1N1JA 5AV8B 1TAFA 1M18D 3X1TA 2J8PA 3MNNB 3KWQD 1R4VA 1TZYB 3UT9A 4R8PD 4J8UD 5B0YA 4XZQA 5FUGA 3REJA 5B40A 1P3BA 3W99D 1P3AD 4X23D 4J8WD 1P3GD 3AZID 3EG5B 4Z5TC 4NE6A 3O62C 3AZMC 1P34A 2FJ7A 5CHLB 5BT1D 5B0ZC 3AZJB 3UT9D 1P3IB 3AZFB 3W96B 2PYOC 4XZQD 2HIOB 5CPKC 3REJD 5GT3B 4AWLB 1P3BD 3AFAA 4YS3B 2IO5C 5CP6B 4WJ3C 1Z2CB 3KUYA 3REKC 4J8VB 5B2JD 1P34D 4WU9C 2JE5A 4KUDA 1P3FB 2NQBB 3KXBA 3AZLA 1AOID 5C3IC 5GXQB 1A7WA 3LZ0C 2F8NG 4JJNC 3X1SB 2RIQA 3AFAD 4WU8C 3C1CA 5DNNC 3NQJA 3MGSD 3X1UB 2DQNC 3KUYD 3LELA 5AV5A 2AROC 3KXBD 3AZLD 5AVCC 3UTBD 1HTAA 4YM6D 3VH6A 5F99D 3A6NB 3VH6T 3AYWD 5AY8D 3KFUG 4Z2MG 3LJAC 3B6FB 5DNMB 3R45B 3WKJC 5AV5D 3AZEC 3AZNB 4LD9C 4DRAA 3B0CT 5B1LC 3WAAB 5CPJC 4Z5TA 3AZMA 3O62A 2XD1A 3AZGB 5B0ZA 1P3MD 1F66D 4WNNA 2PYOA 4XUJC 1P3LC 3V9RA 3REHD 1P3PC 1HQ3A 4NFTA 5JRGB 5B24B 3REKA 1U35A 3AZMD 3EPLA 1ZLAC 4WU9A 3AN2A 3B0DB 3MVDB 5B0ZD 5JA4A 2Y2GA 3LZ0A 4ZUXB 4JJNA 4UUZB 4WU8A 5DNNA 1M18C 3W98B 3WTPE 1HQ3D 2Y2LA 5B32D 3MGRD 1U35D 5B1MD 4G92B 4WU9D 4Z66B 4H9PB 4R8PC 3AN2D 2AROA 3A1IA 1KX4A 1F1EA 5AVCA 2CWEA 5BNXB 5GT0B 1H3OA 2VQRA 4X23C 1P3AC 1P3GC 3EPKA 4JJND 3H0RC 2UWXA 3MGPD 5DNND 5B33B 3AZIC 1S32B 5AV6B 3LJAA 3AZHB 5B32G 5B31B 2CV5C 3WKJA 3AZEA 5E5AD 3TU4D 4LD9A 5B1LA 1KX4D 5AVCD 5CPJA 1P3BC 1KX3B 4H9OB 5B2JC 3LJAD 1WWIA 4XUJA 1P3LA 1BH8A 4G91C 3AZED 1AOIC 1P3PA 5CPJD 5GSUC 3MGQC 3AFAC 3RELB 3MGSC 4NE5A 5B2IB 4Z5TB 1BFMA 5AV9B 3UTBC 2ZY3A 1P3PD 1M18A 2PYOB 4YM6C 3AYWC 5F99C 5CPKB 5AY8C 3KSYA 3WTPB 3AZFD 3W97A 4QLCA 4R8PA 2IO5B 1KX5C
chains in the Genus database with same CATH topology
5GT3D 1W2EA 3WA9B 5AV5C 1P3AA 2W8SA 5CP6D 4X23A 1P3GA 1M19B 1ID3B 1BH9A 3AZIA 2F8NH 1P3FD 2NQBD 5CPIB 2CV5A 4HGAB 4QLCD 2Y2OA 4DQYB 1P3MC 1F66C 3W97D 2F8NA 3REHC 1JFIA 3X1UD 3UTAB 2BYKA 1P3OC 2NZDB 4KHAA 5B2JA 4KGCB 4EO5C 2CV5D 3AV2C 4Z2MH 1AOIA 3FDDA 1ULYA 2F8ND 5GSUA 3MGQA 2HUEC 3MGSA 1HQ3C 5B32C 3MGRC 1U35C 5B1MC 5G49B 3AZND 3WAAD 2BYMA 3AN2C 4J8XB 4CSRA 3UTBA 3REIB 1PZRA 5AVBB 4YM6A 4XUJB 5F99A 5GSUD 3AYWA 5AY8A 3MGQD 1EQZB 3MGPC 3B6GB 4H9NA 3AV1C 1KX5A 3AZKA 2Y2NA 1ZLAB 5E5AC 3TU4C 5JRGD 4CAYB 1KX4C 2YFVA 5BNVA 3MVDD 2ZM5A 4H9RB 2YFWA 1P3MA 3H0MC 1F66A 1KX5D 3AZKD 2XD5A 3A1KA 4E44A 5KDMB 3REHA 3W98D 3KWQB 2Y2MA 1M1AB 4J8UB 1P3OA 3MNNC 1P3KD 1TZYC 4Z66D 3W99B 3X1VA 4J8WB 1N1JB 3AV2A 4NE3A 1TAFB 3VH5A 3X1TB 2F8NK 3VH5T 5B33D 1S32D 3UT9B 5B31D 1P3OD 5B0YB 4XZQB 5FUGB 5B32A 3MGRA 5B1MA 5B40B 3H0LC 3REJB 3AZFC 1P3BB 3X1VD 2HIOC 3AV2D 5GT3C 5B2JB 1P34B 5CP6C 1KX3D 3NQUA 3C1BD 2JCHA 4G91B 2FJ7B 2Y2KA 3MGPA 5B31G 3AV1A 1P3FC 2NQBC 3AFAB 4QLCC 5E5AA 3TU4A 3W97C 3X1SC 2JSSA 5BO0A 3LZ1A 3KUYB 3RELD 4ZBJC 3X1UC 4H9QA 4KUDB 1T3UA 3KXBB 4E45A 3AZLB 2FFFB 3AV1D 5BS7C 5AV8A 5AV9D 4M6BA 3C1CB 3NQJB 3A6NC 3MNNA 3VH6W 3WTPD 3LZ1D 3LELB 1TZYA 5AV5B 3AZNC 1M19D 3WAAC 5AV8D 3B0CW 3MNND 3AZJA 1P3IA 3W96A 1TZYD 3AZFA 3REHB 2HIOA 5GT3A 3AZMB 4YS3A 3O62B 5CP6A 5JRGC 5B24C 2NZDD 5B0ZB 4KGCD 1P3FA 3B0BA 4WNNB 2NQBA 3MVDC 3AZJD 1P3ID 3W96D 3V9RB 5GXQA 2HUEB 2HIOD 4ZUXC 3X1SA 2Y2JA 3AZKC 1HQ3B 3REKB 1U35B 4YS3D 3W98C 4WU9B 3EPJA 3X1UA 4WZSB 4J8VD 3AN2B 4G92C 1P3KC 5C3IB 5JA4B 4Z66C 1B6WA 5BS7A 3LZ0B 4JJNB 3F6TA 1WWSA 5GT0C 5GXQD 4WU8B 5AVBD 5DNNB 3X1SD 3A6NA 5B33C 1S32C 5AV6C 3AZHC 3B6FA 5B31C 2AROB 5DNMA 3R45A 1KX4B 3EPHA 5AVCB 3AZNA 1H3OB 3WAAA 3X1VC 3A6ND 3LJAB 3AZGA 1KX3C 3C1BC 3WKJB 3AZEB 3B6FD 4LD9B 5DNMD 