4Z5TB

The nucleosome containing human h3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
total genus 23
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tB00
1M19C 5CPKD 4WNNB 1P3KB 4H9PB 3X1SA 4J8VD 4J8WC 4G91C 4UUZB 4X23D 3O62A 3TU4D 3AV1C 4KUDD 3MGPD 1TZYB 4WU9A 1M1AD 4WU9C 5GSUD 2F8NG 4NE3A 5CP6C 3MGQB 1ID3D 1F66C 1AOIA 4CAYB 4H9PA 1P3MB 1ZLAB 2F8ND 4LD9B 4HGAB 5CPKB 1P3KD 2YFVB 3B6FD 5AV5B 3VH6T 4CSRB 3REHA 3X1UA 4G92B 3AZGD 5CPJB 3W98D 4KUDB 2F8NA 4H9NB 3AZJD 1WWSA 3MVDD 3AZMC 2NQBD 3W99B 3AZMB 1AOIC 5BO0B 3AZGA 5AV8A 2CWEA 4X23A 3TU4A 1M18A 3X1UB 1TZYA 5GT3C 3X1UC 4Z66C 3X1SC 3WTPC 3V9RB 3X1SB 4DRBA 4XZQC 4CAYA 3MVDB 4J8XB 1P3MA 4LD9A 1M1AB 3NQUB 5E5AC 5B33A 2HUEC 3WKJA 3WTPD 3X1UD 3W98A 3X1VA 3AZFB 4XZQD 3REJB 3W99C 3B0DC 1F1EA 3X1SD 4J8VA 4Z5TA 3LZ0D 5DNNA 5CPID 3KSYA 3KXBD 3AZMD 4E44A 1KX3D 3WTPB 1A7WA 4H9OA 1P3LA 5G49B 3AZFD 4XZQB 3MVDC 4J8VB 3AZJC 3AZID 5DNMD 3W96C 2YFWA 1P34B 3UT9B 3C1CA 1EQZC 3NQUA 4AWLB 1ID3C 1F66D 5CP6D 3REJA 5AV5D 2FJ7A 5B0YB 3B0CW 3AZIB 3MNND 1KX4D 2CV5A 3W98B 4XUJB 3AZEC 1JFIA 5DNMB 5B32D 3B6FA 4R8PD 3KXBB 5B24D 3AZHA 1KX3B 5AY8D 3C1BD 4H9NA 5AVCC 5B0YD 4KUDA 5BNXB 5BT1D 4Z66A 5F99D 3LELB 2YFVA 3B6GA 4QLCD 1F66A 5B40A 3UT9D 4H9QA 2F8NH 3MGSA 5CP6B 5B1LB 3REHC 1M1AA 5AV9D 3KUYC 4WV4B 4J8UB 1TZYD 3LJAC 3B0BA 3KWQA 3C1CC 3WA9B 4R8PB 4H9SC 1P3MD 4LD9D 1P3FD 2HIOB 3WTPE 3WA9C 1KU5A 4JJNA 3VH5W 5B1LD 3RELC 3AZJA 3VH6W 5B2JB 3MGQC 3AV1B 1P34D 4ZUXB 4Z66B 5B2JC 3AFAD 3AV2D 5DNNC 4QLCB 1N1JA 2HIOD 1F66B 5JRGD 3WAAC 5B31A 5B2ID 3AZKD 3B6GB 3REKD 2HUEB 3AV1A 3AZNA 5B2JD 3AFAC 5B32B 3AV2C 5AV5A 2FJ7D 3AFAB 3AV2B 3AZIA 2LY8A 1P3FC 3WA9D 3RELB 1P3BB 1P3FB 5B1MA 4R8PA 1TZYC 5GT3A 5KDMA 5F99B 3LELD 3LZ0B 5AV8C 3A6ND 2FJ7B 3O62D 3MNNA 1KX4A 4Z66D 4WZSB 1U35A 5C3IC 5GT0A 3UT9C 3AZKB 3B6GD 3MGPA 5AVCA 1HTAA 5B31B 3AZHC 3A6NB 4KGCD 5BNVA 5GXQD 5G49A 5B0YC 1P3AD 2PYOA 3W98C 5BS7C 4YM6B 4Z2MH 1P3BD 5AV6C 5B31D 4NE5A 1H3OA 3MNNB 3AYWC 1KX4B 5AV6B 3AYWA 1M1AC 5C3IB 3AV1D 1KX5A 4ZUXD 2BYKB 4X23C 3TU4C 2AROC 4J8UA 3AZED 5B24B 5JRGB 5B2IB 5AY8B 3C1BB 3MVDA 3AYWD 3AZMA 3W96D 5AV6D 2BYMA 3X1TB 5DNMC 1P3AB 3A6NA 4WU8A 1U35C 1P3AC 3LJAB 4H9RB 3W99A 2NZDD 3KXBC 5CPIA 5BNXA 1KX3C 3W96B 1KX3A 5AV9B 3O62C 3KXBA 1BH9A 5CPIC 4J8UD 1P3OB 3AN2D 4WU8B 3O62B 3LELC 4WU8C 5GXQA 3X1TA 4WNNA 1ULYA 3AZFA 5E5AD 3REIC 1P3PA 4WU9B 4Z5TC 5B33B 5AVBC 3MGRB 5AVBB 1P3OD 4WU8D 4Z2MG 3C1CB 2AROA 4J8UC 1HQ3B 1S32D 4YM6D 5B0ZB 1M18B 3NQJA 5GT3D 1M19B 2NQBA 2NZDB 3KUYA 1R4VA 3REKC 2HIOC 5GSUA 3REKB 3WAAD 4G91B 3AN2B 4H9SA 2IO5C 3AZGC 3RELD 4WU9D 1P3MC 4LD9C 1M19A 3MGPC 3WKJB 4KUDC 3VH5A 3VH5T 1P3PB 4J8WD 1M18C 3MGSC 3RELA 3LJAD 1BH8B 5KDMB 1P3IC 5GT3B 3W97A 1M19D 3WKJD 3KWQC 3UTAA 5CHLB 4E45A 4KGCB 5GXQB 4H9RA 5F99C 5GXQC 5AV9A 5E5AB 3AN2A 3W96A 3MGRD 5B24C 2RVQC 1EQZB 5AY8C 3C1BC 4M6BA 1P3PD 4QLCA 2HIOA 3MGRA 3A6NC 5B0ZA 1HQ3D 1S32B 5DNMA 3LZ1D 4XUJC 5B2JA 3AZEB 4XUJA 1M18D 3KWQB 4ZBJC 3MNNC 3AYWB 1KX4C 1EQZD 4J8XA 3B0CT 3X1TD 4H9QB 5E5AA 3AZFC 2CV5D 4XZQA 5B1LA 3B0DB 3LELA 3AZIC 1TAFB 5GT0D 3UTAC 3W97C 1B6WA 5B40B 4YM6C 1U35B 5B40C 4ZBJB 4KHAA 1P3AA 5AVCB 5F99A 1KX5C 2BYMB 5B33D 3MGQA 5GT0B 5B0ZC 2L5AA 5AVBD 4EO5B 1B67A 5JA4A 1P3OC 3REID 3C1CD 1BH8A 3KUYD 3LZ0A 3R45A 4Z5TD 3V9RA 3UTBB 5B0ZD 1JFIB 1P34A 3AN2C 2CV5B 2YFWB 5B33C 5B0YA 2PYOC 3AZLC 2PYOB 4J8WA 3WAAB 4HGAC 3VH6A 1ID3A 3KUYB 1U35D 3LZ1B 3NQJB 4G92C 5CPJC 5BS7A 2NZDC 3AZNC 1P3IA 4EO5C 1P3GD 5AVCD 4NE6A 5B31G 1P3KC 5GSUC 4J8WB 4JJND 4Z5TB 1P3FA 4ZUXC 4YS3D 5AV5C 2AROD 4JJNC 1BH9B 5FUGA 5CPKC 4YS3C 3LZ1C 4YS3A 1HQ3C 3WA9A 3MGSB 1Q9CA 3REIA 5B31C 1P3PC 3REJC 1TAFA 1P3BC 1N1JB 1ZLAD 2F8NB 1P3IB 3AZLA 1P3GC 1BFMA 3AZND 4KGCC 1HQ3A 5AV8B 3AZHD 4J8XC 2IO5B 5CPJD 5B1MD 3AZGB 3AZJB 3LZ0C 1P3LC 3B6GC 5AVBA 5B2IA 5JRGA 3UTBD 3W99D 2NZDA 2NQBB 3KWQD 4ZUXA 4YS3B 5FUGB 2BYKA 3AZLD 1P3ID 2AROB 2PYOD 3UTBA 1S32A 5AV8D 3R45B 3AZHB 1P3KA 5AY8A 3C1BA 1H3OB 3MGSD 1AOIB 5B24A 5CP6A 5JA4B 1P3GB 4UUZA 3AZEA 3LJAA 1KX5D 2FJ7C 1P3OA 1P3LB 1AOID 3WTPA 2NQBC 5B40D 3UT9A 3UTAD 5GT0C 3W97D 3AZKC 5CPIB 5JRGC 5B2IC 3MGQD 1P34C 1ID3B 5BNVB 2JSSA 3B6FC 5DNND 4AWLC 3B6FB 4KGCA 2F8NK 2CV5C 1P3GA 1S32C 3REIB 3UTAB 5B1LC 3W97B 3X1TC 5AV6A 1P3BA 4J8VC 3X1VB 3AFAA 3AV2A 4YM6A 3X1VC 3REHD 5B32G 1KX5B 3AZNB 4X23B 3TU4B 1P3LD 5B1MB 4KHAB 4XUJD 5AV9C 1WWIA 5B1MC 4J8XD 3UTBC 5GSUB 4H9OB 3REKA 1EQZA 5B32A 2RVQD 3AZLB 3MGRC 4QLCC 4CSRA 5DNNB 3REHB 5BT1C 3LZ1A 5CPKA 1ZLAC 3REJD 5BO0A 1ZLAA 4JJNB 3WAAA 3MGPB 3WKJC 4R8PC 4NFTA 3AZKA 5CPJA 5B32C 3X1VD 4DRAA
