4Z5TB

The nucleosome containing human h3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tB00
1BH8B 4H9PA 3X1SC 4NE5A 1BFMA 2YFVB 3VH5W 3AZGD 2NZDB 3LJAA 1TZYB 1P34D 5GT0C 5AV9A 4KHAA 4X23B 2FJ7A 3LZ1C 5B0ZC 1KX5B 1U35A 5G49B 1F66C 3KWQD 3REIA 5GXQD 3AZHD 1P3IA 2AROC 3REJB 5CPKD 1M18A 3AZFC 1P3KB 5B1LB 5E5AB 3MNNC 1M19B 2CV5A 3RELA 5CPID 4KGCA 5C3IB 4YM6D 3B6FD 3AZGC 2NQBD 5B33D 5JRGC 5AV6B 3X1SB 1P34C 3AZMC 1HTAA 5B40A 3O62C 4R8PB 3A6NA 3X1VD 3AV2A 3MVDA 3LELA 3MGRD 3AV1B 5B0YA 1ZLAD 3KWQC 3LZ1B 1BH8A 3MGQA 1F66B 4J8WC 1S32C 3LJAD 1TZYA 5CPIC 2AROB 4ZUXC 4XZQB 4X23A 5AV9D 3AZFB 4YM6C 1KX5A 3B6FC 5G49A 3MNNB 1U35D 3REKC 2YFWB 3WKJC 4E44A 5B33C 4Z2MG 2NQBC 3MGSC 3REID 3X1VC 3AZGB 1ZLAC 3REJA 1P3ID 5JRGB 1P34B 3AZMB 1M18D 3C1CD 1P3KA 4UUZA 5B1LA 3O62B 1M19A 3LJAC 4JJNC 3VH5T 3X1SA 5AY8B 4J8WB 1S32B 5AV9C 3A6ND 3AV2D 3AV1A 4HGAB 3MVDD 3LELD 1M1AB 5B0YD 5CPIB 4ZUXB 5GT0A 5CHLB 5B0ZA 3LZ1A 4LD9C 1F66A 3REKB 3WKJB 1ID3D 3C1CC 3MGSB 2NZDD 1TZYD 2AROA 4XZQA 3AZFA 4Z5TC 4X23D 4H9SC 1KX5D 3MNNA 2YFWA 1P3BC 1A7WA 3AZKB 4H9RA 1P3LC 3AZGA 1KX4B 5AV5C 5B0YC 4JJNB 5JRGA 3UTBC 1P34A 3AZMA 3W98B 3O62A 1P3KD 2PYOB 5B1LD 5E5AD 3AZIC 1M19D 5DNMB 5CPJB 2F8NH 3KWQA 1ID3C 3KXBC 4CSRB 2NZDC 4LD9B 1B6WA 5AV6D 3X1SD 4J8WA 4G92C 1S32A 4R8PD 5KDMB 3AV1D 5CPIA 4ZUXA 5B1MC 4Z5TB 4YM6A 3LZ1D 3WAAB 3REKA 1F66D 2NQBA 5B33A 1P3BB 2IO5B 3WKJA 3MGSA 1P3LB 5E5AC 5AV8B 4J8VC 1ZLAA 5AV5B 3UTBB 1JFIB 4XZQD 3AZFD 4Z66C 4E45A 3MNND 3AZIB 5AV6C 1ID3B 3KXBB 4R8PC 3AZJB 3AV1C 4JJNA 5JRGD 1WWSA 4G92B 3AZMD 2PYOA 3V9RA 3O62D 5DNMA 1BH9B 5CPJA 1ULYA 4CSRA 5B1MB 4NE3A 4EO5C 3X1TB 5JA4B 3LZ0C 1Q9CA 4LD9A 3AFAC 5AY8D 4J8WD 3AZEC 1S32D 4XZQC 3MGPC 3C1CA 5KDMA 5BO0B 3WTPC 4J8VB 1M1AD 4AWLC 4ZUXD 4NE6A 4Z5TA 4H9SA 4Z66B 1HQ3B 3REKD 1P3BA 3WKJD 3VH6W 1P3LA 3MGSD 1H3OB 1KX3C 3C1BC 3TU4B 2F8NK 5AV5A 3UTBA 1JFIA 4WNNB 3B0CW 1TAFB 3AZIA 1P3GC 3AZKD 5AY8C 1ID3A 3KXBA 4EO5B 2YFVA 3LZ0B 2NZDA 1KX4D 4HGAC 2F8NB 3AFAB 4JJND 1M1AC 3AZEB 3KUYC 3W98D 3MGPB 2PYOD 1BH9A 3WTPB 5DNMD 4XUJB 5CPJD 4AWLB 3W97C 3UTAB 5B1MA 4LD9D 5AVBB 1KX3B 3X1UB 5E5AA 4NFTA 3C1BB 4J8VA 3WA9C 3W99B 3AZKC 4Z5TD 3WAAD 5FUGB 4Z66A 1HQ3A 1KX4C 1P3FC 1P3BD 1P3GB 1EQZC 5AV6A 3W98C 1H3OA 1P3LD 4R8PA 2PYOC 5AV8D 5DNMC 5AV5D 1KU5A 3UTBD 5CPJC 4WNNA 3KUYB 1TAFA 5AVCC 3AZID 3W97B 3KXBD 3LZ0A 3AZJD 2F8NA 5B32C 3AFAA 3AZEA 3MGPA 2HIOB 3WAAC 5B2JD 3WTPA 4WU9C 4XUJA 2IO5C 3AZLC 3WA9B 3UT9B 3VH6T 5B1MD 5F99C 3X1TD 3AYWC 3B6GC 4KUDB 5AV8C 1P3FB 1EQZB 1KX3A 5GT3B 3C1BA 4J8VD 4DRAA 4QLCC 5GSUC 4Z66D 3AZJC 1HQ3D 5AVCB 1P3GA 2F8NG 5AY8A 5B2JC 4G91C 3TU4D 1AOIC 5B32B 1M1AA 1P3AC 3KUYA 1P3OC 5BS7C 4J8XC 3X1TC 4WU9B 3AZLB 3W97A 4KHAB 2FJ7B 5F99B 2CWEA 3AYWB 3LZ0D 3B6GB 2F8ND 3AFAD 2BYMB 3AZED 3MGPD 2HIOA 3REHC 1HQ3C 4YS3B 3WTPD 3WA9A 4XUJD 3AZKA 5B2IB 4QLCB 3UTAD 1P3PD 5GSUB 5BT1C 4KUDA 3AZNC 2HUEC 5B31C 5B24C 3TU4C 3B0DC 2CV5B 3RELB 1P3FA 1KX4A 1EQZA 4KGCB 3W98A 4H9NB 5AVBD 1P3MC 1KX3D 3X1UD 3C1BD 5B2JB 4G91B 5DNNC 1AOIB 3W99D 1P3AB 1P3OB 5B40B 4J8XB 2L5AA 5AVCA 1P3GD 3MGQB 5B32A 4J8UB 3R45B 4XUJC 3KUYD 3UTAC 1P3PC 3W96C 3REHB 5CP6C 3WAAA 4WU9A 2RVQC 3AZLA 2BYKB 3W97D 5AVBC 5F99A 3X1UC 3AYWA 3AZNB 2HUEB 3B6GA 5B24B 5B31B 5AV8A 3B0DB 3W99C 2BYMA 4CAYB 2HIOD 1P3MB 4YS3A 4WU8C 4H9OB 5DNNB 3WA9D 3AN2C 5B2IA 3UT9D 4QLCA 5GSUA 4UUZB 4KUDD 1WWIA 5BNVB 3AZJA 1P3FD 1EQZD 5B32G 4H9NA 5GT3D 5B2JA 1AOIA 1P3AA 1P3OA 1P3PB 5BS7A 3W96B 4H9QB 5JA4A 5CP6B 3NQJB 4J8XA 3X1TA 5AVCD 1R4VA 5GT0B 3WTPE 2HIOC 4M6BA 5B0ZB 5GXQC 3AZHC 5BO0A 4J8UA 5B32D 3R45A 5CPKC 3UT9C 3REHA 4KUDC 3NQUB 4WU8B 4WU9D 3AZLD 4Z2MH 2BYKA 4ZBJC 3AN2B 2FJ7D 5GT3C 5F99D 3AZNA 3AYWD 3B6GD 3VH5A 5B31A 5B24A 3TU4A 4H9RB 4CAYA 1P3MA 3MGRC 4YS3D 4WZSB 4H9OA 5DNNA 5B2ID 4QLCD 5GSUD 5BNVA 2CV5D 3RELD 3KWQB 4KGCD 4WV4B 5GXQB 3AZHB 1AOID 5CPKB 1P3AD 3UTAA 1P3PA 1P3OD 5B40D 2FJ7C 3W96A 4H9QA 1N1JB 5CP6A 3NQJA 4J8XD 1U35C 5B31G 3VH6A 5BNXB 4ZBJB 3REIC 5AVBA 3X1UA 4YM6B 3B6FB 3MGQD 3B0CT 4YS3C 2NQBB 5B33B 4J8UD 1P3IC 3W99A 1M18C 5B2IC 2JSSA 3REHD 3X1VB 2LY8A 5FUGA 3MGRB 3NQUA 4WU8A 3RELC 2CV5C 1ZLAB 3AN2A 4KGCC 5BT1D 3AZND 5B31D 5B24D 4H9PB 1F1EA 5B40C 3A6NC 1P3MD 3AV2C 3MVDC 3LELC 3LJAB 5DNND 3REJD 3KSYA 5AV9B 3V9RB 3MGQC 1U35B 3B0BA 4J8UC 1B67A 3REIB 5GXQA 3AZHA 1TZYC 5CPKA 1P3IB 3UT9A 1M18B 4X23C 3C1CB 1KX5C 1N1JA 3W96D 5CP6D 2RVQD 5BNXA 5GT0D 5GT3A 3B6FA 5B0ZD 4DRBA 3REJC 3X1VA 1P3KC 5B1LC 3A6NB 1M19C 3MGRA 3AV2B 3MVDB 3LELB 4WU8D 5B0YB 2AROD 3AN2D 5C3IC