5B1LB 2BG1A 5CPJB 1M1AD 5JRGA 5B24A 3RELC 3AZGD 1P3LB 3MVDA 1BH8B 5B2IC 3X1TD 4ZUXA 1P3PB 4UUZA 5AV9C 4WV4B 3W98A 5B0YD 5B24D 2ZY5A 5B40D 1P3KA 3WTPC 3LZ1C 4Z66A 4H9PA 3WA9C 5BNXA 5GT0A 1ID3C 4ZUXD 1M18B 1M19C 5AV8C 2FJ7D 5B33A 1S32A 3IP4C 5AV6A 3AZHA 4QLCB 5CPIC 3W97B 4R8PB 5B31A 4HGAC 1P3AB 4X23B 4ZBJB 1P3GB 5GT0D 1BH9B 3AZIB 3UTAC 4KUDD 1KX3A 4H9OA 3C1BA 2NZDC 2CV5B 5AV6D 3AZHD 2DF4C 4KGCC 2F8NB 3AZJC 1P3IC 3W96C 2ZY2A 3C1CD 1JFIB 2BYKB 3LELD 4AWLC 3RELA 4DRBA 4KHAB 4YS3C 1KU5A 4J8VC 5B2IA 1AOIB 2L5AA 4J8XC 5AV9A 5GSUB 3MGQB 5GXQC 3REIC 5AVBC 3MGSB 5CPKA 2Y2HA 3WTPA 1EQZC 3B6GC 2RVQC 1B67A 2BYMB 3WA9A 5B2ID 4Z5TD 4CSRB 3O62D 3UTBB 1ID3A 1M19A 2F2AC 4YM6B 3AYWB 5F99B 5AY8B 2PYOD 5CPIA 4H9NB 5CPKD 1KX5B 3AZKB 3B6FC 5DNMC 3WA9D 3REKD 2YFVB 1P3KB 3KWQC 1ID3D 1M1AC 3UTAA 4H9SC 4J8UC 5BNVB 2NZDA 2YFWB 4KGCA 3W99C 5CPID 2Y2QA 1P3MB 3LZ0D 1F66B 4J8WC 3AZGC 4WU8D 2G5IC 2ZY4A 4UPKA 3X1TC 3VH5W 1P3OB 1Q9CA 5BT1C 3UTAD 3UT9C 2AROD 5B0YC 4EO5B 4XZQC 3X1VB 4J8VA 3AV2B 3REJC 5B40C 5G49A 4J8XA 3B0DC 3C1BB 3REIA 1P34C 5AVBA 1EQZA 5B32B 3MGRB 2FJ7C 3B6GA 5B1MB 3WKJD 4LD9D 5B1LD 3P5JB 1ZLAA 4J8XD 4CAYA 3NQUB 3KUYC 3REID 3MGPB 4XUJD 1P3LD 4KUDC 3AV1B 3AL0C 4H9RA 1EQZD 2Y2IA 3KXBC 3B6GD 3AZLC 2RVQD 5E5AB 3TU4B 5KDMA 2Y2PA 1ZLAD 5BO0B 3LZ1B 3KWQA 3C1CC 1M1AA 4H9SA 4J8UA 2G5HC 4H9QB 3LELC 3W99A 2LY8A 4J8WA 1N1JA 5AV8B 1TAFA 1M18D 3X1TA 2J8PA 3MNNB 3KWQD 1R4VA 1TZYB 3UT9A 4R8PD 4J8UD 5B0YA 4XZQA 5FUGA 3REJA 5B40A 1P3BA 3W99D 1P3AD 4X23D 4J8WD 1P3GD 3AZID 3EG5B 4Z5TC 4NE6A 3O62C 3AZMC 1P34A 2FJ7A 5CHLB 5BT1D 5B0ZC 3AZJB 3UT9D 1P3IB 3AZFB 3W96B 2PYOC 4XZQD 2HIOB 5CPKC 3REJD 5GT3B 4AWLB 1P3BD 3AFAA 4YS3B 2IO5C 5CP6B 4WJ3C 1Z2CB 3KUYA 3REKC 4J8VB 5B2JD 1P34D 4WU9C 2JE5A 4KUDA 1P3FB 2NQBB 3KXBA 3AZLA 1AOID 5C3IC 5GXQB 1A7WA 3LZ0C 2F8NG 4JJNC 3X1SB 2RIQA 3AFAD 4WU8C 3C1CA 5DNNC 3NQJA 3MGSD 3X1UB 2DQNC 3KUYD 3LELA 5AV5A 2AROC 3KXBD 3AZLD 5AVCC 3UTBD 1HTAA 4YM6D 3VH6A 5F99D 3A6NB 3VH6T 3AYWD 5AY8D 3KFUG 4Z2MG 3LJAC 3B6FB 5DNMB 3R45B 3WKJC 5AV5D 3AZEC 3AZNB 4LD9C 4DRAA 3B0CT 5B1LC 3WAAB 5CPJC 4Z5TA 3AZMA 3O62A 2XD1A 3AZGB 5B0ZA 1P3MD 1F66D 4WNNA 2PYOA 4XUJC 1P3LC 3V9RA 3REHD 1P3PC 1HQ3A 4NFTA 5JRGB 5B24B 3REKA 1U35A 3AZMD 3EPLA 1ZLAC 4WU9A 3AN2A 3B0DB 3MVDB 5B0ZD 5JA4A 2Y2GA 3LZ0A 4ZUXB 4JJNA 4UUZB 4WU8A 5DNNA 1M18C 3W98B 3WTPE 1HQ3D 2Y2LA 5B32D 3MGRD 1U35D 5B1MD 4G92B 4WU9D 4Z66B 4H9PB 4R8PC 3AN2D 2AROA 3A1IA 1KX4A 1F1EA 5AVCA 2CWEA 5BNXB 5GT0B 1H3OA 2VQRA 4X23C 1P3AC 1P3GC 3EPKA 4JJND 3H0RC 2UWXA 3MGPD 5DNND 5B33B 3AZIC 1S32B 5AV6B 3LJAA 3AZHB 5B32G 5B31B 2CV5C 3WKJA 3AZEA 5E5AD 3TU4D 4LD9A 5B1LA 1KX4D 5AVCD 5CPJA 1P3BC 1KX3B 4H9OB 5B2JC 3LJAD 1WWIA 4XUJA 1P3LA 1BH8A 4G91C 3AZED 1AOIC 1P3PA 5CPJD 5GSUC 3MGQC 3AFAC 3RELB 3MGSC 4NE5A 5B2IB 4Z5TB 1BFMA 5AV9B 3UTBC 2ZY3A 1P3PD 1M18A 2PYOB 4YM6C 3AYWC 5F99C 5CPKB 5AY8C 3KSYA 3WTPB 3AZFD 3W97A 4QLCA 4R8PA 2IO5B 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 D;  3WA9 B;  5AV5 C;  1P3A A;  4X23 A;  5CP6 D;  1P3G A;  1ID3 B;  1M19 B;  1BH9 A;  3AZI A;  2F8N H;  1P3F D;  2NQB D;  5CPI B;  2CV5 A;  4HGA B;  4QLC D;  1P3M C;  1F66 C;  3W97 D;  2F8N A;  3REH C;  1JFI A;  3X1U D;  3UTA B;  2BYK A;  1P3O C;  2NZD B;  4KHA A;  5B2J A;  4KGC B;  4EO5 C;  2CV5 D;  3AV2 C;  4Z2M H;  1AOI A;  1ULY A;  2F8N D;  5GSU A;  3MGQ A;  2HUE C;  3MGS A;  1HQ3 C;  5B32 C;  3MGR C;  1U35 C;  