4Z5TB

The nucleosome containing human h3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
total genus 23
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tB00
4J8VC 3REJB 5CPIB 2NQBC 1S32A 2HUEC 3C1CD 3O62B 5G49A 2IO5C 3KWQD 3C1CC 3X1TB 1P3ID 1ID3A 4R8PD 3AYWC 5GSUB 3KUYD 5KDMB 3O62D 1P3MB 3W99A 1P3OB 1M18B 2CV5D 3LELA 5JA4A 5B1MD 3LZ1A 3UTAA 3AZKB 1M1AA 3TU4A 5BNVA 4WU9D 5B2IB 5AY8C 3UT9A 3B0CT 5CP6C 4YM6D 5B24A 5AV6B 3KXBD 3AZKD 4WU9B 2NZDB 5B2ID 5B32B 2YFWB 5BO0A 5AV5A 3LJAA 3MGQC 3AZGB 1U35C 3KXBB 5B0YB 3W96C 5AVBD 5B31C 4LD9B 1P3FA 4XZQC 5B1LC 4J8UC 5B32C 3AV2A 4X23B 3AV1A 3MGRB 3C1BB 4AWLB 5AV9A 3VH6W 3B6FC 5B0YC 5GXQD 3W96B 2BYMB 5E5AA 4Z66C 3MVDC 1M19D 5BNXB 1KX4C 4ZUXD 5AVCD 3C1BD 5BT1D 4EO5B 5B33A 1P3GD 4R8PB 5B32G 4J8WC 5JRGC 3UTBC 5C3IB 2HIOC 4JJNA 3WA9A 4ZBJC 3VH5T 5G49B 4J8WD 5GT3A 3X1SD 3WTPA 5AVCB 4ZUXB 3REIC 3X1VA 3B0DC 2AROB 3B6GC 3B0CW 5GT0A 3RELC 1KX4D 1P3OC 1M19C 1M18C 3AN2B 4Z66D 2FJ7B 1P3OA 1M18A 3RELA 3X1UB 4YM6B 4DRAA 2NQBB 1F66A 5AV6D 3AZHC 3AZLC 3WKJC 2AROD 1AOIB 5B32D 5CPKD 4J8UD 3AZJB 2F8ND 5B1LB 5DNMD 3AZGD 3AZNC 5DNNA 2NZDA 1P3KD 3AZLB 3REIB 4NE3A 4WZSB 1N1JB 2PYOA 5B40A 3LJAB 2CWEA 3VH6T 1R4VA 1ZLAA 3AN2C 5B0YA 1P34A 3AZKC 5F99D 3V9RA 4EO5C 1P3KB 4YM6C 5GXQB 1P3LC 3MNNB 2YFVB 5B0ZB 4UUZB 2F8NH 4E45A 3WTPE 1P3FC 4ZBJB 3MGRA 5B31A 2F8NG 2HIOB 1P3LD 5F99B 4XUJD 1EQZA 3MGQA 1U35A 1P3GB 3VH5W 3O62C 2HUEB 3NQUA 3AFAB 3W99B 3KUYC 4R8PC 4XUJB 3W98B 1P3IC 3KWQC 5B24C 5CP6A 4KGCA 5DNMC 3A6NA 4JJNB 1TZYB 5CPJA 5AY8A 1BH8A 4CSRA 4H9NB 4Z2MH 3REHA 3TU4C 1M1AC 2NQBD 3VH5A 3WKJD 2IO5B 3X1TC 3AZHD 2BYKB 1P34C 3AN2A 1F1EA 5BO0B 4KUDD 2CV5B 4J8XA 2PYOC 1ID3C 3REJC 2NZDC 1AOIA 2F8NK 3AZNA 4NFTA 3REID 4LD9A 2L5AA 3AV2B 3NQJA 4HGAC 1S32C 3MVDB 5B2JD 1P3BC 1HQ3A 5AV9B 1TAFB 3AZED 3AZLA 5AV8D 4H9OB 1JFIA 1ZLAB 1KX3A 3MVDD 1P3LB 5GT0C 3B6GA 5B33B 3AZIB 4J8VB 1P3PD 4Z5TA 2YFVA 5B0ZA 1KX5D 4H9RB 1TZYC 5BS7C 2HIOA 4JJNC 4XZQD 5CPIA 5JRGA 3UTBA 3W97C 5AVBC 4WU8C 4YS3D 3W98D 3W96D 5B33C 5GSUD 3KUYB 3MGPD 3NQUB 3AFAA 1P3MD 2FJ7A 3B0BA 3X1UA 4WU8A 3B0DB 3W97A 3B6FA 3AZFD 4KGCB 1TZYA 5CPJB 4G91B 5B0ZC 4Z5TC 1B6WA 4H9NA 3AV2C 5B1LA 3LZ0D 3LZ1B 3AYWB 1KX3C 3AZFB 4QLCA 2CV5C 1P3MC 2RVQC 5B31G 2PYOB 4G91C 5AV5C 3MGPC 4J8XB 1P3AA 3W98C 4KHAB 1P3BA 3AYWD 2JSSA 3AZMA 3R45B 5FUGA 2YFWA 5CPKB 3MNNA 5AV8B 3AZJD 3MGSD 4LD9C 4X23D 3REJA 1Q9CA 3REKA 1EQZB 3AZID 4H9QB 4CAYA 3LZ1C 4J8VD 4Z2MG 5AV8C 3WAAD 3X1TA 4WNNA 4XZQB 5B2JC 3REHC 2BYMA 1S32D 5CP6B 3C1CA 4H9RA 3A6NC 4KGCC 4J8WB 3MNNC 3KWQA 1H3OA 4E44A 1P3IA 1ID3D 4R8PA 3KUYA 4KUDC 1KX4B 1P3AC 3O62A 3W99D 2CV5A 3LELD 3X1VB 5B1MA 3LZ1D 3UTAD 1M1AD 3TU4D 4WU9A 5KDMA 4X23C 4NE5A 3UT9D 3MGSC 3KSYA 4YM6A 5B24D 2F8NB 5JA4B 3KXBA 3AZKA 1BH9B 5BNVB 5CHLB 5B2IA 3X1UC 2FJ7C 4DRBA 5AV5D 4KUDB 3LJAD 1JFIB 3MGSB 1P3AB 2RVQD 5DNNC 1P3BB 4HGAB 4XUJC 5AVBA 1N1JA 1P3FD 5CPIC 3LZ0C 3AV2D 5BS7A 3AV1D 4H9SA 5AV9D 3AZFC 5GXQA 1S32B 5E5AD 4M6BA 4UUZA 4H9PB 1M19A 1BFMA 3AV1B 1P3KC 4ZUXA 5AVCA 3C1BA 5B33D 3W97B 1ID3B 3MGQB 1HQ3C 3WTPC 3AZGC 5E5AB 1U35B 1P3PB 1P3GA 5GT0B 3B6FB 3WA9C 3C1CB 4JJND 3WA9D 4J8WA 5GT3D 3X1SA 3WTPD 3LELB 3X1VD 4YS3B 5AV6C 1AOIC 3TU4B 1KX4A 5GT0D 3MGPB 4J8XC 4CSRB 3WA9B 5C3IC 4Z66A 1P3OD 1M18D 3RELD 5B24B 1F66D 5AV6A 3AZEC 3AV1C 2AROA 5DNNB 3X1SC 5B32A 5CPKA 4J8UA 5AV5B 5CPJC 2F8NA 3LZ0B 5DNMA 3VH6A 3AZGA 1P3GC 1F66B 1P34B 3V9RB 5DNND 3C1BC 4ZUXC 5AVCC 1P3KA 3AZEB 2NZDD 4H9QA 4CAYB 2PYOD 4NE6A 5B40D 3NQJB 1ZLAD 5B31B 5B0YD 1P34D 5F99A 1EQZC 4H9SC 3MGRC 5B40B 1KX5B 3MGRD 5B31D 1P3LA 1P3IB 1WWSA 4XUJA 2LY8A 1EQZD 3MGQD 1U35D 1ZLAC 3A6NB 4H9PA 1M19B 1BH8B 5B40C 4G92B 3WAAB 3WTPB 5CP6D 4KGCD 3A6ND 5CPJD 5AY8D 3X1SB 4WU8B 3REHD 2NQBA 3WKJA 1BH9A 3AZHA 1F66C 5F99C 3AZNB 3AN2D 5AY8B 4KUDA 3AZIC 4J8XD 1M1AB 1HQ3B 1AOID 2BYKA 3X1VC 3AZND 3AZJC 3REIA 4LD9D 5GT3C 3UT9B 1A7WA 5DNMB 5CPKC 3KWQB 1KX3B 5B2JA 1HQ3D 2AROC 3B6GB 3AZEA 3AZLD 5AV8A 1ULYA 3REKC 1KX3D 5E5AC 3MVDA 5JRGB 3UTBB 1TAFA 3B6GD 5AV9C 1P3PA 4Z5TD 5B0ZD 1KX5A 1WWIA 2HIOD 4XZQA 3AZMC 5JRGD 3UTBD 5CPID 4YS3A 3W98A 3W96A 1HTAA 5GSUA 5BT1C 3MGPA 4Z5TB 4AWLC 3LJAC 3AFAD 1P3MA 5GSUC 4Z66B 2FJ7D 1H3OB 4WV4B 4QLCC 3X1UD 1KU5A 4YS3C 3REHB 4WU8D 3W97D 3UTAB 5GXQC 3B6FD 3AZFA 1TZYD 1KX5C 4J8UB 1P3PC 5GT3B 3UT9C 5B1LD 3LZ0A 5B1MB 3WKJB 3AZHB 3UTAC 3R45A 4QLCD 3LELC 5FUGB 3AFAC 3W99C 3RELB 1P3AD 1P3BD 5B2IC 1B67A 3AYWA 3AZMD 4QLCB 3REKB 3KXBC 1P3FB 3MNND 4H9OA 3AZJA 3MGSA 4X23A 4KHAA 5B2JB 4WNNB 3REJD 4WU9C 3AZMB 5AVBB 3REKD 3AZIA 5B1MC 4J8VA 3WAAC 4G92C 5BNXA 3WAAA 3X1TD
