4Z67A

The 1.5-angstrom crystal structure of mn(2+)-bound pqqb from pseudomonas putida
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hormone
molecule keywords Coenzyme PQQ synthesis protein B
total genus 108
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z67A00
3X2ZA 2BG2A 4D1UA 5HIPA 1HLKA 1WW1A 4TZEA 4TZ9A 4UWPB 1WUOA 3IE2A 2H6AA 2GFKA 4RL2A 5EH9A 3IELA 5HIOA 2ZZIA 4EYBA 1KR3A 5EVDA 4AWYB 4TZFA 4UAMA 3SBLA 4EXSA 4F6ZA 3PY5A 4FR7A 3QH8A 4XWTA 4Z67A 5LE1A 4ZO2A 3L6NA 3I11A 2UYXA 2Q9UA 2AZ4A 1ZNBA 5EVKA 5IQKA 3VQZA 2Q42A 5K4NA 2QJSA 3BV6A 5LM6A 3FAIA 5K4KA 3RKJA 3I15A 2Y8BA 2ZWRA 5K4MA 2OHHA 2BG8A 3SRXA 4C1FA 3SW3A 3F9OA 1JT1A 2P1EA 1A8TA 3IE1A 2NZEA 2YNTA 1XTOA 1VGNA 5EVBA 4D1VA 4WD6A 1DXKA 4J5FA 5A0TA 5KIKA 1M2XA 1YCFA 1QH5A 2BGAA 2FU8A 2BTNA 5HH4A 4UWRB 3G1PA 5A5ZA 5ACXA 4GYQA 2M5DA 5EW0A 2ZNBA 1JJTA 3AJ3A 4RL0A 4BP0A 3ZR9A 5HISA 4Z7RA 5ACVA 3SFPA 2P4ZA 4LE6A 4V0HA 1MQOA 2CBNA 5EV6A 5EV8A 3ZWFA 2FU9A 3IEMA 4XUKA 5EWAA 4U4LA 3SPUA 3MD7A 4C09A 2NYPA 4GCWA 5B15A 3TP9A 4C1GA 3X30A 2YNVB 1VJNA 4FSBA 1WRAA 2GCUA 3P2UA 1KO2A 2GFJA 1E5DA 4F6HA 4KEQA 3Q6VA 1YCGA 2DOOA 4DIKA 3SD9A 4Z5YA 2WYLA 2NXAA 2QEDA 2FM6A 1DDKA 3AF6A 4UA4A 2BG6A 4UBQA 5HH5A 3H3EA 1YCHA 5B1UA 1XM8A 2BFLA 3I0VA 5LCAA 4EFZA 5B3RA 2I7XA 3IOGA 1ZKPA 3A4YA 2DKFA 3KNRA 4YSKA 2BR6A 3RKKA 4C1HA 3BK1A 3BK2A 5KILA 2Q0JA 5LS3A 3X2YA 4D1TA 2YZ3A 5LCHA 2I7TA 4C1EA 5HIQA 2WHGA 2YNUA 1A7TA 3DHCA 1X8GA 2NZFA 4YSLA 4XWWA 2WYMC 1L9YA 4AX1B 2YNWA 3T3NA 3IOFA 3T3OA 5A0VA 4ZO3A 2BG8B 3PY6A 1BC2A 2BFZB 3AF5A 2P97A 5AXOA 2FHXA 3LVZA 5ACTA 4P62A 5ACQA 4B87A 5K0WA 4UWOB 4Z6XA 2OHJA 3IEKA 4EY2A 3IDZA 4DILA 5FQBA 2YNVA 4TYFA 3VPEA 4Z5ZA 5ACWA 5AYAA 2OHIA 4PVTA 5FQCA 4D1WA 4HL1A 3WXCA 1K07A 4UWSB 3R2UA 2WRSA 4KEPA 5AEBA 2P18A 4AWZA 1BVTA 3FCZA 4ZNBA 1KO3A 4RM5A 2E7YA 5LSCA 5ACSA 1WUPA 3DHAA 3IE0A 3I13A 4C1CA 2FU6A 4ZEJA 5ACRA 3ADRA 3PG4A 4RAMA 3RPCA 2QDTA 3ZNBA 1DD6A 4EXYA 4EYFA 1VMEA 2GKLA 3T9MA 2BFKA 4FEKA 5AHOA 2YCBA 3BC2A 2FK6A 1ZTCA 4RAWA 4EYLA 4J5HA 1BMCA 2Y8AA 1JJEA 2FU7A 2GMNA 2Q0IA 2BC2A 4HKYA 4HL2A 1X8IA 4RBSA 5LCFA 4O98A 2WYMA 4H0DA 2YNTB 3KNSA 4NQ2A 3KL7A 2Y87A 4BZ3A 3DHBA 4TZBA 3X2XA 1P9EA 4CHLA 3ZQ4A 2A7MA 4NQ5A 2I7VA 5DPXA 4Z60A 3ESHA 4D02A 4JO0A 5AHRA 4AD9A 4YSBA 4AX0B 5HH6A 4TYTA 4C1DA 5LLDA 4NQ6A 2QINA 2QDSA 3I14A 2BMIA 3DH8A 1QH3A 2M5CA 2R2DA 2HB9A 2BFZA 2BG7A 4NQ4A 1X8HA 3JXPA 2BIBA 5EHTA 5ACPA 2FHXB 1Y44A 2AIOA 2VW8A 5AXRA 1SMLA 2ZO4A 4PVOA 5A87A 3S0ZA 5FQAA 5LMCA 2XR1A 5ACUA 4GYUA 2XF4A
