4Z67A

The 1.5-angstrom crystal structure of mn(2+)-bound pqqb from pseudomonas putida
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hormone
molecule keywords Coenzyme PQQ synthesis protein B
total genus 108
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z67A00
3X30A 2WYLA 2BG2A 5ACRA 2YNTB 4KEQA 4HL1A 4LE6A 2AZ4A 2GFKA 5EVBA 4RAMA 4ZEJA 5A5ZA 5K4NA 5EW0A 4NQ5A 4DIKA 5A0VA 2FHXA 3I11A 4RL2A 2FM6A 3T3NA 2QJSA 2BFKA 2ZWRA 5EVDA 4EYLA 3RKJA 5LE1A 3ADRA 3S0ZA 1ZTCA 2BGAA 3IELA 2Q0JA 4ZO2A 3FCZA 1X8HA 4UBQA 5ACQA 2NXAA 2Q0IA 3SW3A 2BMIA 5K0WA 3DH8A 2YNVB 1XTOA 4GYUA 2QDTA 2QDSA 1KR3A 5B3RA 5LLDA 2AIOA 3ZR9A 4UWOB 5FQAA 4Z67A 3A4YA 2I7XA 4C1FA 2I7TA 2M5DA 3BC2A 4FSBA 4AD9A 1WUOA 3PG4A 1VMEA 1QH3A 5HISA 3SRXA 2I7VA 3ZNBA 4AWYB 4FR7A 4WD6A 4BP0A 1KO3A 3DHBA 5LSCA 2NZEA 4JO0A 2XR1A 1JT1A 4YSBA 4AWZA 5EV8A 4UWSB 1A8TA 5K4KA 4XWWA 4AX1B 4GCWA 2YNTA 4UAMA 1DDKA 5HIQA 3MD7A 2OHIA 3IEKA 2QEDA 3IOGA 5AXRA 5A87A 1JJTA 3KNSA 3X2ZA 2BTNA 4C09A 4UA4A 5ACSA 2BR6A 3I0VA 2GMNA 5AHOA 4Z5YA 5ACVA 4FEKA 4J5HA 2ZO4A 1WUPA 2P18A 4RL0A 1MQOA 1XM8A 4TZ9A 1KO2A 2BG8B 2Q42A 2FU7A 4H0DA 4HKYA 4Z60A 1WW1A 5HH5A 1YCHA 4EY2A 5HH6A 2VW8A 3ESHA 2OHHA 2ZNBA 1Y44A 2BG6A 2BFZA 5LCAA 1A7TA 5HIOA 2Q9UA 3SPUA 3AF5A 2FU9A 4EXYA 1ZNBA 3DHCA 3F9OA 3IDZA 2BG7A 4EXSA 1HLKA 4D1VA 4TZFA 4XUKA 3LVZA 4NQ2A 4EFZA 4XWTA 5DPXA 1E5DA 5ACUA 2P97A 1VJNA 3IOFA 4D1TA 4RBSA 1M2XA 4PVOA 4NQ4A 3QH8A 4D1UA 4B87A 3L6NA 3DHAA 2M5CA 5B1UA 4RAWA 3TP9A 2HB9A 4NQ6A 4C1DA 2FK6A 2BFZB 2QINA 2BIBA 3PY6A 3WXCA 1DD6A 5IQKA 2GKLA 5LCFA 5HIPA 5EHTA 1YCGA 3KL7A 2BC2A 2YNVA 3ZQ4A 4C1GA 5AEBA 3T9MA 3R2UA 1L9YA 5LS3A 2FU8A 5EWAA 3VPEA 4YSKA 3I14A 3I13A 2GFJA 1X8IA 4J5FA 2WHGA 4KEPA 2YZ3A 5FQCA 4D02A 4V0HA 1YCFA 2DOOA 5B15A 1X8GA 2OHJA 3Q6VA 4TYTA 3IE1A 4YSLA 5KIKA 1QH5A 5LM6A 4TZEA 1VGNA 4TZBA 5AHRA 5KILA 4TYFA 5ACWA 4PVTA 3IE2A 2WYMA 3JXPA 2CBNA 4P62A 2XF4A 2Y8BA 2YNWA 5AXOA 4AX0B 3BK2A 3VQZA 4U4LA 2FU6A 4DILA 4C1HA 3G1PA 3KNRA 4UWRB 5EVKA 1ZKPA 2NZFA 3H3EA 2FHXB 1WRAA 2A7MA 2E7YA 2P1EA 5ACPA 2YNUA 4C1EA 2GCUA 3FAIA 3SFPA 2BFLA 1P9EA 2P4ZA 2ZZIA 4F6HA 5ACTA 4C1CA 1BC2A 3BV6A 3X2YA 4BZ3A 4RM5A 3RPCA 4Z7RA 1K07A 5ACXA 5LCHA 3SBLA 5K4MA 3IE0A 1SMLA 4HL2A 2DKFA 4ZNBA 4ZO3A 3BK1A 4CHLA 3I15A 3PY5A 1BMCA 3AF6A 3T3OA 4Z5ZA 2BG8A 3IEMA 4Z6XA 1JJEA 4UWPB 5LMCA 5HH4A 2H6AA 2Y8AA 3ZWFA 4F6ZA 5FQBA 3SD9A 1DXKA 2NYPA 2R2DA 3X2XA 2YCBA 2WYMC 2WRSA 4GYQA 4D1WA 3AJ3A 4O98A 3P2UA 5EH9A 4EYBA 2Y87A 5A0TA 1BVTA 5AYAA 3RKKA 5EV6A 4EYFA 2UYXA
