4Z5TB

The nucleosome containing human h3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tB00
4WNNA 1KX3A 5GSUB 3TU4A 3X1TC 2CWEA 4WU8A 5GT0B 3REJB 5CPIC 3X1UA 3LZ0B 1EQZB 5AVBA 4G91C 1P3OA 3WAAA 4X23C 3UTBD 3X1TA 3AV2D 3AV1A 5GT3B 5CPIA 1P3PD 1B67A 2BYMA 5AV5C 1ID3D 5B0ZC 4X23A 5CPJD 5AV5A 5B0ZA 5BT1D 3MGSC 4J8XB 3X1VB 5B31G 2PYOB 1U35C 3C1BD 3MGSA 5F99D 3KUYD 3B6GD 1HQ3C 3MNND 3MVDD 2YFVB 1U35A 1P3MD 4XZQC 5JA4B 4ZBJB 3AZJB 4J8UC 5CP6D 3WA9C 4KUDC 1HQ3A 5KDMB 3VH5T 3AZEA 1F1EA 3WAAD 4XZQA 3AZKC 4NFTA 3LZ1B 4J8UA 5CPKC 3WA9A 5GXQB 4KUDA 3AYWC 1KX5C 1JFIB 1P3FC 5B0YC 5E5AB 4XUJD 3AZKA 5DNNC 5B31C 1P3AB 3REIB 2CV5C 3AYWA 1KX5A 1P3GB 1P3FA 3B0DC 1N1JB 5B33B 5DNNA 5B31A 1M1AC 3KWQB 2CV5A 4Z66B 4KGCA 4LD9B 4CAYB 2NZDA 4R8PB 1P34B 1M1AA 3AZHA 1AOIA 1F66D 1P3KD 2LY8A 5AY8C 1BH8A 4H9SC 3W99D 3AN2C 5AY8A 2HIOB 4H9SA 5JRGC 1P3LA 3WA9D 4M6BA 1TZYC 3W96C 3MGRB 3AZNB 3AN2A 2F8NH 2HUEC 4Z2MH 4J8VC 5DNMC 4JJNB 5JRGA 4H9OB 5B40C 5CPKD 5BO0B 3AFAD 3UT9C 5AV8C 3W96A 1TZYA 3AZMD 3AYWD 3O62D 4YS3B 1M19D 5DNMA 5B0YD 3AZFB 5B40A 1R4VA 3AZGB 3UT9A 5AV8A 5FUGB 5B1LC 2RVQC 5B24B 4QLCB 3W97D 3UTBC 1S32D 5AV9B 3RELD 1M1AD 2L5AA 5AV6B 4H9PA 5B1LA 1ID3C 2NQBD 5BNVB 5CPJC 3UTBA 3LELB 2F8NK 1P3PA 3C1CC 5B2JB 1ID3A 2AROB 2F8ND 3AZLB 5CPJA 5BT1C 5B32B 5B1MB 3V9RA 3AN2D 3C1BC 3X1SD 4CSRB 5BNXB 5GT0C 5F99C 3WKJD 3KUYC 3B6GC 3MVDC 1P3BB 1M18D 1TAFA 3C1BA 4J8VD 1P3MC 3REKD 5F99A 5CP6C 3KUYA 2FJ7D 3B6GA 3MVDA 4J8WD 3AZID 1P3MA 4AWLB 5CP6A 1KX4B 1BH9B 5BS7C 3AV2B 1A7WA 2RVQD 5B1LD 5G49B 4H9NA 4XUJC 3KXBB 3LJAB 3W98B 2BYKA 3X1VC 5BS7A 1H3OB 2IO5B 3B6FB 4NE6A 4XUJA 4YM6D 3REHD 1ZLAB 4ZUXD 3WTPB 4WU9B 3NQJB 3C1CD 1P3IB 3A6NB 4Z5TD 5AVCC 1F66C 4H9QB 3MGPD 1P3KC 2YFWB 5GSUD 3MNNB 3AV1B 5AVCA 5GT0D 4WNNB 3REJD 1KX3B 3W99C 3LZ0D 4UUZA 3TU4B 1F66A 1EQZD 1P3KA 4WU8B 3X1UB 5AVBB 1P3OB 3WAAB 1ULYA 5GT3D 3W99A 4EO5C 3X1TB 5CPIB 4HGAC 2BYMB 4G91B 3MGQC 3R45A 2F8NG 4X23B 3AFAC 4NE5A 3AZMC 3O62C 1M19C 5AV5B 4J8XD 3MGQA 5B0ZB 5CPKA 3AFAA 3X1VD 3AZMA 2PYOD 3O62A 1M19A 4DRAA 5B0YA 3W97C 3VH6A 1S32C 3RELC 4KHAA 3MGSB 4WZSB 3W97A 2NQBC 4G92B 1S32A 3AZJD 1U35B 3RELA 5AVCD 3B0CW 2NQBA 1HQ3B 3NQUA 3LZ1D 3AZEB 5GXQD 4XZQB 4J8UB 4KUDB 3WA9B 2F8NA 5E5AD 3UTAC 3X1SC 1P3AD 3WKJC 3REID 3AZKB 1P3GD 1M18C 1KU5A 3X1SA 3UTAA 3AYWB 3REKC 1KX5B 3MGQD 1P3FB 5AV6C 3KWQD 5B2IC 2FJ7C 4Z66D 3WKJA 5DNNB 5B31B 4J8WC 1M18A 4LD9D 3AZIC 4H9RA 2CV5B 4R8PD 4J8VA 3LELC 3REKA 4KGCB 2FJ7A 3B0DB 5B2IA 2NZDB 5C3IC 3KSYA 4J8WA 1M1AB 3AZHB 3AZIA 1AOIB 1BH8B 2HIOD 3REHC 4YM6C 4ZUXC 5AY8B 1Q9CA 3MGRD 3AZND 1P3LB 3REHA 4YM6A 4JJND 4ZUXA 3AN2B 4Z5TC 4YS3D 3MGPC 3C1CA 5JRGB 5GSUC 3W96B 1TZYB 3UTAD 3AZFD 3AZGD 4Z5TA 2HUEB 3REJC 3LZ0C 5DNMB 1EQZC 3MGPA 3VH6W 5B24D 4QLCD 5B40B 5GSUA 5AV8B 3UT9B 3B0CT 5AV9D 5GT0A 3REJA 5GT3C 5AV6D 3LZ0A 5B2ID 1EQZA 4H9PB 5B1LB 3LELD 4E45A 5GT3A 5B2JD 3UTBB 2AROD 1P3IC 1P3PB 3AZLD 3A6NC 1ID3B 4J8XC 5B32D 1HTAA 5B1MD 5CPJB 2PYOC 3V9RB 4J8XA 3X1VA 2PYOA 4WU8C 1P3BD 4WV4B 4ZBJC 3AZJC 1WWIA 1TAFB 1B6WA 3C1BB 2YFVA 5F99B 3KUYB 3B6GB 5JA4A 3MVDB 3AZJA 3LZ1C 1KX4D 5GXQC 1P3MB 5KDMA 5CP6B 5E5AC 3WTPE 3KXBD 3LZ1A 3LJAD 3W98D 5GXQA 1P3AC 3REIC 4H9NB 4E44A 1P3GC 1JFIA 3B6FD 5E5AA 2BYKB 5B33C 1ZLAD 4WU9D 3WTPD 1P3AA 3KWQC 3REIA 4XUJB 4Z66C 4Z2MG 1P3GA 4LD9C 4G92C 1N1JA 1P3ID 5B33A 3VH6T 4R8PC 1P34C 3A6ND 1BFMA 3KWQA 4Z66A 4LD9A 4CAYA 4R8PA 1P34A 3AZEC 3AV1D 1KX3D 3TU4D 5AVCB 4WU8D 2HIOC 3X1UD 4UUZB 1F66B 5AVBD 1P3KB 1P3OD 3X1TD 3MGRC 3AZNC 2HIOA 5CPID 3W99B 4JJNC 3VH5A 4X23D 4YS3C 3MGRA 5B32G 3AZNA 3R45B 4EO5B 5AV5D 4KGCC 4JJNA 3AZFC 5B0ZD 4H9OA 3AZGC 2NZDC 5BO0A 4HGAB 4YS3A 5B24C 3MGQB 3AZHC 1AOIC 4QLCC 5CPKB 3AFAB 5B33D 3AZFA 3AZMB 3O62B 3AZGA 5AV9C 1M19B 5FUGA 5B0YB 3MGSD 5B24A 4QLCA 4KHAB 1P34D 1U35D 5AV9A 5AV6A 3W97B 5B2JC 1S32B 2AROC 1P3LC 3RELB 5BNVA 3AZLC 1HQ3D 3LELA 5B32C 3AZED 5B1MC 2NQBB 5B2JA 4XZQD 3NQUB 2AROA 4J8UD 4KUDD 3AZLA 5B32A 3B0BA 5B1MA 2F8NB 3AZKD 1P3BC 4CSRA 5BNXA 1KX5D 1P3FD 3X1SB 5DNND 5B31D 3UTAB 1P3BA 3WKJB 2CV5D 4AWLC 4KGCD 1M18B 1KX4C 2NZDD 4H9RB 4J8VB 4DRBA 3AV2C 3REKB 3AZHD 1AOID 1P3PC 2FJ7B 5B2IB 3KXBC 4J8WB 1KX4A 3LJAC 3AZIB 3W98C 1BH9A 3AV2A 2IO5C 5G49A 3B6FC 5C3IB 3KXBA 1ZLAC 4WU9C 3WTPC 5AY8D 3LJAA 3W98A 1H3OA 3VH5W 1P3LD 3B6FA 1ZLAA 4WU9A 3WTPA 4NE3A 3NQJA 3REHB 4YM6B 5JRGD 4ZUXB 1P3IA 3MNNC 3W96D 1TZYD 3A6NA 3C1CB 3AV1C 1KX3C 5DNMD 3TU4C 4H9QA 1WWSA 5B40D 4Z5TB 5CHLB 2YFWA 5AV8D 3X1UC 3MNNA 2JSSA 3MGPB 3UT9D 5AVBC 1P3OC 3WAAC