chains in the Genus database with same CATH superfamily
3X2ZA 2BG2A 4D1UA 5HIPA 1HLKA 1WW1A 4TZEA 4TZ9A 4UWPB 1WUOA 3IE2A 2H6AA 2GFKA 4RL2A 5EH9A 3IELA 5HIOA 2ZZIA 4EYBA 1KR3A 5EVDA 4AWYB 4TZFA 4UAMA 3SBLA 4EXSA 4F6ZA 3PY5A 4FR7A 3QH8A 4XWTA 4Z67A 5LE1A 4ZO2A 3L6NA 3I11A 2UYXA 2Q9UA 2AZ4A 1ZNBA 5EVKA 5IQKA 3VQZA 2Q42A 5K4NA 2QJSA 3BV6A 5LM6A 3FAIA 5K4KA 3RKJA 3I15A 2Y8BA 2ZWRA 5K4MA 2OHHA 2BG8A 3SRXA 4C1FA 3SW3A 3F9OA 1JT1A 2P1EA 1A8TA 4AV7A 3IE1A 2NZEA 2YNTA 1XTOA 1VGNA 5EVBA 4D1VA 4WD6A 1DXKA 4AXHA 4J5FA 5A0TA 5KIKA 1M2XA 1YCFA 1QH5A 2BGAA 2FU8A 2BTNA 5HH4A 4UWRB 3G1PA 5A5ZA 5ACXA 4GYQA 2M5DA 5EW0A 2ZNBA 1JJTA 3AJ3A 4RL0A 4BP0A 3ZR9A 5HISA 4Z7RA 5ACVA 2CG3A 3SFPA 2P4ZA 4LE6A 4V0HA 1MQOA 2CBNA 5EV6A 5EV8A 3ZWFA 2FU9A 3IEMA 4XUKA 5EWAA 4U4LA 3SPUA 3MD7A 4C09A 2NYPA 4GCWA 5B15A 4NURA 3TP9A 4C1GA 3X30A 2YNVB 1VJNA 4FSBA 1WRAA 2GCUA 3P2UA 1KO2A 2GFJA 1E5DA 4F6HA 4KEQA 3Q6VA 1YCGA 2DOOA 4DIKA 3SD9A 4Z5YA 2WYLA 2NXAA 2QEDA 2FM6A 1DDKA 3AF6A 4UA4A 2BG6A 4UBQA 5HH5A 3H3EA 1YCHA 5B1UA 1XM8A 2BFLA 3I0VA 5LCAA 4EFZA 5B3RA 2I7XA 4PDXA 3IOGA 1ZKPA 3A4YA 2CFZA 2DKFA 3KNRA 4YSKA 2BR6A 3RKKA 4C1HA 3BK1A 3BK2A 5KILA 2Q0JA 5LS3A 3X2YA 4D1TA 2YZ3A 5LCHA 2I7TA 4C1EA 5HIQA 2WHGA 2YNUA 1A7TA 3DHCA 1X8GA 2NZFA 2CFUA 4YSLA 4XWWA 2WYMC 1L9YA 4AX1B 2YNWA 3T3NA 3IOFA 3T3OA 5A0VA 4ZO3A 2BG8B 3PY6A 1BC2A 2BFZB 3AF5A 2P97A 5AXOA 2FHXA 3LVZA 5ACTA 4P62A 5ACQA 4B87A 5K0WA 4UWOB 4Z6XA 2OHJA 5A23A 3IEKA 4EY2A 3IDZA 4DILA 5FQBA 2YNVA 4TYFA 3VPEA 4Z5ZA 5ACWA 5AYAA 2OHIA 4PVTA 5FQCA 4D1WA 4HL1A 3WXCA 1K07A 4UWSB 3R2UA 2WRSA 4KEPA 5AEBA 2P18A 4AWZA 1BVTA 3FCZA 4ZNBA 1KO3A 4RM5A 2E7YA 5LSCA 5ACSA 1WUPA 3DHAA 3IE0A 3I13A 4C1CA 2FU6A 4ZEJA 5ACRA 3ADRA 3PG4A 4RAMA 3RPCA 2QDTA 3ZNBA 1DD6A 4EXYA 4EYFA 1VMEA 2GKLA 3T9MA 2BFKA 4FEKA 5AHOA 2YCBA 5AIJA 3BC2A 2FK6A 1ZTCA 4RAWA 4EYLA 4J5HA 1BMCA 