chains in the Genus database with same CATH superfamily
4J8VC 3REJB 5CPIB 2NQBC 1S32A 2HUEC 2XD5A 3C1CD 3O62B 5G49A 2IO5C 3KWQD 3C1CC 3X1TB 1P3ID 1ID3A 2JCHA 3FDDA 4R8PD 3AYWC 5GSUB 3KUYD 3EG5B 5KDMB 3O62D 1P3MB 3W99A 1P3OB 1M18B 2JE5A 2CV5D 3LELA 5JA4A 5B1MD 3LZ1A 3UTAA 3AZKB 1M1AA 3TU4A 5BNVA 4WU9D 5B2IB 5AY8C 3UT9A 3B0CT 3P5JB 5CP6C 4YM6D 5B24A 5AV6B 3KXBD 3AZKD 4WU9B 2NZDB 5B2ID 5B32B 2YFWB 5BO0A 5AV5A 3LJAA 3MGQC 3AZGB 1U35C 3KXBB 5B0YB 3W96C 5AVBD 5B31C 4LD9B 3EPKA 1P3FA 4XZQC 5B1LC 4J8UC 5B32C 3AV2A 3IP4C 2W8SA 4X23B 3AV1A 3MGRB 3C1BB 1PZRA 5AV9A 4AWLB 3VH6W 3B6FC 4UPKA 5B0YC 5GXQD 3W96B 2BYMB 5E5AA 4Z66C 3MVDC 1M19D 5BNXB 1KX4C 5AVCD 4ZUXD 1Z2CB 5BT1D 3C1BD 4EO5B 5B33A 1P3GD 4R8PB 5B32G 4J8WC 5JRGC 3UTBC 5C3IB 2HIOC 4JJNA 3WA9A 4ZBJC 3VH5T 5G49B 4J8WD 5GT3A 3X1SD 3WTPA 5AVCB 4ZUXB 3H0LC 3REIC 3X1VA 3B0DC 2Y2KA 2AROB 3B6GC 3B0CW 5GT0A 3RELC 1KX4D 1P3OC 1M19C 1M18C 3AN2B 4Z66D 2FJ7B 1P3OA 1M18A 3RELA 3X1UB 4YM6B 4DRAA 2NQBB 1F66A 5AV6D 3AZHC 3AZLC 3WKJC 2AROD 1AOIB 4WJ3C 5B32D 5CPKD 4J8UD 3AZJB 2F8ND 5B1LB 5DNMD 3AZGD 2G5IC 3AZNC 5DNNA 2NZDA 1P3KD 3AZLB 3REIB 4NE3A 4WZSB 1N1JB 2PYOA 5B40A 3LJAB 2CWEA 3VH6T 1R4VA 1ZLAA 3AN2C 5B0YA 1P34A 3AZKC 5F99D 3V9RA 4EO5C 1P3KB 4YM6C 5GXQB 1P3LC 3MNNB 2YFVB 5B0ZB 4UUZB 2F8NH 4E45A 3WTPE 1P3FC 4ZBJB 3MGRA 5B31A 2F8NG 2HIOB 1P3LD 5F99B 2FFFB 4XUJD 1EQZA 3MGQA 1U35A 1P3GB 3VH5W 3O62C 2Y2JA 2HUEB 3NQUA 3AFAB 3W99B 3KUYC 2Y2GA 4R8PC 4XUJB 2F2AC 2ZY3A 3W98B 1P3IC 3KWQC 5B24C 5CP6A 4KGCA 5DNMC 3A6NA 4JJNB 1TZYB 5CPJA 5AY8A 1BH8A 4CSRA 4H9NB 4Z2MH 3REHA 3TU4C 1M1AC 2NQBD 3VH5A 3WKJD 2IO5B 3X1TC 3AZHD 2BYKB 1P34C 3AN2A 4DQYB 1F1EA 5BO0B 4KUDD 2CV5B 4J8XA 2PYOC 2DF4C 1ID3C 3REJC 2NZDC 1AOIA 2F8NK 3AZNA 4NFTA 3REID 4LD9A 2L5AA 3AV2B 2DQNC 3A1IA 3NQJA 4HGAC 1S32C 3MVDB 5B2JD 1P3BC 1HQ3A 5AV9B 1TAFB 3AZED 3AZLA 5AV8D 4H9OB 1JFIA 1ZLAB 1KX3A 3MVDD 1P3LB 5GT0C 3B6GA 5B33B 3AZIB 4J8VB 1P3PD 4Z5TA 2YFVA 5B0ZA 1KX5D 4H9RB 1TZYC 5BS7C 2HIOA 4JJNC 4XZQD 5CPIA 5JRGA 3UTBA 3W97C 5AVBC 4WU8C 4YS3D 3W98D 3W96D 3A1KA 5B33C 5GSUD 3KUYB 3MGPD 3NQUB 3AFAA 1P3MD 2FJ7A 3B0BA 3X1UA 4WU8A 3B0DB 3W97A 3B6FA 2RIQA 3AZFD 4KGCB 2G5HC 1TZYA 5CPJB 2XD1A 4G91B 5B0ZC 4Z5TC 1B6WA 4H9NA 3AV2C 2BG1A 5B1LA 3LZ0D 3LZ1B 3AYWB 1KX3C 3AZFB 4QLCA 2CV5C 1P3MC 2RVQC 5B31G 2PYOB 4G91C 5AV5C 3MGPC 4J8XB 2Y2MA 1P3AA 3W98C 4KHAB 1P3BA 3AYWD 2JSSA 3AZMA 3R45B 5FUGA 2YFWA 5CPKB 3MNNA 5AV8B 3AZJD 3MGSD 4LD9C 2ZY4A 4X23D 3REJA 1Q9CA 3REKA 1EQZB 3AZID 4H9QB 4CAYA 3LZ1C 4J8VD 4Z2MG 5AV8C 3WAAD 3X1TA 4WNNA 4XZQB 5B2JC 3REHC 2BYMA 1S32D 2Y2PA 5CP6B 3C1CA 4H9RA 3A6NC 4KGCC 4J8WB 3MNNC 3KWQA 3KFUG 1H3OA 4E44A 1P3IA 1ID3D 2Y2NA 4R8PA 3KUYA 4KUDC 1KX4B 1P3AC 3O62A 3W99D 2CV5A 3LELD 3X1VB 5B1MA 3LZ1D 3UTAD 1M1AD 3TU4D 4WU9A 5KDMA 4X23C 4NE5A 3UT9D 3MGSC 3KSYA 4YM6A 5B24D 2F8NB 5JA4B 3KXBA 3AZKA 1BH9B 2Y2IA 5BNVB 5CHLB 5B2IA 3X1UC 2FJ7C 4DRBA 5AV5D 4KUDB 3LJAD 1JFIB 3MGSB 1P3AB 2RVQD 5DNNC 1P3BB 3EPHA 4HGAB 4XUJC 5AVBA 1N1JA 1P3FD 5CPIC 3LZ0C 3AV2D 5BS7A 3AV1D 4H9SA 5AV9D 3AZFC 5GXQA 1W2EA 1S32B 5E5AD 4M6BA 4UUZA 4H9PB 1M19A 1BFMA 2J8PA 3AV1B 2Y2HA 1P3KC 4ZUXA 5AVCA 3C1BA 5B33D 3EPLA 3W97B 1ID3B 3MGQB 1HQ3C 3WTPC 3AZGC 5E5AB 1U35B 1P3PB 1P3GA 5GT0B 3B6FB 3WA9C 3C1CB 4JJND 3WA9D 4J8WA 5GT3D 3X1SA 3WTPD 3H0MC 3LELB 3X1VD 4YS3B 5AV6C 1AOIC 3TU4B 1KX4A 5GT0D 3MGPB 4J8XC 4CSRB 3WA9B 5C3IC 4Z66A 1P3OD 1M18D 3RELD 5B24B 1F66D 5AV6A 3AZEC 3AV1C 2AROA 5DNNB 3X1SC 5B32A 5CPKA 4J8UA 2ZY2A 5AV5B 5CPJC 2F8NA 3LZ0B 5DNMA 3VH6A 3AZGA 1P3GC 1F66B 1P34B 3V9RB 5DNND 3C1BC 4ZUXC 5AVCC 1P3KA 3AZEB 2NZDD 4H9QA 4CAYB 2PYOD 4NE6A 5B40D 3NQJB 1ZLAD 5B31B 5B0YD 1P34D 5F99A 1EQZC 4H9SC 3AL0C 3MGRC 5B40B 1KX5B 3MGRD 5B31D 1P3LA 1P3IB 3H0RC 1WWSA 4XUJA 2LY8A 1EQZD 3MGQD 1U35D 1ZLAC 3A6NB 4H9PA 1M19B 1BH8B 5B40C 4G92B 3WAAB 3WTPB 5CP6D 4KGCD 3A6ND 5CPJD 5AY8D 3X1SB 4WU8B 3REHD 2NQBA 3WKJA 1BH9A 3AZHA 1F66C 5F99C 3AZNB 3AN2D 5AY8B 2VQRA 4KUDA 3AZIC 4J8XD 1M1AB 1HQ3B 1AOID 2BYKA 3X1VC 3AZND 3AZJC 3REIA 4LD9D 5GT3C 3UT9B 2Y2QA 1A7WA 5DNMB 5CPKC 3KWQB 1KX3B 5B2JA 1T3UA 1HQ3D 2AROC 3B6GB 3AZEA 3EPJA 3AZLD 5AV8A 1ULYA 3REKC 1KX3D 5E5AC 3MVDA 5JRGB 3UTBB 1TAFA 3B6GD 2Y2OA 5AV9C 1P3PA 4Z5TD 5B0ZD 1KX5A 1WWIA 2HIOD 4XZQA 3AZMC 5JRGD 3UTBD 5CPID 4YS3A 3W98A 3W96A 1HTAA 5GSUA 5BT1C 3MGPA 4Z5TB 4AWLC 3LJAC 3AFAD 1P3MA 2Y2LA 5GSUC 4Z66B 2FJ7D 1H3OB 4WV4B 4QLCC 3X1UD 1KU5A 4YS3C 3REHB 4WU8D 3W97D 3UTAB 5GXQC 3B6FD 3AZFA 1TZYD 1KX5C 4J8UB 1P3PC 5GT3B 3UT9C 2ZY5A 5B1LD 3LZ0A 5B1MB 3WKJB 3AZHB 3UTAC 3R45A 4QLCD 3LELC 5FUGB 3AFAC 3W99C 2UWXA 3RELB 1P3AD 1P3BD 5B2IC 1B67A 2ZM5A 3AYWA 3AZMD 4QLCB 3REKB 3KXBC 1P3FB 3MNND 4H9OA 3AZJA 3F6TA 3MGSA 4X23A 4KHAA 5B2JB 4WNNB 3REJD 4WU9C 3AZMB 5AVBB 3REKD 3AZIA 5B1MC 4J8VA 3WAAC 4G92C 5BNXA 3WAAA 3X1TD