chains in the Genus database with same CATH superfamily
1M19C 5CPKD 4WNNB 1P3KB 4H9PB 3X1SA 4J8VD 4J8WC 4G91C 4UUZB 4X23D 3O62A 3TU4D 3AV1C 4KUDD 3MGPD 1TZYB 4WU9A 1M1AD 4WU9C 5GSUD 2F8NG 4NE3A 5CP6C 3MGQB 1ID3D 1F66C 1AOIA 4CAYB 4H9PA 1P3MB 1ZLAB 2F8ND 4LD9B 4HGAB 5CPKB 1P3KD 2YFVB 3B6FD 5AV5B 3VH6T 4CSRB 3REHA 3X1UA 4G92B 3AZGD 5CPJB 3W98D 4KUDB 2F8NA 4H9NB 3AZJD 1WWSA 3MVDD 3AZMC 2NQBD 3W99B 3AZMB 1AOIC 5BO0B 3AZGA 5AV8A 2CWEA 4X23A 3TU4A 1M18A 3X1UB 1TZYA 5GT3C 3X1UC 4Z66C 2G5IC 3WTPC 3X1SC 3V9RB 3X1SB 4DRBA 4XZQC 4CAYA 3MVDB 4J8XB 1P3MA 4LD9A 1M1AB 3NQUB 5E5AC 5B33A 2HUEC 3WKJA 3WTPD 3X1UD 3W98A 3X1VA 3AZFB 4XZQD 3REJB 3W99C 3B0DC 1F1EA 3X1SD 4J8VA 2DQNC 4Z5TA 3LZ0D 5DNNA 2VQRA 5CPID 3KSYA 3KXBD 3AZMD 2Y2HA 4E44A 1KX3D 3WTPB 1A7WA 4H9OA 1P3LA 5G49B 3AZFD 4XZQB 3MVDC 4J8VB 3AZJC 3AZID 5DNMD 3W96C 2YFWA 1P34B 3UT9B 3C1CA 1EQZC 3NQUA 4AWLB 1ID3C 1F66D 5CP6D 3REJA 5AV5D 2FJ7A 5B0YB 3B0CW 3AZIB 3MNND 1KX4D 2CV5A 3W98B 4XUJB 3AZEC 1JFIA 5DNMB 3AL0C 5B32D 3B6FA 2Y2IA 4R8PD 3KXBB 5B24D 3EPLA 3AZHA 1KX3B 5AY8D 3C1BD 4H9NA 5AVCC 5B0YD 4KUDA 5BNXB 5BT1D 4Z66A 2Y2NA 5F99D 3LELB 2YFVA 2F2AC 3B6GA 4QLCD 1F66A 5B40A 3UT9D 4H9QA 2F8NH 3MGSA 5CP6B 5B1LB 3REHC 1M1AA 5AV9D 3KUYC 4WV4B 4J8UB 1TZYD 2Y2OA 3LJAC 3B0BA 3KWQA 3C1CC 2ZY4A 3WA9B 4R8PB 4H9SC 1P3MD 4LD9D 1P3FD 2HIOB 3WTPE 3WA9C 1KU5A 4JJNA 3VH5W 5B1LD 3RELC 3AZJA 4WJ3C 3VH6W 1W2EA 5B2JB 3MGQC 2XD1A 3AV1B 4ZUXB 4Z66B 5B2JC 3AFAD 3AV2D 1P34D 5DNNC 4QLCB 1N1JA 2HIOD 1F66B 5JRGD 3WAAC 5B31A 5B2ID 3AZKD 3B6GB 3REKD 2HUEB 3AV1A 3AZNA 5B2JD 3AFAC 5B32B 3AV2C 5AV5A 2FJ7D 3AFAB 3AV2B 3AZIA 2JE5A 2LY8A 1P3FC 3WA9D 3RELB 1P3BB 1P3FB 5B1MA 4R8PA 1TZYC 5GT3A 2W8SA 5KDMA 5F99B 3LELD 3LZ0B 5AV8C 3A6ND 2FJ7B 3O62D 3MNNA 1KX4A 4Z66D 4WZSB 1U35A 5C3IC 5GT0A 3UT9C 3AZKB 3B6GD 3MGPA 5AVCA 1HTAA 5B31B 3AZHC 3A6NB 4KGCD 5BNVA 5GXQD 5G49A 5B0YC 1P3AD 2PYOA 3W98C 3P5JB 2Y2JA 5BS7C 2Y2QA 4YM6B 4Z2MH 1P3BD 5AV6C 5B31D 4NE5A 1H3OA 3MNNB 3AYWC 1KX4B 5AV6B 3AYWA 1M1AC 5C3IB 3AV1D 3H0RC 4ZUXD 1KX5A 2BYKB 4X23C 3TU4C 2AROC 4J8UA 3AZED 5B24B 5JRGB 5B2IB 5AY8B 3C1BB 3MVDA 1PZRA 3AZMA 3AYWD 3KFUG 3W96D 5AV6D 3FDDA 2RIQA 2BYMA 3X1TB 5DNMC 1P3AB 3A6NA 4WU8A 1U35C 1P3AC 3LJAB 4H9RB 3W99A 2NZDD 3KXBC 5CPIA 5BNXA 1KX3C 3W96B 1KX3A 5AV9B 3O62C 5CPIC 1BH9A 3KXBA 4J8UD 1P3OB 3AN2D 4WU8B 3O62B 3LELC 4WU8C 5GXQA 3X1TA 4WNNA 1ULYA 3AZFA 1T3UA 5E5AD 3REIC 1P3PA 4WU9B 4Z5TC 5B33B 5AVBC 3MGRB 5AVBB 1P3OD 4WU8D 4Z2MG 3C1CB 2AROA 4J8UC 1HQ3B 1S32D 4YM6D 5B0ZB 1M18B 2Y2KA 3NQJA 5GT3D 1M19B 2NQBA 2NZDB 3KUYA 1R4VA 3REKC 2HIOC 5GSUA 3REKB 3WAAD 4G91B 3AN2B 4H9SA 2IO5C 3AZGC 3RELD 2G5HC 4WU9D 1P3MC 4LD9C 1M19A 3MGPC 3WKJB 3EPHA 4KUDC 3VH5A 3VH5T 1P3PB 4J8WD 1M18C 3MGSC 2Y2LA 3RELA 3LJAD 1BH8B 5KDMB 1P3IC 5GT3B 3W97A 1M19D 3WKJD 3KWQC 3UTAA 5CHLB 4E45A 4KGCB 5GXQB 2JCHA 4H9RA 5F99C 5GXQC 5AV9A 5E5AB 3AN2A 3W96A 3MGRD 5B24C 2RVQC 1EQZB 5AY8C 3C1BC 4M6BA 1P3PD 4QLCA 2HIOA 3MGRA 3A6NC 5B0ZA 1HQ3D 1S32B 5DNMA 3LZ1D 4XUJC 5B2JA 3AZEB 4XUJA 1M18D 3KWQB 4ZBJC 3MNNC 3AYWB 1KX4C 1EQZD 4J8XA 3B0CT 3X1TD 4H9QB 4UPKA 5E5AA 3AZFC 2CV5D 4XZQA 5B1LA 3B0DB 3LELA 3AZIC 1TAFB 5GT0D 3UTAC 2BG1A 3W97C 1B6WA 5B40B 4YM6C 1U35B 5B40C 1Z2CB 4ZBJB 4KHAA 1P3AA 5AVCB 5F99A 1KX5C 2BYMB 5B33D 3MGQA 5GT0B 5B0ZC 2L5AA 5AVBD 4EO5B 1B67A 5JA4A 1P3OC 2J8PA 3REID 3C1CD 1BH8A 3KUYD 4Z5TD 3R45A 3LZ0A 3V9RA 3UTBB 5B0ZD 1JFIB 1P34A 3AN2C 2CV5B 2YFWB 5B33C 5B0YA 2PYOC 3AZLC 2PYOB 4J8WA 3WAAB 3EG5B 4HGAC 3VH6A 1ID3A 3KUYB 1U35D 3LZ1B 3NQJB 4G92C 5CPJC 5BS7A 2NZDC 3AZNC 1P3IA 4EO5C 1P3GD 5AVCD 2DF4C 4NE6A 5B31G 3A1KA 1P3KC 5GSUC 4J8WB 3H0LC 4JJND 4Z5TB 2UWXA 1P3FA 4ZUXC 2ZM5A 4YS3D 2Y2PA 5AV5C 2AROD 4JJNC 1BH9B 5FUGA 5CPKC 4YS3C 3LZ1C 4YS3A 1HQ3C 3WA9A 3MGSB 1Q9CA 3REIA 5B31C 1P3PC 2Y2MA 3REJC 1TAFA 1P3BC 2ZY5A 3IP4C 1N1JB 1ZLAD 2F8NB 1P3IB 3AZLA 1P3GC 1BFMA 3AZND 4KGCC 1HQ3A 5AV8B 3AZHD 4J8XC 2IO5B 5CPJD 5B1MD 3AZGB 3AZJB 3LZ0C 3A1IA 1P3LC 3B6GC 5AVBA 5B2IA 5JRGA 3UTBD 3W99D 2NZDA 2NQBB 3KWQD 4ZUXA 2ZY3A 4YS3B 5FUGB 2BYKA 3AZLD 1P3ID 2AROB 2PYOD 3UTBA 1S32A 5AV8D 3R45B 3AZHB 1P3KA 5AY8A 3C1BA 1H3OB 3MGSD 1AOIB 3H0MC 5B24A 5CP6A 5JA4B 1P3GB 4UUZA 3AZEA 3LJAA 1KX5D 2FJ7C 1P3OA 1P3LB 2FFFB 1AOID 3WTPA 2NQBC 5B40D 3UT9A 3UTAD 5GT0C 3W97D 3AZKC 5CPIB 5JRGC 5B2IC 3MGQD 1P34C 1ID3B 5BNVB 3F6TA 3EPKA 2JSSA 3B6FC 5DNND 4AWLC 3B6FB 4KGCA 2F8NK 2CV5C 1P3GA 1S32C 3REIB 3UTAB 5B1LC 3W97B 3X1TC 5AV6A 1P3BA 4J8VC 3X1VB 3AFAA 3AV2A 4YM6A 3X1VC 3REHD 5B32G 1KX5B 4DQYB 3AZNB 4X23B 3TU4B 3EPJA 1P3LD 5B1MB 4KHAB 4XUJD 5AV9C 1WWIA 5B1MC 4J8XD 3UTBC 5GSUB 4H9OB 3REKA 1EQZA 2XD5A 5B32A 2RVQD 3AZLB 3MGRC 4QLCC 4CSRA 5DNNB 3REHB 5BT1C 2Y2GA 3LZ1A 5CPKA 2ZY2A 3REJD 5BO0A 1ZLAC 1ZLAA 4JJNB 3WAAA 3MGPB 3WKJC 4R8PC 4NFTA 3AZKA 5CPJA 5B32C 3X1VD 4DRAA