chains in the Genus database with same CATH superfamily
1BH8B 4H9PA 3X1SC 4NE5A 1BFMA 2YFVB 3VH5W 3AZGD 2NZDB 3LJAA 1TZYB 1P34D 5GT0C 5AV9A 4KHAA 4X23B 2FJ7A 3LZ1C 5B0ZC 1KX5B 1U35A 5G49B 1F66C 3KWQD 3REIA 1PZRA 5GXQD 3AZHD 1P3IA 2AROC 3REJB 5CPKD 1M18A 3AZFC 1P3KB 5B1LB 5E5AB 3MNNC 1M19B 2CV5A 3RELA 5CPID 4KGCA 5C3IB 4YM6D 3B6FD 3AZGC 3KFUG 2ZY4A 5B33D 2NQBD 5JRGC 5AV6B 3X1SB 1P34C 3AZMC 1HTAA 5B40A 3O62C 4R8PB 3A6NA 3X1VD 3AV2A 3MVDA 3LELA 3MGRD 3AV1B 5B0YA 1ZLAD 3KWQC 3LZ1B 1BH8A 3MGQA 1F66B 4J8WC 1S32C 2Y2GA 3LJAD 1TZYA 5CPIC 2AROB 4ZUXC 4XZQB 4X23A 5AV9D 3AZFB 4YM6C 1KX5A 3B6FC 5G49A 3MNNB 1U35D 3REKC 2YFWB 3WKJC 4E44A 5B33C 4Z2MG 2NQBC 3MGSC 3REID 3X1VC 3AZGB 1ZLAC 3REJA 1P3ID 5JRGB 3EPLA 1P34B 3AZMB 1M18D 3C1CD 3P5JB 4UUZA 5B1LA 3O62B 1P3KA 1M19A 2XD1A 3LJAC 4JJNC 3VH5T 3X1SA 2Y2QA 5AY8B 4J8WB 1S32B 5AV9C 3A6ND 3AV2D 3AV1A 4HGAB 3MVDD 3LELD 1Z2CB 5B0YD 1M1AB 5CPIB 4ZUXB 5GT0A 5CHLB 5B0ZA 3LZ1A 4LD9C 2ZY5A 1F66A 3REKB 3WKJB 1ID3D 3C1CC 3MGSB 2UWXA 2NZDD 3H0MC 1TZYD 2AROA 4XZQA 3AZFA 4Z5TC 4X23D 4H9SC 1KX5D 3MNNA 2YFWA 1P3BC 1A7WA 3AZKB 4H9RA 1P3LC 3AZGA 1KX4B 5AV5C 5B0YC 4JJNB 5JRGA 3UTBC 1P34A 3AZMA 3W98B 3O62A 1P3KD 2PYOB 2Y2IA 5B1LD 5E5AD 3AZIC 1M19D 5DNMB 5CPJB 2FFFB 2F8NH 3KWQA 2VQRA 3KXBC 1ID3C 4CSRB 2Y2NA 2NZDC 4LD9B 1B6WA 5AV6D 3X1SD 4J8WA 4G92C 1S32A 1W2EA 4R8PD 5KDMB 3AV1D 5CPIA 4ZUXA 5B1MC 4Z5TB 4YM6A 3LZ1D 3WAAB 2ZM5A 3REKA 1F66D 2NQBA 5B33A 1P3BB 2IO5B 3WKJA 2Y2PA 3MGSA 1P3LB 5E5AC 5AV8B 4J8VC 1ZLAA 5AV5B 3UTBB 1JFIB 4XZQD 3AZFD 4Z66C 4E45A 3MNND 3AZIB 5AV6C 1ID3B 3KXBB 4R8PC 3AZJB 3AV1C 4JJNA 5JRGD 3IP4C 1WWSA 4G92B 3AZMD 2PYOA 3V9RA 3O62D 5DNMA 1BH9B 5CPJA 1ULYA 4CSRA 5B1MB 4NE3A 4EO5C 3X1TB 5JA4B 3LZ0C 1Q9CA 4LD9A 3AFAC 5AY8D 4J8WD 3AZEC 1S32D 4XZQC 3MGPC 3C1CA 5KDMA 5BO0B 3WTPC 4J8VB 1M1AD 4AWLC 4ZUXD 4NE6A 4Z5TA 4H9SA 4Z66B 1HQ3B 3REKD 1P3BA 3WKJD 3VH6W 1P3LA 3MGSD 1H3OB 1KX3C 3C1BC 3TU4B 2F8NK 5AV5A 3UTBA 1JFIA 2Y2HA 4WNNB 3B0CW 1TAFB 3AZIA 1P3GC 3AZKD 5AY8C 1ID3A 3KXBA 4EO5B 2YFVA 2G5HC 2BG1A 3LZ0B 1KX4D 4HGAC 2F8NB 2NZDA 3AFAB 4JJND 1M1AC 3AZEB 3KUYC 3W98D 3MGPB 2PYOD 1BH9A 3WTPB 5DNMD 4XUJB 5CPJD 4AWLB 3W97C 3UTAB 5B1MA 4LD9D 2XD5A 5AVBB 1KX3B 3X1UB 5E5AA 4NFTA 3C1BB 4J8VA 3WA9C 3W99B 3AZKC 4Z5TD 3WAAD 5FUGB 4Z66A 1HQ3A 1KX4C 1P3FC 1P3BD 1P3GB 1EQZC 5AV6A 3W98C 1H3OA 1P3LD 4R8PA 2PYOC 3AL0C 5AV8D 5DNMC 5AV5D 1KU5A 3UTBD 5CPJC 2DF4C 4WNNA 3KUYB 1TAFA 3F6TA 5AVCC 3AZID 3W97B 3KXBD 3LZ0A 3AZJD 2F8NA 5B32C 3AFAA 2Y2LA 3EG5B 3AZEA 3MGPA 2HIOB 3WAAC 5B2JD 3WTPA 4WU9C 4XUJA 2IO5C 3AZLC 3WA9B 3UT9B 3VH6T 5B1MD 5F99C 2RIQA 3X1TD 3AYWC 3B6GC 4KUDB 5AV8C 1P3FB 2DQNC 1EQZB 1KX3A 5GT3B 3C1BA 4J8VD 4DRAA 4QLCC 5GSUC 4Z66D 3AZJC 1HQ3D 5AVCB 1P3GA 2F8NG 5AY8A 3A1IA 2ZY3A 4DQYB 5B2JC 4G91C 3TU4D 1AOIC 5B32B 1M1AA 1P3AC 3KUYA 1P3OC 5BS7C 2F2AC 4J8XC 3X1TC 3H0RC 4WU9B 3AZLB 3W97A 4KHAB 2FJ7B 3EPJA 5F99B 2CWEA 3AYWB 3LZ0D 3B6GB 2F8ND 3AFAD 2BYMB 3AZED 2ZY2A 3MGPD 2HIOA 3REHC 1HQ3C 4YS3B 3WTPD 3WA9A 4UPKA 4XUJD 3AZKA 5B2IB 4QLCB 3UTAD 1P3PD 5GSUB 5BT1C 4KUDA 3AZNC 2HUEC 5B31C 5B24C 3TU4C 3B0DC 2CV5B 3RELB 1P3FA 1KX4A 1EQZA 4KGCB 3W98A 4H9NB 5AVBD 1P3MC 1KX3D 3X1UD 3C1BD 5B2JB 4G91B 5DNNC 1AOIB 3W99D 1P3AB 1P3OB 5B40B 4J8XB 2L5AA 5AVCA 1P3GD 2Y2MA 3MGQB 5B32A 4J8UB 3R45B 4XUJC 3KUYD 3UTAC 1P3PC 3W96C 3REHB 5CP6C 3WAAA 4WU9A 4WJ3C 2RVQC 3AZLA 2BYKB 3W97D 5AVBC 5F99A 3X1UC 3AYWA 3AZNB 2HUEB 3B6GA 5B31B 5B24B 5AV8A 3B0DB 3W99C 2BYMA 3EPKA 2Y2JA 4CAYB 2HIOD 1P3MB 4YS3A 2JE5A 4WU8C 4H9OB 5DNNB 3WA9D 3AN2C 5B2IA 3UT9D 4QLCA 3H0LC 5GSUA 4UUZB 4KUDD 1WWIA 5BNVB 3AZJA 1P3FD 1EQZD 5B32G 4H9NA 5GT3D 2Y2OA 5B2JA 1AOIA 1P3AA 1P3OA 1P3PB 5BS7A 3W96B 4H9QB 5JA4A 5CP6B 3NQJB 4J8XA 3X1TA 5AVCD 1R4VA 5GT0B 3WTPE 2HIOC 4M6BA 5B0ZB 5GXQC 3AZHC 5BO0A 4J8UA 5B32D 3R45A 5CPKC 3UT9C 3REHA 4KUDC 3NQUB 4WU8B 4WU9D 3FDDA 3AZLD 4Z2MH 2BYKA 4ZBJC 3AN2B 2FJ7D 5GT3C 5F99D 3AZNA 3AYWD 3B6GD 3VH5A 5B31A 5B24A 3TU4A 4H9RB 4CAYA 1P3MA 3MGRC 4YS3D 4WZSB 4H9OA 5DNNA 5B2ID 4QLCD 5GSUD 5BNVA 2CV5D 3RELD 3KWQB 4KGCD 1T3UA 4WV4B 5GXQB 3AZHB 1AOID 5CPKB 1P3AD 3UTAA 1P3PA 1P3OD 5B40D 2FJ7C 3W96A 4H9QA 1N1JB 5CP6A 3NQJA 4J8XD 1U35C 5B31G 3VH6A 5BNXB 4ZBJB 3REIC 5AVBA 3X1UA 4YM6B 3B6FB 3MGQD 3B0CT 4YS3C 2NQBB 5B33B 4J8UD 1P3IC 3W99A 1M18C 5B2IC 2JSSA 3REHD 3X1VB 2LY8A 5FUGA 3MGRB 3NQUA 4WU8A 3RELC 2CV5C 1ZLAB 3EPHA 3AN2A 4KGCC 5BT1D 3AZND 5B31D 5B24D 4H9PB 1F1EA 5B40C 3A6NC 1P3MD 3AV2C 3MVDC 3LELC 3LJAB 5DNND 2G5IC 3REJD 3KSYA 5AV9B 3V9RB 3MGQC 1U35B 3B0BA 4J8UC 3A1KA 1B67A 3REIB 2JCHA 5GXQA 3AZHA 1TZYC 5CPKA 1P3IB 3UT9A 1M18B 4X23C 3C1CB 2Y2KA 1KX5C 1N1JA 3W96D 5CP6D 2RVQD 5BNXA 5GT0D 5GT3A 3B6FA 5B0ZD 4DRBA 3REJC 2J8PA 3X1VA 1P3KC 2W8SA 5B1LC 3A6NB 1M19C 3MGRA 3AV2B 3MVDB 3LELB 4WU8D 5B0YB 2AROD 3AN2D 5C3IC
chains in the Genus database with same CATH topology
1BH8B 4H9PA 3X1SC 4NE5A 1BFMA 2YFVB 3VH5W 3AZGD 2NZDB 3LJAA 1TZYB 1P34D 5GT0C 5AV9A 4KHAA 4X23B 2FJ7A 3LZ1C 5B0ZC 1KX5B 1U35A 5G49B 1F66C 3KWQD 3REIA 1PZRA 5GXQD 3AZHD 1P3IA 2AROC 3REJB 5CPKD 1M18A 3AZFC 1P3KB 5B1LB 5E5AB 3MNNC 1M19B 2CV5A 3RELA 5CPID 4KGCA 5C3IB 4YM6D 3B6FD 3AZGC 3KFUG 2ZY4A 5B33D 2NQBD 5JRGC 5AV6B 3X1SB 1P34C 3AZMC 1HTAA 5B40A 3O62C 4R8PB 3A6NA 3X1VD 3AV2A 3MVDA 3LELA 3MGRD 3AV1B 5B0YA 1ZLAD 3KWQC 3LZ1B 1BH8A 3MGQA 1F66B 4J8WC 1S32C 2Y2GA 3LJAD 1TZYA 5CPIC 2AROB 4ZUXC 4XZQB 4X23A 5AV9D 3AZFB 4YM6C 1KX5A 3B6FC 5G49A 3MNNB 1U35D 3REKC 2YFWB 3WKJC 4E44A 5B33C 4Z2MG 2NQBC 3MGSC 3REID 3X1VC 3AZGB 1ZLAC 3REJA 1P3ID 5JRGB 3EPLA 1P34B 3AZMB 1M18D 3C1CD 3P5JB 4UUZA 5B1LA 3O62B 1P3KA 1M19A 2XD1A 3LJAC 4JJNC 3VH5T 3X1SA 2Y2QA 5AY8B 4J8WB 1S32B 5AV9C 3A6ND 3AV2D 3AV1A 4HGAB 3MVDD 3LELD 1Z2CB 5B0YD 1M1AB 5CPIB 4ZUXB 5GT0A 5CHLB 5B0ZA 3LZ1A 4LD9C 2ZY5A 1F66A 3REKB 3WKJB 1ID3D 3C1CC 3MGSB 2UWXA 2NZDD 3H0MC 1TZYD 2AROA 4XZQA 3AZFA 4Z5TC 4X23D 4H9SC 1KX5D 3MNNA 2YFWA 1P3BC 1A7WA 3AZKB 4H9RA 1P3LC 3AZGA 1KX4B 5AV5C 5B0YC 4JJNB 5JRGA 3UTBC 1P34A 3AZMA 3W98B 3O62A 1P3KD 2PYOB 2Y2IA 5B1LD 5E5AD 3AZIC 1M19D 5DNMB 5CPJB 2FFFB 2F8NH 3KWQA 2VQRA 3KXBC 1ID3C 4CSRB 2Y2NA 2NZDC 4LD9B 1B6WA 5AV6D 3X1SD 4J8WA 4G92C 1S32A 1W2EA 4R8PD 5KDMB 3AV1D 5CPIA 4ZUXA 5B1MC 4Z5TB 4YM6A 3LZ1D 3WAAB 2ZM5A 3REKA 1F66D 2NQBA 5B33A 1P3BB 2IO5B 3WKJA 2Y2PA 3MGSA 1P3LB 5E5AC 5AV8B 4J8VC 1ZLAA 5AV5B 3UTBB 1JFIB 4XZQD 3AZFD 4Z66C 4E45A 3MNND 3AZIB 5AV6C 1ID3B 3KXBB 4R8PC 3AZJB 3AV1C 4JJNA 5JRGD 3IP4C 1WWSA 4G92B 3AZMD 2PYOA 3V9RA 3O62D 5DNMA 1BH9B 5CPJA 1ULYA 4CSRA 5B1MB 4NE3A 4EO5C 3X1TB 5JA4B 3LZ0C 1Q9CA 4LD9A 3AFAC 5AY8D 4J8WD 3AZEC 1S32D 4XZQC 3MGPC 3C1CA 5KDMA 5BO0B 3WTPC 4J8VB 1M1AD 4AWLC 4ZUXD 4NE6A 4Z5TA 4H9SA 4Z66B 1HQ3B 3REKD 1P3BA 3WKJD 3VH6W 1P3LA 3MGSD 1H3OB 1KX3C 3C1BC 3TU4B 2F8NK 5AV5A 3UTBA 1JFIA 2Y2HA 4WNNB 3B0CW 1TAFB 3AZIA 1P3GC 3AZKD 5AY8C 1ID3A 3KXBA 4EO5B 2YFVA 2G5HC 2BG1A 3LZ0B 1KX4D 4HGAC 2F8NB 2NZDA 3AFAB 4JJND 1M1AC 3AZEB 3KUYC 3W98D 3MGPB 2PYOD 1BH9A 3WTPB 5DNMD 4XUJB 5CPJD 4AWLB 3W97C 3UTAB 5B1MA 4LD9D 2XD5A 5AVBB 1KX3B 3X1UB 5E5AA 4NFTA 3C1BB 4J8VA 3WA9C 3W99B 3AZKC 4Z5TD 3WAAD 5FUGB 4Z66A 1HQ3A 1KX4C 1P3FC 1P3BD 1P3GB 1EQZC 5AV6A 3W98C 1H3OA 1P3LD 4R8PA 2PYOC 3AL0C 5AV8D 5DNMC 5AV5D 1KU5A 3UTBD 5CPJC 2DF4C 4WNNA 3KUYB 1TAFA 3F6TA 5AVCC 3AZID 3W97B 3KXBD 3LZ0A 3AZJD 2F8NA 5B32C 3AFAA 2Y2LA 3EG5B 3AZEA 3MGPA 2HIOB 3WAAC 5B2JD 3WTPA 4WU9C 4XUJA 2IO5C 3AZLC 3WA9B 3UT9B 3VH6T 5B1MD 5F99C 2RIQA 3X1TD 3AYWC 3B6GC 4KUDB 5AV8C 1P3FB 2DQNC 1EQZB 1KX3A 5GT3B 3C1BA 4J8VD 4DRAA 4QLCC 5GSUC 4Z66D 3AZJC 1HQ3D 5AVCB 1P3GA 2F8NG 5AY8A 3A1IA 2ZY3A 4DQYB 5B2JC 4G91C 3TU4D 1AOIC 5B32B 1M1AA 1P3AC 3KUYA 1P3OC 5BS7C 2F2AC 4J8XC 3X1TC 3H0RC 4WU9B 3AZLB 3W97A 4KHAB 2FJ7B 3EPJA 5F99B 2CWEA 3AYWB 3LZ0D 3B6GB 2F8ND 3AFAD 2BYMB 3AZED 2ZY2A 3MGPD 2HIOA 3REHC 1HQ3C 4YS3B 3WTPD 3WA9A 4UPKA 4XUJD 3AZKA 5B2IB 4QLCB 3UTAD 1P3PD 5GSUB 5BT1C 4KUDA 3AZNC 2HUEC 5B31C 5B24C 3TU4C 3B0DC 2CV5B 3RELB 1P3FA 1KX4A 1EQZA 4KGCB 3W98A 4H9NB 5AVBD 1P3MC 1KX3D 3X1UD 3C1BD 5B2JB 4G91B 5DNNC 1AOIB 3W99D 1P3AB 1P3OB 5B40B 4J8XB 2L5AA 5AVCA 1P3GD 2Y2MA 3MGQB 5B32A 4J8UB 3R45B 4XUJC 3KUYD 3UTAC 1P3PC 3W96C 3REHB 5CP6C 3WAAA 4WU9A 4WJ3C 2RVQC 3AZLA 2BYKB 3W97D 5AVBC 5F99A 3X1UC 3AYWA 3AZNB 2HUEB 3B6GA 5B31B 5B24B 5AV8A 3B0DB 3W99C 2BYMA 3EPKA 2Y2JA 4CAYB 2HIOD 1P3MB 4YS3A 2JE5A 4WU8C 4H9OB 5DNNB 3WA9D 3AN2C 5B2IA 3UT9D 4QLCA 3H0LC 5GSUA 4UUZB 4KUDD 1WWIA 5BNVB 3AZJA 1P3FD 1EQZD 5B32G 4H9NA 5GT3D 2Y2OA 5B2JA 1AOIA 1P3AA 1P3OA 1P3PB 5BS7A 3W96B 4H9QB 5JA4A 5CP6B 3NQJB 4J8XA 3X1TA 5AVCD 1R4VA 5GT0B 3WTPE 2HIOC 4M6BA 5B0ZB 5GXQC 3AZHC 5BO0A 4J8UA 5B32D 3R45A 5CPKC 3UT9C 3REHA 4KUDC 3NQUB 4WU8B 4WU9D 3FDDA 3AZLD 4Z2MH 