chains in the Genus database with same CATH superfamily
4WNNA 1KX3A 5GSUB 3TU4A 3X1TC 2CWEA 4WU8A 5GT0B 3REJB 5CPIC 3X1UA 3LZ0B 1EQZB 5AVBA 4G91C 1P3OA 3WAAA 2Y2MA 4X23C 3UTBD 3X1TA 3AV2D 3AV1A 5GT3B 5CPIA 1P3PD 1B67A 2BYMA 5AV5C 1ID3D 5B0ZC 4X23A 5CPJD 5AV5A 5B0ZA 5BT1D 3MGSC 4J8XB 3X1VB 5B31G 2PYOB 1U35C 3A1KA 2VQRA 3C1BD 3MGSA 5F99D 3KUYD 3B6GD 1HQ3C 3MNND 3MVDD 2YFVB 1U35A 1P3MD 4XZQC 5JA4B 4ZBJB 3AZJB 4J8UC 5CP6D 3WA9C 4KUDC 2XD1A 1HQ3A 5KDMB 3VH5T 3AZEA 1F1EA 3WAAD 2Y2HA 4XZQA 3AZKC 4NFTA 3LZ1B 4J8UA 5CPKC 3WA9A 5GXQB 4KUDA 3AYWC 1KX5C 1JFIB 1P3FC 5B0YC 5E5AB 4XUJD 3AZKA 5DNNC 1T3UA 5B31C 1P3AB 3REIB 2CV5C 3AYWA 1KX5A 1P3GB 1P3FA 3B0DC 1N1JB 5B33B 5DNNA 5B31A 1M1AC 3KWQB 2CV5A 4Z66B 3AL0C 4KGCA 4LD9B 4CAYB 2NZDA 4R8PB 1P34B 1M1AA 3AZHA 1AOIA 1F66D 1P3KD 2LY8A 2W8SA 5AY8C 1BH8A 1PZRA 4H9SC 2Y2KA 3W99D 3AN2C 5AY8A 2HIOB 4H9SA 5JRGC 1Z2CB 1P3LA 3WA9D 4M6BA 1TZYC 3W96C 3MGRB 3AZNB 3AN2A 2F8NH 2HUEC 4Z2MH 4J8VC 5DNMC 4JJNB 5JRGA 4H9OB 5B40C 5CPKD 5BO0B 3AFAD 3UT9C 5AV8C 3W96A 1TZYA 3AZMD 3AYWD 3O62D 4YS3B 3EPKA 1M19D 5DNMA 5B0YD 3AZFB 5B40A 1R4VA 3AZGB 3UT9A 5AV8A 5FUGB 5B1LC 2RVQC 5B24B 4QLCB 3W97D 3UTBC 1S32D 5AV9B 3RELD 1M1AD 2JCHA 2L5AA 5AV6B 4H9PA 5B1LA 1ID3C 2NQBD 5BNVB 2G5IC 5CPJC 3UTBA 3LELB 2F8NK 1P3PA 3C1CC 5B2JB 1ID3A 2AROB 2F8ND 2DF4C 3AZLB 5CPJA 5BT1C 5B32B 5B1MB 3V9RA 3AN2D 3C1BC 3X1SD 4CSRB 5BNXB 5GT0C 5F99C 3WKJD 3KUYC 3B6GC 4DQYB 3MVDC 1P3BB 1M18D 1TAFA 3C1BA 4J8VD 1P3MC 3REKD 5F99A 5CP6C 3KUYA 2FJ7D 3B6GA 3MVDA 4J8WD 3AZID 1P3MA 2RIQA 4AWLB 5CP6A 1KX4B 1BH9B 5BS7C 3AV2B 1A7WA 2RVQD 5B1LD 5G49B 4H9NA 4XUJC 3KXBB 3EPJA 3LJAB 3W98B 2BYKA 3X1VC 5BS7A 1H3OB 2IO5B 3B6FB 4NE6A 4XUJA 4YM6D 3REHD 1ZLAB 4ZUXD 3WTPB 4WU9B 3NQJB 3C1CD 1P3IB 3A6NB 4Z5TD 5AVCC 1F66C 4H9QB 3MGPD 1P3KC 2Y2GA 2YFWB 5GSUD 3MNNB 3AV1B 5AVCA 5GT0D 4WNNB 3REJD 1KX3B 3W99C 3LZ0D 4UUZA 3TU4B 2ZY3A 1F66A 1EQZD 1P3KA 4WU8B 3X1UB 5AVBB 1P3OB 3WAAB 1ULYA 5GT3D 3W99A 4EO5C 3X1TB 5CPIB 4HGAC 2BYMB 4G91B 3MGQC 3R45A 2F8NG 4X23B 3AFAC 4NE5A 3AZMC 3O62C 1M19C 2DQNC 5AV5B 4J8XD 3MGQA 5B0ZB 5CPKA 3AFAA 3X1VD 3AZMA 2PYOD 2ZM5A 3O62A 2Y2NA 4DRAA 5B0YA 1M19A 3W97C 3VH6A 1S32C 3RELC 4KHAA 3MGSB 4WZSB 3W97A 2NQBC 4G92B 1S32A 3AZJD 1U35B 3RELA 5AVCD 3B0CW 2NQBA 1HQ3B 3NQUA 3LZ1D 2J8PA 3AZEB 5GXQD 3KFUG 4XZQB 4J8UB 4KUDB 3WA9B 2F8NA 5E5AD 3UTAC 3X1SC 1P3AD 3WKJC 3REID 3AZKB 1P3GD 1M18C 1KU5A 3X1SA 3UTAA 2Y2PA 3REKC 3AYWB 1KX5B 3MGQD 1P3FB 5AV6C 3KWQD 5B2IC 2FJ7C 4Z66D 3WKJA 5DNNB 5B31B 4J8WC 1M18A 4LD9D 3AZIC 4H9RA 2CV5B 4R8PD 4J8VA 3LELC 3REKA 4KGCB 2FJ7A 3B0DB 5B2IA 2NZDB 5C3IC 3H0LC 3KSYA 3EG5B 4J8WA 1M1AB 3AZHB 3AZIA 2Y2QA 1AOIB 2ZY2A 1BH8B 2HIOD 3REHC 4YM6C 4ZUXC 5AY8B 1Q9CA 3MGRD 3AZND 1P3LB 3REHA 4YM6A 4JJND 4ZUXA 3AN2B 2JE5A 4Z5TC 3F6TA 4YS3D 3MGPC 5JRGB 3C1CA 5GSUC 3W96B 1TZYB 3UTAD 3AZFD 3AZGD 4Z5TA 2HUEB 3REJC 3LZ0C 5DNMB 1EQZC 3MGPA 3VH6W 5B24D 4QLCD 5B40B 5GSUA 5AV8B 3UT9B 3B0CT 5AV9D 5GT0A 3REJA 5GT3C 5AV6D 3LZ0A 5B2ID 1EQZA 4H9PB 5B1LB 3LELD 4E45A 5GT3A 5B2JD 3UTBB 2AROD 1P3IC 1P3PB 2Y2IA 3AZLD 3A6NC 1ID3B 4J8XC 5B32D 1HTAA 5B1MD 3EPHA 5CPJB 2PYOC 2G5HC 3V9RB 4J8XA 3X1VA 2PYOA 4WU8C 1P3BD 4WV4B 4ZBJC 3AZJC 1WWIA 1TAFB 3H0MC 1B6WA 3C1BB 2YFVA 5F99B 3KUYB 3B6GB 5JA4A 3MVDB 3AZJA 3LZ1C 1KX4D 5GXQC 2BG1A 1P3MB 5KDMA 5CP6B 3A1IA 5E5AC 3WTPE 3KXBD 3LZ1A 3LJAD 3W98D 5GXQA 1P3AC 3REIC 4H9NB 4E44A 1P3GC 1JFIA 3B6FD 5E5AA 2BYKB 5B33C 1ZLAD 2F2AC 4WU9D 3WTPD 3FDDA 1P3AA 3KWQC 3EPLA 3REIA 4XUJB 4Z66C 4Z2MG 1P3GA 4LD9C 4G92C 1N1JA 1P3ID 5B33A 3VH6T 4R8PC 1P34C 3A6ND 1BFMA 3KWQA 3IP4C 4Z66A 3H0RC 4LD9A 4CAYA 4R8PA 1P34A 2Y2OA 3AZEC 3AV1D 1KX3D 3TU4D 5AVCB 4WU8D 2HIOC 3X1UD 2FFFB 4UUZB 1F66B 5AVBD 1P3KB 1P3OD 2Y2JA 3X1TD 3MGRC 3AZNC 2HIOA 5CPID 3W99B 4JJNC 3P5JB 3VH5A 4X23D 4YS3C 3MGRA 2ZY5A 5B32G 3AZNA 3R45B 4EO5B 5AV5D 4KGCC 4JJNA 3AZFC 5B0ZD 4H9OA 3AZGC 2NZDC 5BO0A 4HGAB 4YS3A 5B24C 3MGQB 3AZHC 2UWXA 4QLCC 1AOIC 5CPKB 3AFAB 5B33D 3AZFA 3AZMB 3O62B 3AZGA 5AV9C 1M19B 5FUGA 5B0YB 3MGSD 5B24A 4QLCA 4KHAB 1P34D 1W2EA 1U35D 5AV9A 5AV6A 3W97B 5B2JC 1S32B 2AROC 1P3LC 3RELB 5BNVA 3AZLC 1HQ3D 3LELA 5B32C 3AZED 5B1MC 2NQBB 5B2JA 4XZQD 3NQUB 2AROA 4J8UD 4KUDD 3AZLA 5B32A 3B0BA 5B1MA 2F8NB 3AZKD 1P3BC 4CSRA 5BNXA 1KX5D 1P3FD 3X1SB 5DNND 5B31D 3UTAB 1P3BA 3WKJB 2CV5D 4AWLC 4KGCD 1M18B 1KX4C 2NZDD 4H9RB 4J8VB 4DRBA 3AV2C 3REKB 3AZHD 1AOID 1P3PC 2FJ7B 5B2IB 3KXBC 4J8WB 1KX4A 3LJAC 3AZIB 3W98C 1BH9A 3AV2A 4UPKA 2IO5C 5G49A 3B6FC 5C3IB 3KXBA 1ZLAC 4WU9C 3WTPC 5AY8D 3LJAA 3W98A 1H3OA 3VH5W 1P3LD 3B6FA 2XD5A 1ZLAA 4WU9A 3WTPA 2ZY4A 4NE3A 3NQJA 3REHB 4YM6B 5JRGD 4ZUXB 1P3IA 2Y2LA 3MNNC 3W96D 1TZYD 3A6NA 3C1CB 3AV1C 1KX3C 4WJ3C 5DNMD 3TU4C 4H9QA 1WWSA 5B40D 4Z5TB 5CHLB 2YFWA 5AV8D 3X1UC 3MNNA 2JSSA 3MGPB 3UT9D 5AVBC 1P3OC 3WAAC