chains in the Genus database with same CATH topology
1M19C 5CPKD 4WNNB 1P3KB 4H9PB 3X1SA 4J8VD 4J8WC 4G91C 4UUZB 4X23D 3O62A 3TU4D 3AV1C 4KUDD 3MGPD 1TZYB 4WU9A 1M1AD 4WU9C 5GSUD 2F8NG 4NE3A 5CP6C 3MGQB 1ID3D 1F66C 1AOIA 4CAYB 4H9PA 1P3MB 1ZLAB 2F8ND 4LD9B 4HGAB 5CPKB 1P3KD 2YFVB 3B6FD 5AV5B 3VH6T 4CSRB 3REHA 3X1UA 4G92B 3AZGD 5CPJB 3W98D 4KUDB 2F8NA 4H9NB 3AZJD 1WWSA 3MVDD 3AZMC 2NQBD 3W99B 3AZMB 1AOIC 5BO0B 3AZGA 5AV8A 2CWEA 4X23A 3TU4A 1M18A 3X1UB 1TZYA 5GT3C 3X1UC 4Z66C 2G5IC 3WTPC 3X1SC 3V9RB 3X1SB 4DRBA 4XZQC 4CAYA 3MVDB 4J8XB 1P3MA 4LD9A 1M1AB 3NQUB 5E5AC 5B33A 2HUEC 3WKJA 3WTPD 3X1UD 3W98A 3X1VA 3AZFB 4XZQD 3REJB 3W99C 3B0DC 1F1EA 3X1SD 4J8VA 2DQNC 4Z5TA 3LZ0D 5DNNA 2VQRA 5CPID 3KSYA 3KXBD 3AZMD 2Y2HA 4E44A 1KX3D 3WTPB 1A7WA 4H9OA 1P3LA 5G49B 3AZFD 4XZQB 3MVDC 4J8VB 3AZJC 3AZID 5DNMD 3W96C 2YFWA 1P34B 3UT9B 3C1CA 1EQZC 3NQUA 4AWLB 1ID3C 1F66D 5CP6D 3REJA 5AV5D 2FJ7A 5B0YB 3B0CW 3AZIB 3MNND 1KX4D 2CV5A 3W98B 4XUJB 3AZEC 1JFIA 5DNMB 3AL0C 5B32D 3B6FA 2Y2IA 4R8PD 3KXBB 5B24D 3EPLA 3AZHA 1KX3B 5AY8D 3C1BD 4H9NA 5AVCC 5B0YD 4KUDA 5BNXB 5BT1D 4Z66A 2Y2NA 5F99D 3LELB 2YFVA 2F2AC 3B6GA 4QLCD 1F66A 5B40A 3UT9D 4H9QA 2F8NH 3MGSA 5CP6B 5B1LB 3REHC 1M1AA 5AV9D 3KUYC 4WV4B 4J8UB 1TZYD 2Y2OA 3LJAC 3B0BA 3KWQA 3C1CC 2ZY4A 3WA9B 4R8PB 4H9SC 1P3MD 4LD9D 1P3FD 2HIOB 3WTPE 3WA9C 1KU5A 4JJNA 3VH5W 5B1LD 3RELC 3AZJA 4WJ3C 3VH6W 1W2EA 5B2JB 3MGQC 2XD1A 3AV1B 4ZUXB 4Z66B 5B2JC 3AFAD 3AV2D 1P34D 5DNNC 4QLCB 1N1JA 2HIOD 1F66B 5JRGD 3WAAC 5B31A 5B2ID 3AZKD 3B6GB 3REKD 2HUEB 3AV1A 3AZNA 5B2JD 3AFAC 5B32B 3AV2C 5AV5A 2FJ7D 3AFAB 3AV2B 3AZIA 2JE5A 2LY8A 1P3FC 3WA9D 3RELB 1P3BB 1P3FB 5B1MA 4R8PA 1TZYC 5GT3A 2W8SA 5KDMA 5F99B 3LELD 3LZ0B 5AV8C 3A6ND 2FJ7B 3O62D 3MNNA 1KX4A 4Z66D 4WZSB 1U35A 5C3IC 5GT0A 3UT9C 3AZKB 3B6GD 3MGPA 5AVCA 1HTAA 5B31B 3AZHC 3A6NB 4KGCD 5BNVA 5GXQD 5G49A 5B0YC 1P3AD 2PYOA 3W98C 3P5JB 2Y2JA 5BS7C 2Y2QA 4YM6B 4Z2MH 1P3BD 5AV6C 5B31D 4NE5A 1H3OA 3MNNB 3AYWC 1KX4B 5AV6B 3AYWA 1M1AC 5C3IB 3AV1D 3H0RC 4ZUXD 1KX5A 2BYKB 4X23C 3TU4C 2AROC 4J8UA 3AZED 5B24B 5JRGB 5B2IB 5AY8B 3C1BB 3MVDA 1PZRA 3AZMA 3AYWD 3KFUG 3W96D 5AV6D 3FDDA 2RIQA 2BYMA 3X1TB 5DNMC 1P3AB 3A6NA 4WU8A 1U35C 1P3AC 3LJAB 4H9RB 3W99A 2NZDD 3KXBC 5CPIA 5BNXA 1KX3C 3W96B 1KX3A 5AV9B 3O62C 5CPIC 1BH9A 3KXBA 4J8UD 1P3OB 3AN2D 4WU8B 3O62B 3LELC 4WU8C 5GXQA 3X1TA 4WNNA 1ULYA 3AZFA 1T3UA 5E5AD 3REIC 1P3PA 4WU9B 4Z5TC 5B33B 5AVBC 3MGRB 5AVBB 1P3OD 4WU8D 4Z2MG 3C1CB 2AROA 4J8UC 1HQ3B 1S32D 4YM6D 5B0ZB 1M18B 2Y2KA 3NQJA 5GT3D 1M19B 2NQBA 2NZDB 3KUYA 1R4VA 3REKC 2HIOC 5GSUA 3REKB 3WAAD 4G91B 3AN2B 4H9SA 2IO5C 3AZGC 3RELD 2G5HC 4WU9D 1P3MC 4LD9C 1M19A 3MGPC 3WKJB 3EPHA 4KUDC 3VH5A 3VH5T 1P3PB 4J8WD 1M18C 3MGSC 2Y2LA 3RELA 3LJAD 1BH8B 5KDMB 1P3IC 5GT3B 3W97A 1M19D 3WKJD 3KWQC 3UTAA 5CHLB 4E45A 4KGCB 5GXQB 2JCHA 4H9RA 5F99C 5GXQC 5AV9A 5E5AB 3AN2A 3W96A 3MGRD 5B24C 2RVQC 1EQZB 5AY8C 3C1BC 4M6BA 1P3PD 4QLCA 2HIOA 3MGRA 3A6NC 5B0ZA 1HQ3D 1S32B 5DNMA 3LZ1D 4XUJC 5B2JA 3AZEB 4XUJA 1M18D 3KWQB 4ZBJC 3MNNC 3AYWB 1KX4C 1EQZD 4J8XA 3B0CT 3X1TD 4H9QB 4UPKA 5E5AA 3AZFC 2CV5D 4XZQA 5B1LA 3B0DB 3LELA 3AZIC 1TAFB 5GT0D 3UTAC 2BG1A 3W97C 1B6WA 5B40B 4YM6C 1U35B 5B40C 1Z2CB 4ZBJB 4KHAA 1P3AA 5AVCB 5F99A 1KX5C 2BYMB 5B33D 3MGQA 5GT0B 5B0ZC 2L5AA 5AVBD 4EO5B 1B67A 5JA4A 1P3OC 2J8PA 3REID 3C1CD 1BH8A 3KUYD 4Z5TD 3R45A 3LZ0A 3V9RA 3UTBB 5B0ZD 1JFIB 1P34A 3AN2C 2CV5B 2YFWB 5B33C 5B0YA 2PYOC 3AZLC 2PYOB 4J8WA 3WAAB 3EG5B 4HGAC 3VH6A 1ID3A 3KUYB 1U35D 3LZ1B 3NQJB 4G92C 5CPJC 5BS7A 2NZDC 3AZNC 1P3IA 4EO5C 1P3GD 5AVCD 2DF4C 4NE6A 5B31G 3A1KA 1P3KC 5GSUC 4J8WB 3H0LC 4JJND 4Z5TB 2UWXA 1P3FA 4ZUXC 2ZM5A 4YS3D 2Y2PA 5AV5C 2AROD 4JJNC 1BH9B 5FUGA 5CPKC 4YS3C 3LZ1C 4YS3A 1HQ3C 3WA9A 3MGSB 1Q9CA 3REIA 5B31C 1P3PC 2Y2MA 3REJC 1TAFA 1P3BC 2ZY5A 3IP4C 1N1JB 