chains in the Genus database with same CATH superfamily
3X30A 2WYLA 2BG2A 5ACRA 2YNTB 2YHEA 4KEQA 4HL1A 4LE6A 2AZ4A 2GFKA 5EVBA 4RAMA 4ZEJA 5A5ZA 5K4NA 5EW0A 4NQ5A 4DIKA 5A0VA 2FHXA 3I11A 4RL2A 2FM6A 3T3NA 2QJSA 2BFKA 2ZWRA 5EVDA 4EYLA 3RKJA 5LE1A 3ADRA 3S0ZA 1ZTCA 2BGAA 3IELA 4AXHA 2Q0JA 4ZO2A 3FCZA 1X8HA 4UBQA 5ACQA 2NXAA 2Q0IA 3SW3A 2BMIA 3DH8A 5K0WA 2YNVB 1XTOA 4GYUA 2QDTA 2QDSA 1KR3A 5B3RA 5LLDA 2AIOA 3ZR9A 4UWOB 5FQAA 4Z67A 3A4YA 2I7XA 4C1FA 2I7TA 2M5DA 3BC2A 4FSBA 4AD9A 1WUOA 3PG4A 1VMEA 1QH3A 5HISA 3SRXA 2I7VA 3ZNBA 4AWYB 4FR7A 4WD6A 4BP0A 1KO3A 3DHBA 5LSCA 2NZEA 4JO0A 2XR1A 1JT1A 4YSBA 4AWZA 5EV8A 4UWSB 1A8TA 5K4KA 5AIJA 4XWWA 4AX1B 4GCWA 2YNTA 4UAMA 1DDKA 5HIQA 3MD7A 2OHIA 3IEKA 2QEDA 3IOGA 5AXRA 5A87A 1JJTA 3KNSA 3X2ZA 2BTNA 4C09A 4UA4A 5ACSA 2BR6A 3I0VA 2GMNA 5AHOA 4Z5YA 5ACVA 4FEKA 4J5HA 2ZO4A 1WUPA 2P18A 4RL0A 1MQOA 2CFUA 1XM8A 4TZ9A 1KO2A 2BG8B 2CG2A 2Q42A 2FU7A 4H0DA 4HKYA 5AJLA 4Z60A 1WW1A 5HH5A 1YCHA 4EY2A 5HH6A 2VW8A 3ESHA 2OHHA 2ZNBA 1Y44A 2BG6A 2BFZA 5LCAA 1A7TA 5HIOA 2Q9UA 4PDXA 3SPUA 3AF5A 2FU9A 4EXYA 1ZNBA 3DHCA 3F9OA 3IDZA 2BG7A 4EXSA 1HLKA 4D1VA 4TZFA 4XUKA 3LVZA 4NQ2A 4EFZA 4XWTA 5DPXA 1E5DA 5ACUA 2P97A 1VJNA 3IOFA 4D1TA 4RBSA 4AV7A 1M2XA 4PVOA 4NQ4A 3QH8A 4D1UA 4B87A 3L6NA 3DHAA 2M5CA 5B1UA 4RAWA 3TP9A 2HB9A 4NQ6A 4C1DA 2FK6A 2BFZB 2QINA 2BIBA 3PY6A 3WXCA 1DD6A 5LCFA 2GKLA 5IQKA 5HIPA 5EHTA 1YCGA 3KL7A 2BC2A 2YNVA 3ZQ4A 4C1GA 5AEBA 3T9MA 3R2UA 1L9YA 5LS3A 2FU8A 5EWAA 3VPEA 4YSKA 3I14A 3I13A 2GFJA 1X8IA 4J5FA 2WHGA 4KEPA 2CFZA 2YZ3A 5FQCA 4D02A 4V0HA 1YCFA 2DOOA 5B15A 1X8GA 2OHJA 3Q6VA 4TYTA 5A23A 3IE1A 4YSLA 5KIKA 1QH5A 5LM6A 4TZEA 1VGNA 4TZBA 5AHRA 5KILA 4TYFA 5ACWA 4PVTA 3IE2A 2WYMA 4NURA 3JXPA 2CBNA 4P62A 2XF4A 2Y8BA 2YNWA 5AXOA 4AX0B 3BK2A 3VQZA 4U4LA 2FU6A 4DILA 4C1HA 3G1PA 3KNRA 4UWRB 5EVKA 1ZKPA 2NZFA 3H3EA 2FHXB 