2Y8AA 1JJEA 2FU7A 2GMNA 2Q0IA 2BC2A 4HKYA 4HL2A 1X8IA 4RBSA 5LCFA 4O98A 2WYMA 4H0DA 2YNTB 3KNSA 4NQ2A 3KL7A 2Y87A 4BZ3A 3DHBA 4TZBA 3X2XA 1P9EA 4CHLA 3ZQ4A 2A7MA 2CG2A 4NQ5A 2I7VA 5DPXA 4Z60A 3ESHA 4D02A 4JO0A 5AHRA 4AD9A 4YSBA 4AX0B 5HH6A 4TYTA 4C1DA 5LLDA 4NQ6A 2QINA 2QDSA 3I14A 2BMIA 3DH8A 1QH3A 2M5CA 2R2DA 2HB9A 2BFZA 2BG7A 2YHEA 4NQ4A 5AJLA 1X8HA 3JXPA 2BIBA 5EHTA 5ACPA 2FHXB 1Y44A 2AIOA 2VW8A 5AXRA 1SMLA 2ZO4A 4PVOA 5A87A 3S0ZA 5FQAA 5LMCA 2XR1A 5ACUA 4GYUA 2XF4A
chains in the Genus database with same CATH topology
3X2ZA 2BG2A 4D1UA 5HIPA 1HLKA 1WW1A 4TZEA 4TZ9A 4UWPB 1WUOA 3IE2A 2H6AA 2GFKA 4RL2A 5EH9A 3IELA 5HIOA 2ZZIA 4EYBA 1KR3A 5EVDA 4AWYB 4TZFA 4UAMA 3SBLA 4EXSA 4F6ZA 3PY5A 4FR7A 3QH8A 4XWTA 4Z67A 5LE1A 4ZO2A 3L6NA 3I11A 2UYXA 2Q9UA 2AZ4A 1ZNBA 5EVKA 5IQKA 3VQZA 2Q42A 5K4NA 2QJSA 3BV6A 5LM6A 3FAIA 5K4KA 3RKJA 3I15A 2Y8BA 2ZWRA 5K4MA 2OHHA 2BG8A 3SRXA 4C1FA 3SW3A 3F9OA 1JT1A 2P1EA 1A8TA 3IE1A 2NZEA 2YNTA 1XTOA 1VGNA 5EVBA 4D1VA 4WD6A 1DXKA 4J5FA 5A0TA 5KIKA 1M2XA 1YCFA 1QH5A 2BGAA 2FU8A 2BTNA 5HH4A 4UWRB 3G1PA 5A5ZA 5ACXA 4GYQA 2M5DA 5EW0A 2ZNBA 1JJTA 3AJ3A 4RL0A 4BP0A 3ZR9A 5HISA 4Z7RA 5ACVA 3SFPA 2P4ZA 4LE6A 4V0HA 1MQOA 2CBNA 5EV6A 5EV8A 3ZWFA 2FU9A 3IEMA 4XUKA 5EWAA 4U4LA 3SPUA 3MD7A 4C09A 2NYPA 4GCWA 5B15A 3TP9A 4C1GA 3X30A 2YNVB 1VJNA 4FSBA 1WRAA 2GCUA 3P2UA 1KO2A 2GFJA 1E5DA 4F6HA 4KEQA 3Q6VA 1YCGA 2DOOA 4DIKA 3SD9A 4Z5YA 2WYLA 2NXAA 2QEDA 2FM6A 1DDKA 3AF6A 4UA4A 2BG6A 4UBQA 5HH5A 3H3EA 1YCHA 5B1UA 1XM8A 2BFLA 3I0VA 5LCAA 4EFZA 5B3RA 2I7XA 3IOGA 1ZKPA 3A4YA 2DKFA 3KNRA 4YSKA 2BR6A 3RKKA 4C1HA 3BK1A 3BK2A 5KILA 2Q0JA 5LS3A 3X2YA 4D1TA 2YZ3A 5LCHA 2I7TA 4C1EA 5HIQA 2WHGA 2YNUA 1A7TA 3DHCA 1X8GA 2NZFA 4YSLA 4XWWA 2WYMC 1L9YA 4AX1B 2YNWA 3T3NA 3IOFA 3T3OA 5A0VA 4ZO3A 2BG8B 3PY6A 1BC2A 2BFZB 3AF5A 2P97A 5AXOA 2FHXA 3LVZA 5ACTA 4P62A 5ACQA 4B87A 5K0WA 4UWOB 4Z6XA 2OHJA 3IEKA 4EY2A 3IDZA 4DILA 5FQBA 2YNVA 4TYFA 3VPEA 4Z5ZA 5ACWA 5AYAA 2OHIA 4PVTA 5FQCA 4D1WA 4HL1A 3WXCA 1K07A 4UWSB 3R2UA 2WRSA 4KEPA 5AEBA 2P18A 4AWZA 1BVTA 3FCZA 4ZNBA 1KO3A 4RM5A 2E7YA 5LSCA 5ACSA 1WUPA 3DHAA 3IE0A 3I13A 4C1CA 2FU6A 4ZEJA 5ACRA 3ADRA 3PG4A 4RAMA 3RPCA 2QDTA 