5B1M C;  5G49 B;  3AZN D;  3WAA D;  2BYM A;  3AN2 C;  4J8X B;  4CSR A;  3UTB A;  3REI B;  5AVB B;  4YM6 A;  4XUJ B;  5F99 A;  5GSU D;  3AYW A;  5AY8 A;  3MGQ D;  1EQZ B;  3MGP C;  3B6G B;  4H9N A;  3AV1 C;  1KX5 A;  3AZK A;  1ZLA B;  5E5A C;  3TU4 C;  5JRG D;  4CAY B;  1KX4 C;  2YFV A;  5BNV A;  3MVD D;  4H9R B;  2YFW A;  1P3M A;  1F66 A;  1KX5 D;  3AZK D;  4E44 A;  5KDM B;  3REH A;  3W98 D;  3KWQ B;  1M1A B;  4J8U B;  1P3O A;  3MNN C;  1P3K D;  1TZY C;  4Z66 D;  3W99 B;  3X1V A;  4J8W B;  1N1J B;  3AV2 A;  4NE3 A;  1TAF B;  3VH5 A;  3X1T B;  2F8N K;  3VH5 T;  5B33 D;  1S32 D;  3UT9 B;  5B31 D;  1P3O D;  5B0Y B;  4XZQ B;  5FUG B;  5B32 A;  3MGR A;  5B1M A;  5B40 B;  3REJ B;  3AZF C;  1P3B B;  3X1V D;  2HIO C;  3AV2 D;  5GT3 C;  5B2J B;  1P34 B;  5CP6 C;  1KX3 D;  3NQU A;  3C1B D;  4G91 B;  2FJ7 B;  3MGP A;  5B31 G;  3AV1 A;  1P3F C;  2NQB C;  3AFA B;  4QLC C;  5E5A A;  3TU4 A;  3W97 C;  3X1S C;  2JSS A;  5BO0 A;  3LZ1 A;  3KUY B;  3REL D;  4ZBJ C;  3X1U C;  4H9Q A;  4KUD B;  3KXB B;  4E45 A;  3AZL B;  3AV1 D;  5BS7 C;  5AV8 A;  5AV9 D;  4M6B A;  3C1C B;  3NQJ B;  3A6N C;  3MNN A;  3VH6 W;  3WTP D;  3LZ1 D;  3LEL B;  1TZY A;  5AV5 B;  3AZN C;  1M19 D;  3WAA C;  5AV8 D;  3B0C W;  3MNN D;  3AZJ A;  1P3I A;  3W96 A;  1TZY D;  3AZF A;  3REH B;  2HIO A;  5GT3 A;  3AZM B;  4YS3 A;  3O62 B;  5CP6 A;  5JRG C;  5B24 C;  2NZD D;  5B0Z B;  4KGC D;  1P3F A;  3B0B A;  4WNN B;  2NQB A;  3MVD C;  3AZJ D;  1P3I D;  3W96 D;  3V9R B;  5GXQ A;  2HUE B;  2HIO D;  4ZUX C;  3X1S A;  3AZK C;  1HQ3 B;  3REK B;  1U35 B;  4YS3 D;  3W98 C;  4WU9 B;  3X1U A;  4WZS B;  4J8V D;  3AN2 B;  4G92 C;  1P3K C;  5C3I B;  5JA4 B;  4Z66 C;  1B6W A;  5BS7 A;  3LZ0 B;  4JJN B;  1WWS A;  5GT0 C;  5GXQ D;  4WU8 B;  5AVB D;  5DNN B;  3X1S D;  3A6N A;  5B33 C;  1S32 C;  5AV6 C;  3AZH C;  3B6F A;  5B31 C;  2ARO B;  5DNM A;  3R45 A;  1KX4 B;  5AVC B;  3AZN A;  1H3O B;  3WAA A;  3X1V C;  3A6N D;  3LJA B;  3AZG A;  1KX3 C;  3C1B C;  3WKJ B;  3AZE B;  3B6F D;  4LD9 B;  5DNM D;  5B1L B;  5CPJ B;  1M1A D;  5JRG A;  5B24 A;  3REL C;  3AZG D;  1P3L B;  3MVD A;  1BH8 B;  5B2I C;  3X1T D;  4ZUX A;  1P3P B;  4UUZ A;  5AV9 C;  4WV4 B;  3W98 A;  5B0Y D;  5B24 D;  5B40 D;  1P3K A;  3WTP C;  3LZ1 C;  4Z66 A;  4H9P A;  3WA9 C;  5BNX A;  5GT0 A;  1ID3 C;  4ZUX D;  1M18 B;  1M19 C;  5AV8 C;  2FJ7 D;  5B33 A;  1S32 A;  5AV6 A;  3AZH A;  4QLC B;  5CPI C;  3W97 B;  4R8P B;  5B31 A;  4HGA C;  1P3A B;  4X23 B;  4ZBJ B;  1P3G B;  5GT0 D;  1BH9 B;  3AZI B;  3UTA C;  4KUD D;  1KX3 A;  4H9O A;  3C1B A;  2NZD C;  2CV5 B;  5AV6 D;  3AZH D;  4KGC C;  2F8N B;  3AZJ C;  1P3I C;  3W96 C;  3C1C D;  1JFI B;  2BYK B;  3LEL D;  4AWL C;  3REL A;  4DRB A;  4KHA B;  4YS3 C;  1KU5 A;  4J8V C;  5B2I A;  1AOI B;  2L5A A;  4J8X C;  5AV9 A;  5GSU B;  3MGQ B;  5GXQ C;  3REI C;  5AVB C;  3MGS B;  5CPK A;  3WTP A;  1EQZ C;  3B6G C;  2RVQ C;  1B67 A;  2BYM B;  3WA9 A;  5B2I D;  4Z5T D;  4CSR B;  3O62 D;  3UTB B;  1ID3 A;  1M19 A;  4YM6 B;  3AYW B;  5F99 B;  5AY8 B;  2PYO D;  5CPI A;  4H9N B;  5CPK D;  1KX5 B;  3AZK B;  3B6F C;  5DNM C;  3WA9 D;  3REK D;  2YFV B;  1P3K B;  3KWQ C;  1ID3 D;  1M1A C;  3UTA A;  4H9S C;  4J8U C;  5BNV B;  2NZD A;  2YFW B;  4KGC A;  3W99 C;  5CPI D;  1P3M B;  1F66 B;  3LZ0 D;  4J8W C;  3AZG C;  4WU8 D;  3X1T C;  3VH5 W;  1P3O B;  1Q9C A;  5BT1 C;  3UTA D;  