chains in the Genus database with same CATH topology
4J8VC 3REJB 5CPIB 2NQBC 1S32A 2HUEC 2XD5A 3C1CD 3O62B 5G49A 2IO5C 3KWQD 3C1CC 3X1TB 1P3ID 1ID3A 2JCHA 3FDDA 4R8PD 3AYWC 5GSUB 3KUYD 3EG5B 5KDMB 3O62D 1P3MB 3W99A 1P3OB 1M18B 2JE5A 2CV5D 3LELA 5JA4A 5B1MD 3LZ1A 3UTAA 3AZKB 1M1AA 3TU4A 5BNVA 4WU9D 5B2IB 5AY8C 3UT9A 3B0CT 3P5JB 5CP6C 4YM6D 5B24A 5AV6B 3KXBD 3AZKD 4WU9B 2NZDB 5B2ID 5B32B 2YFWB 5BO0A 5AV5A 3LJAA 3MGQC 3AZGB 1U35C 3KXBB 5B0YB 3W96C 5AVBD 5B31C 4LD9B 3EPKA 1P3FA 4XZQC 5B1LC 4J8UC 5B32C 3AV2A 3IP4C 2W8SA 4X23B 3AV1A 3MGRB 3C1BB 1PZRA 5AV9A 4AWLB 3VH6W 3B6FC 4UPKA 5B0YC 5GXQD 3W96B 2BYMB 5E5AA 4Z66C 3MVDC 1M19D 5BNXB 1KX4C 5AVCD 4ZUXD 1Z2CB 5BT1D 3C1BD 4EO5B 5B33A 1P3GD 4R8PB 5B32G 4J8WC 5JRGC 3UTBC 5C3IB 2HIOC 4JJNA 3WA9A 4ZBJC 3VH5T 5G49B 4J8WD 5GT3A 3X1SD 3WTPA 5AVCB 4ZUXB 3H0LC 3REIC 3X1VA 3B0DC 2Y2KA 2AROB 3B6GC 3B0CW 5GT0A 3RELC 1KX4D 1P3OC 1M19C 1M18C 3AN2B 4Z66D 2FJ7B 1P3OA 1M18A 3RELA 3X1UB 4YM6B 4DRAA 2NQBB 1F66A 5AV6D 3AZHC 3AZLC 3WKJC 2AROD 1AOIB 4WJ3C 5B32D 5CPKD 4J8UD 3AZJB 2F8ND 5B1LB 5DNMD 3AZGD 2G5IC 3AZNC 5DNNA 2NZDA 1P3KD 3AZLB 3REIB 4NE3A 4WZSB 1N1JB 2PYOA 5B40A 3LJAB 2CWEA 3VH6T 1R4VA 1ZLAA 3AN2C 5B0YA 1P34A 3AZKC 5F99D 3V9RA 4EO5C 1P3KB 4YM6C 5GXQB 1P3LC 3MNNB 2YFVB 5B0ZB 4UUZB 2F8NH 4E45A 3WTPE 1P3FC 4ZBJB 3MGRA 5B31A 2F8NG 2HIOB 1P3LD 5F99B 2FFFB 4XUJD 1EQZA 3MGQA 1U35A 1P3GB 3VH5W 3O62C 2Y2JA 2HUEB 3NQUA 3AFAB 3W99B 3KUYC 2Y2GA 4R8PC 4XUJB 2F2AC 2ZY3A 3W98B 1P3IC 3KWQC 5B24C 5CP6A 4KGCA 5DNMC 3A6NA 4JJNB 1TZYB 5CPJA 5AY8A 1BH8A 4CSRA 4H9NB 4Z2MH 3REHA 3TU4C 1M1AC 2NQBD 3VH5A 3WKJD 2IO5B 3X1TC 3AZHD 2BYKB 1P34C 3AN2A 4DQYB 1F1EA 5BO0B 4KUDD 2CV5B 4J8XA 2PYOC 2DF4C 1ID3C 3REJC 2NZDC 1AOIA 2F8NK 3AZNA 4NFTA 3REID 4LD9A 2L5AA 3AV2B 2DQNC 3A1IA 3NQJA 4HGAC 1S32C 3MVDB 5B2JD 1P3BC 1HQ3A 5AV9B 1TAFB 3AZED 3AZLA 5AV8D 4H9OB 1JFIA 1ZLAB 1KX3A 3MVDD 1P3LB 5GT0C 3B6GA 5B33B 3AZIB 4J8VB 1P3PD 4Z5TA 2YFVA 5B0ZA 1KX5D 4H9RB 1TZYC 5BS7C 2HIOA 4JJNC 4XZQD 5CPIA 5JRGA 3UTBA 3W97C 5AVBC 4WU8C 4YS3D 3W98D 3W96D 3A1KA 5B33C 5GSUD 3KUYB 3MGPD 3NQUB 3AFAA 1P3MD 2FJ7A 3B0BA 3X1UA 4WU8A 3B0DB 3W97A 3B6FA 2RIQA 3AZFD 4KGCB 2G5HC 1TZYA 5CPJB 2XD1A 4G91B 5B0ZC 4Z5TC 1B6WA 4H9NA 3AV2C 2BG1A 5B1LA 3LZ0D 3LZ1B 3AYWB 1KX3C 3AZFB 4QLCA 2CV5C 1P3MC 2RVQC 5B31G 2PYOB 4G91C 5AV5C 3MGPC 4J8XB 2Y2MA 1P3AA 3W98C 4KHAB 1P3BA 3AYWD 2JSSA 3AZMA 3R45B 5FUGA 2YFWA 5CPKB 3MNNA 5AV8B 3AZJD 3MGSD 4LD9C 2ZY4A 4X23D 3REJA 1Q9CA 3REKA 1EQZB 3AZID 4H9QB 4CAYA 3LZ1C 4J8VD 4Z2MG 5AV8C 3WAAD 3X1TA 4WNNA 4XZQB 5B2JC 3REHC 2BYMA 1S32D 2Y2PA 5CP6B 3C1CA 4H9RA 3A6NC 4KGCC 4J8WB 3MNNC 3KWQA 3KFUG 1H3OA 4E44A 1P3IA 1ID3D 2Y2NA 4R8PA 3KUYA 4KUDC 1KX4B 1P3AC 3O62A 3W99D 2CV5A 3LELD 3X1VB 5B1MA 3LZ1D 3UTAD 1M1AD 3TU4D 4WU9A 5KDMA 4X23C 4NE5A 3UT9D 3MGSC 3KSYA 4YM6A 5B24D 2F8NB 5JA4B 3KXBA 3AZKA 1BH9B 2Y2IA 5BNVB 5CHLB 5B2IA 3X1UC 2FJ7C 4DRBA 5AV5D 4KUDB 3LJAD 1JFIB 3MGSB 1P3AB 2RVQD 5DNNC 1P3BB 3EPHA 4HGAB 4XUJC 5AVBA 1N1JA 1P3FD 5CPIC 3LZ0C 3AV2D 5BS7A 3AV1D 4H9SA 5AV9D 3AZFC 5GXQA 1W2EA 1S32B 5E5AD 4M6BA 4UUZA 4H9PB 1M19A 1BFMA 2J8PA 3AV1B 2Y2HA 1P3KC 4ZUXA 5AVCA 3C1BA 5B33D 3EPLA 3W97B 1ID3B 3MGQB 1HQ3C 3WTPC 3AZGC 5E5AB 1U35B 1P3PB 1P3GA 5GT0B 3B6FB 3WA9C 3C1CB 4JJND 3WA9D 4J8WA 5GT3D 3X1SA 3WTPD 3H0MC 3LELB 3X1VD 4YS3B 5AV6C 1AOIC 3TU4B 1KX4A 5GT0D 3MGPB 4J8XC 4CSRB 3WA9B 5C3IC 4Z66A 1P3OD 1M18D 3RELD 5B24B 1F66D 5AV6A 3AZEC 3AV1C 2AROA 5DNNB 3X1SC 5B32A 5CPKA 4J8UA 2ZY2A 5AV5B 5CPJC 2F8NA 3LZ0B 5DNMA 3VH6A 3AZGA 1P3GC 1F66B 1P34B 3V9RB 5DNND 3C1BC 4ZUXC 5AVCC 1P3KA 3AZEB 2NZDD 4H9QA 4CAYB 2PYOD 4NE6A 5B40D 3NQJB 1ZLAD 5B31B 5B0YD 1P34D 5F99A 1EQZC 4H9SC 3AL0C 3MGRC 5B40B 1KX5B 3MGRD 5B31D 1P3LA 1P3IB 3H0RC 1WWSA 4XUJA 2LY8A 1EQZD 3MGQD 1U35D 1ZLAC 3A6NB 4H9PA 1M19B 1BH8B 5B40C 4G92B 3WAAB 