3ZNBA 1DD6A 4EXYA 4EYFA 1VMEA 2GKLA 3T9MA 2BFKA 4FEKA 5AHOA 2YCBA 3BC2A 2FK6A 1ZTCA 4RAWA 4EYLA 4J5HA 1BMCA 2Y8AA 1JJEA 2FU7A 2GMNA 2Q0IA 2BC2A 4HKYA 4HL2A 1X8IA 4RBSA 5LCFA 4O98A 2WYMA 4H0DA 2YNTB 3KNSA 4NQ2A 3KL7A 2Y87A 4BZ3A 3DHBA 4TZBA 3X2XA 1P9EA 4CHLA 3ZQ4A 2A7MA 4NQ5A 2I7VA 5DPXA 4Z60A 3ESHA 4D02A 4JO0A 5AHRA 4AD9A 4YSBA 4AX0B 5HH6A 4TYTA 4C1DA 5LLDA 4NQ6A 2QINA 2QDSA 3I14A 2BMIA 3DH8A 1QH3A 2M5CA 2R2DA 2HB9A 2BFZA 2BG7A 4NQ4A 1X8HA 3JXPA 2BIBA 5EHTA 5ACPA 2FHXB 1Y44A 2AIOA 2VW8A 5AXRA 1SMLA 2ZO4A 4PVOA 5A87A 3S0ZA 5FQAA 5LMCA 2XR1A 5ACUA 4GYUA 2XF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Z A;  2BG2 A;  4D1U A;  5HIP A;  1HLK A;  1WW1 A;  4TZE A;  4TZ9 A;  4UWP B;  1WUO A;  3IE2 A;  2H6A A;  2GFK A;  4RL2 A;  5EH9 A;  3IEL A;  5HIO A;  2ZZI A;  4EYB A;  1KR3 A;  5EVD A;  4AWY B;  4TZF A;  4UAM A;  3SBL A;  4EXS A;  4F6Z A;  3PY5 A;  4FR7 A;  3QH8 A;  4XWT A;  4Z67 A;  5LE1 A;  4ZO2 A;  3L6N A;  3I11 A;  2UYX A;  2Q9U A;  2AZ4 A;  1ZNB A;  5EVK A;  5IQK A;  3VQZ A;  2Q42 A;  5K4N A;  2QJS A;  3BV6 A;  5LM6 A;  3FAI A;  5K4K A;  3RKJ A;  3I15 A;  2Y8B A;  2ZWR A;  5K4M A;  2OHH A;  2BG8 A;  3SRX A;  4C1F A;  3SW3 A;  3F9O A;  1JT1 A;  2P1E A;  1A8T A;  3IE1 A;  2NZE A;  2YNT A;  1XTO A;  1VGN A;  5EVB A;  4D1V A;  4WD6 A;  1DXK A;  4J5F A;  5A0T A;  5KIK A;  1M2X A;  1YCF A;  1QH5 A;  2BGA A;  2FU8 A;  2BTN A;  5HH4 A;  4UWR B;  3G1P A;  5A5Z A;  5ACX A;  4GYQ A;  2M5D A;  5EW0 A;  2ZNB A;  1JJT A;  3AJ3 A;  4RL0 A;  4BP0 A;  3ZR9 A;  5HIS A;  4Z7R A;  5ACV A;  3SFP A;  2P4Z A;  4LE6 A;  4V0H A;  1MQO A;  2CBN A;  5EV6 A;  5EV8 A;  3ZWF A;  2FU9 A;  3IEM A;  4XUK A;  5EWA A;  4U4L A;  3SPU A;  3MD7 A;  4C09 A;  2NYP A;  4GCW A;  5B15 A;  3TP9 A;  4C1G A;  3X30 A;  2YNV B;  1VJN A;  4FSB A;  1WRA A;  2GCU A;  3P2U A;  1KO2 A;  2GFJ A;  1E5D A;  4F6H A;  4KEQ A;  3Q6V A;  1YCG A;  2DOO A;  4DIK A;  3SD9 A;  4Z5Y A;  2WYL A;  2NXA A;  2QED A;  2FM6 A;  1DDK A;  3AF6 A;  4UA4 A;  2BG6 A;  4UBQ A;  5HH5 A;  3H3E A;  1YCH A;  5B1U A;  1XM8 A;  2BFL A;  3I0V A;  5LCA A;  4EFZ A;  5B3R A;  2I7X A;  3IOG A;  1ZKP A;  3A4Y A;  2DKF A;  3KNR A;  