4Z67A

The 1.5-angstrom crystal structure of mn(2+)-bound pqqb from pseudomonas putida
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hormone
total genus 108
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z67A00
4AX1B 3DHBA 2E7YA 4DIKA 5EWAA 2I7VA 2BIBA 1ZKPA 1WUPA 1YCHA 1X8GA 4PVTA 4C1HA 2AIOA 1KR3A 4RL2A 2BFZA 3IE0A 1ZTCA 5B3RA 2Q0JA 2M5DA 5ACTA 2VW8A 2YNVA 3X2XA 3F9OA 3QH8A 4YSKA 3MD7A 2ZWRA 4UWRB 4RAMA 4CHLA 5A0TA 4JO0A 2QDSA 2FM6A 5HH4A 5HISA 2WHGA 2P18A 2ZNBA 3BK2A 2Q9UA 4XUKA 4TYFA 2BR6A 3FCZA 2BTNA 4AWZA 4EXSA 4ZO3A 5EV8A 1JJEA 1DXKA 4YSBA 2H6AA 2GFKA 2P1EA 2YNTA 4XWWA 3LVZA 4NQ6A 3T3NA 2BGAA 4UWOB 4WD6A 2BG8A 4AD9A 1QH5A 5HIQA 2WRSA 1QH3A 5ACRA 4AX0B 5AXOA 3H3EA 3X30A 4C1CA 5HIPA 5K4NA 5LM6A 3DHAA 4C1DA 4B87A 5K0WA 3IELA 3DH8A 3RPCA 4KEPA 1VJNA 2ZZIA 3BC2A 4U4LA 4C1EA 5AEBA 5LCFA 3VPEA 4HL2A 2BG2A 2WYLA 1KO3A 3PY6A 4D1UA 3VQZA 4KEQA 2NZFA 4NQ5A 4Z6XA 2I7XA 2OHIA 4P62A 4C09A 1BVTA 2YNUA 3BV6A 4UAMA 5ACWA 4GCWA 3I15A 3IOGA 3I13A 1E5DA 4BZ3A 2A7MA 3DHCA 2FU7A 4D02A 5AXRA 2BG7A 5EW0A 4Z5YA 3TP9A 4ZO2A 3L6NA 5ACPA 1MQOA 4D1WA 2DOOA 2FHXB 1L9YA 4UWSB 5EVBA 3T9MA 4TZFA 2GFJA 3FAIA 3IEMA 4EYLA 2YZ3A 4XWTA 2Q0IA 4H0DA 2BFZB 5LCHA 5A0VA 2P97A 2FU8A 5AHOA 4RM5A 2BMIA 2QJSA 5DPXA 2YNVB 1X8IA 2YNWA 2XR1A 4Z7RA 1HLKA 2CBNA 2Y8AA 4EYFA 5K4MA 4Z60A 2BC2A 3AF5A 2GCUA 3RKKA 4C1GA 2UYXA 2BFLA 4FEKA 1VMEA 2DKFA 5LSCA 1Y44A 3KL7A 2HB9A 4ZEJA 4TZBA 2OHHA 4O98A 3PG4A 5K4KA 5ACSA 4V0HA 1DDKA 4TZEA 3JXPA 5LE1A 1ZNBA 3IOFA 5ACUA 4J5HA 4UBQA 4D1VA 4UWPB 4Z67A 2P4ZA 2YNTB 3X2YA 5FQCA 3IE1A 2QINA 1YCGA 2BG8B 4EY2A 4HKYA 1A7TA 4BP0A 3AF6A 3T3OA 2XF4A 5EVKA 2GKLA 2AZ4A 3IE2A 3SPUA 4YSLA 3Q6VA 5AYAA 3R2UA 1M2XA 1X8HA 2QEDA 4J5FA 2Y87A 4RAWA 3SW3A 3G1PA 3I0VA 2FK6A 3SBLA 4EYBA 1P9EA 1WUOA 2OHJA 3ZWFA 4PVOA 4F6HA 4ZNBA 4TYTA 2QDTA 5LCAA 4C1FA 3ADRA 3WXCA 1VGNA 4Z5ZA 4RL0A 4RBSA 5HIOA 4UA4A 4AWYB 5EHTA 5LMCA 3A4YA 3ZQ4A 2FU6A 2NYPA 1BMCA 2I7TA 2GMNA 1WW1A 2WYMC 2NZEA 3RKJA 5KILA 1JT1A 1A8TA 1YCFA 4DILA 3SFPA 1K07A 3IDZA 3SRXA 3ZR9A 5AHRA 2NXAA 5A5ZA 1XM8A 3BK1A 2ZO4A 3AJ3A 5FQBA 5EVDA 2Q42A 3KNRA 4EFZA 5A87A 1JJTA 1DD6A 3PY5A 5KIKA 2BG6A 4EXYA 3KNSA 3X2ZA 4F6ZA 5IQKA 5ACVA 3ZNBA 3SD9A 4FSBA 5B1UA 4FR7A 4LE6A 4GYUA 5EV6A 1SMLA 5B15A 3S0ZA 2R2DA 4NQ2A 3I11A 2BFKA 1BC2A 4TZ9A 5LS3A 3ESHA 4D1TA 3P2UA 2WYMA 1XTOA 5ACXA 5HH6A 2Y8BA 4HL1A 2YCBA 3I14A 5LLDA 1KO2A 5EH9A 5HH5A 2FU9A 2M5CA 4NQ4A 5FQAA 1WRAA 3IEKA 5ACQA 4GYQA 2FHXA
chains in the Genus database with same CATH superfamily
4AX1B 3DHBA 2E7YA 4DIKA 5EWAA 2I7VA 2BIBA 4NURA 1ZKPA 1WUPA 1YCHA 1X8GA 4PVTA 4C1HA 2AIOA 1KR3A 4RL2A 2BFZA 3IE0A 1ZTCA 5B3RA 2Q0JA 2M5DA 5ACTA 2VW8A 4PDXA 2YNVA 3X2XA 3F9OA 3QH8A 4YSKA 3MD7A 2ZWRA 4UWRB 4RAMA 4CHLA 5A0TA 4JO0A 2QDSA 2FM6A 5HH4A 5HISA 2WHGA 2P18A 2ZNBA 3BK2A 2Q9UA 4XUKA 4TYFA 2BR6A 3FCZA 2BTNA 4AWZA 4EXSA 4ZO3A 5EV8A 1JJEA 1DXKA 4YSBA 2H6AA 2GFKA 2P1EA 2YNTA 4XWWA 3LVZA 4NQ6A 3T3NA 2BGAA 4UWOB 4WD6A 2BG8A 4AD9A 1QH5A 5HIQA 2WRSA 1QH3A 5ACRA 4AX0B 5AXOA 3H3EA 3X30A 4C1CA 5HIPA 5K4NA 5LM6A 3DHAA 4C1DA 4B87A 5K0WA 3IELA 3DH8A 3RPCA 4KEPA 1VJNA 2ZZIA 3BC2A 4U4LA 4C1EA 5AEBA 5LCFA 3VPEA 4HL2A 2BG2A 2WYLA 1KO3A 3PY6A 4D1UA 3VQZA 4KEQA 2NZFA 4NQ5A 4Z6XA 2I7XA 2OHIA 4P62A 4C09A 1BVTA 2CG3A 2YNUA 3BV6A 4UAMA 5ACWA 4GCWA 3I15A 3IOGA 3I13A 1E5DA 4BZ3A 2A7MA 3DHCA 2FU7A 4D02A 5AXRA 2BG7A 5EW0A 4Z5YA 3TP9A 4ZO2A 3L6NA 5ACPA 1MQOA 4D1WA 2DOOA 2FHXB 1L9YA 4UWSB 5EVBA 3T9MA 4TZFA 2GFJA 2CFUA 3FAIA 3IEMA 4EYLA 2YZ3A 4XWTA 2Q0IA 2CG2A 4H0DA 2BFZB 5LCHA 5A0VA 2P97A 2FU8A 5AHOA 4RM5A 2BMIA 2QJSA 5DPXA 2YNVB 1X8IA 2YNWA 2XR1A 4Z7RA 1HLKA 2CBNA 2Y8AA 4EYFA 5K4MA 4Z60A 2BC2A 3AF5A 2GCUA 3RKKA 4C1GA 2UYXA 2BFLA 4FEKA 1VMEA 2DKFA 5LSCA 1Y44A 3KL7A 2HB9A 4ZEJA 4TZBA 2OHHA 4O98A 2CFZA 3PG4A 5K4KA 5ACSA 4V0HA 1DDKA 5AJLA 4TZEA 3JXPA 5LE1A 1ZNBA 3IOFA 5ACUA 4J5HA 4UBQA 4D1VA 4UWPB 4Z67A 2P4ZA 2YNTB 3X2YA 5FQCA 3IE1A 2QINA 1YCGA 2BG8B 4EY2A 4HKYA 1A7TA 4AXHA 4BP0A 3AF6A 3T3OA 2XF4A 5EVKA 2GKLA 2AZ4A 3IE2A 3SPUA 4YSLA 3Q6VA 5AYAA 3R2UA 1M2XA 1X8HA 2QEDA 5AIJA 4J5FA 2Y87A 4RAWA 3SW3A 3G1PA 3I0VA 2FK6A 3SBLA 4EYBA 1P9EA 1WUOA 2OHJA 3ZWFA 4PVOA 4F6HA 4ZNBA 4TYTA 2QDTA 5LCAA 4C1FA 3ADRA 3WXCA 1VGNA 4Z5ZA 4RL0A 4RBSA 5HIOA 4UA4A 4AWYB 5EHTA 5LMCA 3A4YA 3ZQ4A 2FU6A 2NYPA 1BMCA 2I7TA 2GMNA 1WW1A 2WYMC 2YHEA 2NZEA 3RKJA 5KILA 1JT1A 4AV7A 1A8TA 1YCFA 