1WRAA 2A7MA 2E7YA 2P1EA 5ACPA 2YNUA 4C1EA 2GCUA 3FAIA 3SFPA 2BFLA 1P9EA 2P4ZA 2ZZIA 4F6HA 5ACTA 4C1CA 1BC2A 3BV6A 3X2YA 4BZ3A 4RM5A 3RPCA 4Z7RA 1K07A 5ACXA 5LCHA 3SBLA 5K4MA 3IE0A 2CG3A 1SMLA 4HL2A 2DKFA 4ZNBA 4ZO3A 3BK1A 4CHLA 3I15A 3PY5A 1BMCA 3AF6A 3T3OA 4Z5ZA 2BG8A 3IEMA 4Z6XA 1JJEA 4UWPB 5LMCA 5HH4A 2H6AA 2Y8AA 3ZWFA 4F6ZA 5FQBA 3SD9A 1DXKA 2NYPA 2R2DA 3X2XA 2YCBA 2WYMC 2WRSA 4GYQA 4D1WA 3AJ3A 4O98A 3P2UA 5EH9A 4EYBA 2Y87A 5A0TA 1BVTA 5AYAA 3RKKA 5EV6A 4EYFA 2UYXA
chains in the Genus database with same CATH topology
3X30A 2WYLA 2BG2A 5ACRA 2YNTB 4KEQA 4HL1A 4LE6A 2AZ4A 2GFKA 5EVBA 4RAMA 4ZEJA 5A5ZA 5K4NA 5EW0A 4NQ5A 4DIKA 5A0VA 2FHXA 3I11A 4RL2A 2FM6A 3T3NA 2QJSA 2BFKA 2ZWRA 5EVDA 4EYLA 3RKJA 5LE1A 3ADRA 3S0ZA 1ZTCA 2BGAA 3IELA 2Q0JA 4ZO2A 3FCZA 1X8HA 4UBQA 5ACQA 2NXAA 2Q0IA 3SW3A 2BMIA 5K0WA 3DH8A 2YNVB 1XTOA 4GYUA 2QDTA 2QDSA 1KR3A 5B3RA 5LLDA 2AIOA 3ZR9A 4UWOB 5FQAA 4Z67A 3A4YA 2I7XA 4C1FA 2I7TA 2M5DA 3BC2A 4FSBA 4AD9A 1WUOA 3PG4A 1VMEA 1QH3A 5HISA 3SRXA 2I7VA 3ZNBA 4AWYB 4FR7A 4WD6A 4BP0A 1KO3A 3DHBA 5LSCA 2NZEA 4JO0A 2XR1A 1JT1A 4YSBA 4AWZA 5EV8A 4UWSB 1A8TA 5K4KA 4XWWA 4AX1B 4GCWA 2YNTA 4UAMA 1DDKA 5HIQA 3MD7A 2OHIA 3IEKA 2QEDA 3IOGA 5AXRA 5A87A 1JJTA 3KNSA 3X2ZA 2BTNA 4C09A 4UA4A 5ACSA 2BR6A 3I0VA 2GMNA 5AHOA 4Z5YA 5ACVA 4FEKA 4J5HA 2ZO4A 1WUPA 2P18A 4RL0A 1MQOA 1XM8A 4TZ9A 1KO2A 2BG8B 2Q42A 2FU7A 4H0DA 4HKYA 4Z60A 1WW1A 5HH5A 1YCHA 4EY2A 5HH6A 2VW8A 3ESHA 2OHHA 2ZNBA 1Y44A 2BG6A 2BFZA 5LCAA 1A7TA 5HIOA 2Q9UA 3SPUA 3AF5A 2FU9A 4EXYA 1ZNBA 3DHCA 3F9OA 3IDZA 2BG7A 4EXSA 1HLKA 4D1VA 4TZFA 4XUKA 3LVZA 4NQ2A 4EFZA 4XWTA 5DPXA 1E5DA 5ACUA 2P97A 1VJNA 3IOFA 4D1TA 4RBSA 1M2XA 4PVOA 4NQ4A 3QH8A 4D1UA 4B87A 3L6NA 3DHAA 2M5CA 5B1UA 4RAWA 3TP9A 2HB9A 4NQ6A 4C1DA 2FK6A 2BFZB 2QINA 2BIBA 3PY6A 3WXCA 1DD6A 5IQKA 2GKLA 5LCFA 5HIPA 5EHTA 1YCGA 3KL7A 2BC2A 2YNVA 3ZQ4A 4C1GA 5AEBA 3T9MA 3R2UA 1L9YA 5LS3A 2FU8A 5EWAA 3VPEA 4YSKA 3I14A 3I13A 2GFJA 1X8IA 4J5FA 2WHGA 4KEPA 2YZ3A 5FQCA 4D02A 4V0HA 1YCFA 2DOOA 5B15A 1X8GA 2OHJA 3Q6VA 4TYTA 3IE1A 4YSLA 5KIKA 1QH5A 5LM6A 4TZEA 1VGNA 4TZBA 5AHRA 5KILA 4TYFA 5ACWA 4PVTA 3IE2A 2WYMA 3JXPA 2CBNA 4P62A 2XF4A 2Y8BA 2YNWA 