2BYKA 4ZBJC 3AN2B 2FJ7D 5GT3C 5F99D 3AZNA 3AYWD 3B6GD 3VH5A 5B31A 5B24A 3TU4A 4H9RB 4CAYA 1P3MA 3MGRC 4YS3D 4WZSB 4H9OA 5DNNA 5B2ID 4QLCD 5GSUD 5BNVA 2CV5D 3RELD 3KWQB 4KGCD 1T3UA 4WV4B 5GXQB 3AZHB 1AOID 5CPKB 1P3AD 3UTAA 1P3PA 1P3OD 5B40D 2FJ7C 3W96A 4H9QA 1N1JB 5CP6A 3NQJA 4J8XD 1U35C 5B31G 3VH6A 5BNXB 4ZBJB 3REIC 5AVBA 3X1UA 4YM6B 3B6FB 3MGQD 3B0CT 4YS3C 2NQBB 5B33B 4J8UD 1P3IC 3W99A 1M18C 5B2IC 2JSSA 3REHD 3X1VB 2LY8A 5FUGA 3MGRB 3NQUA 4WU8A 3RELC 2CV5C 1ZLAB 3EPHA 3AN2A 4KGCC 5BT1D 3AZND 5B31D 5B24D 4H9PB 1F1EA 5B40C 3A6NC 1P3MD 3AV2C 3MVDC 3LELC 3LJAB 5DNND 2G5IC 3REJD 3KSYA 5AV9B 3V9RB 3MGQC 1U35B 3B0BA 4J8UC 3A1KA 1B67A 3REIB 2JCHA 5GXQA 3AZHA 1TZYC 5CPKA 1P3IB 3UT9A 1M18B 4X23C 3C1CB 2Y2KA 1KX5C 1N1JA 3W96D 5CP6D 2RVQD 5BNXA 5GT0D 5GT3A 3B6FA 5B0ZD 4DRBA 3REJC 2J8PA 3X1VA 1P3KC 2W8SA 5B1LC 3A6NB 1M19C 3MGRA 3AV2B 3MVDB 3LELB 4WU8D 5B0YB 2AROD 3AN2D 5C3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 B;  4H9P A;  3X1S C;  4NE5 A;  1BFM A;  2YFV B;  3VH5 W;  3AZG D;  2NZD B;  3LJA A;  1TZY B;  1P34 D;  5GT0 C;  5AV9 A;  4KHA A;  4X23 B;  2FJ7 A;  3LZ1 C;  5B0Z C;  1KX5 B;  1U35 A;  5G49 B;  1F66 C;  3KWQ D;  3REI A;  5GXQ D;  3AZH D;  1P3I A;  2ARO C;  3REJ B;  5CPK D;  1M18 A;  3AZF C;  1P3K B;  5B1L B;  5E5A B;  3MNN C;  1M19 B;  2CV5 A;  3REL A;  5CPI D;  4KGC A;  5C3I B;  4YM6 D;  3B6F D;  3AZG C;  2NQB D;  5B33 D;  5JRG C;  5AV6 B;  3X1S B;  1P34 C;  3AZM C;  1HTA A;  5B40 A;  3O62 C;  4R8P B;  3A6N A;  3X1V D;  3AV2 A;  3MVD A;  3LEL A;  3MGR D;  3AV1 B;  5B0Y A;  1ZLA D;  3KWQ C;  3LZ1 B;  1BH8 A;  3MGQ A;  1F66 B;  4J8W C;  1S32 C;  3LJA D;  1TZY A;  5CPI C;  2ARO B;  4ZUX C;  4XZQ B;  4X23 A;  5AV9 D;  3AZF B;  4YM6 C;  1KX5 A;  3B6F C;  5G49 A;  3MNN B;  1U35 D;  3REK C;  2YFW B;  3WKJ C;  4E44 A;  5B33 C;  4Z2M G;  2NQB C;  3MGS C;  3REI D;  3X1V C;  3AZG B;  1ZLA C;  3REJ A;  1P3I D;  5JRG B;  1P34 B;  3AZM B;  1M18 D;  3C1C D;  1P3K A;  4UUZ A;  5B1L A;  3O62 B;  1M19 A;  3LJA C;  4JJN C;  3VH5 T;  3X1S A;  5AY8 B;  4J8W B;  1S32 B;  5AV9 C;  3A6N D;  3AV2 D;  3AV1 A;  4HGA B;  3MVD D;  3LEL D;  1M1A B;  5B0Y D;  5CPI B;  4ZUX B;  5GT0 A;  5CHL B;  5B0Z A;  3LZ1 A;  4LD9 C;  1F66 A;  3REK B;  3WKJ B;  1ID3 D;  3C1C C;  3MGS B;  2NZD D;  1TZY D;  2ARO A;  4XZQ A;  3AZF A;  4Z5T C;  4X23 D;  4H9S C;  1KX5 D;  3MNN A;  2YFW A;  1P3B C;  1A7W A;  3AZK B;  4H9R A;  1P3L C;  3AZG A;  1KX4 B;  5AV5 C;  5B0Y C;  4JJN B;  5JRG A;  3UTB C;  1P34 A;  3AZM A;  3W98 B;  3O62 A;  1P3K D;  2PYO B;  5B1L D;  5E5A D;  3AZI C;  1M19 D;  5DNM B;  5CPJ B;  2F8N H;  3KWQ A;  1ID3 C;  3KXB C;  4CSR B;  2NZD C;  4LD9 B;  1B6W A;  5AV6 D;  3X1S D;  4J8W A;  4G92 C;  1S32 A;  4R8P D;  5KDM B;  3AV1 D;  5CPI A;  4ZUX A;  5B1M C;  4Z5T B;  4YM6 A;  3LZ1 D;  3WAA B;  3REK A;  1F66 D;  2NQB A;  5B33 A;  1P3B B;  2IO5 B;  3WKJ A;  3MGS A;  1P3L B;  5E5A C;  5AV8 B;  4J8V C;  1ZLA A;  5AV5 B;  3UTB B;  1JFI B;  4XZQ D;  3AZF D;  4Z66 C;  4E45 A;  3MNN D;  3AZI B;  5AV6 C;  1ID3 B;  3KXB B;  4R8P C;  3AZJ B;  3AV1 C;  4JJN A;  5JRG D;  1WWS A;  4G92 B;  3AZM D;  2PYO A;  3V9R A;  3O62 D;  5DNM A;  1BH9 B;  5CPJ A;  1ULY A;  4CSR A;  5B1M B;  4NE3 A;  4EO5 C;  3X1T B;  5JA4 B;  3LZ0 C;  1Q9C A;  4LD9 A;  3AFA C;  5AY8 D;  4J8W D;  3AZE C;  1S32 D;  4XZQ C;  3MGP C;  3C1C A;  5KDM A;  5BO0 B;  3WTP C;  4J8V B;  1M1A D;  4AWL C;  4ZUX D;  4NE6 A;  4Z5T A;  4H9S A;  4Z66 B;  1HQ3 B;  3REK D;  1P3B A;  3WKJ D;  3VH6 W;  1P3L A;  3MGS D;  1H3O B;  1KX3 C;  3C1B C;  3TU4 B;  2F8N K;  5AV5 A;  3UTB A;  1JFI A;  4WNN B;  3B0C W;  1TAF B;  3AZI A;  1P3G C;  3AZK D;  5AY8 C;  1ID3 A;  3KXB A;  4EO5 B;  2YFV A;  3LZ0 B;  2NZD A;  1KX4 D;  4HGA C;  2F8N B;  3AFA B;  4JJN D;  1M1A C;  3AZE B;  3KUY C;  3W98 D;  3MGP B;  2PYO D;  1BH9 A;  3WTP B;  5DNM D;  4XUJ B;  5CPJ D;  4AWL B;  3W97 C;  3UTA B;  5B1M A;  4LD9 D;  5AVB B;  1KX3 B;  3X1U B;  5E5A A;  4NFT A;  3C1B B;  4J8V A;  3WA9 C;  3W99 B;  3AZK C;  4Z5T D;  3WAA D;  5FUG B;  4Z66 A;  1HQ3 A;  1KX4 C;  1P3F C;  1P3B D;  1P3G B;  1EQZ C;  5AV6 A;  3W98 C;  1H3O A;  1P3L D;  4R8P A;  2PYO C;  5AV8 D;  5DNM C;  5AV5 D;  1KU5 A;  3UTB D;  5CPJ C;  4WNN A;  3KUY B;  1TAF A;  5AVC C;  3AZI D;  3W97 B;  3KXB D;  3LZ0 A;  3AZJ D;  2F8N A;  5B32 C;  3AFA A;  3AZE