3WTPB 5CP6D 4KGCD 3A6ND 5CPJD 5AY8D 3X1SB 4WU8B 3REHD 2NQBA 3WKJA 1BH9A 3AZHA 1F66C 5F99C 3AZNB 3AN2D 5AY8B 2VQRA 4KUDA 3AZIC 4J8XD 1M1AB 1HQ3B 1AOID 2BYKA 3X1VC 3AZND 3AZJC 3REIA 4LD9D 5GT3C 3UT9B 2Y2QA 1A7WA 5DNMB 5CPKC 3KWQB 1KX3B 5B2JA 1T3UA 1HQ3D 2AROC 3B6GB 3AZEA 3EPJA 3AZLD 5AV8A 1ULYA 3REKC 1KX3D 5E5AC 3MVDA 5JRGB 3UTBB 1TAFA 3B6GD 2Y2OA 5AV9C 1P3PA 4Z5TD 5B0ZD 1KX5A 1WWIA 2HIOD 4XZQA 3AZMC 5JRGD 3UTBD 5CPID 4YS3A 3W98A 3W96A 1HTAA 5GSUA 5BT1C 3MGPA 4Z5TB 4AWLC 3LJAC 3AFAD 1P3MA 2Y2LA 5GSUC 4Z66B 2FJ7D 1H3OB 4WV4B 4QLCC 3X1UD 1KU5A 4YS3C 3REHB 4WU8D 3W97D 3UTAB 5GXQC 3B6FD 3AZFA 1TZYD 1KX5C 4J8UB 1P3PC 5GT3B 3UT9C 2ZY5A 5B1LD 3LZ0A 5B1MB 3WKJB 3AZHB 3UTAC 3R45A 4QLCD 3LELC 5FUGB 3AFAC 3W99C 2UWXA 3RELB 1P3AD 1P3BD 5B2IC 1B67A 2ZM5A 3AYWA 3AZMD 4QLCB 3REKB 3KXBC 1P3FB 3MNND 4H9OA 3AZJA 3F6TA 3MGSA 4X23A 4KHAA 5B2JB 4WNNB 3REJD 4WU9C 3AZMB 5AVBB 3REKD 3AZIA 5B1MC 4J8VA 3WAAC 4G92C 5BNXA 3WAAA 3X1TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V C;  3REJ B;  5CPI B;  2NQB C;  1S32 A;  2HUE C;  3C1C D;  3O62 B;  5G49 A;  2IO5 C;  3KWQ D;  3C1C C;  3X1T B;  1P3I D;  1ID3 A;  4R8P D;  3AYW C;  5GSU B;  3KUY D;  5KDM B;  3O62 D;  1P3M B;  3W99 A;  1P3O B;  1M18 B;  2CV5 D;  3LEL A;  5JA4 A;  5B1M D;  3LZ1 A;  3UTA A;  3AZK B;  1M1A A;  3TU4 A;  5BNV A;  4WU9 D;  5B2I B;  5AY8 C;  3UT9 A;  3B0C T;  5CP6 C;  4YM6 D;  5B24 A;  5AV6 B;  3KXB D;  3AZK D;  4WU9 B;  2NZD B;  5B2I D;  5B32 B;  2YFW B;  5BO0 A;  5AV5 A;  3LJA A;  3MGQ C;  3AZG B;  1U35 C;  3KXB B;  5B0Y B;  3W96 C;  5AVB D;  5B31 C;  4LD9 B;  1P3F A;  4XZQ C;  5B1L C;  4J8U C;  5B32 C;  3AV2 A;  4X23 B;  3AV1 A;  3MGR B;  3C1B B;  4AWL B;  5AV9 A;  3VH6 W;  3B6F C;  5B0Y C;  5GXQ D;  3W96 B;  2BYM B;  5E5A A;  4Z66 C;  3MVD C;  1M19 D;  5BNX B;  1KX4 C;  4ZUX D;  5AVC D;  3C1B D;  5BT1 D;  4EO5 B;  5B33 A;  1P3G D;  4R8P B;  5B32 G;  4J8W C;  5JRG C;  3UTB C;  5C3I B;  2HIO C;  4JJN A;  3WA9 A;  4ZBJ C;  3VH5 T;  5G49 B;  4J8W D;  5GT3 A;  3X1S D;  3WTP A;  5AVC B;  4ZUX B;  3REI C;  3X1V A;  3B0D C;  2ARO B;  3B6G C;  3B0C W;  5GT0 A;  3REL C;  1KX4 D;  1P3O C;  1M19 C;  1M18 C;  3AN2 B;  4Z66 D;  2FJ7 B;  1P3O A;  1M18 A;  3REL A;  3X1U B;  4YM6 B;  4DRA A;  2NQB B;  1F66 A;  5AV6 D;  3AZH C;  3AZL C;  3WKJ C;  2ARO D;  1AOI B;  5B32 D;  5CPK D;  4J8U D;  3AZJ B;  2F8N D;  5B1L B;  5DNM D;  3AZG D;  3AZN C;  5DNN A;  2NZD A;  1P3K D;  3AZL B;  3REI B;  4NE3 A;  4WZS B;  1N1J B;  2PYO A;  5B40 A;  3LJA B;  2CWE A;  3VH6 T;  1R4V A;  1ZLA A;  3AN2 C;  5B0Y A;  1P34 A;  3AZK C;  5F99 D;  3V9R A;  4EO5 C;  1P3K B;  4YM6 C;  5GXQ B;  1P3L C;  3MNN B;  2YFV B;  5B0Z B;  4UUZ B;  2F8N H;  4E45 A;  3WTP E;  1P3F C;  4ZBJ B;  3MGR A;  5B31 A;  2F8N G;  2HIO B;  1P3L D;  5F99 B;  4XUJ D;  1EQZ A;  3MGQ A;  1U35 A;  1P3G B;  3VH5 W;  3O62 C;  2HUE B;  3NQU A;  3AFA B;  3W99 B;  3KUY C;  4R8P C;  4XUJ B;  3W98 B;  1P3I C;  3KWQ C;  5B24 C;  5CP6 A;  4KGC A;  5DNM C;  3A6N A;  4JJN B;  1TZY B;  5CPJ A;  5AY8 A;  1BH8 A;  4CSR A;  4H9N B;  4Z2M H;  3REH A;  3TU4 C;  1M1A C;  2NQB D;  3VH5 A;  3WKJ D;  2IO5 B;  3X1T C;  3AZH D;  2BYK B;  1P34 C;  3AN2 A;  1F1E A;  5BO0 B;  4KUD D;  2CV5 B;  4J8X A;  2PYO C;  1ID3 C;  3REJ C;  2NZD C;  1AOI A;  2F8N K;  3AZN A;  4NFT A;  3REI D;  4LD9 A;  2L5A A;  3AV2 B;  3NQJ A;  4HGA C;  1S32 C;  3MVD B;  5B2J D;  1P3B C;  1HQ3 A;  5AV9 B;  1TAF B;  3AZE D;  3AZL A;  5AV8 D;  4H9O B;  1JFI A;  1ZLA B;  1KX3 A;  3MVD D;  1P3L B;  5GT0 C;  3B6G A;  5B33 B;  3AZI B;  4J8V B;  1P3P D;  4Z5T A;  2YFV A;  5B0Z A;  1KX5 D;  4H9R B;  1TZY C;  5BS7 C;  2HIO A;  4JJN C;  4XZQ D;  5CPI A;  5JRG A;  3UTB A;  3W97 C;  5AVB C;  4WU8 C;  4YS3 D;  3W98 D;  3W96 D;  5B33 C;  5GSU D;  3KUY B;  3MGP D;  3NQU B;  3AFA A;  1P3M D;  2FJ7 A;  3B0B A;  3X1U A;  4WU8 A;  3B0D B;  3W97 A;  3B6F A;  3AZF D;  4KGC B;  1TZY A;  5CPJ B;  4G91 B;  5B0Z C;  4Z5T C;  1B6W A;  4H9N A;  3AV2 C;  5B1L A;  3LZ0 D;  3LZ1 B;  3AYW B;  1KX3 C;  3AZF B;  4QLC A;  2CV5 C;  1P3M C;  2RVQ C;  5B31 G;  2PYO B;  4G91 C;  5AV5 C;  3MGP C;  4J8X B;  1P3A A;  3W98 C;  4KHA B;  1P3B A;  3AYW D;  2JSS A;  3AZM A;  3R45 B;  5FUG A;  2YFW A;  5CPK B;  3MNN A;  5AV8 B;  3AZJ D;  3MGS D;  4LD9 C;  4X23 D;  3REJ A;  1Q9C A;  3REK A;  1EQZ B;  3AZI D;  4H9Q B;  4CAY