chains in the Genus database with same CATH topology
4WNNA 1KX3A 5GSUB 3TU4A 3X1TC 2CWEA 4WU8A 5GT0B 3REJB 5CPIC 3X1UA 3LZ0B 1EQZB 5AVBA 4G91C 1P3OA 3WAAA 2Y2MA 4X23C 3UTBD 3X1TA 3AV2D 3AV1A 5GT3B 5CPIA 1P3PD 1B67A 2BYMA 5AV5C 1ID3D 5B0ZC 4X23A 5CPJD 5AV5A 5B0ZA 5BT1D 3MGSC 4J8XB 3X1VB 5B31G 2PYOB 1U35C 3A1KA 2VQRA 3C1BD 3MGSA 5F99D 3KUYD 3B6GD 1HQ3C 3MNND 3MVDD 2YFVB 1U35A 1P3MD 4XZQC 5JA4B 4ZBJB 3AZJB 4J8UC 5CP6D 3WA9C 4KUDC 2XD1A 1HQ3A 5KDMB 3VH5T 3AZEA 1F1EA 3WAAD 2Y2HA 4XZQA 3AZKC 4NFTA 3LZ1B 4J8UA 5CPKC 3WA9A 5GXQB 4KUDA 3AYWC 1KX5C 1JFIB 1P3FC 5B0YC 5E5AB 4XUJD 3AZKA 5DNNC 1T3UA 5B31C 1P3AB 3REIB 2CV5C 3AYWA 1KX5A 1P3GB 1P3FA 3B0DC 1N1JB 5B33B 5DNNA 5B31A 1M1AC 3KWQB 2CV5A 4Z66B 3AL0C 4KGCA 4LD9B 4CAYB 2NZDA 4R8PB 1P34B 1M1AA 3AZHA 1AOIA 1F66D 1P3KD 2LY8A 2W8SA 5AY8C 1BH8A 1PZRA 4H9SC 2Y2KA 3W99D 3AN2C 5AY8A 2HIOB 4H9SA 5JRGC 1Z2CB 1P3LA 3WA9D 4M6BA 1TZYC 3W96C 3MGRB 3AZNB 3AN2A 2F8NH 2HUEC 4Z2MH 4J8VC 5DNMC 4JJNB 5JRGA 4H9OB 5B40C 5CPKD 5BO0B 3AFAD 3UT9C 5AV8C 3W96A 1TZYA 3AZMD 3AYWD 3O62D 4YS3B 3EPKA 1M19D 5DNMA 5B0YD 3AZFB 5B40A 1R4VA 3AZGB 3UT9A 5AV8A 5FUGB 5B1LC 2RVQC 5B24B 4QLCB 3W97D 3UTBC 1S32D 5AV9B 3RELD 1M1AD 2JCHA 2L5AA 5AV6B 4H9PA 5B1LA 1ID3C 2NQBD 5BNVB 2G5IC 5CPJC 3UTBA 3LELB 2F8NK 1P3PA 3C1CC 5B2JB 1ID3A 2AROB 2F8ND 2DF4C 3AZLB 5CPJA 5BT1C 5B32B 5B1MB 3V9RA 3AN2D 3C1BC 3X1SD 4CSRB 5BNXB 5GT0C 5F99C 3WKJD 3KUYC 3B6GC 4DQYB 3MVDC 1P3BB 1M18D 1TAFA 3C1BA 4J8VD 1P3MC 3REKD 5F99A 5CP6C 3KUYA 2FJ7D 3B6GA 3MVDA 4J8WD 3AZID 1P3MA 2RIQA 4AWLB 5CP6A 1KX4B 1BH9B 5BS7C 3AV2B 1A7WA 2RVQD 5B1LD 5G49B 4H9NA 4XUJC 3KXBB 3EPJA 3LJAB 3W98B 2BYKA 3X1VC 5BS7A 1H3OB 2IO5B 3B6FB 4NE6A 4XUJA 4YM6D 3REHD 1ZLAB 4ZUXD 3WTPB 4WU9B 3NQJB 3C1CD 1P3IB 3A6NB 4Z5TD 5AVCC 1F66C 4H9QB 3MGPD 1P3KC 2Y2GA 2YFWB 5GSUD 3MNNB 3AV1B 5AVCA 5GT0D 4WNNB 3REJD 1KX3B 3W99C 3LZ0D 4UUZA 3TU4B 2ZY3A 1F66A 1EQZD 1P3KA 4WU8B 3X1UB 5AVBB 1P3OB 3WAAB 1ULYA 5GT3D 3W99A 4EO5C 3X1TB 5CPIB 4HGAC 2BYMB 4G91B 3MGQC 3R45A 2F8NG 4X23B 3AFAC 4NE5A 3AZMC 3O62C 1M19C 2DQNC 5AV5B 4J8XD 3MGQA 5B0ZB 5CPKA 3AFAA 3X1VD 3AZMA 2PYOD 2ZM5A 3O62A 2Y2NA 4DRAA 5B0YA 1M19A 3W97C 3VH6A 1S32C 3RELC 4KHAA 3MGSB 4WZSB 3W97A 2NQBC 4G92B 1S32A 3AZJD 1U35B 3RELA 5AVCD 3B0CW 2NQBA 1HQ3B 3NQUA 3LZ1D 2J8PA 3AZEB 5GXQD 3KFUG 4XZQB 4J8UB 4KUDB 3WA9B 2F8NA 5E5AD 3UTAC 3X1SC 1P3AD 3WKJC 3REID 3AZKB 1P3GD 1M18C 1KU5A 3X1SA 3UTAA 2Y2PA 3REKC 3AYWB 1KX5B 3MGQD 1P3FB 5AV6C 3KWQD 5B2IC 2FJ7C 4Z66D 3WKJA 5DNNB 5B31B 4J8WC 1M18A 4LD9D 3AZIC 4H9RA 2CV5B 4R8PD 4J8VA 3LELC 3REKA 4KGCB 2FJ7A 3B0DB 5B2IA 2NZDB 5C3IC 3H0LC 3KSYA 3EG5B 4J8WA 1M1AB 3AZHB 3AZIA 2Y2QA 1AOIB 2ZY2A 1BH8B 2HIOD 3REHC 4YM6C 4ZUXC 5AY8B 1Q9CA 3MGRD 3AZND 1P3LB 3REHA 4YM6A 4JJND 4ZUXA 3AN2B 2JE5A 4Z5TC 3F6TA 4YS3D 3MGPC 5JRGB 3C1CA 5GSUC 3W96B 1TZYB 3UTAD 3AZFD 3AZGD 4Z5TA 2HUEB 3REJC 3LZ0C 5DNMB 1EQZC 3MGPA 3VH6W 5B24D 4QLCD 5B40B 5GSUA 5AV8B 3UT9B 3B0CT 5AV9D 5GT0A 3REJA 5GT3C 5AV6D 3LZ0A 5B2ID 1EQZA 4H9PB 5B1LB 3LELD 4E45A 5GT3A 5B2JD 3UTBB 2AROD 1P3IC 1P3PB 2Y2IA 3AZLD 3A6NC 1ID3B 4J8XC 5B32D 1HTAA 5B1MD 3EPHA 5CPJB 2PYOC 2G5HC 3V9RB 4J8XA 3X1VA 2PYOA 4WU8C 1P3BD 4WV4B 4ZBJC 3AZJC 1WWIA 1TAFB 3H0MC 1B6WA 3C1BB 2YFVA 5F99B 3KUYB 3B6GB 5JA4A 3MVDB 3AZJA 3LZ1C 1KX4D 5GXQC 2BG1A 1P3MB 5KDMA 5CP6B 3A1IA 5E5AC 3WTPE 3KXBD 3LZ1A 3LJAD 3W98D 5GXQA 1P3AC 3REIC 4H9NB 4E44A 1P3GC 1JFIA 3B6FD 5E5AA 2BYKB 5B33C 1ZLAD 2F2AC 4WU9D 3WTPD 3FDDA 1P3AA 3KWQC 3EPLA 3REIA 4XUJB 4Z66C 4Z2MG 1P3GA 4LD9C 4G92C 1N1JA 1P3ID 5B33A 3VH6T 4R8PC 1P34C 3A6ND 1BFMA 3KWQA 3IP4C 4Z66A 3H0RC 4LD9A 4CAYA 4R8PA 1P34A 2Y2OA 3AZEC 3AV1D 1KX3D 3TU4D 5AVCB 4WU8D 2HIOC 3X1UD 2FFFB 4UUZB 1F66B 5AVBD 1P3KB 1P3OD 2Y2JA 3X1TD 3MGRC 3AZNC 2HIOA 5CPID 3W99B 4JJNC 3P5JB 3VH5A 4X23D 4YS3C 3MGRA 2ZY5A 5B32G 3AZNA 3R45B 4EO5B 5AV5D 4KGCC 4JJNA 3AZFC 5B0ZD 4H9OA 