1ZLAD 2F8NB 1P3IB 3AZLA 1P3GC 1BFMA 3AZND 4KGCC 1HQ3A 5AV8B 3AZHD 4J8XC 2IO5B 5CPJD 5B1MD 3AZGB 3AZJB 3LZ0C 3A1IA 1P3LC 3B6GC 5AVBA 5B2IA 5JRGA 3UTBD 3W99D 2NZDA 2NQBB 3KWQD 4ZUXA 2ZY3A 4YS3B 5FUGB 2BYKA 3AZLD 1P3ID 2AROB 2PYOD 3UTBA 1S32A 5AV8D 3R45B 3AZHB 1P3KA 5AY8A 3C1BA 1H3OB 3MGSD 1AOIB 3H0MC 5B24A 5CP6A 5JA4B 1P3GB 4UUZA 3AZEA 3LJAA 1KX5D 2FJ7C 1P3OA 1P3LB 2FFFB 1AOID 3WTPA 2NQBC 5B40D 3UT9A 3UTAD 5GT0C 3W97D 3AZKC 5CPIB 5JRGC 5B2IC 3MGQD 1P34C 1ID3B 5BNVB 3F6TA 3EPKA 2JSSA 3B6FC 5DNND 4AWLC 3B6FB 4KGCA 2F8NK 2CV5C 1P3GA 1S32C 3REIB 3UTAB 5B1LC 3W97B 3X1TC 5AV6A 1P3BA 4J8VC 3X1VB 3AFAA 3AV2A 4YM6A 3X1VC 3REHD 5B32G 1KX5B 4DQYB 3AZNB 4X23B 3TU4B 3EPJA 1P3LD 5B1MB 4KHAB 4XUJD 5AV9C 1WWIA 5B1MC 4J8XD 3UTBC 5GSUB 4H9OB 3REKA 1EQZA 2XD5A 5B32A 2RVQD 3AZLB 3MGRC 4QLCC 4CSRA 5DNNB 3REHB 5BT1C 2Y2GA 3LZ1A 5CPKA 2ZY2A 3REJD 5BO0A 1ZLAC 1ZLAA 4JJNB 3WAAA 3MGPB 3WKJC 4R8PC 4NFTA 3AZKA 5CPJA 5B32C 3X1VD 4DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 C;  5CPK D;  4WNN B;  1P3K B;  4H9P B;  3X1S A;  4J8V D;  4J8W C;  4G91 C;  4UUZ B;  4X23 D;  3O62 A;  3TU4 D;  3AV1 C;  4KUD D;  3MGP D;  1TZY B;  4WU9 A;  1M1A D;  4WU9 C;  5GSU D;  2F8N G;  4NE3 A;  5CP6 C;  3MGQ B;  1ID3 D;  1F66 C;  1AOI A;  4CAY B;  4H9P A;  1P3M B;  1ZLA B;  2F8N D;  4LD9 B;  4HGA B;  5CPK B;  1P3K D;  2YFV B;  3B6F D;  5AV5 B;  3VH6 T;  4CSR B;  3REH A;  3X1U A;  4G92 B;  3AZG D;  5CPJ B;  3W98 D;  4KUD B;  2F8N A;  4H9N B;  3AZJ D;  1WWS A;  3MVD D;  3AZM C;  2NQB D;  3W99 B;  3AZM B;  1AOI C;  5BO0 B;  3AZG A;  5AV8 A;  2CWE A;  4X23 A;  3TU4 A;  1M18 A;  3X1U B;  1TZY A;  5GT3 C;  3X1U C;  4Z66 C;  3X1S C;  3WTP C;  3V9R B;  3X1S B;  4DRB A;  4XZQ C;  4CAY A;  3MVD B;  4J8X B;  1P3M A;  4LD9 A;  1M1A B;  3NQU B;  5E5A C;  5B33 A;  2HUE C;  3WKJ A;  3WTP D;  3X1U D;  3W98 A;  3X1V A;  3AZF B;  4XZQ D;  3REJ B;  3W99 C;  3B0D C;  1F1E A;  3X1S D;  4J8V A;  4Z5T A;  3LZ0 D;  5DNN A;  5CPI D;  3KSY A;  3KXB D;  3AZM D;  4E44 A;  1KX3 D;  3WTP B;  1A7W A;  4H9O A;  1P3L A;  5G49 B;  3AZF D;  4XZQ B;  3MVD C;  4J8V B;  3AZJ C;  3AZI D;  5DNM D;  3W96 C;  2YFW A;  1P34 B;  3UT9 B;  3C1C A;  1EQZ C;  3NQU A;  4AWL B;  1ID3 C;  1F66 D;  5CP6 D;  3REJ A;  5AV5 D;  2FJ7 A;  5B0Y B;  3B0C W;  3AZI B;  3MNN D;  1KX4 D;  2CV5 A;  3W98 B;  4XUJ B;  3AZE C;  1JFI A;  5DNM B;  5B32 D;  3B6F A;  4R8P D;  3KXB B;  5B24 D;  3AZH A;  1KX3 B;  5AY8 D;  3C1B D;  4H9N A;  5AVC C;  5B0Y D;  4KUD A;  5BNX B;  5BT1 D;  4Z66 A;  5F99 D;  3LEL B;  2YFV A;  3B6G A;  4QLC D;  1F66 A;  5B40 A;  3UT9 D;  4H9Q A;  2F8N H;  3MGS A;  5CP6 B;  5B1L B;  3REH C;  1M1A A;  5AV9 D;  3KUY C;  4WV4 B;  4J8U B;  1TZY D;  3LJA C;  3B0B A;  3KWQ A;  3C1C C;  3WA9 B;  4R8P B;  4H9S C;  1P3M D;  4LD9 D;  1P3F D;  2HIO B;  3WTP E;  3WA9 C;  1KU5 A;  4JJN A;  3VH5 W;  5B1L D;  3REL C;  3AZJ A;  3VH6 W;  5B2J B;  3MGQ C;  3AV1 B;  1P34 D;  4ZUX B;  4Z66 B;  5B2J C;  3AFA D;  3AV2 D;  5DNN C;  4QLC B;  1N1J A;  2HIO D;  1F66 B;  5JRG D;  3WAA C;  5B31 A;  5B2I D;  3AZK D;  3B6G B;  3REK D;  2HUE B;  3AV1 A;  3AZN A;  5B2J D;  3AFA C;  5B32 B;  3AV2 C;  5AV5 A;  2FJ7 D;  3AFA B;  3AV2 B;  3AZI A;  2LY8 A;  1P3F C;  3WA9 D;  3REL B;  1P3B B;  1P3F B;  5B1M A;  4R8P A;  1TZY C;  5GT3 A;  5KDM A;  5F99 B;  3LEL D;  3LZ0 B;  5AV8 C;  3A6N D;  2FJ7 B;  3O62 D;  3MNN A;  1KX4 A;  4Z66 D;  4WZS B;  1U35 A;  5C3I C;  5GT0 A;  3UT9 C;  3AZK B;  3B6G D;  3MGP A;  5AVC A;  1HTA A;  5B31 B;  3AZH C;  3A6N B;  4KGC D;  5BNV A;  5GXQ D;  5G49 A;  5B0Y C;  1P3A D;  2PYO A;  3W98 C;  5BS7 C;  4YM6 B;  4Z2M H;  1P3B D;  5AV6 C;  5B31 D;  4NE5 A;  1H3O A;  3MNN B;  3AYW C;  1KX4 B;  5AV6 B;  3AYW A;  1M1A C;  5C3I B;  3AV1 D;  1KX5 A;  4ZUX D;  2BYK B;  4X23 C;  3TU4 C;  2ARO C;  4J8U A;  3AZE D;  5B24 B;  5JRG B;  5B2I B;  5AY8 B;  3C1B B;  3MVD A;  3AYW D;  3AZM A;  3W96 D;  5AV6 D;  2BYM A;  3X1T B;  5DNM C;  1P3A B;  3A6N A;  4WU8 A;  1U35 C;  1P3A C;  3LJA B;  4H9R B;  3W99 A;  2NZD D;  3KXB C;  5CPI A;  5BNX A;  1KX3 C;  3W96 B;  1KX3 A;  5AV9 B;  3O62 C;  3KXB A;  1BH9 A;  5CPI C;  4J8U D;  1P3O B;  3AN2 D;  4WU8 B;  3O62 B;  3LEL C;  4WU8 C;  5GXQ A;  3X1T A;  4WNN A;  1ULY A;  3AZF A;  5E5A D;  3REI C;  1P3P A;  4WU9 B;  4Z5T C;  5B33 B;  5AVB C;  3MGR B;  5AVB B;  1P3O D;  4WU8 