3UT9 C;  2ARO D;  5B0Y C;  4EO5 B;  4XZQ C;  3X1V B;  4J8V A;  3AV2 B;  3REJ C;  5B40 C;  5G49 A;  4J8X A;  3B0D C;  3C1B B;  3REI A;  1P34 C;  5AVB A;  1EQZ A;  5B32 B;  3MGR B;  2FJ7 C;  3B6G A;  5B1M B;  3WKJ D;  4LD9 D;  5B1L D;  1ZLA A;  4J8X D;  4CAY A;  3NQU B;  3KUY C;  3REI D;  3MGP B;  4XUJ D;  1P3L D;  4KUD C;  3AV1 B;  4H9R A;  1EQZ D;  3KXB C;  3B6G D;  3AZL C;  2RVQ D;  5E5A B;  3TU4 B;  5KDM A;  1ZLA D;  5BO0 B;  3LZ1 B;  3KWQ A;  3C1C C;  1M1A A;  4H9S A;  4J8U A;  4H9Q B;  3LEL C;  3W99 A;  2LY8 A;  4J8W A;  1N1J A;  5AV8 B;  1TAF A;  1M18 D;  3X1T A;  3MNN B;  3KWQ D;  1R4V A;  1TZY B;  3UT9 A;  4R8P D;  4J8U D;  5B0Y A;  4XZQ A;  5FUG A;  3REJ A;  5B40 A;  1P3B A;  3W99 D;  1P3A D;  4X23 D;  4J8W D;  1P3G D;  3AZI D;  4Z5T C;  3AZM C;  4NE6 A;  3O62 C;  1P34 A;  2FJ7 A;  5CHL B;  5BT1 D;  5B0Z C;  3AZJ B;  3UT9 D;  1P3I B;  3AZF B;  3W96 B;  2PYO C;  4XZQ D;  2HIO B;  5CPK C;  3REJ D;  5GT3 B;  4AWL B;  1P3B D;  3AFA A;  4YS3 B;  2IO5 C;  5CP6 B;  3KUY A;  3REK C;  4J8V B;  5B2J D;  1P34 D;  4WU9 C;  4KUD A;  1P3F B;  2NQB B;  3KXB A;  3AZL A;  1AOI D;  5C3I C;  5GXQ B;  1A7W A;  3LZ0 C;  2F8N G;  4JJN C;  3X1S B;  3AFA D;  4WU8 C;  3C1C A;  5DNN C;  3NQJ A;  3MGS D;  3X1U B;  3KUY D;  3LEL A;  5AV5 A;  2ARO C;  3KXB D;  3AZL D;  5AVC C;  3UTB D;  1HTA A;  4YM6 D;  3VH6 A;  5F99 D;  3A6N B;  3VH6 T;  3AYW D;  5AY8 D;  4Z2M G;  3LJA C;  3B6F B;  5DNM B;  3R45 B;  3WKJ C;  5AV5 D;  3AZE C;  3AZN B;  4LD9 C;  4DRA A;  3B0C T;  5B1L C;  3WAA B;  5CPJ C;  4Z5T A;  3AZM A;  3O62 A;  3AZG B;  5B0Z A;  1P3M D;  1F66 D;  4WNN A;  2PYO A;  4XUJ C;  1P3L C;  3V9R A;  3REH D;  1P3P C;  1HQ3 A;  4NFT A;  5B24 B;  5JRG B;  3REK A;  1U35 A;  3AZM D;  1ZLA C;  4WU9 A;  3AN2 A;  3B0D B;  3MVD B;  5B0Z D;  5JA4 A;  3LZ0 A;  4ZUX B;  4JJN A;  4UUZ B;  4WU8 A;  5DNN A;  1M18 C;  3W98 B;  3WTP E;  1HQ3 D;  5B32 D;  3MGR D;  1U35 D;  5B1M D;  4G92 B;  4WU9 D;  4Z66 B;  4H9P B;  4R8P C;  3AN2 D;  2ARO A;  1KX4 A;  1F1E A;  5AVC A;  2CWE A;  5BNX B;  5GT0 B;  1H3O A;  1P3A C;  4X23 C;  1P3G C;  4JJN D;  3MGP D;  5DNN D;  5B33 B;  3AZI C;  1S32 B;  5AV6 B;  3LJA A;  3AZH B;  5B32 G;  5B31 B;  2CV5 C;  3WKJ A;  3AZE A;  5E5A D;  3TU4 D;  4LD9 A;  5B1L A;  1KX4 D;  5AVC D;  5CPJ A;  1P3B C;  1KX3 B;  4H9O B;  5B2J C;  3LJA D;  1WWI A;  4XUJ A;  1P3L A;  1BH8 A;  4G91 C;  3AZE D;  1AOI C;  1P3P A;  5CPJ D;  5GSU C;  3MGQ C;  3AFA C;  3REL B;  3MGS C;  4NE5 A;  5B2I B;  4Z5T B;  1BFM A;  5AV9 B;  3UTB C;  1P3P D;  1M18 A;  2PYO B;  4YM6 C;  3AYW C;  5F99 C;  5CPK B;  5AY8 C;  3KSY A;  3WTP B;  3AZF D;  3W97 A;  4QLC A;  4R8P A;  2IO5 B;  1KX5 C; 
#chains in the Genus database with same CATH topology
 5GT3 D;  1W2E A;  3WA9 B;  5AV5 C;  1P3A A;  2W8S A;  5CP6 D;  4X23 A;  1P3G A;  1M19 B;  1ID3 B;  1BH9 A;  3AZI A;  2F8N H;  1P3F D;  2NQB D;  5CPI B;  2CV5 A;  4HGA B;  4QLC D;  2Y2O A;  4DQY B;  1P3M C;  1F66 C;  3W97 D;  2F8N A;  3REH C;  1JFI A;  3X1U D;  3UTA B;  2BYK A;  1P3O C;  2NZD B;  4KHA A;  5B2J A;  4KGC B;  4EO5 C;  2CV5 D;  3AV2 C;  4Z2M H;  1AOI A;  3FDD A;  1ULY A;  2F8N D;  5GSU A;  3MGQ A;  2HUE C;  3MGS A;  1HQ3 C;  5B32 C;  3MGR C;  1U35 C;  5B1M C;  5G49 B;  3AZN D;  3WAA D;  2BYM A;  3AN2 C;  4J8X B;  4CSR A;  3UTB A;  3REI B;  1PZR A;  5AVB B;  4YM6 A;  4XUJ B;  5F99 A;  5GSU