3AZGC 2NZDC 5BO0A 4HGAB 4YS3A 5B24C 3MGQB 3AZHC 2UWXA 4QLCC 1AOIC 5CPKB 3AFAB 5B33D 3AZFA 3AZMB 3O62B 3AZGA 5AV9C 1M19B 5FUGA 5B0YB 3MGSD 5B24A 4QLCA 4KHAB 1P34D 1W2EA 1U35D 5AV9A 5AV6A 3W97B 5B2JC 1S32B 2AROC 1P3LC 3RELB 5BNVA 3AZLC 1HQ3D 3LELA 5B32C 3AZED 5B1MC 2NQBB 5B2JA 4XZQD 3NQUB 2AROA 4J8UD 4KUDD 3AZLA 5B32A 3B0BA 5B1MA 2F8NB 3AZKD 1P3BC 4CSRA 5BNXA 1KX5D 1P3FD 3X1SB 5DNND 5B31D 3UTAB 1P3BA 3WKJB 2CV5D 4AWLC 4KGCD 1M18B 1KX4C 2NZDD 4H9RB 4J8VB 4DRBA 3AV2C 3REKB 3AZHD 1AOID 1P3PC 2FJ7B 5B2IB 3KXBC 4J8WB 1KX4A 3LJAC 3AZIB 3W98C 1BH9A 3AV2A 4UPKA 2IO5C 5G49A 3B6FC 5C3IB 3KXBA 1ZLAC 4WU9C 3WTPC 5AY8D 3LJAA 3W98A 1H3OA 3VH5W 1P3LD 3B6FA 2XD5A 1ZLAA 4WU9A 3WTPA 2ZY4A 4NE3A 3NQJA 3REHB 4YM6B 5JRGD 4ZUXB 1P3IA 2Y2LA 3MNNC 3W96D 1TZYD 3A6NA 3C1CB 3AV1C 1KX3C 4WJ3C 5DNMD 3TU4C 4H9QA 1WWSA 5B40D 4Z5TB 5CHLB 2YFWA 5AV8D 3X1UC 3MNNA 2JSSA 3MGPB 3UT9D 5AVBC 1P3OC 3WAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNN A;  1KX3 A;  5GSU B;  3TU4 A;  3X1T C;  2CWE A;  4WU8 A;  5GT0 B;  3REJ B;  5CPI C;  3X1U A;  3LZ0 B;  1EQZ B;  5AVB A;  4G91 C;  1P3O A;  3WAA A;  4X23 C;  3UTB D;  3X1T A;  3AV2 D;  3AV1 A;  5GT3 B;  5CPI A;  1P3P D;  1B67 A;  2BYM A;  5AV5 C;  1ID3 D;  5B0Z C;  4X23 A;  5CPJ D;  5AV5 A;  5B0Z A;  5BT1 D;  3MGS C;  4J8X B;  3X1V B;  5B31 G;  2PYO B;  1U35 C;  3C1B D;  3MGS A;  5F99 D;  3KUY D;  3B6G D;  1HQ3 C;  3MNN D;  3MVD D;  2YFV B;  1U35 A;  1P3M D;  4XZQ C;  5JA4 B;  4ZBJ B;  3AZJ B;  4J8U C;  5CP6 D;  3WA9 C;  4KUD C;  1HQ3 A;  5KDM B;  3VH5 T;  3AZE A;  1F1E A;  3WAA D;  4XZQ A;  3AZK C;  4NFT A;  3LZ1 B;  4J8U A;  5CPK C;  3WA9 A;  5GXQ B;  4KUD A;  3AYW C;  1KX5 C;  1JFI B;  1P3F C;  5B0Y C;  5E5A B;  4XUJ D;  3AZK A;  5DNN C;  5B31 C;  1P3A B;  3REI B;  2CV5 C;  3AYW A;  1KX5 A;  1P3G B;  1P3F A;  3B0D C;  1N1J B;  5B33 B;  5DNN A;  5B31 A;  1M1A C;  3KWQ B;  2CV5 A;  4Z66 B;  4KGC A;  4LD9 B;  4CAY B;  2NZD A;  4R8P B;  1P34 B;  1M1A A;  3AZH A;  1AOI A;  1F66 D;  1P3K D;  2LY8 A;  5AY8 C;  1BH8 A;  4H9S C;  3W99 D;  3AN2 C;  5AY8 A;  2HIO B;  4H9S A;  5JRG C;  1P3L A;  3WA9 D;  4M6B A;  1TZY C;  3W96 C;  3MGR B;  3AZN B;  3AN2 A;  2F8N H;  2HUE C;  4Z2M H;  4J8V C;  5DNM C;  4JJN B;  5JRG A;  4H9O B;  5B40 C;  5CPK D;  5BO0 B;  3AFA D;  3UT9 C;  5AV8 C;  3W96 A;  1TZY A;  3AZM D;  3AYW D;  3O62 D;  4YS3 B;  1M19 D;  5DNM A;  5B0Y D;  3AZF B;  5B40 A;  1R4V A;  3AZG B;  3UT9 A;  5AV8 A;  5FUG B;  5B1L C;  2RVQ C;  5B24 B;  4QLC B;  3W97 D;  3UTB C;  1S32 D;  5AV9 B;  3REL D;  1M1A D;  2L5A A;  5AV6 B;  4H9P A;  5B1L A;  1ID3 C;  2NQB D;  5BNV B;  5CPJ C;  3UTB A;  3LEL B;  2F8N K;  1P3P A;  3C1C C;  5B2J B;  1ID3 A;  2ARO B;  2F8N D;  3AZL B;  5CPJ A;  5BT1 C;  5B32 B;  5B1M B;  3V9R A;  3AN2 D;  3C1B C;  3X1S D;  4CSR B;  5BNX B;  5GT0 C;  5F99 C;  3WKJ D;  3KUY C;  3B6G C;  3MVD C;  1P3B B;  1M18 D;  1TAF A;  3C1B A;  4J8V D;  1P3M C;  3REK D;  5F99 A;  5CP6 C;  3KUY A;  2FJ7 D;  3B6G A;  3MVD A;  4J8W D;  3AZI D;  1P3M A;  4AWL B;  5CP6 A;  1KX4 B;  1BH9 B;  5BS7 C;  3AV2 B;  1A7W A;  2RVQ D;  5B1L D;  5G49 B;  4H9N A;  4XUJ C;  3KXB B;  3LJA B;  3W98 B;  2BYK A;  3X1V C;  5BS7 A;  1H3O B;  2IO5 B;  3B6F B;  4NE6 A;  4XUJ A;  4YM6 D;  3REH D;  1ZLA B;  4ZUX D;  3WTP B;  4WU9 B;  3NQJ B;  3C1C D;  1P3I B;  3A6N B;  4Z5T D;  5AVC C;  1F66 C;  4H9Q B;  3MGP D;  1P3K C;  2YFW B;  5GSU D;  3MNN B;  3AV1 B;  5AVC A;  5GT0 D;  4WNN B;  3REJ D;  1KX3 B;  3W99 C;  3LZ0 D;  4UUZ A;  3TU4 B;  1F66 A;  1EQZ D;  1P3K A;  4WU8 B;  3X1U B;  5AVB B;  1P3O B;  3WAA B;  1ULY A;  5GT3 D;  3W99 A;  4EO5 C;  3X1T B;  5CPI B;  4HGA C;  2BYM B;  4G91 B;  3MGQ C;  3R45 A;  2F8N G;  4X23 B;  3AFA C;  4NE5 A;  3AZM C;  3O62 C;  1M19 C;  5AV5 B;  4J8X D;  3MGQ A;  5B0Z B;  5CPK A;  3AFA A;  3X1V D;  3AZM A;  2PYO D;  3O62 A;  1M19 A;  4DRA A;  5B0Y A;  3W97 C;  3VH6 A;  1S32 C;  3REL C;  4KHA A;  3MGS B;  4WZS B;  3W97 A;  2NQB C;  4G92 B;  1S32 A;  3AZJ D;  1U35 B;  3REL A;  5AVC D;  3B0C W;  2NQB A;  1HQ3 B;  3NQU A;  3LZ1 D;  3AZE B;  5GXQ D;  4XZQ B;  4J8U B;  4KUD B;  3WA9 B;  2F8N A;  5E5A D;  3UTA C;  3X1S C;  1P3A D;  3WKJ C;  3REI D;  3AZK B;  1P3G D;  1M18 C;  1KU5 A;  3X1S A;  3UTA A;  3AYW B;  3REK C;  1KX5 B;  3MGQ D;  1P3F B;  5AV6 C;  3KWQ D;  5B2I C;  2FJ7 C;  4Z66 D;  3WKJ A;  5DNN B;  5B31 B;  4J8W C;  1M18 A;  4LD9 D;  3AZI C;  4H9R A;  2CV5 B;  4R8P D;  4J8V A;  3LEL C;  3REK A;  4KGC B;  2FJ7 A;  3B0D B;  5B2I A;  2NZD B;  5C3I C;  3KSY A;  4J8W A;  1M1A B;  3AZH B;  3AZI A;  1AOI B;  1BH8 B;  2HIO D;  3REH C;  4YM6 C;  4ZUX C;  5AY8 B;  1Q9C A;  3MGR D;  3AZN D;  1P3L B;  3REH A;  4YM6 A;  4JJN D;  4ZUX A;  3AN2 B;  4Z5T C;  4YS3 D;  3MGP C;  3C1C A;  5JRG B;  5GSU C;  3W96 B;  1TZY B;  3UTA D;  3AZF D;  3AZG D;  4Z5T A;  2HUE B;  3REJ C;  3LZ0 C;  5DNM B;  1EQZ C;  3MGP A;  3VH6 W;  5B24 D;  4QLC D;  5B40 B;  5GSU A;  5AV8 B;  3UT9 B;  3B0C T;  5AV9 D;  5GT0 A;  3REJ A;  5GT3 C;  5AV6 D;  3LZ0 A;  5B2I D;  1EQZ A;  4H9P B;  5B1L B;  3LEL D;  4E45 A;  5GT3 A;  5B2J D;  3UTB B;  2ARO D;  1P3I C;  1P3P B;  3AZL D;  3A6N C;  1ID3 B;  4J8X C;  5B32 D;  1HTA A;  5B1M D;  5CPJ B;  2PYO C;  3V9R B;  4J8X A;  3X1V A;  2PYO A;  4WU8 C;  1P3B D;  4WV4 B;  4ZBJ C;  3AZJ C;  1WWI A;  1TAF B;  1B6W A;  3C1B B;  2YFV A;  5F99 B;  3KUY B;  3B6G B;  5JA4 A;  3MVD B;  3AZJ A;  3LZ1 C;  1KX4 D;  5GXQ C;  1P3M B;  5KDM A;  5CP6 B;  5E5A C;  3WTP E;  3KXB D;  3LZ1 A;  3LJA D;  3W98 D;  5GXQ A;  1P3A C;  3REI C;  4H9N B;  4E44 A;  1P3G C;  1JFI A;  3B6F D;  5E5A A;  2BYK B;  5B33 C;  1ZLA D;  4WU9 D;  3WTP D;  1P3A A;  3KWQ C;  3REI A;  4XUJ B;  4Z66 C;  4Z2M G;  1P3G A;  4LD9 C;  4G92 C;  1N1J A;  1P3I D;  5B33 A;  3VH6 T;  4R8P C;  1P34 C;  3A6N D;  1BFM A;  3KWQ A;  4Z66 A;  4LD9 A;  4CAY A;  4R8P A;  1P34 A;  3AZE C;  3AV1 D;  1KX3 D;  3TU4 D;  5AVC B;  4WU8 D;  2HIO C;  3X1U D;  4UUZ B;  1F66 B;  5AVB D;  1P3K B;  1P3O D;  3X1T D;  3MGR C;  3AZN C;  2HIO A;  5CPI D;  3W99 B;  4JJN C;  3VH5 A;  4X23 D;  4YS3 C;  3MGR A;  5B32 G;  3AZN A;  3R45 B;  4EO5 B;  5AV5 D;  4KGC C;  4JJN A;  3AZF C;  5B0Z D;  4H9O A;  3AZG C;  2NZD C;  5BO0 A;  4HGA B;  4YS3 A;  5B24 C;  3MGQ B;  3AZH C;  1AOI C;  4QLC C;  5CPK B;  3AFA B;  5B33 D;  3AZF A;  3AZM B;  3O62 B;  3AZG A;  5AV9 C;  1M19 B;  5FUG A;  5B0Y B;  3MGS D;  5B24 A;  4QLC A;  4KHA B;  1P34 D;  1U35 D;  5AV9 A;  5AV6 A;  3W97 B;  5B2J C;  1S32 B;  2ARO C;  1P3L C;  3REL B;  5BNV A;  3AZL C;  1HQ3 D;  3LEL A;  5B32 C;  3AZE D;  5B1M C;  2NQB B;  5B2J A;  4XZQ D;  3NQU B;  2ARO A;  4J8U D;  4KUD D;  3AZL A;  5B32 A;  3B0B A;  5B1M A;  2F8N B;  3AZK D;  1P3B C;  4CSR A;  5BNX A;  1KX5 D;  1P3F D;  3X1S B;  5DNN D;  5B31 D;  3UTA B;  1P3B A;  3WKJ B;  2CV5 D;  4AWL C;  4KGC D;  1M18 B;  1KX4 C;  2NZD D;  4H9R B;  4J8V B;  4DRB A;  3AV2 C;  3REK B;  3AZH D;  1AOI D;  1P3P C;  2FJ7 B;  5B2I B;  3KXB C;  4J8W B;  1KX4 A;  3LJA C;  3AZI B;  3W98 C;  1BH9 A;  3AV2 A;  2IO5 C;  5G49 A;  3B6F C;  5C3I B;  3KXB A;  1ZLA C;  4WU9 C;  3WTP C;  5AY8 D;  3LJA A;  3W98 A;  1H3O A;  3VH5 W;  1P3L D;  3B6F A;  1ZLA A;  4WU9 A;  3WTP A;  4NE3 A;  3NQJ A;  3REH B;  4YM6 B;  5JRG D;  4ZUX B;  1P3I A;  3MNN C;  3W96 D;  1TZY D;  3A6N A;  3C1C B;  3AV1 C;  1KX3 C;  5DNM D;  3TU4 C;  4H9Q A;  1WWS A;  5B40 D;  4Z5T B;  5CHL B;  2YFW A;  5AV8 D;  3X1U C;  3MNN A;  2JSS A;  3MGP B;  3UT9 D;  5AVB C;  1P3O C;  3WAA C; 
#chains in the Genus database with same CATH topology
 4WNN A;  1KX3 A;  5GSU B;  3TU4 A;  3X1T C;  2CWE A;  4WU8 A;  5GT0 B;  3REJ B;  5CPI C;  3X1U A;  3LZ0 B;  1EQZ B;  5AVB A;  4G91 C;  1P3O A;  3WAA A;  2Y2M A;  4X23 C;  3UTB D;  3X1T A;  3AV2 D;  3AV1 A;  5GT3 B;  5CPI A;  1P3P D;  1B67 A;  2BYM A;  5AV5 C;  1ID3 D;  5B0Z C;  4X23 A;  5CPJ D;  5AV5 A;  5B0Z A;  5BT1 D;  3MGS C;  4J8X B;  3X1V B;  5B31 G;  2PYO B;  1U35 C;  3A1K A;  2VQR A;  3C1B D;  3MGS A;  5F99 D;  3KUY D;  3B6G D;  1HQ3 C;  3MNN D;  3MVD D;  2YFV B;  1U35 A;  1P3M D;  4XZQ C;  5JA4 B;  4ZBJ B;  3AZJ B;  4J8U C;  5CP6 D;  3WA9 C;  4KUD C;  2XD1 A;  1HQ3 A;  5KDM B;  3VH5 T;  3AZE A;  1F1E A;  3WAA D;  2Y2H A;  4XZQ A;  3AZK C;  4NFT A;  3LZ1 B;  4J8U A;  5CPK C;  3WA9 A;  5GXQ B;  4KUD A;  3AYW C;  1KX5 C;  1JFI B;  1P3F C;  5B0Y C;  5E5A B;  4XUJ D;  3AZK A;  5DNN C;  1T3U A;  5B31 C;  1P3A B;  3REI B;  2CV5 C;  3AYW A;  1KX5 A;  1P3G B;  1P3F A;  3B0D C;  1N1J B;  5B33 B;  5DNN A;  5B31 A;  1M1A C;  3KWQ B;  2CV5 A;  4Z66 B;  3AL0 C;  4KGC A;  4LD9 B;  4CAY B;  2NZD A;  4R8P B;  1P34 B;  1M1A A;  3AZH A;  1AOI A;  1F66 D;  1P3K D;  2LY8 A;  2W8S A;  5AY8 C;  1BH8 