A;  3MGP A;  2HIO B;  3WAA C;  5B2J D;  3WTP A;  4WU9 C;  4XUJ A;  2IO5 C;  3AZL C;  3WA9 B;  3UT9 B;  3VH6 T;  5B1M D;  5F99 C;  3X1T D;  3AYW C;  3B6G C;  4KUD B;  5AV8 C;  1P3F B;  1EQZ B;  1KX3 A;  5GT3 B;  3C1B A;  4J8V D;  4DRA A;  4QLC C;  5GSU C;  4Z66 D;  3AZJ C;  1HQ3 D;  5AVC B;  1P3G A;  2F8N G;  5AY8 A;  5B2J C;  4G91 C;  3TU4 D;  1AOI C;  5B32 B;  1M1A A;  1P3A C;  3KUY A;  1P3O C;  5BS7 C;  4J8X C;  3X1T C;  4WU9 B;  3AZL B;  3W97 A;  4KHA B;  2FJ7 B;  5F99 B;  2CWE A;  3AYW B;  3LZ0 D;  3B6G B;  2F8N D;  3AFA D;  2BYM B;  3AZE D;  3MGP D;  2HIO A;  3REH C;  1HQ3 C;  4YS3 B;  3WTP D;  3WA9 A;  4XUJ D;  3AZK A;  5B2I B;  4QLC B;  3UTA D;  1P3P D;  5GSU B;  5BT1 C;  4KUD A;  3AZN C;  2HUE C;  5B31 C;  5B24 C;  3TU4 C;  3B0D C;  2CV5 B;  3REL B;  1P3F A;  1KX4 A;  1EQZ A;  4KGC B;  3W98 A;  4H9N B;  5AVB D;  1P3M C;  1KX3 D;  3X1U D;  3C1B D;  5B2J B;  4G91 B;  5DNN C;  1AOI B;  3W99 D;  1P3A B;  1P3O B;  5B40 B;  4J8X B;  2L5A A;  5AVC A;  1P3G D;  3MGQ B;  5B32 A;  4J8U B;  3R45 B;  4XUJ C;  3KUY D;  3UTA C;  1P3P C;  3W96 C;  3REH B;  5CP6 C;  3WAA A;  4WU9 A;  2RVQ C;  3AZL A;  2BYK B;  3W97 D;  5AVB C;  5F99 A;  3X1U C;  3AYW A;  3AZN B;  2HUE B;  3B6G A;  5B24 B;  5B31 B;  5AV8 A;  3B0D B;  3W99 C;  2BYM A;  4CAY B;  2HIO D;  1P3M B;  4YS3 A;  4WU8 C;  4H9O B;  5DNN B;  3WA9 D;  3AN2 C;  5B2I A;  3UT9 D;  4QLC A;  5GSU A;  4UUZ B;  4KUD D;  1WWI A;  5BNV B;  3AZJ A;  1P3F D;  1EQZ D;  5B32 G;  4H9N A;  5GT3 D;  5B2J A;  1AOI A;  1P3A A;  1P3O A;  1P3P B;  5BS7 A;  3W96 B;  4H9Q B;  5JA4 A;  5CP6 B;  3NQJ B;  4J8X A;  3X1T A;  5AVC D;  1R4V A;  5GT0 B;  3WTP E;  2HIO C;  4M6B A;  5B0Z B;  5GXQ C;  3AZH C;  5BO0 A;  4J8U A;  5B32 D;  3R45 A;  5CPK C;  3UT9 C;  3REH A;  4KUD C;  3NQU B;  4WU8 B;  4WU9 D;  3AZL D;  4Z2M H;  2BYK A;  4ZBJ C;  3AN2 B;  2FJ7 D;  5GT3 C;  5F99 D;  3AZN A;  3AYW D;  3B6G D;  3VH5 A;  5B31 A;  5B24 A;  3TU4 A;  4H9R B;  4CAY A;  1P3M A;  3MGR C;  4YS3 D;  4WZS B;  4H9O A;  5DNN A;  5B2I D;  4QLC D;  5GSU D;  5BNV A;  2CV5 D;  3REL D;  3KWQ B;  4KGC D;  4WV4 B;  5GXQ B;  3AZH B;  1AOI D;  5CPK B;  1P3A D;  3UTA A;  1P3P A;  1P3O D;  5B40 D;  2FJ7 C;  3W96 A;  4H9Q A;  1N1J B;  5CP6 A;  3NQJ A;  4J8X D;  1U35 C;  5B31 G;  3VH6 A;  5BNX B;  4ZBJ B;  3REI C;  5AVB A;  3X1U A;  4YM6 B;  3B6F B;  3MGQ D;  3B0C T;  4YS3 C;  2NQB B;  5B33 B;  4J8U D;  1P3I C;  3W99 A;  1M18 C;  5B2I C;  2JSS A;  3REH D;  3X1V B;  2LY8 A;  5FUG A;  3MGR B;  3NQU A;  4WU8 A;  3REL C;  2CV5 C;  1ZLA B;  3AN2 A;  4KGC C;  5BT1 D;  3AZN D;  5B31 D;  5B24 D;  4H9P B;  1F1E A;  5B40 C;  3A6N C;  1P3M D;  3AV2 C;  3MVD C;  3LEL C;  3LJA B;  5DNN D;  3REJ D;  3KSY A;  5AV9 B;  3V9R B;  3MGQ C;  1U35 B;  3B0B A;  4J8U C;  1B67 A;  3REI B;  5GXQ A;  3AZH A;  1TZY C;  5CPK A;  1P3I B;  3UT9 A;  1M18 B;  4X23 C;  3C1C B;  1KX5 C;  1N1J A;  3W96 D;  5CP6 D;  2RVQ D;  5BNX A;  5GT0 D;  5GT3 A;  3B6F A;  5B0Z D;  4DRB A;  3REJ C;  3X1V A;  1P3K C;  5B1L C;  3A6N B;  1M19 C;  3MGR A;  3AV2 B;  3MVD B;  3LEL B;  4WU8 D;  5B0Y B;  2ARO D;  3AN2 D;  5C3I C; 
#chains in the Genus database with same CATH topology
 1BH8 B;  4H9P A;  3X1S C;  4NE5 A;  1BFM A;  2YFV B;  3VH5 W;  3AZG D;  2NZD B;  3LJA A;  1TZY B;  1P34 D;  5GT0 C;  5AV9 A;  4KHA A;  4X23 B;  2FJ7 A;  3LZ1 C;  5B0Z C;  1KX5 B;  1U35 A;  5G49 B;  1F66 C;  3KWQ D;  3REI A;  1PZR A;  5GXQ D;  3AZH D;  1P3I A;  2ARO C;  3REJ B;  5CPK D;  1M18 A;  3AZF C;  1P3K B;  5B1L B;  5E5A B;  3MNN C;  1M19 B;  2CV5 A;  3REL A;  5CPI D;  4KGC A;  5C3I B;  4YM6 D;  3B6F D;  3AZG C;  3KFU G;  2ZY4 A;  5B33 D;  2NQB D;  5JRG C;  5AV6 B;  3X1S B;  1P34 C;  3AZM C;  1HTA A;  5B40 A;  3O62 C;  4R8P B;  3A6N A;  3X1V D;  3AV2 A;  3MVD A;  3LEL A;  3MGR D;  3AV1 B;  5B0Y A;  1ZLA D;  3KWQ C;  3LZ1 B;  1BH8 A;  3MGQ A;  1F66 B;  4J8W C;  1S32 C;  2Y2G A;  3LJA D;  1TZY A;  5CPI C;  2ARO B;  4ZUX C;  4XZQ B;  4X23 A;  5AV9 D;  3AZF B;  4YM6 C;  1KX5 A;  3B6F C;  5G49 A;  3MNN B;  1U35 D;  3REK C;  2YFW B;  3WKJ C;  4E44 A;  5B33 C;  4Z2M G;  2NQB C;  3MGS C;  3REI D;  3X1V C;  3AZG B;  1ZLA C;  3REJ A;  1P3I D;  5JRG B;  3EPL A;  1P34 B;  3AZM B;  1M18 D;  3C1C D;  3P5J B;  4UUZ A;  5B1L A;  3O62 B;  1P3K A;  1M19 A;  2XD1 A;  3LJA C;  4JJN C;  3VH5 T;  3X1S