4DILA 3SFPA 1K07A 3IDZA 5A23A 3SRXA 3ZR9A 5AHRA 2NXAA 5A5ZA 1XM8A 3BK1A 2ZO4A 3AJ3A 5FQBA 5EVDA 2Q42A 3KNRA 4EFZA 5A87A 1JJTA 1DD6A 3PY5A 5KIKA 2BG6A 4EXYA 3KNSA 3X2ZA 4F6ZA 5IQKA 5ACVA 3ZNBA 3SD9A 4FSBA 5B1UA 4FR7A 4LE6A 4GYUA 5EV6A 1SMLA 5B15A 3S0ZA 2R2DA 4NQ2A 3I11A 2BFKA 1BC2A 4TZ9A 5LS3A 3ESHA 4D1TA 3P2UA 2WYMA 1XTOA 5ACXA 5HH6A 2Y8BA 4HL1A 2YCBA 3I14A 5LLDA 1KO2A 5EH9A 5HH5A 2FU9A 2M5CA 4NQ4A 5FQAA 1WRAA 3IEKA 5ACQA 4GYQA 2FHXA
chains in the Genus database with same CATH topology
4AX1B 3DHBA 2E7YA 4DIKA 5EWAA 2I7VA 2BIBA 1ZKPA 1WUPA 1YCHA 1X8GA 4PVTA 4C1HA 2AIOA 1KR3A 4RL2A 2BFZA 3IE0A 1ZTCA 5B3RA 2Q0JA 2M5DA 5ACTA 2VW8A 2YNVA 3X2XA 3F9OA 3QH8A 4YSKA 3MD7A 2ZWRA 4UWRB 4RAMA 4CHLA 5A0TA 4JO0A 2QDSA 2FM6A 5HH4A 5HISA 2WHGA 2P18A 2ZNBA 3BK2A 2Q9UA 4XUKA 4TYFA 2BR6A 3FCZA 2BTNA 4AWZA 4EXSA 4ZO3A 5EV8A 1JJEA 1DXKA 4YSBA 2H6AA 2GFKA 2P1EA 2YNTA 4XWWA 3LVZA 4NQ6A 3T3NA 2BGAA 4UWOB 4WD6A 2BG8A 4AD9A 1QH5A 5HIQA 2WRSA 1QH3A 5ACRA 4AX0B 5AXOA 3H3EA 3X30A 4C1CA 5HIPA 5K4NA 5LM6A 3DHAA 4C1DA 4B87A 5K0WA 3IELA 3DH8A 3RPCA 4KEPA 1VJNA 2ZZIA 3BC2A 4U4LA 4C1EA 5AEBA 5LCFA 3VPEA 4HL2A 2BG2A 2WYLA 1KO3A 3PY6A 4D1UA 3VQZA 4KEQA 2NZFA 4NQ5A 4Z6XA 2I7XA 2OHIA 4P62A 4C09A 1BVTA 2YNUA 3BV6A 4UAMA 5ACWA 4GCWA 3I15A 3IOGA 3I13A 1E5DA 4BZ3A 2A7MA 3DHCA 2FU7A 4D02A 5AXRA 2BG7A 5EW0A 4Z5YA 3TP9A 4ZO2A 3L6NA 5ACPA 1MQOA 4D1WA 2DOOA 2FHXB 1L9YA 4UWSB 5EVBA 3T9MA 4TZFA 2GFJA 3FAIA 3IEMA 4EYLA 2YZ3A 4XWTA 2Q0IA 4H0DA 2BFZB 5LCHA 5A0VA 2P97A 2FU8A 5AHOA 4RM5A 2BMIA 2QJSA 5DPXA 2YNVB 1X8IA 2YNWA 2XR1A 4Z7RA 1HLKA 2CBNA 2Y8AA 4EYFA 5K4MA 4Z60A 2BC2A 3AF5A 2GCUA 3RKKA 4C1GA 2UYXA 2BFLA 4FEKA 1VMEA 2DKFA 5LSCA 1Y44A 3KL7A 2HB9A 4ZEJA 4TZBA 2OHHA 4O98A 3PG4A 5K4KA 5ACSA 4V0HA 1DDKA 4TZEA 3JXPA 5LE1A 1ZNBA 3IOFA 5ACUA 4J5HA 4UBQA 4D1VA 4UWPB 4Z67A 2P4ZA 2YNTB 3X2YA 5FQCA 3IE1A 2QINA 1YCGA 2BG8B 4EY2A 4HKYA 1A7TA 4BP0A 3AF6A 3T3OA 2XF4A 5EVKA 2GKLA 2AZ4A 3IE2A 3SPUA 4YSLA 3Q6VA 5AYAA 3R2UA 1M2XA 1X8HA 2QEDA 4J5FA 2Y87A 4RAWA 3SW3A 3G1PA 3I0VA 2FK6A 3SBLA 4EYBA 1P9EA 1WUOA 2OHJA 3ZWFA 4PVOA 4F6HA 4ZNBA 4TYTA 2QDTA 5LCAA 4C1FA 3ADRA 3WXCA 1VGNA 4Z5ZA 4RL0A 4RBSA 5HIOA 4UA4A 4AWYB 