A;  1PZR A;  4H9S C;  2Y2K A;  3W99 D;  3AN2 C;  5AY8 A;  2HIO B;  4H9S A;  5JRG C;  1Z2C B;  1P3L A;  3WA9 D;  4M6B A;  1TZY C;  3W96 C;  3MGR B;  3AZN B;  3AN2 A;  2F8N H;  2HUE C;  4Z2M H;  4J8V C;  5DNM C;  4JJN B;  5JRG A;  4H9O B;  5B40 C;  5CPK D;  5BO0 B;  3AFA D;  3UT9 C;  5AV8 C;  3W96 A;  1TZY A;  3AZM D;  3AYW D;  3O62 D;  4YS3 B;  3EPK A;  1M19 D;  5DNM A;  5B0Y D;  3AZF B;  5B40 A;  1R4V A;  3AZG B;  3UT9 A;  5AV8 A;  5FUG B;  5B1L C;  2RVQ C;  5B24 B;  4QLC B;  3W97 D;  3UTB C;  1S32 D;  5AV9 B;  3REL D;  1M1A D;  2JCH A;  2L5A A;  5AV6 B;  4H9P A;  5B1L A;  1ID3 C;  2NQB D;  5BNV B;  2G5I C;  5CPJ C;  3UTB A;  3LEL B;  2F8N K;  1P3P A;  3C1C C;  5B2J B;  1ID3 A;  2ARO B;  2F8N D;  2DF4 C;  3AZL B;  5CPJ A;  5BT1 C;  5B32 B;  5B1M B;  3V9R A;  3AN2 D;  3C1B C;  3X1S D;  4CSR B;  5BNX B;  5GT0 C;  5F99 C;  3WKJ D;  3KUY C;  3B6G C;  4DQY B;  3MVD C;  1P3B B;  1M18 D;  1TAF A;  3C1B A;  4J8V D;  1P3M C;  3REK D;  5F99 A;  5CP6 C;  3KUY A;  2FJ7 D;  3B6G A;  3MVD A;  4J8W D;  3AZI D;  1P3M A;  2RIQ A;  4AWL B;  5CP6 A;  1KX4 B;  1BH9 B;  5BS7 C;  3AV2 B;  1A7W A;  2RVQ D;  5B1L D;  5G49 B;  4H9N A;  4XUJ C;  3KXB B;  3EPJ A;  3LJA B;  3W98 B;  2BYK A;  3X1V C;  5BS7 A;  1H3O B;  2IO5 B;  3B6F B;  4NE6 A;  4XUJ A;  4YM6 D;  3REH D;  1ZLA B;  4ZUX D;  3WTP B;  4WU9 B;  3NQJ B;  3C1C D;  1P3I B;  3A6N B;  4Z5T D;  5AVC C;  1F66 C;  4H9Q B;  3MGP D;  1P3K C;  2Y2G A;  2YFW B;  5GSU D;  3MNN B;  3AV1 B;  5AVC A;  5GT0 D;  4WNN B;  3REJ D;  1KX3 B;  3W99 C;  3LZ0 D;  4UUZ A;  3TU4 B;  2ZY3 A;  1F66 A;  1EQZ D;  1P3K A;  4WU8 B;  3X1U B;  5AVB B;  1P3O B;  3WAA B;  1ULY A;  5GT3 D;  3W99 A;  4EO5 C;  3X1T B;  5CPI B;  4HGA C;  2BYM B;  4G91 B;  3MGQ C;  3R45 A;  2F8N G;  4X23 B;  3AFA C;  4NE5 A;  3AZM C;  3O62 C;  1M19 C;  2DQN C;  5AV5 B;  4J8X D;  3MGQ A;  5B0Z B;  5CPK A;  3AFA A;  3X1V D;  3AZM A;  2PYO D;  2ZM5 A;  3O62 A;  2Y2N A;  4DRA A;  5B0Y A;  1M19 A;  3W97 C;  3VH6 A;  1S32 C;  3REL C;  4KHA A;  3MGS B;  4WZS B;  3W97 A;  2NQB C;  4G92 B;  1S32 A;  3AZJ D;  1U35 B;  3REL A;  5AVC D;  3B0C W;  2NQB A;  1HQ3 B;  3NQU A;  3LZ1 D;  2J8P A;  3AZE B;  5GXQ D;  3KFU G;  4XZQ B;  4J8U B;  4KUD B;  3WA9 B;  2F8N A;  5E5A D;  3UTA C;  3X1S C;  1P3A D;  3WKJ C;  3REI D;  3AZK B;  1P3G D;  1M18 C;  1KU5 A;  3X1S A;  3UTA A;  2Y2P A;  3REK C;  3AYW B;  1KX5 B;  3MGQ D;  1P3F B;  5AV6 C;  3KWQ D;  5B2I C;  2FJ7 C;  4Z66 D;  3WKJ A;  5DNN B;  5B31 B;  4J8W C;  1M18 A;  4LD9 D;  3AZI C;  4H9R A;  2CV5 B;  4R8P D;  4J8V A;  3LEL C;  3REK A;  4KGC B;  2FJ7 A;  3B0D B;  5B2I A;  2NZD B;  5C3I C;  3H0L C;  3KSY A;  3EG5 B;  4J8W A;  1M1A B;  3AZH B;  3AZI A;  2Y2Q A;  1AOI B;  2ZY2 A;  1BH8 B;  2HIO D;  3REH C;  4YM6 C;  4ZUX C;  5AY8 B;  1Q9C A;  3MGR D;  3AZN D;  1P3L B;  3REH A;  4YM6 A;  4JJN D;  4ZUX A;  3AN2 B;  2JE5 A;  4Z5T C;  3F6T A;  4YS3 D;  3MGP C;  5JRG B;  3C1C A;  5GSU C;  3W96 B;  1TZY B;  3UTA D;  3AZF D;  3AZG D;  4Z5T A;  2HUE B;  3REJ C;  3LZ0 C;  5DNM B;  1EQZ C;  3MGP A;  3VH6 W;  5B24 D;  4QLC D;  5B40 B;  5GSU A;  5AV8 B;  3UT9 B;  3B0C T;  5AV9 D;  5GT0 A;  3REJ A;  5GT3 C;  5AV6 D;  3LZ0 A;  5B2I D;  1EQZ A;  4H9P B;  5B1L B;  3LEL D;  4E45 A;  5GT3 A;  5B2J D;  3UTB B;  2ARO D;  1P3I C;  1P3P B;  2Y2I A;  3AZL D;  3A6N C;  1ID3 B;  4J8X C;  5B32 D;  1HTA A;  5B1M D;  3EPH A;  5CPJ B;  2PYO C;  2G5H C;  3V9R B;  4J8X A;  3X1V A;  2PYO A;  4WU8 C;  1P3B D;  4WV4 B;  4ZBJ C;  3AZJ C;  1WWI A;  1TAF B;  3H0M C;  1B6W A;  3C1B B;  2YFV A;  5F99 B;  3KUY B;  3B6G B;  5JA4 A;  3MVD B;  3AZJ A;  3LZ1 C;  1KX4 D;  5GXQ C;  2BG1 A;  1P3M B;  5KDM A;  5CP6 B;  3A1I A;  5E5A C;  3WTP E;  3KXB D;  3LZ1 A;  3LJA D;  3W98 D;  5GXQ A;  1P3A C;  3REI C;  4H9N B;  4E44 A;  1P3G C;  1JFI A;  3B6F D;  5E5A A;  2BYK B;  5B33 C;  1ZLA D;  2F2A C;  4WU9 D;  3WTP D;  3FDD A;  1P3A A;  3KWQ C;  3EPL A;  3REI A;  4XUJ B;  4Z66 C;  4Z2M G;  1P3G A;  4LD9 C;  4G92 C;  1N1J A;  1P3I D;  5B33 A;  3VH6 T;  4R8P C;  1P34 C;  3A6N D;  1BFM A;  3KWQ A;  3IP4 C;  4Z66 A;  3H0R C;  4LD9 A;  4CAY A;  4R8P A;  1P34 A;  2Y2O A;  3AZE C;  3AV1 D;  1KX3 D;  3TU4 D;  5AVC B;  4WU8 D;  2HIO C;  3X1U D;  2FFF B;  4UUZ B;  1F66 B;  5AVB D;  1P3K B;  1P3O D;  2Y2J A;  3X1T D;  3MGR C;  3AZN C;  2HIO A;  5CPI