D;  3AYW A;  5AY8 A;  3MGQ D;  1EQZ B;  3MGP C;  3B6G B;  4H9N A;  3AV1 C;  1KX5 A;  3AZK A;  2Y2N A;  1ZLA B;  5E5A C;  3TU4 C;  5JRG D;  4CAY B;  1KX4 C;  2YFV A;  5BNV A;  3MVD D;  2ZM5 A;  4H9R B;  2YFW A;  1P3M A;  3H0M C;  1F66 A;  1KX5 D;  3AZK D;  2XD5 A;  3A1K A;  4E44 A;  5KDM B;  3REH A;  3W98 D;  3KWQ B;  2Y2M A;  1M1A B;  4J8U B;  1P3O A;  3MNN C;  1P3K D;  1TZY C;  4Z66 D;  3W99 B;  3X1V A;  4J8W B;  1N1J B;  3AV2 A;  4NE3 A;  1TAF B;  3VH5 A;  3X1T B;  2F8N K;  3VH5 T;  5B33 D;  1S32 D;  3UT9 B;  5B31 D;  1P3O D;  5B0Y B;  4XZQ B;  5FUG B;  5B32 A;  3MGR A;  5B1M A;  5B40 B;  3H0L C;  3REJ B;  3AZF C;  1P3B B;  3X1V D;  2HIO C;  3AV2 D;  5GT3 C;  5B2J B;  1P34 B;  5CP6 C;  1KX3 D;  3NQU A;  3C1B D;  2JCH A;  4G91 B;  2FJ7 B;  2Y2K A;  3MGP A;  5B31 G;  3AV1 A;  1P3F C;  2NQB C;  3AFA B;  4QLC C;  5E5A A;  3TU4 A;  3W97 C;  3X1S C;  2JSS A;  5BO0 A;  3LZ1 A;  3KUY B;  3REL D;  4ZBJ C;  3X1U C;  4H9Q A;  4KUD B;  1T3U A;  3KXB B;  4E45 A;  3AZL B;  2FFF B;  3AV1 D;  5BS7 C;  5AV8 A;  5AV9 D;  4M6B A;  3C1C B;  3NQJ B;  3A6N C;  3MNN A;  3VH6 W;  3WTP D;  3LZ1 D;  3LEL B;  1TZY A;  5AV5 B;  3AZN C;  1M19 D;  3WAA C;  5AV8 D;  3B0C W;  3MNN D;  3AZJ A;  1P3I A;  3W96 A;  1TZY D;  3AZF A;  3REH B;  2HIO A;  5GT3 A;  3AZM B;  4YS3 A;  3O62 B;  5CP6 A;  5JRG C;  5B24 C;  2NZD D;  5B0Z B;  4KGC D;  1P3F A;  3B0B A;  4WNN B;  2NQB A;  3MVD C;  3AZJ D;  1P3I D;  3W96 D;  3V9R B;  5GXQ A;  2HUE B;  2HIO D;  4ZUX C;  3X1S A;  2Y2J A;  3AZK C;  1HQ3 B;  3REK B;  1U35 B;  4YS3 D;  3W98 C;  4WU9 B;  3EPJ A;  3X1U A;  4WZS B;  4J8V D;  3AN2 B;  4G92 C;  1P3K C;  5C3I B;  5JA4 B;  4Z66 C;  1B6W A;  5BS7 A;  3LZ0 B;  4JJN B;  3F6T A;  1WWS A;  5GT0 C;  5GXQ D;  4WU8 B;  5AVB D;  5DNN B;  3X1S D;  3A6N A;  5B33 C;  1S32 C;  5AV6 C;  3AZH C;  3B6F A;  5B31 C;  2ARO B;  5DNM A;  3R45 A;  1KX4 B;  3EPH A;  5AVC B;  3AZN A;  1H3O B;  3WAA A;  3X1V C;  3A6N D;  3LJA B;  3AZG A;  1KX3 C;  3C1B C;  3WKJ B;  3AZE B;  3B6F D;  4LD9 B;  5DNM D;  5B1L B;  2BG1 A;  5CPJ B;  1M1A D;  5JRG A;  5B24 A;  3REL C;  3AZG D;  1P3L B;  3MVD A;  1BH8 B;  5B2I C;  3X1T D;  4ZUX A;  1P3P B;  4UUZ A;  5AV9 C;  4WV4 B;  3W98 A;  5B0Y D;  5B24 D;  2ZY5 A;  5B40 D;  1P3K A;  3WTP C;  3LZ1 C;  4Z66 A;  4H9P A;  3WA9 C;  5BNX A;  5GT0 A;  1ID3 C;  4ZUX D;  1M18 B;  1M19 C;  5AV8 C;  2FJ7 D;  5B33 A;  1S32 A;  3IP4 C;  5AV6 A;  3AZH A;  4QLC B;  5CPI C;  3W97 B;  4R8P B;  5B31 A;  4HGA C;  1P3A B;  4X23 B;  4ZBJ B;  1P3G B;  5GT0 D;  1BH9 B;  3AZI B;  3UTA C;  4KUD D;  1KX3 A;  4H9O A;  3C1B A;  2NZD C;  2CV5 B;  5AV6 D;  3AZH D;  2DF4 C;  4KGC C;  2F8N B;  3AZJ C;  1P3I C;  3W96 C;  2ZY2 A;  3C1C D;  1JFI B;  2BYK B;  3LEL D;  4AWL C;  3REL A;  4DRB A;  4KHA B;  4YS3 C;  1KU5 A;  4J8V C;  5B2I A;  1AOI B;  2L5A A;  4J8X C;  5AV9 A;  5GSU B;  3MGQ B;  5GXQ C;  3REI C;  5AVB C;  3MGS B;  5CPK A;  2Y2H A;  3WTP A;  1EQZ C;  3B6G C;  2RVQ C;  1B67 A;  2BYM B;  3WA9 A;  5B2I D;  4Z5T D;  4CSR B;  3O62 D;  3UTB B;  1ID3 A;  1M19 A;  2F2A C;  4YM6 B;  3AYW B;  5F99 B;  5AY8 B;  2PYO D;  5CPI A;  4H9N B;  5CPK D;  1KX5 B;  3AZK B;  3B6F C;  5DNM C;  3WA9 D;  3REK D;  2YFV B;  1P3K B;  3KWQ C;  1ID3 D;  1M1A C;  3UTA A;  4H9S C;  4J8U C;  5BNV B;  2NZD A;  2YFW B;  4KGC A;  3W99 C;  5CPI D;  2Y2Q A;  1P3M B;  3LZ0 D;  1F66 B;  4J8W