5EHTA 5LMCA 3A4YA 3ZQ4A 2FU6A 2NYPA 1BMCA 2I7TA 2GMNA 1WW1A 2WYMC 2NZEA 3RKJA 5KILA 1JT1A 1A8TA 1YCFA 4DILA 3SFPA 1K07A 3IDZA 3SRXA 3ZR9A 5AHRA 2NXAA 5A5ZA 1XM8A 3BK1A 2ZO4A 3AJ3A 5FQBA 5EVDA 2Q42A 3KNRA 4EFZA 5A87A 1JJTA 1DD6A 3PY5A 5KIKA 2BG6A 4EXYA 3KNSA 3X2ZA 4F6ZA 5IQKA 5ACVA 3ZNBA 3SD9A 4FSBA 5B1UA 4FR7A 4LE6A 4GYUA 5EV6A 1SMLA 5B15A 3S0ZA 2R2DA 4NQ2A 3I11A 2BFKA 1BC2A 4TZ9A 5LS3A 3ESHA 4D1TA 3P2UA 2WYMA 1XTOA 5ACXA 5HH6A 2Y8BA 4HL1A 2YCBA 3I14A 5LLDA 1KO2A 5EH9A 5HH5A 2FU9A 2M5CA 4NQ4A 5FQAA 1WRAA 3IEKA 5ACQA 4GYQA 2FHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX1 B;  3DHB A;  2E7Y A;  4DIK A;  5EWA A;  2I7V A;  2BIB A;  1ZKP A;  1WUP A;  1YCH A;  1X8G A;  4PVT A;  4C1H A;  2AIO A;  1KR3 A;  4RL2 A;  2BFZ A;  3IE0 A;  1ZTC A;  5B3R A;  2Q0J A;  2M5D A;  5ACT A;  2VW8 A;  2YNV A;  3X2X A;  3F9O A;  3QH8 A;  4YSK A;  3MD7 A;  2ZWR A;  4UWR B;  4RAM A;  4CHL A;  5A0T A;  4JO0 A;  2QDS A;  2FM6 A;  5HH4 A;  5HIS A;  2WHG A;  2P18 A;  2ZNB A;  3BK2 A;  2Q9U A;  4XUK A;  4TYF A;  2BR6 A;  3FCZ A;  2BTN A;  4AWZ A;  4EXS A;  4ZO3 A;  5EV8 A;  1JJE A;  1DXK A;  4YSB A;  2H6A A;  2GFK A;  2P1E A;  2YNT A;  4XWW A;  3LVZ A;  4NQ6 A;  3T3N A;  2BGA A;  4UWO B;  4WD6 A;  2BG8 A;  4AD9 A;  1QH5 A;  5HIQ A;  2WRS A;  1QH3 A;  5ACR A;  4AX0 B;  5AXO A;  3H3E A;  3X30 A;  4C1C A;  5HIP A;  5K4N A;  5LM6 A;  3DHA A;  4C1D A;  4B87 A;  5K0W A;  3IEL A;  3DH8 A;  3RPC A;  4KEP A;  1VJN A;  2ZZI A;  3BC2 A;  4U4L A;  4C1E A;  5AEB A;  5LCF A;  3VPE A;  4HL2 A;  2BG2 A;  2WYL A;  1KO3 A;  3PY6 A;  4D1U A;  3VQZ A;  4KEQ A;  2NZF A;  4NQ5 A;  4Z6X A;  2I7X A;  2OHI A;  4P62 A;  4C09 A;  1BVT A;  2YNU A;  3BV6 A;  4UAM A;  5ACW A;  4GCW A;  3I15 A;  3IOG A;  3I13 A;  1E5D A;  4BZ3 A;  2A7M A;  3DHC A;  2FU7 A;  4D02 A;  5AXR A;  2BG7 A;  5EW0 A;  4Z5Y A;  3TP9 A;  4ZO2 A;  3L6N A;  5ACP A;  1MQO A;  4D1W A;  2DOO A;  2FHX B;  1L9Y A;  4UWS B;  5EVB A;  3T9M A;  4TZF A;  2GFJ A;  3FAI A;  3IEM A;  4EYL A;  2YZ3 A;  4XWT A;  2Q0I A;  4H0D A;  2BFZ B;  5LCH A;  5A0V A;  2P97 A;  2FU8 A;  5AHO A;  4RM5 A;  2BMI A;  2QJS A;  5DPX A;  2YNV B;  1X8I A;  2YNW