A;  3LZ1 C;  4J8V D;  4Z2M G;  5AV8 C;  3WAA D;  3X1T A;  4WNN A;  4XZQ B;  5B2J C;  3REH C;  2BYM A;  1S32 D;  5CP6 B;  3C1C A;  4H9R A;  3A6N C;  4KGC C;  4J8W B;  3MNN C;  3KWQ A;  1H3O A;  4E44 A;  1P3I A;  1ID3 D;  4R8P A;  3KUY A;  4KUD C;  1KX4 B;  1P3A C;  3O62 A;  3W99 D;  2CV5 A;  3LEL D;  3X1V B;  5B1M A;  3LZ1 D;  3UTA D;  1M1A D;  3TU4 D;  4WU9 A;  5KDM A;  4X23 C;  4NE5 A;  3UT9 D;  3MGS C;  3KSY A;  4YM6 A;  5B24 D;  2F8N B;  5JA4 B;  3KXB A;  3AZK A;  1BH9 B;  5BNV B;  5CHL B;  5B2I A;  3X1U C;  2FJ7 C;  4DRB A;  5AV5 D;  4KUD B;  3LJA D;  1JFI B;  3MGS B;  1P3A B;  2RVQ D;  5DNN C;  1P3B B;  4HGA B;  4XUJ C;  5AVB A;  1N1J A;  1P3F D;  5CPI C;  3LZ0 C;  3AV2 D;  5BS7 A;  3AV1 D;  4H9S A;  5AV9 D;  3AZF C;  5GXQ A;  1S32 B;  5E5A D;  4M6B A;  4UUZ A;  4H9P B;  1M19 A;  1BFM A;  3AV1 B;  1P3K C;  4ZUX A;  5AVC A;  3C1B A;  5B33 D;  3W97 B;  1ID3 B;  3MGQ B;  1HQ3 C;  3WTP C;  3AZG C;  5E5A B;  1U35 B;  1P3P B;  1P3G A;  5GT0 B;  3B6F B;  3WA9 C;  3C1C B;  4JJN D;  3WA9 D;  4J8W A;  5GT3 D;  3X1S A;  3WTP D;  3LEL B;  3X1V D;  4YS3 B;  5AV6 C;  1AOI C;  3TU4 B;  1KX4 A;  5GT0 D;  3MGP B;  4J8X C;  4CSR B;  3WA9 B;  5C3I C;  4Z66 A;  1P3O D;  1M18 D;  3REL D;  5B24 B;  1F66 D;  5AV6 A;  3AZE C;  3AV1 C;  2ARO A;  5DNN B;  3X1S C;  5B32 A;  5CPK A;  4J8U A;  5AV5 B;  5CPJ C;  2F8N A;  3LZ0 B;  5DNM A;  3VH6 A;  3AZG A;  1P3G C;  1F66 B;  1P34 B;  3V9R B;  5DNN D;  3C1B C;  4ZUX C;  5AVC C;  1P3K A;  3AZE B;  2NZD D;  4H9Q A;  4CAY B;  2PYO D;  4NE6 A;  5B40 D;  3NQJ B;  1ZLA D;  5B31 B;  5B0Y D;  1P34 D;  5F99 A;  1EQZ C;  4H9S C;  3MGR C;  5B40 B;  1KX5 B;  3MGR D;  5B31 D;  1P3L A;  1P3I B;  1WWS A;  4XUJ A;  2LY8 A;  1EQZ D;  3MGQ D;  1U35 D;  1ZLA C;  3A6N B;  4H9P A;  1M19 B;  1BH8 B;  5B40 C;  4G92 B;  3WAA B;  3WTP B;  5CP6 D;  4KGC D;  3A6N D;  5CPJ D;  5AY8 D;  3X1S B;  4WU8 B;  3REH D;  2NQB A;  3WKJ A;  1BH9 A;  3AZH A;  1F66 C;  5F99 C;  3AZN B;  3AN2 D;  5AY8 B;  4KUD A;  3AZI C;  4J8X D;  1M1A B;  1HQ3 B;  1AOI D;  2BYK A;  3X1V C;  3AZN D;  3AZJ C;  3REI A;  4LD9 D;  5GT3 C;  3UT9 B;  1A7W A;  5DNM B;  5CPK C;  3KWQ B;  1KX3 B;  5B2J A;  1HQ3 D;  2ARO C;  3B6G B;  3AZE A;  3AZL D;  5AV8 A;  1ULY A;  3REK C;  1KX3 D;  5E5A C;  3MVD A;  5JRG B;  3UTB B;  1TAF A;  3B6G D;  5AV9 C;  1P3P A;  4Z5T D;  5B0Z D;  1KX5 A;  1WWI A;  2HIO D;  4XZQ A;  3AZM C;  5JRG D;  3UTB D;  5CPI D;  4YS3 A;  3W98 A;  3W96 A;  1HTA A;  5GSU A;  5BT1 C;  3MGP A;  4Z5T B;  4AWL C;  3LJA C;  3AFA D;  1P3M A;  5GSU C;  4Z66 B;  2FJ7 D;  1H3O B;  4WV4 B;  4QLC C;  3X1U D;  1KU5 A;  4YS3 C;  3REH B;  4WU8 D;  3W97 D;  3UTA B;  5GXQ C;  3B6F D;  3AZF A;  1TZY D;  1KX5 C;  4J8U B;  1P3P C;  5GT3 B;  3UT9 C;  5B1L D;  3LZ0 A;  5B1M B;  3WKJ B;  3AZH B;  3UTA C;  3R45 A;  4QLC D;  3LEL C;  5FUG B;  3AFA C;  3W99 C;  3REL B;  1P3A D;  1P3B D;  5B2I C;  1B67 A;  3AYW A;  3AZM D;  4QLC B;  3REK B;  3KXB C;  1P3F B;  3MNN D;  4H9O A;  3AZJ A;  3MGS A;  4X23 A;  4KHA A;  5B2J B;  4WNN B;  3REJ D;  4WU9 C;  3AZM B;  5AVB B;  3REK D;  3AZI A;  5B1M C;  4J8V A;  3WAA C;  4G92 C;  5BNX A;  3WAA A;  3X1T D; 
#chains in the Genus database with same CATH topology
 4J8V C;  3REJ B;  5CPI B;  2NQB C;  1S32 A;  2HUE C;  2XD5 A;  3C1C D;  3O62 B;  5G49 A;  2IO5 C;  3KWQ D;  3C1C C;  3X1T B;  1P3I D;  1ID3 A;  2JCH A;  3FDD A;  4R8P D;  3AYW C;  5GSU B;  3KUY D;  3EG5 B;  5KDM B;  3O62 D;  1P3M B;  3W99 A;  1P3O B;  1M18 B;  2JE5 A;  2CV5 D;  3LEL A;  5JA4 A;  5B1M D;  3LZ1 A;  3UTA A;  3AZK B;  1M1A A;  3TU4 A;  5BNV A;  4WU9 D;  5B2I B;  5AY8 C;  3UT9 A;  3B0C T;  3P5J B;  5CP6 C;  4YM6 D;  5B24 A;  5AV6 B;  3KXB D;  3AZK D;  4WU9 B;  2NZD B;  5B2I D;  5B32 B;  2YFW B;  5BO0 A;  5AV5 A;  3LJA A;  3MGQ C;  3AZG B;  1U35 C;  3KXB B;  5B0Y B;  3W96 C;  5AVB D;  5B31 C;  4LD9 B;  3EPK A;  1P3F A;  4XZQ C;  5B1L C;  4J8U C;  5B32 C;  3AV2 A;  3IP4 C;  2W8S A;  4X23 B;  3AV1 A;  3MGR B;  3C1B B;  1PZR A;  5AV9 A;  4AWL B;  3VH6 W;  3B6F C;  4UPK A;  5B0Y C;  5GXQ D;  3W96 B;  2BYM B;  5E5A A;  4Z66 C;  3MVD C;  1M19 D;  5BNX B;  1KX4 C;  5AVC D;  4ZUX D;  1Z2C B;  5BT1 D;  3C1B D;  4EO5 B;  5B33 A;  1P3G D;  4R8P B;  5B32 G;  4J8W C;  5JRG C;  3UTB C;  5C3I B;  2HIO C;  4JJN A;  3WA9 A;  4ZBJ C;  3VH5 T;  5G49 B;  4J8W D;  5GT3 