D;  3W99 B;  4JJN C;  3P5J B;  3VH5 A;  4X23 D;  4YS3 C;  3MGR A;  2ZY5 A;  5B32 G;  3AZN A;  3R45 B;  4EO5 B;  5AV5 D;  4KGC C;  4JJN A;  3AZF C;  5B0Z D;  4H9O A;  3AZG C;  2NZD C;  5BO0 A;  4HGA B;  4YS3 A;  5B24 C;  3MGQ B;  3AZH C;  2UWX A;  4QLC C;  1AOI C;  5CPK B;  3AFA B;  5B33 D;  3AZF A;  3AZM B;  3O62 B;  3AZG A;  5AV9 C;  1M19 B;  5FUG A;  5B0Y B;  3MGS D;  5B24 A;  4QLC A;  4KHA B;  1P34 D;  1W2E A;  1U35 D;  5AV9 A;  5AV6 A;  3W97 B;  5B2J C;  1S32 B;  2ARO C;  1P3L C;  3REL B;  5BNV A;  3AZL C;  1HQ3 D;  3LEL A;  5B32 C;  3AZE D;  5B1M C;  2NQB B;  5B2J A;  4XZQ D;  3NQU B;  2ARO A;  4J8U D;  4KUD D;  3AZL A;  5B32 A;  3B0B A;  5B1M A;  2F8N B;  3AZK D;  1P3B C;  4CSR A;  5BNX A;  1KX5 D;  1P3F D;  3X1S B;  5DNN D;  5B31 D;  3UTA B;  1P3B A;  3WKJ B;  2CV5 D;  4AWL C;  4KGC D;  1M18 B;  1KX4 C;  2NZD D;  4H9R B;  4J8V B;  4DRB A;  3AV2 C;  3REK B;  3AZH D;  1AOI D;  1P3P C;  2FJ7 B;  5B2I B;  3KXB C;  4J8W B;  1KX4 A;  3LJA C;  3AZI B;  3W98 C;  1BH9 A;  3AV2 A;  4UPK A;  2IO5 C;  5G49 A;  3B6F C;  5C3I B;  3KXB A;  1ZLA C;  4WU9 C;  3WTP C;  5AY8 D;  3LJA A;  3W98 A;  1H3O A;  3VH5 W;  1P3L D;  3B6F A;  2XD5 A;  1ZLA A;  4WU9 A;  3WTP A;  2ZY4 A;  4NE3 A;  3NQJ A;  3REH B;  4YM6 B;  5JRG D;  4ZUX B;  1P3I A;  2Y2L A;  3MNN C;  3W96 D;  1TZY D;  3A6N A;  3C1C B;  3AV1 C;  1KX3 C;  4WJ3 C;  5DNM D;  3TU4 C;  4H9Q A;  1WWS A;  5B40 D;  4Z5T B;  5CHL B;  2YFW A;  5AV8 D;  3X1U C;  3MNN A;  2JSS A;  3MGP B;  3UT9 D;  5AVB C;  1P3O C;  3WAA C; 
#chains in the Genus database with same CATH homology
 4WNN A;  1KX3 A;  5GSU B;  3TU4 A;  3X1T C;  2CWE A;  4WU8 A;  5GT0 B;  3REJ B;  5CPI C;  3X1U A;  3LZ0 B;  1EQZ B;  5AVB A;  4G91 C;  1P3O A;  3WAA A;  2Y2M A;  4X23 C;  3UTB D;  3X1T A;  3AV2 D;  3AV1 A;  5GT3 B;  5CPI A;  1P3P D;  1B67 A;  2BYM A;  5AV5 C;  1ID3 D;  5B0Z C;  4X23 A;  5CPJ D;  5AV5 A;  5B0Z A;  5BT1 D;  3MGS C;  4J8X B;  3X1V B;  5B31 G;  2PYO B;  1U35 C;  3A1K A;  2VQR A;  3C1B D;  3MGS A;  5F99 D;  3KUY D;  3B6G D;  1HQ3 C;  3MNN D;  3MVD D;  2YFV B;  1U35 A;  1P3M D;  4XZQ C;  5JA4 B;  4ZBJ B;  3AZJ B;  4J8U C;  5CP6 D;  3WA9 C;  4KUD C;  2XD1 A;  1HQ3 A;  5KDM B;  3VH5 T;  3AZE A;  1F1E A;  3WAA D;  2Y2H A;  4XZQ A;  3AZK C;  4NFT A;  3LZ1 B;  4J8U A;  5CPK C;  3WA9 A;  5GXQ B;  4KUD A;  3AYW C;  1KX5 C;  1JFI B;  1P3F C;  5B0Y C;  5E5A B;  4XUJ D;  3AZK A;  5DNN C;  1T3U A;  5B31 C;  1P3A B;  3REI B;  2CV5 C;  3AYW A;  1KX5 A;  1P3G B;  1P3F A;  3B0D C;  1N1J B;  5B33 B;  5DNN A;  5B31 A;  1M1A C;  3KWQ B;  2CV5 A;  4Z66 B;  3AL0 C;  4KGC A;  4LD9 B;  4CAY B;  2NZD A;  4R8P B;  1P34 B;  1M1A A;  3AZH A;  1AOI A;  1F66 D;  1P3K D;  2LY8 A;  2W8S A;  5AY8 C;  1BH8 A;  1PZR A;  4H9S C;  2Y2K A;  3W99 D;  3AN2 C;  5AY8 A;  2HIO B;  4H9S A;  5JRG C;  1Z2C B;  1P3L A;  3WA9 D;  4M6B A;  1TZY C;  3W96 C;  3MGR B;  3AZN B;  3AN2 A;  2F8N H;  2HUE C;  4Z2M H;  4J8V C;  5DNM C;  4JJN B;  5JRG A;  4H9O B;  5B40 C;  5CPK D;  5BO0 B;  3AFA D;  3UT9 C;  5AV8 C;  3W96 A;  1TZY A;  3AZM D;  3AYW D;  3O62 D;  4YS3 B;  3EPK A;  1M19 D;  5DNM A;  5B0Y D;  3AZF B;  5B40 A;  1R4V A;  3AZG B;  3UT9 A;  5AV8 A;  5FUG B;  5B1L C;  2RVQ C;  5B24 B;  4QLC B;  3W97 D;  3UTB C;  1S32 D;  5AV9 B;  3REL D;  1M1A D;  2JCH A;  2L5A A;  5AV6 B;  4H9P A;  5B1L A;  1ID3 C;  2NQB D;  5BNV B;  2G5I C;  5CPJ C;  3UTB A;  3LEL B;  2F8N K;  1P3P A;  3C1C C;  5B2J B;  1ID3 A;  2ARO B;  2F8N D;  2DF4 C;  3AZL B;  5CPJ A;  5BT1 C;  5B32 B;  5B1M B;  3V9R A;  3AN2 D;  3C1B C;  3X1S D;  4CSR B;  5BNX B;  5GT0 C;  5F99 C;  3WKJ D;  3KUY C;  3B6G C;  4DQY B;  3MVD C;  1P3B B;  1M18 D;  1TAF A;  3C1B A;  4J8V D;  1P3M C;  3REK D;  5F99 A;  5CP6 C;  3KUY A;  2FJ7 D;  3B6G A;  3MVD A;  4J8W D;  3AZI D;  1P3M A;  2RIQ A;  4AWL B;  5CP6 A;  1KX4 B;  1BH9 B;  5BS7 C;  3AV2 B;  1A7W A;  2RVQ D;  5B1L D;  5G49 B;  4H9N A;  4XUJ C;  3KXB B;  3EPJ A;  3LJA B;  3W98 B;  2BYK A;  3X1V C;  5BS7 A;  1H3O B;  2IO5 B;  3B6F B;  4NE6 A;  4XUJ A;  4YM6 D;  3REH D;  1ZLA B;  4ZUX D;  3WTP B;  4WU9 B;  3NQJ B;  3C1C D;  1P3I B;  3A6N B;  4Z5T D;  5AVC C;  1F66 C;  4H9Q B;  3MGP D;  1P3K C;  2Y2G A;  2YFW B;  5GSU D;  3MNN B;  3AV1 B;  5AVC A;  5GT0 D;  4WNN B;  3REJ D;  1KX3 B;  3W99 C;  3LZ0 D;  4UUZ A;  3TU4 B;  2ZY3 A;  1F66 