A;  2XR1 A;  4Z7R A;  1HLK A;  2CBN A;  2Y8A A;  4EYF A;  5K4M A;  4Z60 A;  2BC2 A;  3AF5 A;  2GCU A;  3RKK A;  4C1G A;  2UYX A;  2BFL A;  4FEK A;  1VME A;  2DKF A;  5LSC A;  1Y44 A;  3KL7 A;  2HB9 A;  4ZEJ A;  4TZB A;  2OHH A;  4O98 A;  3PG4 A;  5K4K A;  5ACS A;  4V0H A;  1DDK A;  4TZE A;  3JXP A;  5LE1 A;  1ZNB A;  3IOF A;  5ACU A;  4J5H A;  4UBQ A;  4D1V A;  4UWP B;  4Z67 A;  2P4Z A;  2YNT B;  3X2Y A;  5FQC A;  3IE1 A;  2QIN A;  1YCG A;  2BG8 B;  4EY2 A;  4HKY A;  1A7T A;  4BP0 A;  3AF6 A;  3T3O A;  2XF4 A;  5EVK A;  2GKL A;  2AZ4 A;  3IE2 A;  3SPU A;  4YSL A;  3Q6V A;  5AYA A;  3R2U A;  1M2X A;  1X8H A;  2QED A;  4J5F A;  2Y87 A;  4RAW A;  3SW3 A;  3G1P A;  3I0V A;  2FK6 A;  3SBL A;  4EYB A;  1P9E A;  1WUO A;  2OHJ A;  3ZWF A;  4PVO A;  4F6H A;  4ZNB A;  4TYT A;  2QDT A;  5LCA A;  4C1F A;  3ADR A;  3WXC A;  1VGN A;  4Z5Z A;  4RL0 A;  4RBS A;  5HIO A;  4UA4 A;  4AWY B;  5EHT A;  5LMC A;  3A4Y A;  3ZQ4 A;  2FU6 A;  2NYP A;  1BMC A;  2I7T A;  2GMN A;  1WW1 A;  2WYM C;  2NZE A;  3RKJ A;  5KIL A;  1JT1 A;  1A8T A;  1YCF A;  4DIL A;  3SFP A;  1K07 A;  3IDZ A;  3SRX A;  3ZR9 A;  5AHR A;  2NXA A;  5A5Z A;  1XM8 A;  3BK1 A;  2ZO4 A;  3AJ3 A;  5FQB A;  5EVD A;  2Q42 A;  3KNR A;  4EFZ A;  5A87 A;  1JJT A;  1DD6 A;  3PY5 A;  5KIK A;  2BG6 A;  4EXY A;  3KNS A;  3X2Z A;  4F6Z A;  5IQK A;  5ACV A;  3ZNB A;  3SD9 A;  4FSB A;  5B1U A;  4FR7 A;  4LE6 A;  4GYU A;  5EV6 A;  1SML A;  5B15 A;  3S0Z A;  2R2D A;  4NQ2 A;  3I11 A;  2BFK A;  1BC2 A;  4TZ9 A;  5LS3 A;  3ESH A;  4D1T A;  3P2U A;  2WYM A;  1XTO A;  5ACX A;  5HH6 A;  2Y8B A;  4HL1 A;  2YCB A;  3I14 A;  5LLD A;  1KO2 A;  5EH9 A;  5HH5 A;  2FU9 A;  2M5C A;  4NQ4 A;  5FQA A;  1WRA A;  3IEK A;  5ACQ A;  4GYQ A;  2FHX A; 
#chains in the Genus database with same CATH topology
 4AX1 B;  3DHB A;  2E7Y A;  4DIK A;  5EWA A;  2I7V A;  2BIB A;  4NUR A;  1ZKP A;  1WUP A;  1YCH A;  1X8G A;  4PVT A;  4C1H A;  2AIO A;  1KR3 A;  4RL2 A;  2BFZ A;  3IE0 A;  1ZTC A;  5B3R A;  2Q0J A;  2M5D A;  5ACT A;  2VW8 A;  4PDX A;  2YNV A;  3X2X A;  3F9O A;  3QH8 A;  4YSK A;  3MD7 A;  2ZWR A;  4UWR B;  4RAM A;  4CHL A;  5A0T A;  4JO0 A;  