A;  3X1S D;  3WTP A;  5AVC B;  4ZUX B;  3H0L C;  3REI C;  3X1V A;  3B0D C;  2Y2K A;  2ARO B;  3B6G C;  3B0C W;  5GT0 A;  3REL C;  1KX4 D;  1P3O C;  1M19 C;  1M18 C;  3AN2 B;  4Z66 D;  2FJ7 B;  1P3O A;  1M18 A;  3REL A;  3X1U B;  4YM6 B;  4DRA A;  2NQB B;  1F66 A;  5AV6 D;  3AZH C;  3AZL C;  3WKJ C;  2ARO D;  1AOI B;  4WJ3 C;  5B32 D;  5CPK D;  4J8U D;  3AZJ B;  2F8N D;  5B1L B;  5DNM D;  3AZG D;  2G5I C;  3AZN C;  5DNN A;  2NZD A;  1P3K D;  3AZL B;  3REI B;  4NE3 A;  4WZS B;  1N1J B;  2PYO A;  5B40 A;  3LJA B;  2CWE A;  3VH6 T;  1R4V A;  1ZLA A;  3AN2 C;  5B0Y A;  1P34 A;  3AZK C;  5F99 D;  3V9R A;  4EO5 C;  1P3K B;  4YM6 C;  5GXQ B;  1P3L C;  3MNN B;  2YFV B;  5B0Z B;  4UUZ B;  2F8N H;  4E45 A;  3WTP E;  1P3F C;  4ZBJ B;  3MGR A;  5B31 A;  2F8N G;  2HIO B;  1P3L D;  5F99 B;  2FFF B;  4XUJ D;  1EQZ A;  3MGQ A;  1U35 A;  1P3G B;  3VH5 W;  3O62 C;  2Y2J A;  2HUE B;  3NQU A;  3AFA B;  3W99 B;  3KUY C;  2Y2G A;  4R8P C;  4XUJ B;  2F2A C;  2ZY3 A;  3W98 B;  1P3I C;  3KWQ C;  5B24 C;  5CP6 A;  4KGC A;  5DNM C;  3A6N A;  4JJN B;  1TZY B;  5CPJ A;  5AY8 A;  1BH8 A;  4CSR A;  4H9N B;  4Z2M H;  3REH A;  3TU4 C;  1M1A C;  2NQB D;  3VH5 A;  3WKJ D;  2IO5 B;  3X1T C;  3AZH D;  2BYK B;  1P34 C;  3AN2 A;  4DQY B;  1F1E A;  5BO0 B;  4KUD D;  2CV5 B;  4J8X A;  2PYO C;  2DF4 C;  1ID3 C;  3REJ C;  2NZD C;  1AOI A;  2F8N K;  3AZN A;  4NFT A;  3REI D;  4LD9 A;  2L5A A;  3AV2 B;  2DQN C;  3A1I A;  3NQJ A;  4HGA C;  1S32 C;  3MVD B;  5B2J D;  1P3B C;  1HQ3 A;  5AV9 B;  1TAF B;  3AZE D;  3AZL A;  5AV8 D;  4H9O B;  1JFI A;  1ZLA B;  1KX3 A;  3MVD D;  1P3L B;  5GT0 C;  3B6G A;  5B33 B;  3AZI B;  4J8V B;  1P3P D;  4Z5T A;  2YFV A;  5B0Z A;  1KX5 D;  4H9R B;  1TZY C;  5BS7 C;  2HIO A;  4JJN C;  4XZQ D;  5CPI A;  5JRG A;  3UTB A;  3W97 C;  5AVB C;  4WU8 C;  4YS3 D;  3W98 D;  3W96 D;  3A1K A;  5B33 C;  5GSU D;  3KUY B;  3MGP D;  3NQU B;  3AFA A;  1P3M D;  2FJ7 A;  3B0B A;  3X1U A;  4WU8 A;  3B0D B;  3W97 A;  3B6F A;  2RIQ A;  3AZF D;  4KGC B;  2G5H C;  1TZY A;  5CPJ B;  2XD1 A;  4G91 B;  5B0Z C;  4Z5T C;  1B6W A;  4H9N A;  3AV2 C;  2BG1 A;  5B1L A;  3LZ0 D;  3LZ1 B;  3AYW B;  1KX3 C;  3AZF B;  4QLC A;  2CV5 C;  1P3M C;  2RVQ C;  5B31 G;  2PYO B;  4G91 C;  5AV5 C;  3MGP C;  4J8X B;  2Y2M A;  1P3A A;  3W98 C;  4KHA B;  1P3B A;  3AYW D;  2JSS A;  3AZM A;  3R45 B;  5FUG A;  2YFW A;  5CPK B;  3MNN A;  5AV8 B;  3AZJ D;  3MGS D;  4LD9 C;  2ZY4 A;  4X23 D;  3REJ A;  1Q9C A;  3REK A;  1EQZ B;  3AZI D;  4H9Q B;  4CAY A;  3LZ1 C;  4J8V D;  4Z2M G;  5AV8 C;  3WAA D;  3X1T A;  4WNN A;  4XZQ B;  5B2J C;  3REH C;  2BYM A;  1S32 D;  2Y2P A;  5CP6 B;  3C1C A;  4H9R A;  3A6N C;  4KGC C;  4J8W B;  3MNN C;  3KWQ A;  3KFU G;  1H3O A;  4E44 A;  1P3I A;  1ID3 D;  2Y2N A;  4R8P A;  3KUY A;  4KUD C;  1KX4 B;  1P3A C;  3O62 A;  3W99 D;  2CV5 A;  3LEL D;  3X1V B;  5B1M A;  3LZ1 D;  3UTA D;  1M1A D;  3TU4 D;  4WU9 A;  5KDM A;  4X23 C;  4NE5 A;  3UT9 D;  3MGS C;  3KSY A;  4YM6 A;  5B24 D;  2F8N B;  5JA4 B;  3KXB A;  3AZK A;  1BH9 B;  2Y2I A;  5BNV B;  5CHL B;  5B2I A;  3X1U C;  2FJ7 C;  4DRB A;  5AV5 D;  4KUD B;  3LJA D;  1JFI B;  3MGS B;  1P3A B;  2RVQ D;  5DNN C;  1P3B B;  3EPH A;  4HGA B;  4XUJ C;  5AVB A;  1N1J A;  1P3F D;  5CPI C;  3LZ0 C;  3AV2 D;  5BS7 A;  3AV1 D;  4H9S A;  5AV9 D;  3AZF C;  5GXQ A;  1W2E A;  1S32 B;  5E5A D;  4M6B A;  4UUZ A;  4H9P B;  1M19 A;  1BFM A;  2J8P A;  3AV1 B;  2Y2H A;  1P3K C;  4ZUX A;  5AVC A;  3C1B A;  5B33 D;  3EPL A;  3W97 B;  1ID3 B;  3MGQ B;  1HQ3 C;  3WTP C;  3AZG C;  5E5A B;  1U35 B;  1P3P B;  1P3G A;  5GT0 B;  3B6F B;  3WA9 C;  3C1C B;  4JJN D;  3WA9 D;  4J8W A;  5GT3 D;  3X1S A;  3WTP D;  3H0M C;  3LEL B;  3X1V D;  4YS3 B;  5AV6 C;  1AOI C;  3TU4 B;  1KX4 A;  5GT0 D;  3MGP B;  4J8X C;  4CSR B;  3WA9 B;  5C3I C;  4Z66 A;  1P3O D;  1M18 D;  3REL D;  5B24 B;  1F66 D;  5AV6 A;  3AZE C;  3AV1 C;  2ARO A;  5DNN B;  3X1S C;  5B32 A;  5CPK A;  4J8U A;  2ZY2 A;  5AV5 B;  5CPJ C;  2F8N A;  3LZ0 B;  5DNM A;  3VH6 A;  3AZG A;  1P3G C;  1F66 B;  1P34 B;  3V9R B;  5DNN D;  3C1B C;  4ZUX C;  5AVC C;  1P3K A;  3AZE B;  2NZD D;  4H9Q A;  4CAY B;  2PYO D;  4NE6 A;  5B40 D;  3NQJ B;  1ZLA D;  5B31 B;  5B0Y D;  1P34 D;  5F99 A;  1EQZ C;  4H9S C;  3AL0 C;  3MGR C;  5B40 B;  1KX5 B;  3MGR D;  5B31 D;  1P3L A;  1P3I B;  3H0R C;  1WWS