4YSK A;  2BR6 A;  3RKK A;  4C1H A;  3BK1 A;  3BK2 A;  5KIL A;  2Q0J A;  5LS3 A;  3X2Y A;  4D1T A;  2YZ3 A;  5LCH A;  2I7T A;  4C1E A;  5HIQ A;  2WHG A;  2YNU A;  1A7T A;  3DHC A;  1X8G A;  2NZF A;  4YSL A;  4XWW A;  2WYM C;  1L9Y A;  4AX1 B;  2YNW A;  3T3N A;  3IOF A;  3T3O A;  5A0V A;  4ZO3 A;  2BG8 B;  3PY6 A;  1BC2 A;  2BFZ B;  3AF5 A;  2P97 A;  5AXO A;  2FHX A;  3LVZ A;  5ACT A;  4P62 A;  5ACQ A;  4B87 A;  5K0W A;  4UWO B;  4Z6X A;  2OHJ A;  3IEK A;  4EY2 A;  3IDZ A;  4DIL A;  5FQB A;  2YNV A;  4TYF A;  3VPE A;  4Z5Z A;  5ACW A;  5AYA A;  2OHI A;  4PVT A;  5FQC A;  4D1W A;  4HL1 A;  3WXC A;  1K07 A;  4UWS B;  3R2U A;  2WRS A;  4KEP A;  5AEB A;  2P18 A;  4AWZ A;  1BVT A;  3FCZ A;  4ZNB A;  1KO3 A;  4RM5 A;  2E7Y A;  5LSC A;  5ACS A;  1WUP A;  3DHA A;  3IE0 A;  3I13 A;  4C1C A;  2FU6 A;  4ZEJ A;  5ACR A;  3ADR A;  3PG4 A;  4RAM A;  3RPC A;  2QDT A;  3ZNB A;  1DD6 A;  4EXY A;  4EYF A;  1VME A;  2GKL A;  3T9M A;  2BFK A;  4FEK A;  5AHO A;  2YCB A;  3BC2 A;  2FK6 A;  1ZTC A;  4RAW A;  4EYL A;  4J5H A;  1BMC A;  2Y8A A;  1JJE A;  2FU7 A;  2GMN A;  2Q0I A;  2BC2 A;  4HKY A;  4HL2 A;  1X8I A;  4RBS A;  5LCF A;  4O98 A;  2WYM A;  4H0D A;  2YNT B;  3KNS A;  4NQ2 A;  3KL7 A;  2Y87 A;  4BZ3 A;  3DHB A;  4TZB A;  3X2X A;  1P9E A;  4CHL A;  3ZQ4 A;  2A7M A;  4NQ5 A;  2I7V A;  5DPX A;  4Z60 A;  3ESH A;  4D02 A;  4JO0 A;  5AHR A;  4AD9 A;  4YSB A;  4AX0 B;  5HH6 A;  4TYT A;  4C1D A;  5LLD A;  4NQ6 A;  2QIN A;  2QDS A;  3I14 A;  2BMI A;  3DH8 A;  1QH3 A;  2M5C A;  2R2D A;  2HB9 A;  2BFZ A;  2BG7 A;  4NQ4 A;  1X8H A;  3JXP A;  2BIB A;  5EHT A;  5ACP A;  2FHX B;  1Y44 A;  2AIO A;  2VW8 A;  5AXR A;  1SML A;  2ZO4 A;  4PVO A;  5A87 A;  3S0Z A;  5FQA A;  5LMC A;  2XR1 A;  5ACU A;  4GYU A;  2XF4 A; 
#chains in the Genus database with same CATH topology
 3X2Z A;  2BG2 A;  4D1U A;  5HIP A;  1HLK A;  1WW1 A;  4TZE A;  4TZ9 A;  4UWP B;  1WUO A;  3IE2 A;  2H6A A;  2GFK A;  4RL2 A;  5EH9 A;  3IEL A;  5HIO A;  2ZZI A;  4EYB A;  1KR3 A;  5EVD A;  4AWY B;  4TZF A;  4UAM A;  3SBL A;  4EXS A;  4F6Z A;  3PY5 A;  4FR7 A;  3QH8 A;  4XWT A;  4Z67 A;  5LE1 A;  4ZO2 A;  3L6N A;  3I11 A;  