2QDS A;  2FM6 A;  5HH4 A;  5HIS A;  2WHG A;  2P18 A;  2ZNB A;  3BK2 A;  2Q9U A;  4XUK A;  4TYF A;  2BR6 A;  3FCZ A;  2BTN A;  4AWZ A;  4EXS A;  4ZO3 A;  5EV8 A;  1JJE A;  1DXK A;  4YSB A;  2H6A A;  2GFK A;  2P1E A;  2YNT A;  4XWW A;  3LVZ A;  4NQ6 A;  3T3N A;  2BGA A;  4UWO B;  4WD6 A;  2BG8 A;  4AD9 A;  1QH5 A;  5HIQ A;  2WRS A;  1QH3 A;  5ACR A;  4AX0 B;  5AXO A;  3H3E A;  3X30 A;  4C1C A;  5HIP A;  5K4N A;  5LM6 A;  3DHA A;  4C1D A;  4B87 A;  5K0W A;  3IEL A;  3DH8 A;  3RPC A;  4KEP A;  1VJN A;  2ZZI A;  3BC2 A;  4U4L A;  4C1E A;  5AEB A;  5LCF A;  3VPE A;  4HL2 A;  2BG2 A;  2WYL A;  1KO3 A;  3PY6 A;  4D1U A;  3VQZ A;  4KEQ A;  2NZF A;  4NQ5 A;  4Z6X A;  2I7X A;  2OHI A;  4P62 A;  4C09 A;  1BVT A;  2CG3 A;  2YNU A;  3BV6 A;  4UAM A;  5ACW A;  4GCW A;  3I15 A;  3IOG A;  3I13 A;  1E5D A;  4BZ3 A;  2A7M A;  3DHC A;  2FU7 A;  4D02 A;  5AXR A;  2BG7 A;  5EW0 A;  4Z5Y A;  3TP9 A;  4ZO2 A;  3L6N A;  5ACP A;  1MQO A;  4D1W A;  2DOO A;  2FHX B;  1L9Y A;  4UWS B;  5EVB A;  3T9M A;  4TZF A;  2GFJ A;  2CFU A;  3FAI A;  3IEM A;  4EYL A;  2YZ3 A;  4XWT A;  2Q0I A;  2CG2 A;  4H0D A;  2BFZ B;  5LCH A;  5A0V A;  2P97 A;  2FU8 A;  5AHO A;  4RM5 A;  2BMI A;  2QJS A;  5DPX A;  2YNV B;  1X8I A;  2YNW A;  2XR1 A;  4Z7R A;  1HLK A;  2CBN A;  2Y8A A;  4EYF A;  5K4M A;  4Z60 A;  2BC2 A;  3AF5 A;  2GCU A;  3RKK A;  4C1G A;  2UYX A;  2BFL A;  4FEK A;  1VME A;  2DKF A;  5LSC A;  1Y44 A;  3KL7 A;  2HB9 A;  4ZEJ A;  4TZB A;  2OHH A;  4O98 A;  2CFZ A;  3PG4 A;  5K4K A;  5ACS A;  4V0H A;  1DDK A;  5AJL A;  4TZE A;  3JXP A;  5LE1 A;  1ZNB A;  3IOF A;  5ACU A;  4J5H A;  4UBQ A;  4D1V A;  4UWP B;  4Z67 A;  2P4Z A;  2YNT B;  3X2Y A;  5FQC A;  3IE1 A;  2QIN A;  1YCG A;  2BG8 B;  4EY2 A;  4HKY A;  1A7T A;  4AXH A;  4BP0 A;  3AF6 A;  3T3O A;  2XF4 A;  5EVK A;  2GKL A;  2AZ4 A;  3IE2 A;  3SPU A;  4YSL A;  3Q6V A;  5AYA A;  3R2U A;  1M2X A;  1X8H A;  2QED A;  5AIJ A;  4J5F A;  2Y87 A;  4RAW A;  3SW3 A;  3G1P A;  3I0V A;  2FK6 A;  3SBL A;  4EYB A;  1P9E A;  1WUO A;  2OHJ A;  3ZWF A;  4PVO A;  4F6H A;  4ZNB A;  4TYT A;  2QDT A;  5LCA A;  4C1F A;  3ADR A;  3WXC A;  1VGN A;  4Z5Z A;  