A;  1EQZ D;  1P3K A;  4WU8 B;  3X1U B;  5AVB B;  1P3O B;  3WAA B;  1ULY A;  5GT3 D;  3W99 A;  4EO5 C;  3X1T B;  5CPI B;  4HGA C;  2BYM B;  4G91 B;  3MGQ C;  3R45 A;  2F8N G;  4X23 B;  3AFA C;  4NE5 A;  3AZM C;  3O62 C;  1M19 C;  2DQN C;  5AV5 B;  4J8X D;  3MGQ A;  5B0Z B;  5CPK A;  3AFA A;  3X1V D;  3AZM A;  2PYO D;  2ZM5 A;  3O62 A;  2Y2N A;  4DRA A;  5B0Y A;  1M19 A;  3W97 C;  3VH6 A;  1S32 C;  3REL C;  4KHA A;  3MGS B;  4WZS B;  3W97 A;  2NQB C;  4G92 B;  1S32 A;  3AZJ D;  1U35 B;  3REL A;  5AVC D;  3B0C W;  2NQB A;  1HQ3 B;  3NQU A;  3LZ1 D;  2J8P A;  3AZE B;  5GXQ D;  3KFU G;  4XZQ B;  4J8U B;  4KUD B;  3WA9 B;  2F8N A;  5E5A D;  3UTA C;  3X1S C;  1P3A D;  3WKJ C;  3REI D;  3AZK B;  1P3G D;  1M18 C;  1KU5 A;  3X1S A;  3UTA A;  2Y2P A;  3REK C;  3AYW B;  1KX5 B;  3MGQ D;  1P3F B;  5AV6 C;  3KWQ D;  5B2I C;  2FJ7 C;  4Z66 D;  3WKJ A;  5DNN B;  5B31 B;  4J8W C;  1M18 A;  4LD9 D;  3AZI C;  4H9R A;  2CV5 B;  4R8P D;  4J8V A;  3LEL C;  3REK A;  4KGC B;  2FJ7 A;  3B0D B;  5B2I A;  2NZD B;  5C3I C;  3H0L C;  3KSY A;  3EG5 B;  4J8W A;  1M1A B;  3AZH B;  3AZI A;  2Y2Q A;  1AOI B;  2ZY2 A;  1BH8 B;  2HIO D;  3REH C;  4YM6 C;  4ZUX C;  5AY8 B;  1Q9C A;  3MGR D;  3AZN D;  1P3L B;  3REH A;  4YM6 A;  4JJN D;  4ZUX A;  3AN2 B;  2JE5 A;  4Z5T C;  3F6T A;  4YS3 D;  3MGP C;  5JRG B;  3C1C A;  5GSU C;  3W96 B;  1TZY B;  3UTA D;  3AZF D;  3AZG D;  4Z5T A;  2HUE B;  3REJ C;  3LZ0 C;  5DNM B;  1EQZ C;  3MGP A;  3VH6 W;  5B24 D;  4QLC D;  5B40 B;  5GSU A;  5AV8 B;  3UT9 B;  3B0C T;  5AV9 D;  5GT0 A;  3REJ A;  5GT3 C;  5AV6 D;  3LZ0 A;  5B2I D;  1EQZ A;  4H9P B;  5B1L B;  3LEL D;  4E45 A;  5GT3 A;  5B2J D;  3UTB B;  2ARO D;  1P3I C;  1P3P B;  2Y2I A;  3AZL D;  3A6N C;  1ID3 B;  4J8X C;  5B32 D;  1HTA A;  5B1M D;  3EPH A;  5CPJ B;  2PYO C;  2G5H C;  3V9R B;  4J8X A;  3X1V A;  2PYO A;  4WU8 C;  1P3B D;  4WV4 B;  4ZBJ C;  3AZJ C;  1WWI A;  1TAF B;  3H0M C;  1B6W A;  3C1B B;  2YFV A;  5F99 B;  3KUY B;  3B6G B;  5JA4 A;  3MVD B;  3AZJ A;  3LZ1 C;  1KX4 D;  5GXQ C;  2BG1 A;  1P3M B;  5KDM A;  5CP6 B;  3A1I A;  5E5A C;  3WTP E;  3KXB D;  3LZ1 A;  3LJA D;  3W98 D;  5GXQ A;  1P3A C;  3REI C;  4H9N B;  4E44 A;  1P3G C;  1JFI A;  3B6F D;  5E5A A;  2BYK B;  5B33 C;  1ZLA D;  2F2A C;  4WU9 D;  3WTP D;  3FDD A;  1P3A A;  3KWQ C;  3EPL A;  3REI A;  4XUJ B;  4Z66 C;  4Z2M G;  1P3G A;  4LD9 C;  4G92 C;  1N1J A;  1P3I D;  5B33 A;  3VH6 T;  4R8P C;  1P34 C;  3A6N D;  1BFM A;  3KWQ A;  3IP4 C;  4Z66 A;  3H0R C;  4LD9 A;  4CAY A;  4R8P A;  1P34 A;  2Y2O A;  3AZE C;  3AV1 D;  1KX3 D;  3TU4 D;  5AVC B;  4WU8 D;  2HIO C;  3X1U D;  2FFF B;  4UUZ B;  1F66 B;  5AVB D;  1P3K B;  1P3O D;  2Y2J A;  3X1T D;  3MGR C;  3AZN C;  2HIO A;  5CPI D;  3W99 B;  4JJN C;  3P5J B;  3VH5 A;  4X23 D;  4YS3 C;  3MGR A;  2ZY5 A;  5B32 G;  3AZN A;  3R45 B;  4EO5 B;  5AV5 D;  4KGC C;  4JJN A;  3AZF C;  5B0Z D;  4H9O A;  3AZG C;  2NZD C;  5BO0 A;  4HGA B;  4YS3 A;  5B24 C;  3MGQ B;  3AZH C;  2UWX A;  4QLC C;  1AOI C;  5CPK B;  3AFA B;  5B33 D;  3AZF A;  3AZM B;  3O62 B;  3AZG A;  5AV9 C;  1M19 B;  5FUG A;  5B0Y B;  3MGS D;  5B24 A;  4QLC A;  4KHA B;  1P34 D;  1W2E A;  1U35 D;  5AV9 A;  5AV6 A;  3W97 B;  5B2J C;  1S32 B;  2ARO C;  1P3L C;  3REL B;  5BNV A;  3AZL C;  1HQ3 D;  3LEL A;  5B32 C;  3AZE D;  5B1M C;  2NQB B;  5B2J A;  4XZQ D;  3NQU B;  2ARO A;  4J8U D;  4KUD D;  3AZL A;  5B32 A;  3B0B A;  5B1M A;  2F8N B;  3AZK D;  1P3B C;  4CSR A;  5BNX A;  1KX5 D;  1P3F D;  3X1S B;  5DNN D;  5B31 D;  3UTA B;  1P3B A;  3WKJ B;  2CV5 D;  4AWL C;  4KGC D;  1M18 B;  1KX4 C;  2NZD D;  4H9R B;  4J8V B;  4DRB A;  3AV2 C;  3REK B;  3AZH D;  1AOI D;  1P3P C;  2FJ7 B;  5B2I B;  3KXB C;  4J8W B;  1KX4 A;  3LJA C;  3AZI B;  3W98 C;  1BH9 A;  3AV2 A;  4UPK A;  2IO5 C;  5G49 A;  3B6F C;  5C3I B;  3KXB A;  1ZLA C;  4WU9 C;  3WTP C;  5AY8 D;  3LJA A;  3W98 A;  1H3O A;  3VH5 W;  1P3L D;  3B6F A;  2XD5 A;  1ZLA A;  4WU9 A;  3WTP A;  2ZY4 A;  4NE3 A;  3NQJ A;  3REH B;  4YM6 B;  5JRG D;  4ZUX B;  1P3I A;  2Y2L A;  3MNN C;  3W96 D;  1TZY D;  3A6N A;  3C1C B;  3AV1 C;  1KX3 C;  4WJ3 C;  5DNM D;  3TU4 C;  4H9Q A;  1WWS A;  5B40 D;  4Z5T B;  5CHL B;  2YFW A;  5AV8 D;  3X1U C;  3MNN A;  2JSS A;  3MGP B;  3UT9 D;  5AVB C;  1P3O C;  3WAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...