5AXOA 4AX0B 3BK2A 3VQZA 4U4LA 2FU6A 4DILA 4C1HA 3G1PA 3KNRA 4UWRB 5EVKA 1ZKPA 2NZFA 3H3EA 2FHXB 1WRAA 2A7MA 2E7YA 2P1EA 5ACPA 2YNUA 4C1EA 2GCUA 3FAIA 3SFPA 2BFLA 1P9EA 2P4ZA 2ZZIA 4F6HA 5ACTA 4C1CA 1BC2A 3BV6A 3X2YA 4BZ3A 4RM5A 3RPCA 4Z7RA 1K07A 5ACXA 5LCHA 3SBLA 5K4MA 3IE0A 1SMLA 4HL2A 2DKFA 4ZNBA 4ZO3A 3BK1A 4CHLA 3I15A 3PY5A 1BMCA 3AF6A 3T3OA 4Z5ZA 2BG8A 3IEMA 4Z6XA 1JJEA 4UWPB 5LMCA 5HH4A 2H6AA 2Y8AA 3ZWFA 4F6ZA 5FQBA 3SD9A 1DXKA 2NYPA 2R2DA 3X2XA 2YCBA 2WYMC 2WRSA 4GYQA 4D1WA 3AJ3A 4O98A 3P2UA 5EH9A 4EYBA 2Y87A 5A0TA 1BVTA 5AYAA 3RKKA 5EV6A 4EYFA 2UYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X30 A;  2WYL A;  2BG2 A;  5ACR A;  2YNT B;  4KEQ A;  4HL1 A;  4LE6 A;  2AZ4 A;  2GFK A;  5EVB A;  4RAM A;  4ZEJ A;  5A5Z A;  5K4N A;  5EW0 A;  4NQ5 A;  4DIK A;  5A0V A;  2FHX A;  3I11 A;  4RL2 A;  2FM6 A;  3T3N A;  2QJS A;  2BFK A;  2ZWR A;  5EVD A;  4EYL A;  3RKJ A;  5LE1 A;  3ADR A;  3S0Z A;  1ZTC A;  2BGA A;  3IEL A;  2Q0J A;  4ZO2 A;  3FCZ A;  1X8H A;  4UBQ A;  5ACQ A;  2NXA A;  2Q0I A;  3SW3 A;  2BMI A;  5K0W A;  3DH8 A;  2YNV B;  1XTO A;  4GYU A;  2QDT A;  2QDS A;  1KR3 A;  5B3R A;  5LLD A;  2AIO A;  3ZR9 A;  4UWO B;  5FQA A;  4Z67 A;  3A4Y A;  2I7X A;  4C1F A;  2I7T A;  2M5D A;  3BC2 A;  4FSB A;  4AD9 A;  1WUO A;  3PG4 A;  1VME A;  1QH3 A;  5HIS A;  3SRX A;  2I7V A;  3ZNB A;  4AWY B;  4FR7 A;  4WD6 A;  4BP0 A;  1KO3 A;  3DHB A;  5LSC A;  2NZE A;  4JO0 A;  2XR1 A;  1JT1 A;  4YSB A;  4AWZ A;  5EV8 A;  4UWS B;  1A8T A;  5K4K A;  4XWW A;  4AX1 B;  4GCW A;  2YNT A;  4UAM A;  1DDK A;  5HIQ A;  3MD7 A;  2OHI A;  3IEK A;  2QED A;  3IOG A;  5AXR A;  5A87 A;  1JJT A;  3KNS A;  3X2Z A;  2BTN A;  4C09 A;  4UA4 A;  5ACS A;  2BR6 A;  3I0V A;  2GMN A;  5AHO A;  4Z5Y A;  5ACV A;  4FEK A;  4J5H A;  2ZO4 A;  1WUP A;  2P18 A;  4RL0 A;  1MQO A;  1XM8 A;  4TZ9 A;  1KO2 A;  2BG8 B;  2Q42 A;  2FU7 A;  4H0D A;  4HKY A;  4Z60 A;  1WW1 A;  5HH5 A;  1YCH A;  4EY2 A;  5HH6 A;  2VW8 A;  3ESH A;  2OHH A;  2ZNB A;  1Y44 A;  2BG6 A;  2BFZ A;  5LCA A;  1A7T A;  5HIO A;  2Q9U A;  3SPU A;  3AF5 A;  2FU9 A;  4EXY A;  1ZNB A;  3DHC A;  3F9O A;  3IDZ A;  2BG7 A;  4EXS A;  1HLK A;  