A;  4XUJ A;  2LY8 A;  1EQZ D;  3MGQ D;  1U35 D;  1ZLA C;  3A6N B;  4H9P A;  1M19 B;  1BH8 B;  5B40 C;  4G92 B;  3WAA B;  3WTP B;  5CP6 D;  4KGC D;  3A6N D;  5CPJ D;  5AY8 D;  3X1S B;  4WU8 B;  3REH D;  2NQB A;  3WKJ A;  1BH9 A;  3AZH A;  1F66 C;  5F99 C;  3AZN B;  3AN2 D;  5AY8 B;  2VQR A;  4KUD A;  3AZI C;  4J8X D;  1M1A B;  1HQ3 B;  1AOI D;  2BYK A;  3X1V C;  3AZN D;  3AZJ C;  3REI A;  4LD9 D;  5GT3 C;  3UT9 B;  2Y2Q A;  1A7W A;  5DNM B;  5CPK C;  3KWQ B;  1KX3 B;  5B2J A;  1T3U A;  1HQ3 D;  2ARO C;  3B6G B;  3AZE A;  3EPJ A;  3AZL D;  5AV8 A;  1ULY A;  3REK C;  1KX3 D;  5E5A C;  3MVD A;  5JRG B;  3UTB B;  1TAF A;  3B6G D;  2Y2O A;  5AV9 C;  1P3P A;  4Z5T D;  5B0Z D;  1KX5 A;  1WWI A;  2HIO D;  4XZQ A;  3AZM C;  5JRG D;  3UTB D;  5CPI D;  4YS3 A;  3W98 A;  3W96 A;  1HTA A;  5GSU A;  5BT1 C;  3MGP A;  4Z5T B;  4AWL C;  3LJA C;  3AFA D;  1P3M A;  2Y2L A;  5GSU C;  4Z66 B;  2FJ7 D;  1H3O B;  4WV4 B;  4QLC C;  3X1U D;  1KU5 A;  4YS3 C;  3REH B;  4WU8 D;  3W97 D;  3UTA B;  5GXQ C;  3B6F D;  3AZF A;  1TZY D;  1KX5 C;  4J8U B;  1P3P C;  5GT3 B;  3UT9 C;  2ZY5 A;  5B1L D;  3LZ0 A;  5B1M B;  3WKJ B;  3AZH B;  3UTA C;  3R45 A;  4QLC D;  3LEL C;  5FUG B;  3AFA C;  3W99 C;  2UWX A;  3REL B;  1P3A D;  1P3B D;  5B2I C;  1B67 A;  2ZM5 A;  3AYW A;  3AZM D;  4QLC B;  3REK B;  3KXB C;  1P3F B;  3MNN D;  4H9O A;  3AZJ A;  3F6T A;  3MGS A;  4X23 A;  4KHA A;  5B2J B;  4WNN B;  3REJ D;  4WU9 C;  3AZM B;  5AVB B;  3REK D;  3AZI A;  5B1M C;  4J8V A;  3WAA C;  4G92 C;  5BNX A;  3WAA A;  3X1T D; 
#chains in the Genus database with same CATH homology
 4J8V C;  3REJ B;  5CPI B;  2NQB C;  1S32 A;  2HUE C;  2XD5 A;  3C1C D;  3O62 B;  5G49 A;  2IO5 C;  3KWQ D;  3C1C C;  3X1T B;  1P3I D;  1ID3 A;  2JCH A;  3FDD A;  4R8P D;  3AYW C;  5GSU B;  3KUY D;  3EG5 B;  5KDM B;  3O62 D;  1P3M B;  3W99 A;  1P3O B;  1M18 B;  2JE5 A;  2CV5 D;  3LEL A;  5JA4 A;  5B1M D;  3LZ1 A;  3UTA A;  3AZK B;  1M1A A;  3TU4 A;  5BNV A;  4WU9 D;  5B2I B;  5AY8 C;  3UT9 A;  3B0C T;  3P5J B;  5CP6 C;  4YM6 D;  5B24 A;  5AV6 B;  3KXB D;  3AZK D;  4WU9 B;  2NZD B;  5B2I D;  5B32 B;  2YFW B;  5BO0 A;  5AV5 A;  3LJA A;  3MGQ C;  3AZG B;  1U35 C;  3KXB B;  5B0Y B;  3W96 C;  5AVB D;  5B31 C;  4LD9 B;  3EPK A;  1P3F A;  4XZQ C;  5B1L C;  4J8U C;  5B32 C;  3AV2 A;  3IP4 C;  2W8S A;  4X23 B;  3AV1 A;  3MGR B;  3C1B B;  1PZR A;  5AV9 A;  4AWL B;  3VH6 W;  3B6F C;  4UPK A;  5B0Y C;  5GXQ D;  3W96 B;  2BYM B;  5E5A A;  4Z66 C;  3MVD C;  1M19 D;  5BNX B;  1KX4 C;  5AVC D;  4ZUX D;  1Z2C B;  5BT1 D;  3C1B D;  4EO5 B;  5B33 A;  1P3G D;  4R8P B;  5B32 G;  4J8W C;  5JRG C;  3UTB C;  5C3I B;  2HIO C;  4JJN A;  3WA9 A;  4ZBJ C;  3VH5 T;  5G49 B;  4J8W D;  5GT3 A;  3X1S D;  3WTP A;  5AVC B;  4ZUX B;  3H0L C;  3REI C;  3X1V A;  3B0D C;  2Y2K A;  2ARO B;  3B6G C;  3B0C W;  5GT0 A;  3REL C;  1KX4 D;  1P3O C;  1M19 C;  1M18 C;  3AN2 B;  4Z66 D;  2FJ7 B;  1P3O A;  1M18 A;  3REL A;  3X1U B;  4YM6 B;  4DRA A;  2NQB B;  1F66 A;  5AV6 D;  3AZH C;  3AZL C;  3WKJ C;  2ARO D;  1AOI B;  4WJ3 C;  5B32 D;  5CPK D;  4J8U D;  3AZJ B;  2F8N D;  5B1L B;  5DNM D;  3AZG D;  2G5I C;  3AZN C;  5DNN A;  2NZD A;  1P3K D;  3AZL B;  3REI B;  4NE3 A;  4WZS B;  1N1J B;  2PYO A;  5B40 A;  3LJA B;  2CWE A;  3VH6 T;  1R4V A;  1ZLA A;  3AN2 C;  5B0Y A;  1P34 A;  3AZK C;  5F99 D;  3V9R A;  4EO5 C;  1P3K B;  4YM6 C;  5GXQ B;  1P3L C;  3MNN B;  2YFV B;  5B0Z B;  4UUZ B;  2F8N H;  4E45 A;  3WTP E;  1P3F C;  4ZBJ B;  3MGR A;  5B31 A;  2F8N G;  2HIO B;  1P3L D;  5F99 B;  2FFF B;  4XUJ D;  1EQZ A;  3MGQ A;  1U35 A;  1P3G B;  3VH5 W;  3O62 C;  2Y2J A;  2HUE B;  3NQU A;  3AFA B;  3W99 B;  3KUY C;  2Y2G A;  4R8P C;  4XUJ B;  2F2A C;  2ZY3 A;  3W98 B;  1P3I C;  3KWQ C;  5B24 C;  5CP6 A;  4KGC A;  5DNM C;  3A6N A;  4JJN B;  1TZY B;  5CPJ A;  5AY8 A;  1BH8 A;  4CSR A;  4H9N B;  4Z2M H;  3REH A;  3TU4 C;  1M1A C;  2NQB D;  3VH5 A;  3WKJ D;  2IO5 B;  3X1T C;  3AZH D;  2BYK B;  1P34 C;  3AN2 A;  4DQY B;  1F1E A;  5BO0 B;  4KUD D;  2CV5 B;  4J8X A;  2PYO C;  2DF4 C;  1ID3 C;  3REJ C;  2NZD C;  1AOI A;  2F8N K;  3AZN A;  4NFT A;  3REI D;  4LD9 A;  2L5A A;  3AV2 B;  2DQN C;  3A1I A;  3NQJ A;  4HGA C;  1S32 C;  3MVD B;  5B2J D;  1P3B C;  1HQ3 A;  5AV9 B;  1TAF B;  3AZE D;  3AZL A;  5AV8 D;  4H9O B;  1JFI A;  1ZLA B;  1KX3 A;  3MVD