2UYX A;  2Q9U A;  2AZ4 A;  1ZNB A;  5EVK A;  5IQK A;  3VQZ A;  2Q42 A;  5K4N A;  2QJS A;  3BV6 A;  5LM6 A;  3FAI A;  5K4K A;  3RKJ A;  3I15 A;  2Y8B A;  2ZWR A;  5K4M A;  2OHH A;  2BG8 A;  3SRX A;  4C1F A;  3SW3 A;  3F9O A;  1JT1 A;  2P1E A;  1A8T A;  4AV7 A;  3IE1 A;  2NZE A;  2YNT A;  1XTO A;  1VGN A;  5EVB A;  4D1V A;  4WD6 A;  1DXK A;  4AXH A;  4J5F A;  5A0T A;  5KIK A;  1M2X A;  1YCF A;  1QH5 A;  2BGA A;  2FU8 A;  2BTN A;  5HH4 A;  4UWR B;  3G1P A;  5A5Z A;  5ACX A;  4GYQ A;  2M5D A;  5EW0 A;  2ZNB A;  1JJT A;  3AJ3 A;  4RL0 A;  4BP0 A;  3ZR9 A;  5HIS A;  4Z7R A;  5ACV A;  2CG3 A;  3SFP A;  2P4Z A;  4LE6 A;  4V0H A;  1MQO A;  2CBN A;  5EV6 A;  5EV8 A;  3ZWF A;  2FU9 A;  3IEM A;  4XUK A;  5EWA A;  4U4L A;  3SPU A;  3MD7 A;  4C09 A;  2NYP A;  4GCW A;  5B15 A;  4NUR A;  3TP9 A;  4C1G A;  3X30 A;  2YNV B;  1VJN A;  4FSB A;  1WRA A;  2GCU A;  3P2U A;  1KO2 A;  2GFJ A;  1E5D A;  4F6H A;  4KEQ A;  3Q6V A;  1YCG A;  2DOO A;  4DIK A;  3SD9 A;  4Z5Y A;  2WYL A;  2NXA A;  2QED A;  2FM6 A;  1DDK A;  3AF6 A;  4UA4 A;  2BG6 A;  4UBQ A;  5HH5 A;  3H3E A;  1YCH A;  5B1U A;  1XM8 A;  2BFL A;  3I0V A;  5LCA A;  4EFZ A;  5B3R A;  2I7X A;  4PDX A;  3IOG A;  1ZKP A;  3A4Y A;  2CFZ A;  2DKF A;  3KNR A;  4YSK A;  2BR6 A;  3RKK A;  4C1H A;  3BK1 A;  3BK2 A;  5KIL A;  2Q0J A;  5LS3 A;  3X2Y A;  4D1T A;  2YZ3 A;  5LCH A;  2I7T A;  4C1E A;  5HIQ A;  2WHG A;  2YNU A;  1A7T A;  3DHC A;  1X8G A;  2NZF A;  2CFU A;  4YSL A;  4XWW A;  2WYM C;  1L9Y A;  4AX1 B;  2YNW A;  3T3N A;  3IOF A;  3T3O A;  5A0V A;  4ZO3 A;  2BG8 B;  3PY6 A;  1BC2 A;  2BFZ B;  3AF5 A;  2P97 A;  5AXO A;  2FHX A;  3LVZ A;  5ACT A;  4P62 A;  5ACQ A;  4B87 A;  5K0W A;  4UWO B;  4Z6X A;  2OHJ A;  5A23 A;  3IEK A;  4EY2 A;  3IDZ A;  4DIL A;  5FQB A;  2YNV A;  4TYF A;  3VPE A;  4Z5Z A;  5ACW A;  5AYA A;  2OHI A;  4PVT A;  5FQC A;  4D1W A;  4HL1 A;  3WXC A;  1K07 A;  4UWS B;  3R2U A;  2WRS A;  4KEP A;  5AEB A;  2P18 A;  4AWZ A;  1BVT A;  3FCZ A;  4ZNB A;  1KO3 A;  4RM5 A;  2E7Y A;  5LSC A;  5ACS A;  1WUP A;  3DHA A;  3IE0 A;  3I13 A;  4C1C A;  2FU6 A;  4ZEJ A;  5ACR A;  3ADR A;  3PG4 A;  4RAM A;  3RPC A;  2QDT