4RL0 A;  4RBS A;  5HIO A;  4UA4 A;  4AWY B;  5EHT A;  5LMC A;  3A4Y A;  3ZQ4 A;  2FU6 A;  2NYP A;  1BMC A;  2I7T A;  2GMN A;  1WW1 A;  2WYM C;  2YHE A;  2NZE A;  3RKJ A;  5KIL A;  1JT1 A;  4AV7 A;  1A8T A;  1YCF A;  4DIL A;  3SFP A;  1K07 A;  3IDZ A;  5A23 A;  3SRX A;  3ZR9 A;  5AHR A;  2NXA A;  5A5Z A;  1XM8 A;  3BK1 A;  2ZO4 A;  3AJ3 A;  5FQB A;  5EVD A;  2Q42 A;  3KNR A;  4EFZ A;  5A87 A;  1JJT A;  1DD6 A;  3PY5 A;  5KIK A;  2BG6 A;  4EXY A;  3KNS A;  3X2Z A;  4F6Z A;  5IQK A;  5ACV A;  3ZNB A;  3SD9 A;  4FSB A;  5B1U A;  4FR7 A;  4LE6 A;  4GYU A;  5EV6 A;  1SML A;  5B15 A;  3S0Z A;  2R2D A;  4NQ2 A;  3I11 A;  2BFK A;  1BC2 A;  4TZ9 A;  5LS3 A;  3ESH A;  4D1T A;  3P2U A;  2WYM A;  1XTO A;  5ACX A;  5HH6 A;  2Y8B A;  4HL1 A;  2YCB A;  3I14 A;  5LLD A;  1KO2 A;  5EH9 A;  5HH5 A;  2FU9 A;  2M5C A;  4NQ4 A;  5FQA A;  1WRA A;  3IEK A;  5ACQ A;  4GYQ A;  2FHX A; 
#chains in the Genus database with same CATH homology
 4AX1 B;  3DHB A;  2E7Y A;  4DIK A;  5EWA A;  2I7V A;  2BIB A;  1ZKP A;  1WUP A;  1YCH A;  1X8G A;  4PVT A;  4C1H A;  2AIO A;  1KR3 A;  4RL2 A;  2BFZ A;  3IE0 A;  1ZTC A;  5B3R A;  2Q0J A;  2M5D A;  5ACT A;  2VW8 A;  2YNV A;  3X2X A;  3F9O A;  3QH8 A;  4YSK A;  3MD7 A;  2ZWR A;  4UWR B;  4RAM A;  4CHL A;  5A0T A;  4JO0 A;  2QDS A;  2FM6 A;  5HH4 A;  5HIS A;  2WHG A;  2P18 A;  2ZNB A;  3BK2 A;  2Q9U A;  4XUK A;  4TYF A;  2BR6 A;  3FCZ A;  2BTN A;  4AWZ A;  4EXS A;  4ZO3 A;  5EV8 A;  1JJE A;  1DXK A;  4YSB A;  2H6A A;  2GFK A;  2P1E A;  2YNT A;  4XWW A;  3LVZ A;  4NQ6 A;  3T3N A;  2BGA A;  4UWO B;  4WD6 A;  2BG8 A;  4AD9 A;  1QH5 A;  5HIQ A;  2WRS A;  1QH3 A;  5ACR A;  4AX0 B;  5AXO A;  3H3E A;  3X30 A;  4C1C A;  5HIP A;  5K4N A;  5LM6 A;  3DHA A;  4C1D A;  4B87 A;  5K0W A;  3IEL A;  3DH8 A;  3RPC A;  4KEP A;  1VJN A;  2ZZI A;  3BC2 A;  4U4L A;  4C1E A;  5AEB A;  5LCF A;  3VPE A;  4HL2 A;  2BG2 A;  2WYL A;  1KO3 A;  3PY6 A;  4D1U A;  3VQZ A;  4KEQ A;  2NZF A;  4NQ5 A;  4Z6X A;  2I7X A;  2OHI A;  4P62 A;  4C09 A;  1BVT A;  2YNU A;  3BV6 A;  4UAM A;  5ACW A;  4GCW A;  3I15 A;  3IOG A;  3I13 A;  1E5D A;  4BZ3 A;  2A7M A;  3DHC A;  2FU7 A;  4D02 