4D1V A;  4TZF A;  4XUK A;  3LVZ A;  4NQ2 A;  4EFZ A;  4XWT A;  5DPX A;  1E5D A;  5ACU A;  2P97 A;  1VJN A;  3IOF A;  4D1T A;  4RBS A;  1M2X A;  4PVO A;  4NQ4 A;  3QH8 A;  4D1U A;  4B87 A;  3L6N A;  3DHA A;  2M5C A;  5B1U A;  4RAW A;  3TP9 A;  2HB9 A;  4NQ6 A;  4C1D A;  2FK6 A;  2BFZ B;  2QIN A;  2BIB A;  3PY6 A;  3WXC A;  1DD6 A;  5IQK A;  2GKL A;  5LCF A;  5HIP A;  5EHT A;  1YCG A;  3KL7 A;  2BC2 A;  2YNV A;  3ZQ4 A;  4C1G A;  5AEB A;  3T9M A;  3R2U A;  1L9Y A;  5LS3 A;  2FU8 A;  5EWA A;  3VPE A;  4YSK A;  3I14 A;  3I13 A;  2GFJ A;  1X8I A;  4J5F A;  2WHG A;  4KEP A;  2YZ3 A;  5FQC A;  4D02 A;  4V0H A;  1YCF A;  2DOO A;  5B15 A;  1X8G A;  2OHJ A;  3Q6V A;  4TYT A;  3IE1 A;  4YSL A;  5KIK A;  1QH5 A;  5LM6 A;  4TZE A;  1VGN A;  4TZB A;  5AHR A;  5KIL A;  4TYF A;  5ACW A;  4PVT A;  3IE2 A;  2WYM A;  3JXP A;  2CBN A;  4P62 A;  2XF4 A;  2Y8B A;  2YNW A;  5AXO A;  4AX0 B;  3BK2 A;  3VQZ A;  4U4L A;  2FU6 A;  4DIL A;  4C1H A;  3G1P A;  3KNR A;  4UWR B;  5EVK A;  1ZKP A;  2NZF A;  3H3E A;  2FHX B;  1WRA A;  2A7M A;  2E7Y A;  2P1E A;  5ACP A;  2YNU A;  4C1E A;  2GCU A;  3FAI A;  3SFP A;  2BFL A;  1P9E A;  2P4Z A;  2ZZI A;  4F6H A;  5ACT A;  4C1C A;  1BC2 A;  3BV6 A;  3X2Y A;  4BZ3 A;  4RM5 A;  3RPC A;  4Z7R A;  1K07 A;  5ACX A;  5LCH A;  3SBL A;  5K4M A;  3IE0 A;  1SML A;  4HL2 A;  2DKF A;  4ZNB A;  4ZO3 A;  3BK1 A;  4CHL A;  3I15 A;  3PY5 A;  1BMC A;  3AF6 A;  3T3O A;  4Z5Z A;  2BG8 A;  3IEM A;  4Z6X A;  1JJE A;  4UWP B;  5LMC A;  5HH4 A;  2H6A A;  2Y8A A;  3ZWF A;  4F6Z A;  5FQB A;  3SD9 A;  1DXK A;  2NYP A;  2R2D A;  3X2X A;  2YCB A;  2WYM C;  2WRS A;  4GYQ A;  4D1W A;  3AJ3 A;  4O98 A;  3P2U A;  5EH9 A;  4EYB A;  2Y87 A;  5A0T A;  1BVT A;  5AYA A;  3RKK A;  5EV6 A;  4EYF A;  2UYX A; 
#chains in the Genus database with same CATH topology
 3X30 A;  2WYL A;  2BG2 A;  5ACR A;  2YNT B;  2YHE A;  4KEQ A;  4HL1 A;  4LE6 A;  2AZ4 A;  2GFK A;  5EVB A;  4RAM A;  4ZEJ A;  5A5Z A;  5K4N A;  5EW0 A;  4NQ5 A;  4DIK A;  5A0V A;  2FHX A;  3I11 A;  4RL2 A;  2FM6 A;  3T3N A;  2QJS A;  2BFK A;  2ZWR A;  5EVD A;  4EYL A;  3RKJ A;  5LE1 A;  3ADR A;  3S0Z A;  1ZTC A;  2BGA