A;  3ZNB A;  1DD6 A;  4EXY A;  4EYF A;  1VME A;  2GKL A;  3T9M A;  2BFK A;  4FEK A;  5AHO A;  2YCB A;  5AIJ A;  3BC2 A;  2FK6 A;  1ZTC A;  4RAW A;  4EYL A;  4J5H A;  1BMC A;  2Y8A A;  1JJE A;  2FU7 A;  2GMN A;  2Q0I A;  2BC2 A;  4HKY A;  4HL2 A;  1X8I A;  4RBS A;  5LCF A;  4O98 A;  2WYM A;  4H0D A;  2YNT B;  3KNS A;  4NQ2 A;  3KL7 A;  2Y87 A;  4BZ3 A;  3DHB A;  4TZB A;  3X2X A;  1P9E A;  4CHL A;  3ZQ4 A;  2A7M A;  2CG2 A;  4NQ5 A;  2I7V A;  5DPX A;  4Z60 A;  3ESH A;  4D02 A;  4JO0 A;  5AHR A;  4AD9 A;  4YSB A;  4AX0 B;  5HH6 A;  4TYT A;  4C1D A;  5LLD A;  4NQ6 A;  2QIN A;  2QDS A;  3I14 A;  2BMI A;  3DH8 A;  1QH3 A;  2M5C A;  2R2D A;  2HB9 A;  2BFZ A;  2BG7 A;  2YHE A;  4NQ4 A;  5AJL A;  1X8H A;  3JXP A;  2BIB A;  5EHT A;  5ACP A;  2FHX B;  1Y44 A;  2AIO A;  2VW8 A;  5AXR A;  1SML A;  2ZO4 A;  4PVO A;  5A87 A;  3S0Z A;  5FQA A;  5LMC A;  2XR1 A;  5ACU A;  4GYU A;  2XF4 A; 
#chains in the Genus database with same CATH homology
 3X2Z A;  2BG2 A;  4D1U A;  5HIP A;  1HLK A;  1WW1 A;  4TZE A;  4TZ9 A;  4UWP B;  1WUO A;  3IE2 A;  2H6A A;  2GFK A;  4RL2 A;  5EH9 A;  3IEL A;  5HIO A;  2ZZI A;  4EYB A;  1KR3 A;  5EVD A;  4AWY B;  4TZF A;  4UAM A;  3SBL A;  4EXS A;  4F6Z A;  3PY5 A;  4FR7 A;  3QH8 A;  4XWT A;  4Z67 A;  5LE1 A;  4ZO2 A;  3L6N A;  3I11 A;  2UYX A;  2Q9U A;  2AZ4 A;  1ZNB A;  5EVK A;  5IQK A;  3VQZ A;  2Q42 A;  5K4N A;  2QJS A;  3BV6 A;  5LM6 A;  3FAI A;  5K4K A;  3RKJ A;  3I15 A;  2Y8B A;  2ZWR A;  5K4M A;  2OHH A;  2BG8 A;  3SRX A;  4C1F A;  3SW3 A;  3F9O A;  1JT1 A;  2P1E A;  1A8T A;  3IE1 A;  2NZE A;  2YNT A;  1XTO A;  1VGN A;  5EVB A;  4D1V A;  4WD6 A;  1DXK A;  4J5F A;  5A0T A;  5KIK A;  1M2X A;  1YCF A;  1QH5 A;  2BGA A;  2FU8 A;  2BTN A;  5HH4 A;  4UWR B;  3G1P A;  5A5Z A;  5ACX A;  4GYQ A;  2M5D A;  5EW0 A;  2ZNB A;  1JJT A;  3AJ3 A;  4RL0 A;  4BP0 A;  3ZR9 A;  5HIS A;  4Z7R A;  5ACV A;  3SFP A;  2P4Z A;  4LE6 A;  4V0H A;  1MQO A;  2CBN A;  5EV6 A;  5EV8 A;  3ZWF A;  2FU9 A;  3IEM A;  4XUK A;  5EWA A;  4U4L A;  3SPU A;  3MD7 A;  4C09 A;  2NYP A;  4GCW A;  5B15 A;  3TP9 A;  4C1G A;  3X30 A;  2YNV B;  1VJN A;  4FSB A;  1WRA A;  2GCU A;  3P2U