D;  1P3L B;  5GT0 C;  3B6G A;  5B33 B;  3AZI B;  4J8V B;  1P3P D;  4Z5T A;  2YFV A;  5B0Z A;  1KX5 D;  4H9R B;  1TZY C;  5BS7 C;  2HIO A;  4JJN C;  4XZQ D;  5CPI A;  5JRG A;  3UTB A;  3W97 C;  5AVB C;  4WU8 C;  4YS3 D;  3W98 D;  3W96 D;  3A1K A;  5B33 C;  5GSU D;  3KUY B;  3MGP D;  3NQU B;  3AFA A;  1P3M D;  2FJ7 A;  3B0B A;  3X1U A;  4WU8 A;  3B0D B;  3W97 A;  3B6F A;  2RIQ A;  3AZF D;  4KGC B;  2G5H C;  1TZY A;  5CPJ B;  2XD1 A;  4G91 B;  5B0Z C;  4Z5T C;  1B6W A;  4H9N A;  3AV2 C;  2BG1 A;  5B1L A;  3LZ0 D;  3LZ1 B;  3AYW B;  1KX3 C;  3AZF B;  4QLC A;  2CV5 C;  1P3M C;  2RVQ C;  5B31 G;  2PYO B;  4G91 C;  5AV5 C;  3MGP C;  4J8X B;  2Y2M A;  1P3A A;  3W98 C;  4KHA B;  1P3B A;  3AYW D;  2JSS A;  3AZM A;  3R45 B;  5FUG A;  2YFW A;  5CPK B;  3MNN A;  5AV8 B;  3AZJ D;  3MGS D;  4LD9 C;  2ZY4 A;  4X23 D;  3REJ A;  1Q9C A;  3REK A;  1EQZ B;  3AZI D;  4H9Q B;  4CAY A;  3LZ1 C;  4J8V D;  4Z2M G;  5AV8 C;  3WAA D;  3X1T A;  4WNN A;  4XZQ B;  5B2J C;  3REH C;  2BYM A;  1S32 D;  2Y2P A;  5CP6 B;  3C1C A;  4H9R A;  3A6N C;  4KGC C;  4J8W B;  3MNN C;  3KWQ A;  3KFU G;  1H3O A;  4E44 A;  1P3I A;  1ID3 D;  2Y2N A;  4R8P A;  3KUY A;  4KUD C;  1KX4 B;  1P3A C;  3O62 A;  3W99 D;  2CV5 A;  3LEL D;  3X1V B;  5B1M A;  3LZ1 D;  3UTA D;  1M1A D;  3TU4 D;  4WU9 A;  5KDM A;  4X23 C;  4NE5 A;  3UT9 D;  3MGS C;  3KSY A;  4YM6 A;  5B24 D;  2F8N B;  5JA4 B;  3KXB A;  3AZK A;  1BH9 B;  2Y2I A;  5BNV B;  5CHL B;  5B2I A;  3X1U C;  2FJ7 C;  4DRB A;  5AV5 D;  4KUD B;  3LJA D;  1JFI B;  3MGS B;  1P3A B;  2RVQ D;  5DNN C;  1P3B B;  3EPH A;  4HGA B;  4XUJ C;  5AVB A;  1N1J A;  1P3F D;  5CPI C;  3LZ0 C;  3AV2 D;  5BS7 A;  3AV1 D;  4H9S A;  5AV9 D;  3AZF C;  5GXQ A;  1W2E A;  1S32 B;  5E5A D;  4M6B A;  4UUZ A;  4H9P B;  1M19 A;  1BFM A;  2J8P A;  3AV1 B;  2Y2H A;  1P3K C;  4ZUX A;  5AVC A;  3C1B A;  5B33 D;  3EPL A;  3W97 B;  1ID3 B;  3MGQ B;  1HQ3 C;  3WTP C;  3AZG C;  5E5A B;  1U35 B;  1P3P B;  1P3G A;  5GT0 B;  3B6F B;  3WA9 C;  3C1C B;  4JJN D;  3WA9 D;  4J8W A;  5GT3 D;  3X1S A;  3WTP D;  3H0M C;  3LEL B;  3X1V D;  4YS3 B;  5AV6 C;  1AOI C;  3TU4 B;  1KX4 A;  5GT0 D;  3MGP B;  4J8X C;  4CSR B;  3WA9 B;  5C3I C;  4Z66 A;  1P3O D;  1M18 D;  3REL D;  5B24 B;  1F66 D;  5AV6 A;  3AZE C;  3AV1 C;  2ARO A;  5DNN B;  3X1S C;  5B32 A;  5CPK A;  4J8U A;  2ZY2 A;  5AV5 B;  5CPJ C;  2F8N A;  3LZ0 B;  5DNM A;  3VH6 A;  3AZG A;  1P3G C;  1F66 B;  1P34 B;  3V9R B;  5DNN D;  3C1B C;  4ZUX C;  5AVC C;  1P3K A;  3AZE B;  2NZD D;  4H9Q A;  4CAY B;  2PYO D;  4NE6 A;  5B40 D;  3NQJ B;  1ZLA D;  5B31 B;  5B0Y D;  1P34 D;  5F99 A;  1EQZ C;  4H9S C;  3AL0 C;  3MGR C;  5B40 B;  1KX5 B;  3MGR D;  5B31 D;  1P3L A;  1P3I B;  3H0R C;  1WWS A;  4XUJ A;  2LY8 A;  1EQZ D;  3MGQ D;  1U35 D;  1ZLA C;  3A6N B;  4H9P A;  1M19 B;  1BH8 B;  5B40 C;  4G92 B;  3WAA B;  3WTP B;  5CP6 D;  4KGC D;  3A6N D;  5CPJ D;  5AY8 D;  3X1S B;  4WU8 B;  3REH D;  2NQB A;  3WKJ A;  1BH9 A;  3AZH A;  1F66 C;  5F99 C;  3AZN B;  3AN2 D;  5AY8 B;  2VQR A;  4KUD A;  3AZI C;  4J8X D;  1M1A B;  1HQ3 B;  1AOI D;  2BYK A;  3X1V C;  3AZN D;  3AZJ C;  3REI A;  4LD9 D;  5GT3 C;  3UT9 B;  2Y2Q A;  1A7W A;  5DNM B;  5CPK C;  3KWQ B;  1KX3 B;  5B2J A;  1T3U A;  1HQ3 D;  2ARO C;  3B6G B;  3AZE A;  3EPJ A;  3AZL D;  5AV8 A;  1ULY A;  3REK C;  1KX3 D;  5E5A C;  3MVD A;  5JRG B;  3UTB B;  1TAF A;  3B6G D;  2Y2O A;  5AV9 C;  1P3P A;  4Z5T D;  5B0Z D;  1KX5 A;  1WWI A;  2HIO D;  4XZQ A;  3AZM C;  5JRG D;  3UTB D;  5CPI D;  4YS3 A;  3W98 A;  3W96 A;  1HTA A;  5GSU A;  5BT1 C;  3MGP A;  4Z5T B;  4AWL C;  3LJA C;  3AFA D;  1P3M A;  2Y2L A;  5GSU C;  4Z66 B;  2FJ7 D;  1H3O B;  4WV4 B;  4QLC C;  3X1U D;  1KU5 A;  4YS3 C;  3REH B;  4WU8 D;  3W97 D;  3UTA B;  5GXQ C;  3B6F D;  3AZF A;  1TZY D;  1KX5 C;  4J8U B;  1P3P C;  5GT3 B;  3UT9 C;  2ZY5 A;  5B1L D;  3LZ0 A;  5B1M B;  3WKJ B;  3AZH B;  3UTA C;  3R45 A;  4QLC D;  3LEL C;  5FUG B;  3AFA C;  3W99 C;  2UWX A;  3REL B;  1P3A D;  1P3B D;  5B2I C;  1B67 A;  2ZM5 A;  3AYW A;  3AZM D;  4QLC B;  3REK B;  3KXB C;  1P3F B;  3MNN D;  4H9O A;  3AZJ A;  3F6T A;  3MGS A;  4X23 A;  4KHA A;  5B2J B;  4WNN B;  3REJ D;  4WU9 C;  3AZM B;  5AVB B;  3REK D;  3AZI A;  5B1M C;  4J8V A;  3WAA C;  4G92 C;  5BNX A;  3WAA A;  3X1T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...