A;  3IEL A;  4AXH A;  2Q0J A;  4ZO2 A;  3FCZ A;  1X8H A;  4UBQ A;  5ACQ A;  2NXA A;  2Q0I A;  3SW3 A;  2BMI A;  3DH8 A;  5K0W A;  2YNV B;  1XTO A;  4GYU A;  2QDT A;  2QDS A;  1KR3 A;  5B3R A;  5LLD A;  2AIO A;  3ZR9 A;  4UWO B;  5FQA A;  4Z67 A;  3A4Y A;  2I7X A;  4C1F A;  2I7T A;  2M5D A;  3BC2 A;  4FSB A;  4AD9 A;  1WUO A;  3PG4 A;  1VME A;  1QH3 A;  5HIS A;  3SRX A;  2I7V A;  3ZNB A;  4AWY B;  4FR7 A;  4WD6 A;  4BP0 A;  1KO3 A;  3DHB A;  5LSC A;  2NZE A;  4JO0 A;  2XR1 A;  1JT1 A;  4YSB A;  4AWZ A;  5EV8 A;  4UWS B;  1A8T A;  5K4K A;  5AIJ A;  4XWW A;  4AX1 B;  4GCW A;  2YNT A;  4UAM A;  1DDK A;  5HIQ A;  3MD7 A;  2OHI A;  3IEK A;  2QED A;  3IOG A;  5AXR A;  5A87 A;  1JJT A;  3KNS A;  3X2Z A;  2BTN A;  4C09 A;  4UA4 A;  5ACS A;  2BR6 A;  3I0V A;  2GMN A;  5AHO A;  4Z5Y A;  5ACV A;  4FEK A;  4J5H A;  2ZO4 A;  1WUP A;  2P18 A;  4RL0 A;  1MQO A;  2CFU A;  1XM8 A;  4TZ9 A;  1KO2 A;  2BG8 B;  2CG2 A;  2Q42 A;  2FU7 A;  4H0D A;  4HKY A;  5AJL A;  4Z60 A;  1WW1 A;  5HH5 A;  1YCH A;  4EY2 A;  5HH6 A;  2VW8 A;  3ESH A;  2OHH A;  2ZNB A;  1Y44 A;  2BG6 A;  2BFZ A;  5LCA A;  1A7T A;  5HIO A;  2Q9U A;  4PDX A;  3SPU A;  3AF5 A;  2FU9 A;  4EXY A;  1ZNB A;  3DHC A;  3F9O A;  3IDZ A;  2BG7 A;  4EXS A;  1HLK A;  4D1V A;  4TZF A;  4XUK A;  3LVZ A;  4NQ2 A;  4EFZ A;  4XWT A;  5DPX A;  1E5D A;  5ACU A;  2P97 A;  1VJN A;  3IOF A;  4D1T A;  4RBS A;  4AV7 A;  1M2X A;  4PVO A;  4NQ4 A;  3QH8 A;  4D1U A;  4B87 A;  3L6N A;  3DHA A;  2M5C A;  5B1U A;  4RAW A;  3TP9 A;  2HB9 A;  4NQ6 A;  4C1D A;  2FK6 A;  2BFZ B;  2QIN A;  2BIB A;  3PY6 A;  3WXC A;  1DD6 A;  5LCF A;  2GKL A;  5IQK A;  5HIP A;  5EHT A;  1YCG A;  3KL7 A;  2BC2 A;  2YNV A;  3ZQ4 A;  4C1G A;  5AEB A;  3T9M A;  3R2U A;  1L9Y A;  5LS3 A;  2FU8 A;  5EWA A;  3VPE A;  4YSK A;  3I14 A;  3I13 A;  2GFJ A;  1X8I A;  4J5F A;  2WHG A;  4KEP A;  2CFZ A;  2YZ3 A;  5FQC A;  4D02 A;  4V0H A;  1YCF A;  2DOO A;  5B15 A;  1X8G A;  2OHJ A;  3Q6V A;  4TYT A;  5A23 A;  3IE1 A;  4YSL A;  5KIK A;  1QH5 A;  5LM6 A;  4TZE A;  1VGN A;  4TZB A;  5AHR A;  5KIL A;  4TYF A;  5ACW A;  4PVT A;  3IE2 A;  2WYM A;  4NUR A;  3JXP A;  2CBN A;  4P62 