D;  4Z2M G;  3C1C B;  2ARO A;  4J8U C;  1HQ3 B;  1S32 D;  4YM6 D;  5B0Z B;  1M18 B;  3NQJ A;  5GT3 D;  1M19 B;  2NQB A;  2NZD B;  3KUY A;  1R4V A;  3REK C;  2HIO C;  5GSU A;  3REK B;  3WAA D;  4G91 B;  3AN2 B;  4H9S A;  2IO5 C;  3AZG C;  3REL D;  4WU9 D;  1P3M C;  4LD9 C;  1M19 A;  3MGP C;  3WKJ B;  4KUD C;  3VH5 A;  3VH5 T;  1P3P B;  4J8W D;  1M18 C;  3MGS C;  3REL A;  3LJA D;  1BH8 B;  5KDM B;  1P3I C;  5GT3 B;  3W97 A;  1M19 D;  3WKJ D;  3KWQ C;  3UTA A;  5CHL B;  4E45 A;  4KGC B;  5GXQ B;  4H9R A;  5F99 C;  5GXQ C;  5AV9 A;  5E5A B;  3AN2 A;  3W96 A;  3MGR D;  5B24 C;  2RVQ C;  1EQZ B;  5AY8 C;  3C1B C;  4M6B A;  1P3P D;  4QLC A;  2HIO A;  3MGR A;  3A6N C;  5B0Z A;  1HQ3 D;  1S32 B;  5DNM A;  3LZ1 D;  4XUJ C;  5B2J A;  3AZE B;  4XUJ A;  1M18 D;  3KWQ B;  4ZBJ C;  3MNN C;  3AYW B;  1KX4 C;  1EQZ D;  4J8X A;  3B0C T;  3X1T D;  4H9Q B;  5E5A A;  3AZF C;  2CV5 D;  4XZQ A;  5B1L A;  3B0D B;  3LEL A;  3AZI C;  1TAF B;  5GT0 D;  3UTA C;  3W97 C;  1B6W A;  5B40 B;  4YM6 C;  1U35 B;  5B40 C;  4ZBJ B;  4KHA A;  1P3A A;  5AVC B;  5F99 A;  1KX5 C;  2BYM B;  5B33 D;  3MGQ A;  5GT0 B;  5B0Z C;  2L5A A;  5AVB D;  4EO5 B;  1B67 A;  5JA4 A;  1P3O C;  3REI D;  3C1C D;  1BH8 A;  3KUY D;  3LZ0 A;  3R45 A;  4Z5T D;  3V9R A;  3UTB B;  5B0Z D;  1JFI B;  1P34 A;  3AN2 C;  2CV5 B;  2YFW B;  5B33 C;  5B0Y A;  2PYO C;  3AZL C;  2PYO B;  4J8W A;  3WAA B;  4HGA C;  3VH6 A;  1ID3 A;  3KUY B;  1U35 D;  3LZ1 B;  3NQJ B;  4G92 C;  5CPJ C;  5BS7 A;  2NZD C;  3AZN C;  1P3I A;  4EO5 C;  1P3G D;  5AVC D;  4NE6 A;  5B31 G;  1P3K C;  5GSU C;  4J8W B;  4JJN D;  4Z5T B;  1P3F A;  4ZUX C;  4YS3 D;  5AV5 C;  2ARO D;  4JJN C;  1BH9 B;  5FUG A;  5CPK C;  4YS3 C;  3LZ1 C;  4YS3 A;  1HQ3 C;  3WA9 A;  3MGS B;  1Q9C A;  3REI A;  5B31 C;  1P3P C;  3REJ C;  1TAF A;  1P3B C;  1N1J B;  1ZLA D;  2F8N B;  1P3I B;  3AZL A;  1P3G C;  1BFM A;  3AZN D;  4KGC C;  1HQ3 A;  5AV8 B;  3AZH D;  4J8X C;  2IO5 B;  5CPJ D;  5B1M D;  3AZG B;  3AZJ B;  3LZ0 C;  1P3L C;  3B6G C;  5AVB A;  5B2I A;  5JRG A;  3UTB D;  3W99 D;  2NZD A;  2NQB B;  3KWQ D;  4ZUX A;  4YS3 B;  5FUG B;  2BYK A;  3AZL D;  1P3I D;  2ARO B;  2PYO D;  3UTB A;  1S32 A;  5AV8 D;  3R45 B;  3AZH B;  1P3K A;  5AY8 A;  3C1B A;  1H3O B;  3MGS D;  1AOI B;  5B24 A;  5CP6 A;  5JA4 B;  1P3G B;  4UUZ A;  3AZE A;  3LJA A;  1KX5 D;  2FJ7 C;  1P3O A;  1P3L B;  1AOI D;  3WTP A;  2NQB C;  5B40 D;  3UT9 A;  3UTA D;  5GT0 C;  3W97 D;  3AZK C;  5CPI B;  5JRG C;  5B2I C;  3MGQ D;  1P34 C;  1ID3 B;  5BNV B;  2JSS A;  3B6F C;  5DNN D;  4AWL C;  3B6F B;  4KGC A;  2F8N K;  2CV5 C;  1P3G A;  1S32 C;  3REI B;  3UTA B;  5B1L C;  3W97 B;  3X1T C;  5AV6 A;  1P3B A;  4J8V C;  3X1V B;  3AFA A;  3AV2 A;  4YM6 A;  3X1V C;  3REH D;  5B32 G;  1KX5 B;  3AZN B;  4X23 B;  3TU4 B;  1P3L D;  5B1M B;  4KHA B;  4XUJ D;  5AV9 C;  1WWI A;  5B1M C;  4J8X D;  3UTB C;  5GSU B;  4H9O B;  3REK A;  1EQZ A;  5B32 A;  2RVQ D;  3AZL B;  3MGR C;  4QLC C;  4CSR A;  5DNN B;  3REH B;  5BT1 C;  3LZ1 A;  5CPK A;  1ZLA C;  3REJ D;  5BO0 A;  1ZLA A;  4JJN B;  3WAA A;  3MGP B;  3WKJ C;  4R8P C;  4NFT A;  3AZK A;  5CPJ A;  5B32 C;  3X1V D;  4DRA A; 
#chains in the Genus database with same CATH topology
 1M19 C;  5CPK D;  4WNN B;  1P3K B;  4H9P B;  3X1S A;  4J8V D;  4J8W C;  4G91 C;  4UUZ B;  4X23 D;  3O62 A;  3TU4 D;  3AV1 C;  4KUD D;  3MGP D;  1TZY B;  4WU9 A;  1M1A D;  4WU9 C;  5GSU D;  2F8N G;  4NE3 A;  5CP6 C;  3MGQ B;  1ID3 D;  1F66 C;  1AOI A;  4CAY B;  4H9P A;  1P3M B;  1ZLA B;  2F8N D;  4LD9 B;  4HGA B;  5CPK B;  1P3K D;  2YFV B;  3B6F D;  5AV5 B;  3VH6 T;  4CSR B;  3REH A;  3X1U A;  4G92 B;  3AZG D;  5CPJ B;  3W98 D;  4KUD B;  2F8N A;  4H9N B;  3AZJ D;  1WWS A;  3MVD D;  3AZM C;  2NQB D;  3W99 B;  3AZM B;  1AOI C;  5BO0 B;  3AZG A;  5AV8 A;  2CWE A;  4X23 A;  3TU4 A;  1M18 A;  3X1U B;  1TZY A;  5GT3 C;  3X1U C;  4Z66 C;  2G5I C;  3WTP C;  3X1S C;  3V9R B;  3X1S B;  4DRB A;  4XZQ C;  4CAY A;  3MVD B;  4J8X B;  1P3M A;  4LD9 A;  1M1A B;  3NQU B;  5E5A C;  5B33 A;  2HUE C;  3WKJ A;  3WTP D;  3X1U D;  3W98 A;  3X1V A;  3AZF B;  4XZQ D;  3REJ B;  3W99 C;  3B0D C;  1F1E A;  3X1S D;  4J8V A;  2DQN C;  4Z5T A;  3LZ0 D;  5DNN A;  2VQR A;  5CPI D;  3KSY A;  3KXB D;  3AZM D;  2Y2H A;  4E44 A;  1KX3 D;  3WTP B;  1A7W A;  4H9O A;  1P3L A;  5G49 B;  3AZF D;  4XZQ B;  3MVD C;  4J8V B;  3AZJ C;  3AZI D;  5DNM D;  3W96 C;  2YFW A;  1P34 B;  3UT9 B;  3C1C A;  1EQZ C;  3NQU A;  4AWL B;  1ID3 C;  1F66 D;  5CP6 D;  3REJ A;  5AV5 D;  2FJ7 A;  5B0Y B;  3B0C W;  3AZI B;  3MNN D;  1KX4 D;  2CV5 A;  3W98 B;  4XUJ B;  3AZE C;  1JFI A;  5DNM B;  3AL0 C;  5B32 D;  3B6F A;  2Y2I A;  4R8P D;  3KXB B;  5B24 D;  3EPL A;  3AZH A;  1KX3 B;  5AY8 D;  3C1B D;  4H9N A;  5AVC C;  5B0Y D;  4KUD A;  5BNX B;  5BT1 D;  4Z66 A;  2Y2N A;  5F99 D;  3LEL B;  2YFV A;  2F2A C;  3B6G A;  4QLC D;  1F66 A;  5B40 A;  3UT9 D;  4H9Q A;  2F8N H;  3MGS A;  5CP6 B;  5B1L B;  3REH C;  1M1A A;  5AV9 D;  3KUY C;  4WV4 B;  4J8U B;  1TZY D;  2Y2O A;  3LJA C;  3B0B A;  3KWQ A;  3C1C C;  2ZY4 A;  3WA9 B;  4R8P B;  4H9S C;  1P3M D;  4LD9 D;  1P3F D;  2HIO B;  3WTP E;  3WA9 C;  1KU5 A;  4JJN A;  3VH5 W;  5B1L D;  3REL C;  3AZJ A;  4WJ3 C;  3VH6 W;  1W2E A;  5B2J B;  3MGQ C;  2XD1 A;  3AV1 B;  4ZUX B;  4Z66 B;  5B2J C;  3AFA D;  3AV2 D;  1P34 D;  5DNN C;  4QLC B;  1N1J A;  2HIO D;  1F66 B;  5JRG D;  3WAA C;  5B31 A;  5B2I D;  3AZK D;  3B6G B;  3REK D;  2HUE B;  3AV1 A;  3AZN A;  5B2J D;  3AFA C;  5B32 B;  3AV2 C;  5AV5 A;  2FJ7 D;  3AFA B;  3AV2 B;  3AZI A;  2JE5 A;  2LY8 A;  1P3F C;  3WA9 D;  3REL B;  1P3B B;  1P3F B;  5B1M A;  4R8P A;  1TZY C;  5GT3 A;  2W8S A;  5KDM A;  5F99 B;  3LEL D;  3LZ0 B;  5AV8 C;  3A6N D;  2FJ7 B;  3O62 D;  3MNN A;  1KX4 A;  4Z66 D;  4WZS B;  1U35 A;  5C3I C;  5GT0 A;  3UT9 C;  3AZK B;  3B6G D;  3MGP A;  5AVC A;  1HTA A;  5B31 B;  3AZH C;  3A6N B;  4KGC D;  5BNV A;  5GXQ D;  5G49 A;  5B0Y C;  1P3A D;  2PYO A;  3W98 C;  3P5J B;  2Y2J A;  5BS7 C;  2Y2Q A;  4YM6 B;  4Z2M H;  1P3B D;  5AV6 C;  5B31 D;  4NE5 A;  1H3O A;  3MNN B;  3AYW C;  1KX4 B;  5AV6 B;  3AYW A;  1M1A C;  5C3I B;  3AV1 D;  3H0R C;  4ZUX D;  1KX5 A;  2BYK B;  4X23 C;  3TU4 C;  2ARO C;  4J8U A;  3AZE D;  5B24 B;  5JRG B;  5B2I B;  5AY8 B;  3C1B B;  3MVD A;  1PZR A;  3AZM A;  3AYW D;  3KFU G;  3W96 D;  5AV6 D;  3FDD A;  2RIQ A;  2BYM A;  3X1T B;  5DNM C;  1P3A B;  3A6N A;  4WU8 A;  1U35 C;  1P3A C;  3LJA B;  4H9R B;  3W99 A;  2NZD D;  3KXB C;  5CPI A;  5BNX A;  1KX3 C;  3W96 B;  1KX3 A;  5AV9 B;  3O62 C;  5CPI C;  1BH9 A;  3KXB A;  4J8U D;  1P3O B;  3AN2 D;  4WU8 B;  3O62 B;  3LEL C;  4WU8 C;  5GXQ A;  3X1T A;  4WNN A;  1ULY A;  3AZF A;  1T3U A;  5E5A D;  3REI C;  1P3P A;  4WU9 B;  4Z5T C;  5B33 B;  5AVB C;  3MGR B;  5AVB B;  1P3O D;  4WU8 D;  4Z2M G;  3C1C B;  2ARO A;  4J8U C;  1HQ3 B;  1S32 D;  4YM6 D;  5B0Z B;  1M18 B;  2Y2K A;  3NQJ A;  5GT3 D;  1M19 B;  2NQB A;  2NZD B;  3KUY A;  1R4V A;  3REK C;  2HIO C;  5GSU A;  3REK B;  3WAA D;  4G91 B;  3AN2 B;  4H9S A;  2IO5 C;  3AZG C;  3REL D;  2G5H C;  4WU9 D;  1P3M C;  4LD9 C;  1M19 A;  3MGP C;  3WKJ B;  3EPH A;  4KUD C;  3VH5 A;  3VH5 T;  1P3P B;  4J8W D;  1M18 C;  3MGS C;  2Y2L A;  3REL A;  3LJA D;  1BH8 B;  5KDM B;  1P3I C;  5GT3 B;  3W97 A;  1M19 D;  3WKJ D;  3KWQ C;  3UTA A;  5CHL B;  4E45 A;  4KGC B;  5GXQ B;  2JCH A;  4H9R A;  5F99 C;  5GXQ C;  5AV9 A;  5E5A B;  3AN2 A;  3W96 A;  3MGR D;  5B24 C;  2RVQ C;  1EQZ B;  5AY8 C;  3C1B C;  4M6B A;  1P3P D;  4QLC A;  2HIO A;  3MGR A;  3A6N C;  5B0Z A;  1HQ3 D;  1S32 B;  5DNM A;  3LZ1 D;  4XUJ C;  5B2J A;  3AZE B;  4XUJ A;  1M18 D;  3KWQ B;  4ZBJ C;  3MNN C;  3AYW B;  1KX4 C;  1EQZ D;  4J8X A;  3B0C T;  3X1T D;  4H9Q B;  4UPK A;  5E5A A;  3AZF C;  2CV5 D;  4XZQ A;  5B1L A;  3B0D B;  3LEL A;  3AZI C;  1TAF B;  5GT0 D;  3UTA C;  2BG1 A;  3W97 C;  1B6W A;  5B40 B;  4YM6 C;  1U35 B;  5B40 C;  1Z2C B;  4ZBJ B;  4KHA A;  1P3A A;  5AVC B;  5F99 A;  1KX5 C;  2BYM B;  5B33 D;  3MGQ A;  5GT0 B;  5B0Z C;  2L5A A;  5AVB D;  4EO5 B;  1B67 A;  5JA4 A;  1P3O C;  2J8P A;  3REI D;  3C1C D;  1BH8 A;  3KUY D;  4Z5T D;  3R45 A;  3LZ0 A;  3V9R A;  3UTB B;  5B0Z D;  1JFI B;  1P34 A;  3AN2 C;  2CV5 B;  2YFW B;  5B33 C;  5B0Y A;  2PYO C;  3AZL C;  2PYO B;  4J8W A;  3WAA B;  3EG5 B;  4HGA C;  3VH6 A;  1ID3 A;  3KUY B;  1U35 D;  3LZ1 B;  3NQJ B;  4G92 C;  5CPJ C;  5BS7 A;  2NZD C;  3AZN C;  1P3I A;  4EO5 C;  1P3G D;  5AVC D;  2DF4 C;  4NE6 A;  5B31 G;  3A1K A;  1P3K C;  5GSU C;  4J8W B;  3H0L C;  4JJN D;  4Z5T B;  2UWX A;  1P3F A;  4ZUX C;  2ZM5 A;  4YS3 D;  2Y2P A;  5AV5 C;  2ARO D;  4JJN C;  1BH9 B;  5FUG A;  5CPK C;  4YS3 C;  3LZ1 C;  4YS3 A;  1HQ3 