C;  3AZG C;  4WU8 D;  2G5I C;  2ZY4 A;  4UPK A;  3X1T C;  3VH5 W;  1P3O B;  1Q9C A;  5BT1 C;  3UTA D;  3UT9 C;  2ARO D;  5B0Y C;  4EO5 B;  4XZQ C;  3X1V B;  4J8V A;  3AV2 B;  3REJ C;  5B40 C;  5G49 A;  4J8X A;  3B0D C;  3C1B B;  3REI A;  1P34 C;  5AVB A;  1EQZ A;  5B32 B;  3MGR B;  2FJ7 C;  3B6G A;  5B1M B;  3WKJ D;  4LD9 D;  5B1L D;  3P5J B;  1ZLA A;  4J8X D;  4CAY A;  3NQU B;  3KUY C;  3REI D;  3MGP B;  4XUJ D;  1P3L D;  4KUD C;  3AV1 B;  3AL0 C;  4H9R A;  1EQZ D;  2Y2I A;  3KXB C;  3B6G D;  3AZL C;  2RVQ D;  5E5A B;  3TU4 B;  5KDM A;  2Y2P A;  1ZLA D;  5BO0 B;  3LZ1 B;  3KWQ A;  3C1C C;  1M1A A;  4H9S A;  4J8U A;  2G5H C;  4H9Q B;  3LEL C;  3W99 A;  2LY8 A;  4J8W A;  1N1J A;  5AV8 B;  1TAF A;  1M18 D;  3X1T A;  2J8P A;  3MNN B;  3KWQ D;  1R4V A;  1TZY B;  3UT9 A;  4R8P D;  4J8U D;  5B0Y A;  4XZQ A;  5FUG A;  3REJ A;  5B40 A;  1P3B A;  3W99 D;  1P3A D;  4X23 D;  4J8W D;  1P3G D;  3AZI D;  3EG5 B;  4Z5T C;  4NE6 A;  3O62 C;  3AZM C;  1P34 A;  2FJ7 A;  5CHL B;  5BT1 D;  5B0Z C;  3AZJ B;  3UT9 D;  1P3I B;  3AZF B;  3W96 B;  2PYO C;  4XZQ D;  2HIO B;  5CPK C;  3REJ D;  5GT3 B;  4AWL B;  1P3B D;  3AFA A;  4YS3 B;  2IO5 C;  5CP6 B;  4WJ3 C;  1Z2C B;  3KUY A;  3REK C;  4J8V B;  5B2J D;  1P34 D;  4WU9 C;  2JE5 A;  4KUD A;  1P3F B;  2NQB B;  3KXB A;  3AZL A;  1AOI D;  5C3I C;  5GXQ B;  1A7W A;  3LZ0 C;  2F8N G;  4JJN C;  3X1S B;  2RIQ A;  3AFA D;  4WU8 C;  3C1C A;  5DNN C;  3NQJ A;  3MGS D;  3X1U B;  2DQN C;  3KUY D;  3LEL A;  5AV5 A;  2ARO C;  3KXB D;  3AZL D;  5AVC C;  3UTB D;  1HTA A;  4YM6 D;  3VH6 A;  5F99 D;  3A6N B;  3VH6 T;  3AYW D;  5AY8 D;  3KFU G;  4Z2M G;  3LJA C;  3B6F B;  5DNM B;  3R45 B;  3WKJ C;  5AV5 D;  3AZE C;  3AZN B;  4LD9 C;  4DRA A;  3B0C T;  5B1L C;  3WAA B;  5CPJ C;  4Z5T A;  3AZM A;  3O62 A;  2XD1 A;  3AZG B;  5B0Z A;  1P3M D;  1F66 D;  4WNN A;  2PYO A;  4XUJ C;  1P3L C;  3V9R A;  3REH D;  1P3P C;  1HQ3 A;  4NFT A;  5JRG B;  5B24 B;  3REK A;  1U35 A;  3AZM D;  3EPL A;  1ZLA C;  4WU9 A;  3AN2 A;  3B0D B;  3MVD B;  5B0Z D;  5JA4 A;  2Y2G A;  3LZ0 A;  4ZUX B;  4JJN A;  4UUZ B;  4WU8 A;  5DNN A;  1M18 C;  3W98 B;  3WTP E;  1HQ3 D;  2Y2L A;  5B32 D;  3MGR D;  1U35 D;  5B1M D;  4G92 B;  4WU9 D;  4Z66 B;  4H9P B;  4R8P C;  3AN2 D;  2ARO A;  3A1I A;  1KX4 A;  1F1E A;  5AVC A;  2CWE A;  5BNX B;  5GT0 B;  1H3O A;  2VQR A;  4X23 C;  1P3A C;  1P3G C;  3EPK A;  4JJN D;  3H0R C;  2UWX A;  3MGP D;  5DNN D;  5B33 B;  3AZI C;  1S32 B;  5AV6 B;  3LJA A;  3AZH B;  5B32 G;  5B31 B;  2CV5 C;  3WKJ A;  3AZE A;  5E5A D;  3TU4 D;  4LD9 A;  5B1L A;  1KX4 D;  5AVC D;  5CPJ A;  1P3B C;  1KX3 B;  4H9O B;  5B2J C;  3LJA D;  1WWI A;  4XUJ A;  1P3L A;  1BH8 A;  4G91 C;  3AZE D;  1AOI C;  1P3P A;  5CPJ D;  5GSU C;  3MGQ C;  3AFA C;  3REL B;  3MGS C;  4NE5 A;  5B2I B;  4Z5T B;  1BFM A;  5AV9 B;  3UTB C;  2ZY3 A;  1P3P D;  1M18 A;  2PYO B;  4YM6 C;  3AYW C;  5F99 C;  5CPK B;  5AY8 C;  3KSY A;  3WTP B;  3AZF D;  3W97 A;  4QLC A;  4R8P A;  2IO5 B;  1KX5 C; 
#chains in the Genus database with same CATH homology