A;  2Y2Q A;  5AY8 B;  4J8W B;  1S32 B;  5AV9 C;  3A6N D;  3AV2 D;  3AV1 A;  4HGA B;  3MVD D;  3LEL D;  1Z2C B;  5B0Y D;  1M1A B;  5CPI B;  4ZUX B;  5GT0 A;  5CHL B;  5B0Z A;  3LZ1 A;  4LD9 C;  2ZY5 A;  1F66 A;  3REK B;  3WKJ B;  1ID3 D;  3C1C C;  3MGS B;  2UWX A;  2NZD D;  3H0M C;  1TZY D;  2ARO A;  4XZQ A;  3AZF A;  4Z5T C;  4X23 D;  4H9S C;  1KX5 D;  3MNN A;  2YFW A;  1P3B C;  1A7W A;  3AZK B;  4H9R A;  1P3L C;  3AZG A;  1KX4 B;  5AV5 C;  5B0Y C;  4JJN B;  5JRG A;  3UTB C;  1P34 A;  3AZM A;  3W98 B;  3O62 A;  1P3K D;  2PYO B;  2Y2I A;  5B1L D;  5E5A D;  3AZI C;  1M19 D;  5DNM B;  5CPJ B;  2FFF B;  2F8N H;  3KWQ A;  2VQR A;  3KXB C;  1ID3 C;  4CSR B;  2Y2N A;  2NZD C;  4LD9 B;  1B6W A;  5AV6 D;  3X1S D;  4J8W A;  4G92 C;  1S32 A;  1W2E A;  4R8P D;  5KDM B;  3AV1 D;  5CPI A;  4ZUX A;  5B1M C;  4Z5T B;  4YM6 A;  3LZ1 D;  3WAA B;  2ZM5 A;  3REK A;  1F66 D;  2NQB A;  5B33 A;  1P3B B;  2IO5 B;  3WKJ A;  2Y2P A;  3MGS A;  1P3L B;  5E5A C;  5AV8 B;  4J8V C;  1ZLA A;  5AV5 B;  3UTB B;  1JFI B;  4XZQ D;  3AZF D;  4Z66 C;  4E45 A;  3MNN D;  3AZI B;  5AV6 C;  1ID3 B;  3KXB B;  4R8P C;  3AZJ B;  3AV1 C;  4JJN A;  5JRG D;  3IP4 C;  1WWS A;  4G92 B;  3AZM D;  2PYO A;  3V9R A;  3O62 D;  5DNM A;  1BH9 B;  5CPJ A;  1ULY A;  4CSR A;  5B1M B;  4NE3 A;  4EO5 C;  3X1T B;  5JA4 B;  3LZ0 C;  1Q9C A;  4LD9 A;  3AFA C;  5AY8 D;  4J8W D;  3AZE C;  1S32 D;  4XZQ C;  3MGP C;  3C1C A;  5KDM A;  5BO0 B;  3WTP C;  4J8V B;  1M1A D;  4AWL C;  4ZUX D;  4NE6 A;  4Z5T A;  4H9S A;  4Z66 B;  1HQ3 B;  3REK D;  1P3B A;  3WKJ D;  3VH6 W;  1P3L A;  3MGS D;  1H3O B;  1KX3 C;  3C1B C;  3TU4 B;  2F8N K;  5AV5 A;  3UTB A;  1JFI A;  2Y2H A;  4WNN B;  3B0C W;  1TAF B;  3AZI A;  1P3G C;  3AZK D;  5AY8 C;  1ID3 A;  3KXB A;  4EO5 B;  2YFV A;  2G5H C;  2BG1 A;  3LZ0 B;  1KX4 D;  4HGA C;  2F8N B;  2NZD A;  3AFA B;  4JJN D;  1M1A C;  3AZE B;  3KUY C;  3W98 D;  3MGP B;  2PYO D;  1BH9 A;  3WTP B;  5DNM D;  4XUJ B;  5CPJ D;  4AWL B;  3W97 C;  3UTA B;  5B1M A;  4LD9 D;  2XD5 A;  5AVB B;  1KX3 B;  3X1U B;  5E5A A;  4NFT A;  3C1B B;  4J8V A;  3WA9 C;  3W99 B;  3AZK C;  4Z5T D;  3WAA D;  5FUG B;  4Z66 A;  1HQ3 A;  1KX4 C;  1P3F C;  1P3B D;  1P3G B;  1EQZ C;  5AV6 A;  3W98 C;  1H3O A;  1P3L D;  4R8P A;  2PYO C;  3AL0 C;  5AV8 D;  5DNM C;  5AV5 D;  1KU5 A;  3UTB D;  5CPJ C;  2DF4 C;  4WNN A;  3KUY B;  1TAF A;  3F6T A;  5AVC C;  3AZI D;  3W97 B;  3KXB D;  3LZ0 A;  3AZJ D;  2F8N A;  5B32 C;  3AFA A;  2Y2L A;  3EG5 B;  3AZE A;  3MGP A;  2HIO B;  3WAA C;  5B2J D;  3WTP A;  4WU9 C;  4XUJ A;  2IO5 C;  3AZL C;  3WA9 B;  3UT9 B;  3VH6 T;  5B1M D;  5F99 C;  2RIQ A;  3X1T D;  3AYW C;  3B6G C;  4KUD B;  5AV8 C;  1P3F B;  2DQN C;  1EQZ B;  1KX3 A;  5GT3 B;  3C1B A;  4J8V D;  4DRA A;  4QLC C;  5GSU C;  4Z66 D;  3AZJ C;  1HQ3 D;  5AVC B;  1P3G A;  2F8N G;  5AY8 A;  3A1I A;  2ZY3 A;  4DQY B;  5B2J C;  4G91 C;  3TU4 D;  1AOI C;  5B32 B;  1M1A A;  1P3A C;  3KUY A;  1P3O C;  5BS7 C;  2F2A C;  4J8X C;  3X1T C;  3H0R C;  4WU9 B;  3AZL B;  3W97 A;  4KHA B;  2FJ7 B;  3EPJ A;  5F99 B;  2CWE A;  3AYW B;  3LZ0 D;  3B6G B;  2F8N D;  3AFA D;  2BYM B;  3AZE D;  2ZY2 A;  3MGP D;  2HIO A;  3REH C;  1HQ3 C;  4YS3 B;  3WTP D;  3WA9 A;  4UPK A;  4XUJ D;  3AZK A;  5B2I B;  4QLC B;  3UTA D;  1P3P D;  5GSU B;  5BT1 C;  4KUD A;  3AZN C;  2HUE C;  5B31 C;  5B24 C;  3TU4 C;  3B0D C;  2CV5 B;  3REL B;  1P3F A;  1KX4 A;  1EQZ A;  4KGC B;  3W98 A;  4H9N B;  5AVB D;  1P3M C;  1KX3 D;  3X1U D;  3C1B D;  5B2J B;  4G91 B;  5DNN C;  1AOI B;  3W99 D;  1P3A B;  1P3O B;  5B40 B;  4J8X B;  2L5A A;  5AVC A;  1P3G D;  2Y2M A;  3MGQ B;  5B32 A;  4J8U B;  3R45 B;  4XUJ C;  3KUY D;  3UTA C;  1P3P C;  3W96 C;  3REH B;  5CP6 C;  3WAA A;  4WU9 A;  4WJ3 C;  2RVQ C;  3AZL A;  2BYK B;  3W97 D;  5AVB C;  5F99 A;  3X1U C;  3AYW A;  3AZN B;  2HUE B;  3B6G A;  5B31 B;  5B24 B;  5AV8 A;  3B0D B;  3W99 C;  2BYM A;  3EPK A;  2Y2J A;  4CAY B;  2HIO D;  1P3M B;  4YS3 A;  2JE5 A;  4WU8 C;  4H9O B;  5DNN B;  3WA9 D;  3AN2 C;  5B2I A;  3UT9 D;  4QLC A;  3H0L C;  5GSU A;  4UUZ B;  4KUD D;  1WWI A;  5BNV B;  3AZJ A;  1P3F D;  1EQZ D;  5B32 G;  4H9N A;  5GT3 D;  2Y2O A;  5B2J A;  1AOI A;  1P3A A;  1P3O A;  1P3P B;  5BS7 A;  3W96 B;  4H9Q B;  5JA4 A;  5CP6 B;  3NQJ B;  4J8X A;  3X1T A;  5AVC D;  1R4V A;  5GT0 B;  3WTP E;  2HIO