A;  2XF4 A;  2Y8B A;  2YNW A;  5AXO A;  4AX0 B;  3BK2 A;  3VQZ A;  4U4L A;  2FU6 A;  4DIL A;  4C1H A;  3G1P A;  3KNR A;  4UWR B;  5EVK A;  1ZKP A;  2NZF A;  3H3E A;  2FHX B;  1WRA A;  2A7M A;  2E7Y A;  2P1E A;  5ACP A;  2YNU A;  4C1E A;  2GCU A;  3FAI A;  3SFP A;  2BFL A;  1P9E A;  2P4Z A;  2ZZI A;  4F6H A;  5ACT A;  4C1C A;  1BC2 A;  3BV6 A;  3X2Y A;  4BZ3 A;  4RM5 A;  3RPC A;  4Z7R A;  1K07 A;  5ACX A;  5LCH A;  3SBL A;  5K4M A;  3IE0 A;  2CG3 A;  1SML A;  4HL2 A;  2DKF A;  4ZNB A;  4ZO3 A;  3BK1 A;  4CHL A;  3I15 A;  3PY5 A;  1BMC A;  3AF6 A;  3T3O A;  4Z5Z A;  2BG8 A;  3IEM A;  4Z6X A;  1JJE A;  4UWP B;  5LMC A;  5HH4 A;  2H6A A;  2Y8A A;  3ZWF A;  4F6Z A;  5FQB A;  3SD9 A;  1DXK A;  2NYP A;  2R2D A;  3X2X A;  2YCB A;  2WYM C;  2WRS A;  4GYQ A;  4D1W A;  3AJ3 A;  4O98 A;  3P2U A;  5EH9 A;  4EYB A;  2Y87 A;  5A0T A;  1BVT A;  5AYA A;  3RKK A;  5EV6 A;  4EYF A;  2UYX A; 
#chains in the Genus database with same CATH homology
 3X30 A;  2WYL A;  2BG2 A;  5ACR A;  2YNT B;  4KEQ A;  4HL1 A;  4LE6 A;  2AZ4 A;  2GFK A;  5EVB A;  4RAM A;  4ZEJ A;  5A5Z A;  5K4N A;  5EW0 A;  4NQ5 A;  4DIK A;  5A0V A;  2FHX A;  3I11 A;  4RL2 A;  2FM6 A;  3T3N A;  2QJS A;  2BFK A;  2ZWR A;  5EVD A;  4EYL A;  3RKJ A;  5LE1 A;  3ADR A;  3S0Z A;  1ZTC A;  2BGA A;  3IEL A;  2Q0J A;  4ZO2 A;  3FCZ A;  1X8H A;  4UBQ A;  5ACQ A;  2NXA A;  2Q0I A;  3SW3 A;  2BMI A;  5K0W A;  3DH8 A;  2YNV B;  1XTO A;  4GYU A;  2QDT A;  2QDS A;  1KR3 A;  5B3R A;  5LLD A;  2AIO A;  3ZR9 A;  4UWO B;  5FQA A;  4Z67 A;  3A4Y A;  2I7X A;  4C1F A;  2I7T A;  2M5D A;  3BC2 A;  4FSB A;  4AD9 A;  1WUO A;  3PG4 A;  1VME A;  1QH3 A;  5HIS A;  3SRX A;  2I7V A;  3ZNB A;  4AWY B;  4FR7 A;  4WD6 A;  4BP0 A;  1KO3 A;  3DHB A;  5LSC A;  2NZE A;  4JO0 A;  2XR1 A;  1JT1 A;  4YSB A;  4AWZ A;  5EV8 A;  4UWS B;  1A8T A;  5K4K A;  4XWW A;  4AX1 B;  4GCW A;  2YNT A;  4UAM A;  1DDK A;  5HIQ A;  3MD7 A;  2OHI A;  3IEK A;  2QED A;  3IOG A;  5AXR A;  5A87 A;  1JJT A;  3KNS A;  3X2Z A;  2BTN A;  4C09 A;  4UA4 A;  5ACS A;  2BR6 A;  3I0V A;  2GMN A;  5AHO A;  4Z5Y A;  5ACV A;  4FEK A;  4J5H A;  2ZO4 A;  1WUP A;  2P18 A;  4RL0 A;  1MQO