 5GT3 D;  1W2E A;  3WA9 B;  5AV5 C;  1P3A A;  2W8S A;  5CP6 D;  4X23 A;  1P3G A;  1M19 B;  1ID3 B;  1BH9 A;  3AZI A;  2F8N H;  1P3F D;  2NQB D;  5CPI B;  2CV5 A;  4HGA B;  4QLC D;  2Y2O A;  4DQY B;  1P3M C;  1F66 C;  3W97 D;  2F8N A;  3REH C;  1JFI A;  3X1U D;  3UTA B;  2BYK A;  1P3O C;  2NZD B;  4KHA A;  5B2J A;  4KGC B;  4EO5 C;  2CV5 D;  3AV2 C;  4Z2M H;  1AOI A;  3FDD A;  1ULY A;  2F8N D;  5GSU A;  3MGQ A;  2HUE C;  3MGS A;  1HQ3 C;  5B32 C;  3MGR C;  1U35 C;  5B1M C;  5G49 B;  3AZN D;  3WAA D;  2BYM A;  3AN2 C;  4J8X B;  4CSR A;  3UTB A;  3REI B;  1PZR A;  5AVB B;  4YM6 A;  4XUJ B;  5F99 A;  5GSU D;  3AYW A;  5AY8 A;  3MGQ D;  1EQZ B;  3MGP C;  3B6G B;  4H9N A;  3AV1 C;  1KX5 A;  3AZK A;  2Y2N A;  1ZLA B;  5E5A C;  3TU4 C;  5JRG D;  4CAY B;  1KX4 C;  2YFV A;  5BNV A;  3MVD D;  2ZM5 A;  4H9R B;  2YFW A;  1P3M A;  3H0M C;  1F66 A;  1KX5 D;  3AZK D;  2XD5 A;  3A1K A;  4E44 A;  5KDM B;  3REH A;  3W98 D;  3KWQ B;  2Y2M A;  1M1A B;  4J8U B;  1P3O A;  3MNN C;  1P3K D;  1TZY C;  4Z66 D;  3W99 B;  3X1V A;  4J8W B;  1N1J B;  3AV2 A;  4NE3 A;  1TAF B;  3VH5 A;  3X1T B;  2F8N K;  3VH5 T;  5B33 D;  1S32 D;  3UT9 B;  5B31 D;  1P3O D;  5B0Y B;  4XZQ B;  5FUG B;  5B32 A;  3MGR A;  5B1M A;  5B40 B;  3H0L C;  3REJ B;  3AZF C;  1P3B B;  3X1V D;  2HIO C;  3AV2 D;  5GT3 C;  5B2J B;  1P34 B;  5CP6 C;  1KX3 D;  3NQU A;  3C1B D;  2JCH A;  4G91 B;  2FJ7 B;  2Y2K A;  3MGP A;  5B31 G;  3AV1 A;  1P3F C;  2NQB C;  3AFA B;  4QLC C;  5E5A A;  3TU4 A;  3W97 C;  3X1S C;  2JSS A;  5BO0 A;  3LZ1 A;  3KUY B;  3REL D;  4ZBJ C;  3X1U C;  4H9Q A;  4KUD B;  1T3U A;  3KXB B;  4E45 A;  3AZL B;  2FFF B;  3AV1 D;  5BS7 C;  5AV8 A;  5AV9 D;  4M6B A;  3C1C B;  3NQJ B;  3A6N C;  3MNN A;  3VH6 W;  3WTP D;  3LZ1 D;  3LEL B;  1TZY A;  5AV5 B;  3AZN C;  1M19 D;  3WAA C;  5AV8 D;  3B0C W;  3MNN D;  3AZJ A;  1P3I A;  3W96 A;  1TZY D;  3AZF A;  3REH B;  2HIO A;  5GT3 A;  3AZM B;  4YS3 A;  3O62 B;  5CP6 A;  5JRG C;  5B24 C;  2NZD D;  5B0Z B;  4KGC D;  1P3F A;  3B0B A;  4WNN B;  2NQB A;  3MVD C;  3AZJ D;  1P3I D;  3W96 D;  3V9R B;  5GXQ A;  2HUE B;  2HIO D;  4ZUX C;  3X1S A;  2Y2J A;  3AZK C;  1HQ3 B;  3REK B;  1U35 B;  4YS3 D;  3W98 C;  4WU9 B;  3EPJ A;  3X1U A;  4WZS B;  4J8V D;  3AN2 B;  4G92 C;  1P3K C;  5C3I B;  5JA4 B;  4Z66 C;  1B6W A;  5BS7 A;  3LZ0 B;  4JJN B;  3F6T A;  1WWS A;  5GT0 C;  5GXQ D;  4WU8 B;  5AVB D;  5DNN B;  3X1S D;  3A6N A;  5B33 C;  1S32 C;  5AV6 C;  3AZH C;  3B6F A;  5B31 C;  2ARO B;  5DNM A;  3R45 A;  1KX4 B;  3EPH A;  5AVC B;  3AZN A;  1H3O B;  3WAA A;  3X1V C;  3A6N D;  3LJA B;  3AZG A;  1KX3 C;  3C1B C;  3WKJ B;  3AZE B;  3B6F D;  4LD9 B;  5DNM D;  5B1L B;  2BG1 A;  5CPJ B;  1M1A D;  5JRG A;  5B24 A;  3REL C;  3AZG D;  1P3L B;  3MVD A;  1BH8 B;  5B2I C;  3X1T D;  4ZUX A;  1P3P B;  4UUZ A;  5AV9 C;  4WV4 B;  3W98 A;  5B0Y D;  5B24 D;  2ZY5 A;  5B40 D;  1P3K A;  3WTP C;  3LZ1 C;  4Z66 A;  4H9P A;  3WA9 C;  5BNX A;  5GT0 A;  1ID3 C;  4ZUX D;  1M18 B;  1M19 C;  5AV8 C;  2FJ7 D;  5B33 A;  1S32 A;  3IP4 C;  5AV6 A;  3AZH A;  4QLC B;  5CPI C;  3W97 B;  4R8P B;  5B31 A;  4HGA C;  1P3A B;  4X23 B;  4ZBJ B;  1P3G B;  5GT0 D;  1BH9 B;  3AZI B;  3UTA C;  4KUD D;  1KX3 A;  4H9O A;  3C1B A;  2NZD C;  2CV5 B;  5AV6 D;  3AZH D;  2DF4 C;  4KGC C;  2F8N B;  3AZJ C;  1P3I C;  3W96 C;  2ZY2 A;  3C1C D;  1JFI B;  2BYK B;  3LEL D;  4AWL C;  3REL A;  4DRB A;  4KHA B;  4YS3 C;  1KU5 A;  4J8V C;  5B2I A;  1AOI B;  2L5A A;  4J8X C;  5AV9 A;  5GSU B;  3MGQ B;  5GXQ C;  3REI C;  5AVB C;  3MGS B;  5CPK A;  2Y2H A;  3WTP A;  1EQZ C;  3B6G C;  2RVQ C;  1B67 A;  2BYM B;  3WA9 A;  5B2I D;  4Z5T D;  4CSR B;  3O62 D;  3UTB B;  1ID3 A;  