C;  4M6B A;  5B0Z B;  5GXQ C;  3AZH C;  5BO0 A;  4J8U A;  5B32 D;  3R45 A;  5CPK C;  3UT9 C;  3REH A;  4KUD C;  3NQU B;  4WU8 B;  4WU9 D;  3FDD A;  3AZL D;  4Z2M H;  2BYK A;  4ZBJ C;  3AN2 B;  2FJ7 D;  5GT3 C;  5F99 D;  3AZN A;  3AYW D;  3B6G D;  3VH5 A;  5B31 A;  5B24 A;  3TU4 A;  4H9R B;  4CAY A;  1P3M A;  3MGR C;  4YS3 D;  4WZS B;  4H9O A;  5DNN A;  5B2I D;  4QLC D;  5GSU D;  5BNV A;  2CV5 D;  3REL D;  3KWQ B;  4KGC D;  1T3U A;  4WV4 B;  5GXQ B;  3AZH B;  1AOI D;  5CPK B;  1P3A D;  3UTA A;  1P3P A;  1P3O D;  5B40 D;  2FJ7 C;  3W96 A;  4H9Q A;  1N1J B;  5CP6 A;  3NQJ A;  4J8X D;  1U35 C;  5B31 G;  3VH6 A;  5BNX B;  4ZBJ B;  3REI C;  5AVB A;  3X1U A;  4YM6 B;  3B6F B;  3MGQ D;  3B0C T;  4YS3 C;  2NQB B;  5B33 B;  4J8U D;  1P3I C;  3W99 A;  1M18 C;  5B2I C;  2JSS A;  3REH D;  3X1V B;  2LY8 A;  5FUG A;  3MGR B;  3NQU A;  4WU8 A;  3REL C;  2CV5 C;  1ZLA B;  3EPH A;  3AN2 A;  4KGC C;  5BT1 D;  3AZN D;  5B31 D;  5B24 D;  4H9P B;  1F1E A;  5B40 C;  3A6N C;  1P3M D;  3AV2 C;  3MVD C;  3LEL C;  3LJA B;  5DNN D;  2G5I C;  3REJ D;  3KSY A;  5AV9 B;  3V9R B;  3MGQ C;  1U35 B;  3B0B A;  4J8U C;  3A1K A;  1B67 A;  3REI B;  2JCH A;  5GXQ A;  3AZH A;  1TZY C;  5CPK A;  1P3I B;  3UT9 A;  1M18 B;  4X23 C;  3C1C B;  2Y2K A;  1KX5 C;  1N1J A;  3W96 D;  5CP6 D;  2RVQ D;  5BNX A;  5GT0 D;  5GT3 A;  3B6F A;  5B0Z D;  4DRB A;  3REJ C;  2J8P A;  3X1V A;  1P3K C;  2W8S A;  5B1L C;  3A6N B;  1M19 C;  3MGR A;  3AV2 B;  3MVD B;  3LEL B;  4WU8 D;  5B0Y B;  2ARO D;  3AN2 D;  5C3I C; 
#chains in the Genus database with same CATH homology
 1BH8 B;  4H9P A;  3X1S C;  4NE5 A;  1BFM A;  2YFV B;  3VH5 W;  3AZG D;  2NZD B;  3LJA A;  1TZY B;  1P34 D;  5GT0 C;  5AV9 A;  4KHA A;  4X23 B;  2FJ7 A;  3LZ1 C;  5B0Z C;  1KX5 B;  1U35 A;  5G49 B;  1F66 C;  3KWQ D;  3REI A;  1PZR A;  5GXQ D;  3AZH D;  1P3I A;  2ARO C;  3REJ B;  5CPK D;  1M18 A;  3AZF C;  1P3K B;  5B1L B;  5E5A B;  3MNN C;  1M19 B;  2CV5 A;  3REL A;  5CPI D;  4KGC A;  5C3I B;  4YM6 D;  3B6F D;  3AZG C;  3KFU G;  2ZY4 A;  5B33 D;  2NQB D;  5JRG C;  5AV6 B;  3X1S B;  1P34 C;  3AZM C;  1HTA A;  5B40 A;  3O62 C;  4R8P B;  3A6N A;  3X1V D;  3AV2 A;  3MVD A;  3LEL A;  3MGR D;  3AV1 B;  5B0Y A;  1ZLA D;  3KWQ C;  3LZ1 B;  1BH8 A;  3MGQ A;  1F66 B;  4J8W C;  1S32 C;  2Y2G A;  3LJA D;  1TZY A;  5CPI C;  2ARO B;  4ZUX C;  4XZQ B;  4X23 A;  5AV9 D;  3AZF B;  4YM6 C;  1KX5 A;  3B6F C;  5G49 A;  3MNN B;  1U35 D;  3REK C;  2YFW B;  3WKJ C;  4E44 A;  5B33 C;  4Z2M G;  2NQB C;  3MGS C;  3REI D;  3X1V C;  3AZG B;  1ZLA C;  3REJ A;  1P3I D;  5JRG B;  3EPL A;  1P34 B;  3AZM B;  1M18 D;  3C1C D;  3P5J B;  4UUZ A;  5B1L A;  3O62 B;  1P3K A;  1M19 A;  2XD1 A;  3LJA C;  4JJN C;  3VH5 T;  3X1S A;  2Y2Q A;  5AY8 B;  4J8W B;  1S32 B;  5AV9 C;  3A6N D;  3AV2 D;  3AV1 A;  4HGA B;  3MVD D;  3LEL D;  1Z2C B;  5B0Y D;  1M1A B;  5CPI B;  4ZUX B;  5GT0 A;  5CHL B;  5B0Z A;  3LZ1 A;  4LD9 C;  2ZY5 A;  1F66 A;  3REK B;  3WKJ B;  1ID3 D;  3C1C C;  3MGS B;  2UWX A;  2NZD D;  3H0M C;  1TZY D;  2ARO A;  4XZQ A;  3AZF A;  4Z5T C;  4X23 D;  4H9S C;  1KX5 D;  3MNN A;  2YFW A;  1P3B C;  1A7W A;  3AZK B;  4H9R A;  1P3L C;  3AZG A;  1KX4 B;  5AV5 C;  5B0Y C;  4JJN B;  5JRG A;  3UTB C;  1P34 A;  3AZM A;  3W98 B;  3O62 A;  1P3K D;  2PYO B;  2Y2I A;  5B1L D;  5E5A D;  3AZI C;  1M19 D;  5DNM B;  5CPJ B;  2FFF B;  2F8N H;  3KWQ A;  2VQR A;  3KXB C;  1ID3 C;  4CSR B;  2Y2N A;  2NZD C;  4LD9 B;  1B6W A;  5AV6 D;  3X1S D;  4J8W A;  4G92 C;  1S32 A;  1W2E A;  4R8P D;  5KDM B;  3AV1 D;  5CPI A;  4ZUX A;  5B1M C;  4Z5T B;  4YM6 A;  3LZ1 D;  3WAA B;  2ZM5 A;  3REK A;  1F66 D;  2NQB A;  5B33 A;  1P3B B;  2IO5 B;  3WKJ A;  2Y2P A;  3MGS A;  1P3L B;  5E5A C;  5AV8 B;  4J8V C;  1ZLA A;  5AV5 B;  3UTB B;  1JFI B;  4XZQ D;  3AZF D;  4Z66 C;  4E45 A;  3MNN D;  3AZI B;  5AV6 C;  1ID3 B;  3KXB B;  4R8P C;  3AZJ B;  3AV1 C;  4JJN A;  5JRG D;  3IP4 C;  1WWS A;  4G92 B;  3AZM D;  2PYO A;  3V9R A;  3O62 D;  5DNM A;  1BH9 B;  5CPJ A;  1ULY A;  4CSR A;  5B1M B;  4NE3 A;  4EO5 C;  3X1T B;  5JA4 B;  3LZ0 C;  1Q9C A;  4LD9 A;  3AFA C;  5AY8 D;  4J8W D;  3AZE C;  1S32 D;  4XZQ C;  3MGP C;  3C1C A;  5KDM A;  5BO0 B;  3WTP C;  4J8V B;  1M1A D;  4AWL C;  4ZUX D;  4NE6 A;  4Z5T A;  4H9S A;  4Z66 B;  1HQ3 B;  3REK D;  1P3B A;  3WKJ D;  3VH6 W;  1P3L