C;  3WA9 A;  3MGS B;  1Q9C A;  3REI A;  5B31 C;  1P3P C;  2Y2M A;  3REJ C;  1TAF A;  1P3B C;  2ZY5 A;  3IP4 C;  1N1J B;  1ZLA D;  2F8N B;  1P3I B;  3AZL A;  1P3G C;  1BFM A;  3AZN D;  4KGC C;  1HQ3 A;  5AV8 B;  3AZH D;  4J8X C;  2IO5 B;  5CPJ D;  5B1M D;  3AZG B;  3AZJ B;  3LZ0 C;  3A1I A;  1P3L C;  3B6G C;  5AVB A;  5B2I A;  5JRG A;  3UTB D;  3W99 D;  2NZD A;  2NQB B;  3KWQ D;  4ZUX A;  2ZY3 A;  4YS3 B;  5FUG B;  2BYK A;  3AZL D;  1P3I D;  2ARO B;  2PYO D;  3UTB A;  1S32 A;  5AV8 D;  3R45 B;  3AZH B;  1P3K A;  5AY8 A;  3C1B A;  1H3O B;  3MGS D;  1AOI B;  3H0M C;  5B24 A;  5CP6 A;  5JA4 B;  1P3G B;  4UUZ A;  3AZE A;  3LJA A;  1KX5 D;  2FJ7 C;  1P3O A;  1P3L B;  2FFF B;  1AOI D;  3WTP A;  2NQB C;  5B40 D;  3UT9 A;  3UTA D;  5GT0 C;  3W97 D;  3AZK C;  5CPI B;  5JRG C;  5B2I C;  3MGQ D;  1P34 C;  1ID3 B;  5BNV B;  3F6T A;  3EPK A;  2JSS A;  3B6F C;  5DNN D;  4AWL C;  3B6F B;  4KGC A;  2F8N K;  2CV5 C;  1P3G A;  1S32 C;  3REI B;  3UTA B;  5B1L C;  3W97 B;  3X1T C;  5AV6 A;  1P3B A;  4J8V C;  3X1V B;  3AFA A;  3AV2 A;  4YM6 A;  3X1V C;  3REH D;  5B32 G;  1KX5 B;  4DQY B;  3AZN B;  4X23 B;  3TU4 B;  3EPJ A;  1P3L D;  5B1M B;  4KHA B;  4XUJ D;  5AV9 C;  1WWI A;  5B1M C;  4J8X D;  3UTB C;  5GSU B;  4H9O B;  3REK A;  1EQZ A;  2XD5 A;  5B32 A;  2RVQ D;  3AZL B;  3MGR C;  4QLC C;  4CSR A;  5DNN B;  3REH B;  5BT1 C;  2Y2G A;  3LZ1 A;  5CPK A;  2ZY2 A;  3REJ D;  5BO0 A;  1ZLA C;  1ZLA A;  4JJN B;  3WAA A;  3MGP B;  3WKJ C;  4R8P C;  4NFT A;  3AZK A;  5CPJ A;  5B32 C;  3X1V D;  4DRA A; 
#chains in the Genus database with same CATH homology
 1M19 C;  5CPK D;  4WNN B;  1P3K B;  4H9P B;  3X1S A;  4J8V D;  4J8W C;  4G91 C;  4UUZ B;  4X23 D;  3O62 A;  3TU4 D;  3AV1 C;  4KUD D;  3MGP D;  1TZY B;  4WU9 A;  1M1A D;  4WU9 C;  5GSU D;  2F8N G;  4NE3 A;  5CP6 C;  3MGQ B;  1ID3 D;  1F66 C;  1AOI A;  4CAY B;  4H9P A;  1P3M B;  1ZLA B;  2F8N D;  4LD9 B;  4HGA B;  5CPK B;  1P3K D;  2YFV B;  3B6F D;  5AV5 B;  3VH6 T;  4CSR B;  3REH A;  3X1U A;  4G92 B;  3AZG D;  5CPJ B;  3W98 D;  4KUD B;  2F8N A;  4H9N B;  3AZJ D;  1WWS A;  3MVD D;  3AZM C;  2NQB D;  3W99 B;  3AZM B;  1AOI C;  5BO0 B;  3AZG A;  5AV8 A;  2CWE A;  4X23 A;  3TU4 A;  1M18 A;  3X1U B;  1TZY A;  5GT3 C;  3X1U C;  4Z66 C;  2G5I C;  3WTP C;  3X1S C;  3V9R B;  3X1S B;  4DRB A;  4XZQ C;  4CAY A;  3MVD B;  4J8X B;  1P3M A;  4LD9 A;  1M1A B;  3NQU B;  5E5A C;  5B33 A;  2HUE C;  3WKJ A;  3WTP D;  3X1U D;  3W98 A;  3X1V A;  3AZF B;  4XZQ D;  3REJ B;  3W99 C;  3B0D C;  1F1E A;  3X1S D;  4J8V A;  2DQN C;  4Z5T A;  3LZ0 D;  5DNN A;  2VQR A;  5CPI D;  3KSY A;  3KXB D;  3AZM D;  2Y2H A;  4E44 A;  1KX3 D;  3WTP B;  1A7W A;  4H9O A;  1P3L A;  5G49 B;  3AZF D;  4XZQ B;  3MVD C;  4J8V B;  3AZJ C;  3AZI D;  5DNM D;  3W96 C;  2YFW A;  1P34 B;  3UT9 B;  3C1C A;  1EQZ C;  3NQU A;  4AWL B;  1ID3 C;  1F66 D;  5CP6 D;  3REJ A;  5AV5 D;  2FJ7 A;  5B0Y B;  3B0C W;  3AZI B;  3MNN D;  1KX4 D;  2CV5 A;  3W98 B;  4XUJ B;  3AZE C;  1JFI A;  5DNM B;  3AL0 C;  5B32 D;  3B6F A;  2Y2I A;  4R8P D;  3KXB B;  5B24 D;  3EPL A;  3AZH A;  1KX3 B;  5AY8 D;  3C1B D;  4H9N A;  5AVC C;  5B0Y D;  4KUD A;  5BNX B;  5BT1 D;  4Z66 A;  2Y2N A;  5F99 D;  3LEL B;  2YFV A;  2F2A C;  3B6G A;  4QLC D;  1F66 A;  5B40 A;  3UT9 D;  4H9Q A;  2F8N H;  3MGS A;  5CP6 B;  5B1L B;  3REH C;  1M1A A;  5AV9 D;  3KUY C;  4WV4 B;  4J8U B;  1TZY D;  2Y2O A;  3LJA C;  3B0B A;  3KWQ A;  3C1C C;  2ZY4 A;  3WA9 B;  4R8P B;  4H9S C;  1P3M D;  4LD9 D;  1P3F D;  2HIO B;  3WTP E;  3WA9 C;  1KU5 A;  4JJN A;  3VH5 W;  5B1L D;  3REL C;  3AZJ A;  4WJ3 C;  3VH6 W;  1W2E A;  5B2J B;  3MGQ C;  2XD1 A;  3AV1 B;  4ZUX B;  4Z66 B;  5B2J C;  3AFA D;  3AV2 D;  1P34 D;  5DNN C;  4QLC B;  1N1J A;  2HIO D;  1F66 B;  5JRG D;  3WAA C;  5B31 A;  5B2I D;  3AZK D;  3B6G B;  3REK D;  2HUE B;  3AV1 A;  3AZN A;  5B2J D;  3AFA C;  5B32 B;  3AV2 C;  5AV5 A;  2FJ7 D;  3AFA B;  3AV2 B;  3AZI A;  2JE5 A;  2LY8 A;  1P3F C;  3WA9 D;  3REL B;  1P3B B;  1P3F B;  5B1M A;  4R8P A;  1TZY C;  5GT3 A;  2W8S A;  5KDM A;  5F99 B;  3LEL D;  3LZ0 B;  5AV8 C;  3A6N D;  2FJ7 B;  3O62 D;  3MNN A;  1KX4 A;  4Z66 D;  4WZS B;  1U35 A;  5C3I C;  5GT0 A;  3UT9 C;  3AZK B;  3B6G D;  3MGP A;  5AVC A;  1HTA A;  5B31 B;  3AZH C;  3A6N B;  4KGC D;  5BNV A;  5GXQ D;  5G49 A;  5B0Y C;  1P3A D;  2PYO