A;  1XM8 A;  4TZ9 A;  1KO2 A;  2BG8 B;  2Q42 A;  2FU7 A;  4H0D A;  4HKY A;  4Z60 A;  1WW1 A;  5HH5 A;  1YCH A;  4EY2 A;  5HH6 A;  2VW8 A;  3ESH A;  2OHH A;  2ZNB A;  1Y44 A;  2BG6 A;  2BFZ A;  5LCA A;  1A7T A;  5HIO A;  2Q9U A;  3SPU A;  3AF5 A;  2FU9 A;  4EXY A;  1ZNB A;  3DHC A;  3F9O A;  3IDZ A;  2BG7 A;  4EXS A;  1HLK A;  4D1V A;  4TZF A;  4XUK A;  3LVZ A;  4NQ2 A;  4EFZ A;  4XWT A;  5DPX A;  1E5D A;  5ACU A;  2P97 A;  1VJN A;  3IOF A;  4D1T A;  4RBS A;  1M2X A;  4PVO A;  4NQ4 A;  3QH8 A;  4D1U A;  4B87 A;  3L6N A;  3DHA A;  2M5C A;  5B1U A;  4RAW A;  3TP9 A;  2HB9 A;  4NQ6 A;  4C1D A;  2FK6 A;  2BFZ B;  2QIN A;  2BIB A;  3PY6 A;  3WXC A;  1DD6 A;  5IQK A;  2GKL A;  5LCF A;  5HIP A;  5EHT A;  1YCG A;  3KL7 A;  2BC2 A;  2YNV A;  3ZQ4 A;  4C1G A;  5AEB A;  3T9M A;  3R2U A;  1L9Y A;  5LS3 A;  2FU8 A;  5EWA A;  3VPE A;  4YSK A;  3I14 A;  3I13 A;  2GFJ A;  1X8I A;  4J5F A;  2WHG A;  4KEP A;  2YZ3 A;  5FQC A;  4D02 A;  4V0H A;  1YCF A;  2DOO A;  5B15 A;  1X8G A;  2OHJ A;  3Q6V A;  4TYT A;  3IE1 A;  4YSL A;  5KIK A;  1QH5 A;  5LM6 A;  4TZE A;  1VGN A;  4TZB A;  5AHR A;  5KIL A;  4TYF A;  5ACW A;  4PVT A;  3IE2 A;  2WYM A;  3JXP A;  2CBN A;  4P62 A;  2XF4 A;  2Y8B A;  2YNW A;  5AXO A;  4AX0 B;  3BK2 A;  3VQZ A;  4U4L A;  2FU6 A;  4DIL A;  4C1H A;  3G1P A;  3KNR A;  4UWR B;  5EVK A;  1ZKP A;  2NZF A;  3H3E A;  2FHX B;  1WRA A;  2A7M A;  2E7Y A;  2P1E A;  5ACP A;  2YNU A;  4C1E A;  2GCU A;  3FAI A;  3SFP A;  2BFL A;  1P9E A;  2P4Z A;  2ZZI A;  4F6H A;  5ACT A;  4C1C A;  1BC2 A;  3BV6 A;  3X2Y A;  4BZ3 A;  4RM5 A;  3RPC A;  4Z7R A;  1K07 A;  5ACX A;  5LCH A;  3SBL A;  5K4M A;  3IE0 A;  1SML A;  4HL2 A;  2DKF A;  4ZNB A;  4ZO3 A;  3BK1 A;  4CHL A;  3I15 A;  3PY5 A;  1BMC A;  3AF6 A;  3T3O A;  4Z5Z A;  2BG8 A;  3IEM A;  4Z6X A;  1JJE A;  4UWP B;  5LMC A;  5HH4 A;  2H6A A;  2Y8A A;  3ZWF A;  4F6Z A;  5FQB A;  3SD9 A;  1DXK A;  2NYP A;  2R2D A;  3X2X A;  2YCB A;  2WYM C;  2WRS A;  4GYQ A;  4D1W A;  3AJ3 A;  4O98 A;  3P2U A;  5EH9 A;  4EYB A;  2Y87 A;  5A0T A;  1BVT A;  5AYA A;  3RKK A;  5EV6 A;  4EYF A;  2UYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...