A;  1KO2 A;  2GFJ A;  1E5D A;  4F6H A;  4KEQ A;  3Q6V A;  1YCG A;  2DOO A;  4DIK A;  3SD9 A;  4Z5Y A;  2WYL A;  2NXA A;  2QED A;  2FM6 A;  1DDK A;  3AF6 A;  4UA4 A;  2BG6 A;  4UBQ A;  5HH5 A;  3H3E A;  1YCH A;  5B1U A;  1XM8 A;  2BFL A;  3I0V A;  5LCA A;  4EFZ A;  5B3R A;  2I7X A;  3IOG A;  1ZKP A;  3A4Y A;  2DKF A;  3KNR A;  4YSK A;  2BR6 A;  3RKK A;  4C1H A;  3BK1 A;  3BK2 A;  5KIL A;  2Q0J A;  5LS3 A;  3X2Y A;  4D1T A;  2YZ3 A;  5LCH A;  2I7T A;  4C1E A;  5HIQ A;  2WHG A;  2YNU A;  1A7T A;  3DHC A;  1X8G A;  2NZF A;  4YSL A;  4XWW A;  2WYM C;  1L9Y A;  4AX1 B;  2YNW A;  3T3N A;  3IOF A;  3T3O A;  5A0V A;  4ZO3 A;  2BG8 B;  3PY6 A;  1BC2 A;  2BFZ B;  3AF5 A;  2P97 A;  5AXO A;  2FHX A;  3LVZ A;  5ACT A;  4P62 A;  5ACQ A;  4B87 A;  5K0W A;  4UWO B;  4Z6X A;  2OHJ A;  3IEK A;  4EY2 A;  3IDZ A;  4DIL A;  5FQB A;  2YNV A;  4TYF A;  3VPE A;  4Z5Z A;  5ACW A;  5AYA A;  2OHI A;  4PVT A;  5FQC A;  4D1W A;  4HL1 A;  3WXC A;  1K07 A;  4UWS B;  3R2U A;  2WRS A;  4KEP A;  5AEB A;  2P18 A;  4AWZ A;  1BVT A;  3FCZ A;  4ZNB A;  1KO3 A;  4RM5 A;  2E7Y A;  5LSC A;  5ACS A;  1WUP A;  3DHA A;  3IE0 A;  3I13 A;  4C1C A;  2FU6 A;  4ZEJ A;  5ACR A;  3ADR A;  3PG4 A;  4RAM A;  3RPC A;  2QDT A;  3ZNB A;  1DD6 A;  4EXY A;  4EYF A;  1VME A;  2GKL A;  3T9M A;  2BFK A;  4FEK A;  5AHO A;  2YCB A;  3BC2 A;  2FK6 A;  1ZTC A;  4RAW A;  4EYL A;  4J5H A;  1BMC A;  2Y8A A;  1JJE A;  2FU7 A;  2GMN A;  2Q0I A;  2BC2 A;  4HKY A;  4HL2 A;  1X8I A;  4RBS A;  5LCF A;  4O98 A;  2WYM A;  4H0D A;  2YNT B;  3KNS A;  4NQ2 A;  3KL7 A;  2Y87 A;  4BZ3 A;  3DHB A;  4TZB A;  3X2X A;  1P9E A;  4CHL A;  3ZQ4 A;  2A7M A;  4NQ5 A;  2I7V A;  5DPX A;  4Z60 A;  3ESH A;  4D02 A;  4JO0 A;  5AHR A;  4AD9 A;  4YSB A;  4AX0 B;  5HH6 A;  4TYT A;  4C1D A;  5LLD A;  4NQ6 A;  2QIN A;  2QDS A;  3I14 A;  2BMI A;  3DH8 A;  1QH3 A;  2M5C A;  2R2D A;  2HB9 A;  2BFZ A;  2BG7 A;  4NQ4 A;  1X8H A;  3JXP A;  2BIB A;  5EHT A;  5ACP A;  2FHX B;  1Y44 A;  2AIO A;  2VW8 A;  5AXR A;  1SML A;  2ZO4 A;  4PVO A;  5A87 A;  3S0Z A;  5FQA A;  5LMC A;  2XR1 A;  5ACU A;  4GYU A;  2XF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...