A;  5AXR A;  2BG7 A;  5EW0 A;  4Z5Y A;  3TP9 A;  4ZO2 A;  3L6N A;  5ACP A;  1MQO A;  4D1W A;  2DOO A;  2FHX B;  1L9Y A;  4UWS B;  5EVB A;  3T9M A;  4TZF A;  2GFJ A;  3FAI A;  3IEM A;  4EYL A;  2YZ3 A;  4XWT A;  2Q0I A;  4H0D A;  2BFZ B;  5LCH A;  5A0V A;  2P97 A;  2FU8 A;  5AHO A;  4RM5 A;  2BMI A;  2QJS A;  5DPX A;  2YNV B;  1X8I A;  2YNW A;  2XR1 A;  4Z7R A;  1HLK A;  2CBN A;  2Y8A A;  4EYF A;  5K4M A;  4Z60 A;  2BC2 A;  3AF5 A;  2GCU A;  3RKK A;  4C1G A;  2UYX A;  2BFL A;  4FEK A;  1VME A;  2DKF A;  5LSC A;  1Y44 A;  3KL7 A;  2HB9 A;  4ZEJ A;  4TZB A;  2OHH A;  4O98 A;  3PG4 A;  5K4K A;  5ACS A;  4V0H A;  1DDK A;  4TZE A;  3JXP A;  5LE1 A;  1ZNB A;  3IOF A;  5ACU A;  4J5H A;  4UBQ A;  4D1V A;  4UWP B;  4Z67 A;  2P4Z A;  2YNT B;  3X2Y A;  5FQC A;  3IE1 A;  2QIN A;  1YCG A;  2BG8 B;  4EY2 A;  4HKY A;  1A7T A;  4BP0 A;  3AF6 A;  3T3O A;  2XF4 A;  5EVK A;  2GKL A;  2AZ4 A;  3IE2 A;  3SPU A;  4YSL A;  3Q6V A;  5AYA A;  3R2U A;  1M2X A;  1X8H A;  2QED A;  4J5F A;  2Y87 A;  4RAW A;  3SW3 A;  3G1P A;  3I0V A;  2FK6 A;  3SBL A;  4EYB A;  1P9E A;  1WUO A;  2OHJ A;  3ZWF A;  4PVO A;  4F6H A;  4ZNB A;  4TYT A;  2QDT A;  5LCA A;  4C1F A;  3ADR A;  3WXC A;  1VGN A;  4Z5Z A;  4RL0 A;  4RBS A;  5HIO A;  4UA4 A;  4AWY B;  5EHT A;  5LMC A;  3A4Y A;  3ZQ4 A;  2FU6 A;  2NYP A;  1BMC A;  2I7T A;  2GMN A;  1WW1 A;  2WYM C;  2NZE A;  3RKJ A;  5KIL A;  1JT1 A;  1A8T A;  1YCF A;  4DIL A;  3SFP A;  1K07 A;  3IDZ A;  3SRX A;  3ZR9 A;  5AHR A;  2NXA A;  5A5Z A;  1XM8 A;  3BK1 A;  2ZO4 A;  3AJ3 A;  5FQB A;  5EVD A;  2Q42 A;  3KNR A;  4EFZ A;  5A87 A;  1JJT A;  1DD6 A;  3PY5 A;  5KIK A;  2BG6 A;  4EXY A;  3KNS A;  3X2Z A;  4F6Z A;  5IQK A;  5ACV A;  3ZNB A;  3SD9 A;  4FSB A;  5B1U A;  4FR7 A;  4LE6 A;  4GYU A;  5EV6 A;  1SML A;  5B15 A;  3S0Z A;  2R2D A;  4NQ2 A;  3I11 A;  2BFK A;  1BC2 A;  4TZ9 A;  5LS3 A;  3ESH A;  4D1T A;  3P2U A;  2WYM A;  1XTO A;  5ACX A;  5HH6 A;  2Y8B A;  4HL1 A;  2YCB A;  3I14 A;  5LLD A;  1KO2 A;  5EH9 A;  5HH5 A;  2FU9 A;  2M5C A;  4NQ4 A;  5FQA A;  1WRA A;  3IEK A;  5ACQ A;  4GYQ A;  2FHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...