A;  3W98 C;  3P5J B;  2Y2J A;  5BS7 C;  2Y2Q A;  4YM6 B;  4Z2M H;  1P3B D;  5AV6 C;  5B31 D;  4NE5 A;  1H3O A;  3MNN B;  3AYW C;  1KX4 B;  5AV6 B;  3AYW A;  1M1A C;  5C3I B;  3AV1 D;  3H0R C;  4ZUX D;  1KX5 A;  2BYK B;  4X23 C;  3TU4 C;  2ARO C;  4J8U A;  3AZE D;  5B24 B;  5JRG B;  5B2I B;  5AY8 B;  3C1B B;  3MVD A;  1PZR A;  3AZM A;  3AYW D;  3KFU G;  3W96 D;  5AV6 D;  3FDD A;  2RIQ A;  2BYM A;  3X1T B;  5DNM C;  1P3A B;  3A6N A;  4WU8 A;  1U35 C;  1P3A C;  3LJA B;  4H9R B;  3W99 A;  2NZD D;  3KXB C;  5CPI A;  5BNX A;  1KX3 C;  3W96 B;  1KX3 A;  5AV9 B;  3O62 C;  5CPI C;  1BH9 A;  3KXB A;  4J8U D;  1P3O B;  3AN2 D;  4WU8 B;  3O62 B;  3LEL C;  4WU8 C;  5GXQ A;  3X1T A;  4WNN A;  1ULY A;  3AZF A;  1T3U A;  5E5A D;  3REI C;  1P3P A;  4WU9 B;  4Z5T C;  5B33 B;  5AVB C;  3MGR B;  5AVB B;  1P3O D;  4WU8 D;  4Z2M G;  3C1C B;  2ARO A;  4J8U C;  1HQ3 B;  1S32 D;  4YM6 D;  5B0Z B;  1M18 B;  2Y2K A;  3NQJ A;  5GT3 D;  1M19 B;  2NQB A;  2NZD B;  3KUY A;  1R4V A;  3REK C;  2HIO C;  5GSU A;  3REK B;  3WAA D;  4G91 B;  3AN2 B;  4H9S A;  2IO5 C;  3AZG C;  3REL D;  2G5H C;  4WU9 D;  1P3M C;  4LD9 C;  1M19 A;  3MGP C;  3WKJ B;  3EPH A;  4KUD C;  3VH5 A;  3VH5 T;  1P3P B;  4J8W D;  1M18 C;  3MGS C;  2Y2L A;  3REL A;  3LJA D;  1BH8 B;  5KDM B;  1P3I C;  5GT3 B;  3W97 A;  1M19 D;  3WKJ D;  3KWQ C;  3UTA A;  5CHL B;  4E45 A;  4KGC B;  5GXQ B;  2JCH A;  4H9R A;  5F99 C;  5GXQ C;  5AV9 A;  5E5A B;  3AN2 A;  3W96 A;  3MGR D;  5B24 C;  2RVQ C;  1EQZ B;  5AY8 C;  3C1B C;  4M6B A;  1P3P D;  4QLC A;  2HIO A;  3MGR A;  3A6N C;  5B0Z A;  1HQ3 D;  1S32 B;  5DNM A;  3LZ1 D;  4XUJ C;  5B2J A;  3AZE B;  4XUJ A;  1M18 D;  3KWQ B;  4ZBJ C;  3MNN C;  3AYW B;  1KX4 C;  1EQZ D;  4J8X A;  3B0C T;  3X1T D;  4H9Q B;  4UPK A;  5E5A A;  3AZF C;  2CV5 D;  4XZQ A;  5B1L A;  3B0D B;  3LEL A;  3AZI C;  1TAF B;  5GT0 D;  3UTA C;  2BG1 A;  3W97 C;  1B6W A;  5B40 B;  4YM6 C;  1U35 B;  5B40 C;  1Z2C B;  4ZBJ B;  4KHA A;  1P3A A;  5AVC B;  5F99 A;  1KX5 C;  2BYM B;  5B33 D;  3MGQ A;  5GT0 B;  5B0Z C;  2L5A A;  5AVB D;  4EO5 B;  1B67 A;  5JA4 A;  1P3O C;  2J8P A;  3REI D;  3C1C D;  1BH8 A;  3KUY D;  4Z5T D;  3R45 A;  3LZ0 A;  3V9R A;  3UTB B;  5B0Z D;  1JFI B;  1P34 A;  3AN2 C;  2CV5 B;  2YFW B;  5B33 C;  5B0Y A;  2PYO C;  3AZL C;  2PYO B;  4J8W A;  3WAA B;  3EG5 B;  4HGA C;  3VH6 A;  1ID3 A;  3KUY B;  1U35 D;  3LZ1 B;  3NQJ B;  4G92 C;  5CPJ C;  5BS7 A;  2NZD C;  3AZN C;  1P3I A;  4EO5 C;  1P3G D;  5AVC D;  2DF4 C;  4NE6 A;  5B31 G;  3A1K A;  1P3K C;  5GSU C;  4J8W B;  3H0L C;  4JJN D;  4Z5T B;  2UWX A;  1P3F A;  4ZUX C;  2ZM5 A;  4YS3 D;  2Y2P A;  5AV5 C;  2ARO D;  4JJN C;  1BH9 B;  5FUG A;  5CPK C;  4YS3 C;  3LZ1 C;  4YS3 A;  1HQ3 C;  3WA9 A;  3MGS B;  1Q9C A;  3REI A;  5B31 C;  1P3P C;  2Y2M A;  3REJ C;  1TAF A;  1P3B C;  2ZY5 A;  3IP4 C;  1N1J B;  1ZLA D;  2F8N B;  1P3I B;  3AZL A;  1P3G C;  1BFM A;  3AZN D;  4KGC C;  1HQ3 A;  5AV8 B;  3AZH D;  4J8X C;  2IO5 B;  5CPJ D;  5B1M D;  3AZG B;  3AZJ B;  3LZ0 C;  3A1I A;  1P3L C;  3B6G C;  5AVB A;  5B2I A;  5JRG A;  3UTB D;  3W99 D;  2NZD A;  2NQB B;  3KWQ D;  4ZUX A;  2ZY3 A;  4YS3 B;  5FUG B;  2BYK A;  3AZL D;  1P3I D;  2ARO B;  2PYO D;  3UTB A;  1S32 A;  5AV8 D;  3R45 B;  3AZH B;  1P3K A;  5AY8 A;  3C1B A;  1H3O B;  3MGS D;  1AOI B;  3H0M C;  5B24 A;  5CP6 A;  5JA4 B;  1P3G B;  4UUZ A;  3AZE A;  3LJA A;  1KX5 D;  2FJ7 C;  1P3O A;  1P3L B;  2FFF B;  1AOI D;  3WTP A;  2NQB C;  5B40 D;  3UT9 A;  3UTA D;  5GT0 C;  3W97 D;  3AZK C;  5CPI B;  5JRG C;  5B2I C;  3MGQ D;  1P34 C;  1ID3 B;  5BNV B;  3F6T A;  3EPK A;  2JSS A;  3B6F C;  5DNN D;  4AWL C;  3B6F B;  4KGC A;  2F8N K;  2CV5 C;  1P3G A;  1S32 C;  3REI B;  3UTA B;  5B1L C;  3W97 B;  3X1T C;  5AV6 A;  1P3B A;  4J8V C;  3X1V B;  3AFA A;  3AV2 A;  4YM6 A;  3X1V C;  3REH D;  5B32 G;  1KX5 B;  4DQY B;  3AZN B;  4X23 B;  3TU4 B;  3EPJ A;  1P3L D;  5B1M B;  4KHA B;  4XUJ D;  5AV9 C;  1WWI A;  5B1M C;  4J8X D;  3UTB C;  5GSU B;  4H9O B;  3REK A;  1EQZ A;  2XD5 A;  5B32 A;  2RVQ D;  3AZL B;  3MGR C;  4QLC C;  4CSR A;  5DNN B;  3REH B;  5BT1 C;  2Y2G A;  3LZ1 A;  5CPK A;  2ZY2 A;  3REJ D;  5BO0 A;  1ZLA C;  1ZLA A;  4JJN B;  3WAA A;  3MGP B;  3WKJ C;  4R8P C;  4NFT A;  3AZK A;  5CPJ A;  5B32 C;  3X1V D;  4DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...