1M19 A;  2F2A C;  4YM6 B;  3AYW B;  5F99 B;  5AY8 B;  2PYO D;  5CPI A;  4H9N B;  5CPK D;  1KX5 B;  3AZK B;  3B6F C;  5DNM C;  3WA9 D;  3REK D;  2YFV B;  1P3K B;  3KWQ C;  1ID3 D;  1M1A C;  3UTA A;  4H9S C;  4J8U C;  5BNV B;  2NZD A;  2YFW B;  4KGC A;  3W99 C;  5CPI D;  2Y2Q A;  1P3M B;  3LZ0 D;  1F66 B;  4J8W C;  3AZG C;  4WU8 D;  2G5I C;  2ZY4 A;  4UPK A;  3X1T C;  3VH5 W;  1P3O B;  1Q9C A;  5BT1 C;  3UTA D;  3UT9 C;  2ARO D;  5B0Y C;  4EO5 B;  4XZQ C;  3X1V B;  4J8V A;  3AV2 B;  3REJ C;  5B40 C;  5G49 A;  4J8X A;  3B0D C;  3C1B B;  3REI A;  1P34 C;  5AVB A;  1EQZ A;  5B32 B;  3MGR B;  2FJ7 C;  3B6G A;  5B1M B;  3WKJ D;  4LD9 D;  5B1L D;  3P5J B;  1ZLA A;  4J8X D;  4CAY A;  3NQU B;  3KUY C;  3REI D;  3MGP B;  4XUJ D;  1P3L D;  4KUD C;  3AV1 B;  3AL0 C;  4H9R A;  1EQZ D;  2Y2I A;  3KXB C;  3B6G D;  3AZL C;  2RVQ D;  5E5A B;  3TU4 B;  5KDM A;  2Y2P A;  1ZLA D;  5BO0 B;  3LZ1 B;  3KWQ A;  3C1C C;  1M1A A;  4H9S A;  4J8U A;  2G5H C;  4H9Q B;  3LEL C;  3W99 A;  2LY8 A;  4J8W A;  1N1J A;  5AV8 B;  1TAF A;  1M18 D;  3X1T A;  2J8P A;  3MNN B;  3KWQ D;  1R4V A;  1TZY B;  3UT9 A;  4R8P D;  4J8U D;  5B0Y A;  4XZQ A;  5FUG A;  3REJ A;  5B40 A;  1P3B A;  3W99 D;  1P3A D;  4X23 D;  4J8W D;  1P3G D;  3AZI D;  3EG5 B;  4Z5T C;  4NE6 A;  3O62 C;  3AZM C;  1P34 A;  2FJ7 A;  5CHL B;  5BT1 D;  5B0Z C;  3AZJ B;  3UT9 D;  1P3I B;  3AZF B;  3W96 B;  2PYO C;  4XZQ D;  2HIO B;  5CPK C;  3REJ D;  5GT3 B;  4AWL B;  1P3B D;  3AFA A;  4YS3 B;  2IO5 C;  5CP6 B;  4WJ3 C;  1Z2C B;  3KUY A;  3REK C;  4J8V B;  5B2J D;  1P34 D;  4WU9 C;  2JE5 A;  4KUD A;  1P3F B;  2NQB B;  3KXB A;  3AZL A;  1AOI D;  5C3I C;  5GXQ B;  1A7W A;  3LZ0 C;  2F8N G;  4JJN C;  3X1S B;  2RIQ A;  3AFA D;  4WU8 C;  3C1C A;  5DNN C;  3NQJ A;  3MGS D;  3X1U B;  2DQN C;  3KUY D;  3LEL A;  5AV5 A;  2ARO C;  3KXB D;  3AZL D;  5AVC C;  3UTB D;  1HTA A;  4YM6 D;  3VH6 A;  5F99 D;  3A6N B;  3VH6 T;  3AYW D;  5AY8 D;  3KFU G;  4Z2M G;  3LJA C;  3B6F B;  5DNM B;  3R45 B;  3WKJ C;  5AV5 D;  3AZE C;  3AZN B;  4LD9 C;  4DRA A;  3B0C T;  5B1L C;  3WAA B;  5CPJ C;  4Z5T A;  3AZM A;  3O62 A;  2XD1 A;  3AZG B;  5B0Z A;  1P3M D;  1F66 D;  4WNN A;  2PYO A;  4XUJ C;  1P3L C;  3V9R A;  3REH D;  1P3P C;  1HQ3 A;  4NFT A;  5JRG B;  5B24 B;  3REK A;  1U35 A;  3AZM D;  3EPL A;  1ZLA C;  4WU9 A;  3AN2 A;  3B0D B;  3MVD B;  5B0Z D;  5JA4 A;  2Y2G A;  3LZ0 A;  4ZUX B;  4JJN A;  4UUZ B;  4WU8 A;  5DNN A;  1M18 C;  3W98 B;  3WTP E;  1HQ3 D;  2Y2L A;  5B32 D;  3MGR D;  1U35 D;  5B1M D;  4G92 B;  4WU9 D;  4Z66 B;  4H9P B;  4R8P C;  3AN2 D;  2ARO A;  3A1I A;  1KX4 A;  1F1E A;  5AVC A;  2CWE A;  5BNX B;  5GT0 B;  1H3O A;  2VQR A;  4X23 C;  1P3A C;  1P3G C;  3EPK A;  4JJN D;  3H0R C;  2UWX A;  3MGP D;  5DNN D;  5B33 B;  3AZI C;  1S32 B;  5AV6 B;  3LJA A;  3AZH B;  5B32 G;  5B31 B;  2CV5 C;  3WKJ A;  3AZE A;  5E5A D;  3TU4 D;  4LD9 A;  5B1L A;  1KX4 D;  5AVC D;  5CPJ A;  1P3B C;  1KX3 B;  4H9O B;  5B2J C;  3LJA D;  1WWI A;  4XUJ A;  1P3L A;  1BH8 A;  4G91 C;  3AZE D;  1AOI C;  1P3P A;  5CPJ D;  5GSU C;  3MGQ C;  3AFA C;  3REL B;  3MGS C;  4NE5 A;  5B2I B;  4Z5T B;  1BFM A;  5AV9 B;  3UTB C;  2ZY3 A;  1P3P D;  1M18 A;  2PYO B;  4YM6 C;  3AYW C;  5F99 C;  5CPK B;  5AY8 C;  3KSY A;  3WTP B;  3AZF D;  3W97 A;  4QLC A;  4R8P A;  2IO5 B;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...