A;  3MGS D;  1H3O B;  1KX3 C;  3C1B C;  3TU4 B;  2F8N K;  5AV5 A;  3UTB A;  1JFI A;  2Y2H A;  4WNN B;  3B0C W;  1TAF B;  3AZI A;  1P3G C;  3AZK D;  5AY8 C;  1ID3 A;  3KXB A;  4EO5 B;  2YFV A;  2G5H C;  2BG1 A;  3LZ0 B;  1KX4 D;  4HGA C;  2F8N B;  2NZD A;  3AFA B;  4JJN D;  1M1A C;  3AZE B;  3KUY C;  3W98 D;  3MGP B;  2PYO D;  1BH9 A;  3WTP B;  5DNM D;  4XUJ B;  5CPJ D;  4AWL B;  3W97 C;  3UTA B;  5B1M A;  4LD9 D;  2XD5 A;  5AVB B;  1KX3 B;  3X1U B;  5E5A A;  4NFT A;  3C1B B;  4J8V A;  3WA9 C;  3W99 B;  3AZK C;  4Z5T D;  3WAA D;  5FUG B;  4Z66 A;  1HQ3 A;  1KX4 C;  1P3F C;  1P3B D;  1P3G B;  1EQZ C;  5AV6 A;  3W98 C;  1H3O A;  1P3L D;  4R8P A;  2PYO C;  3AL0 C;  5AV8 D;  5DNM C;  5AV5 D;  1KU5 A;  3UTB D;  5CPJ C;  2DF4 C;  4WNN A;  3KUY B;  1TAF A;  3F6T A;  5AVC C;  3AZI D;  3W97 B;  3KXB D;  3LZ0 A;  3AZJ D;  2F8N A;  5B32 C;  3AFA A;  2Y2L A;  3EG5 B;  3AZE A;  3MGP A;  2HIO B;  3WAA C;  5B2J D;  3WTP A;  4WU9 C;  4XUJ A;  2IO5 C;  3AZL C;  3WA9 B;  3UT9 B;  3VH6 T;  5B1M D;  5F99 C;  2RIQ A;  3X1T D;  3AYW C;  3B6G C;  4KUD B;  5AV8 C;  1P3F B;  2DQN C;  1EQZ B;  1KX3 A;  5GT3 B;  3C1B A;  4J8V D;  4DRA A;  4QLC C;  5GSU C;  4Z66 D;  3AZJ C;  1HQ3 D;  5AVC B;  1P3G A;  2F8N G;  5AY8 A;  3A1I A;  2ZY3 A;  4DQY B;  5B2J C;  4G91 C;  3TU4 D;  1AOI C;  5B32 B;  1M1A A;  1P3A C;  3KUY A;  1P3O C;  5BS7 C;  2F2A C;  4J8X C;  3X1T C;  3H0R C;  4WU9 B;  3AZL B;  3W97 A;  4KHA B;  2FJ7 B;  3EPJ A;  5F99 B;  2CWE A;  3AYW B;  3LZ0 D;  3B6G B;  2F8N D;  3AFA D;  2BYM B;  3AZE D;  2ZY2 A;  3MGP D;  2HIO A;  3REH C;  1HQ3 C;  4YS3 B;  3WTP D;  3WA9 A;  4UPK A;  4XUJ D;  3AZK A;  5B2I B;  4QLC B;  3UTA D;  1P3P D;  5GSU B;  5BT1 C;  4KUD A;  3AZN C;  2HUE C;  5B31 C;  5B24 C;  3TU4 C;  3B0D C;  2CV5 B;  3REL B;  1P3F A;  1KX4 A;  1EQZ A;  4KGC B;  3W98 A;  4H9N B;  5AVB D;  1P3M C;  1KX3 D;  3X1U D;  3C1B D;  5B2J B;  4G91 B;  5DNN C;  1AOI B;  3W99 D;  1P3A B;  1P3O B;  5B40 B;  4J8X B;  2L5A A;  5AVC A;  1P3G D;  2Y2M A;  3MGQ B;  5B32 A;  4J8U B;  3R45 B;  4XUJ C;  3KUY D;  3UTA C;  1P3P C;  3W96 C;  3REH B;  5CP6 C;  3WAA A;  4WU9 A;  4WJ3 C;  2RVQ C;  3AZL A;  2BYK B;  3W97 D;  5AVB C;  5F99 A;  3X1U C;  3AYW A;  3AZN B;  2HUE B;  3B6G A;  5B31 B;  5B24 B;  5AV8 A;  3B0D B;  3W99 C;  2BYM A;  3EPK A;  2Y2J A;  4CAY B;  2HIO D;  1P3M B;  4YS3 A;  2JE5 A;  4WU8 C;  4H9O B;  5DNN B;  3WA9 D;  3AN2 C;  5B2I A;  3UT9 D;  4QLC A;  3H0L C;  5GSU A;  4UUZ B;  4KUD D;  1WWI A;  5BNV B;  3AZJ A;  1P3F D;  1EQZ D;  5B32 G;  4H9N A;  5GT3 D;  2Y2O A;  5B2J A;  1AOI A;  1P3A A;  1P3O A;  1P3P B;  5BS7 A;  3W96 B;  4H9Q B;  5JA4 A;  5CP6 B;  3NQJ B;  4J8X A;  3X1T A;  5AVC D;  1R4V A;  5GT0 B;  3WTP E;  2HIO C;  4M6B A;  5B0Z B;  5GXQ C;  3AZH C;  5BO0 A;  4J8U A;  5B32 D;  3R45 A;  5CPK C;  3UT9 C;  3REH A;  4KUD C;  3NQU B;  4WU8 B;  4WU9 D;  3FDD A;  3AZL D;  4Z2M H;  2BYK A;  4ZBJ C;  3AN2 B;  2FJ7 D;  5GT3 C;  5F99 D;  3AZN A;  3AYW D;  3B6G D;  3VH5 A;  5B31 A;  5B24 A;  3TU4 A;  4H9R B;  4CAY A;  1P3M A;  3MGR C;  4YS3 D;  4WZS B;  4H9O A;  5DNN A;  5B2I D;  4QLC D;  5GSU D;  5BNV A;  2CV5 D;  3REL D;  3KWQ B;  4KGC D;  1T3U A;  4WV4 B;  5GXQ B;  3AZH B;  1AOI D;  5CPK B;  1P3A D;  3UTA A;  1P3P A;  1P3O D;  5B40 D;  2FJ7 C;  3W96 A;  4H9Q A;  1N1J B;  5CP6 A;  3NQJ A;  4J8X D;  1U35 C;  5B31 G;  3VH6 A;  5BNX B;  4ZBJ B;  3REI C;  5AVB A;  3X1U A;  4YM6 B;  3B6F B;  3MGQ D;  3B0C T;  4YS3 C;  2NQB B;  5B33 B;  4J8U D;  1P3I C;  3W99 A;  1M18 C;  5B2I C;  2JSS A;  3REH D;  3X1V B;  2LY8 A;  5FUG A;  3MGR B;  3NQU A;  4WU8 A;  3REL C;  2CV5 C;  1ZLA B;  3EPH A;  3AN2 A;  4KGC C;  5BT1 D;  3AZN D;  5B31 D;  5B24 D;  4H9P B;  1F1E A;  5B40 C;  3A6N C;  1P3M D;  3AV2 C;  3MVD C;  3LEL C;  3LJA B;  5DNN D;  2G5I C;  3REJ D;  3KSY A;  5AV9 B;  3V9R B;  3MGQ C;  1U35 B;  3B0B A;  4J8U C;  3A1K A;  1B67 A;  3REI B;  2JCH A;  5GXQ A;  3AZH A;  1TZY C;  5CPK A;  1P3I B;  3UT9 A;  1M18 B;  4X23 C;  3C1C B;  2Y2K A;  1KX5 C;  1N1J A;  3W96 D;  5CP6 D;  2RVQ D;  5BNX A;  5GT0 D;  5GT3 A;  3B6F A;  5B0Z D;  4DRB A;  3REJ C;  2J8P A;  3X1V A;  1P3K C;  2W8S A;  5B1L C;  3A6N B;  1M19 C;  3MGR A;  3AV2 B;  3MVD B;  3LEL B;  4WU8 D;  5B0Y B;  2ARO D;  3AN2 D;  5C3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...