4Z68A

Hybrid structural analysis of the arp2/3 regulator arpin identifies its acidic tail as a primary binding epitope
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4z68A00
3JXIA 2DZNA 5ENTD 3EHRA 3D9HA 4O1PA 1BI7B 4DX2A 5HRYA 3UXGA 3SO8A 1NFIE 3NBNB 3J5QB 2RFMA 4ATZD 3NOCD 4OAUC 1SW6A 4U8VD 4UUCA 1IKND 5ENRD 3ZUVB 2DVWA 5ITZF 4HLLA 1YYHA 4BERA 3Q9NC 3EHQA 4QFVA 4DX6D 1BD8A 5AARA 5JA4D 3V2XA 5JMND 2DZOA 3AAAC 4U8YD 4J8YA 5D66A 2B0OE 5AQ7A 4DX5D 2XENA 4HB5A 5FINA 4K5AB 2VGEA 5EYPF 4BETA 4BSZB 2ETBA 5KWDA 4G8KA 2BKGA 4DUIA 3B7BA 5HS0A 4F1PA 2P2CP 3KEAA 5FIOA 4C48B 2ETCA 2V4HC 3T8KA 3B95A 3J5PA 3TWQA 1WDYA 3V30A 1AWCB 2HE0A 2DWZA 1SVXA 2XZTG 5EYLA 4U96D 4Z68A 2AJAA 3V2OA 5EIDA 1MX2A 2QC9A 3V31A 4HNAD 2JABA 5BXUA 2V5QC 5CEDB 1K1BA 5CBOA 1A5EA 3T9KA 1UOHA 2RFAA 5ENQD 4J7WA 3DEPA 5AQ9A 4K5BA 3JUEA 4HI9A 3TWSA 3TWWA 3AJIA 2F8XK 4HI8A 2L6BA 1AP7A 2Y0BG 4LSZE 2PNNA 4CYMD 5ENPD 4DX7D 1N11A 1G3NB 2XZDG 4YDYA 1IHBA 1TR4A 5KBAA 3TWRA 3HG0D 5EIBE 5ENOD 3TWUA 4DRXE 1BU9A 1D9SA 4U95D 4BEPA 2Y1LE 3HRAA 3Q9UC 2ZGDA 3ZU7B 4B93B 1IXVA 1OT8A 3IXEA 4O1OA 2ZGGA 2BKKB 2J8SD 5HKPA 3V79K 5AAOA 5CECB 1OY3D 2XEHA 1N0RA 4LG6A 1MX4A 1K1AA 3F6QA 2QYJA 4N5QA 2KXPC 1WG0A 5EILA 4NIKA 1N0QA 1MJ0A 1QYMA 3EU9A 4GMRA 4ZFHA 2MYOA 4HQDA 4HRLA 1DC2A 3ZKJA 4YDWA 4CZ2D 4HRNA 5KNHD 3LJNA 2FO1E 1S70B 3TWTA 3NOGD 4RLYA 1DCQA 4LNUD 3TWVA 1BI8B 2XEEA 3UI2A 3ZNGA 1K3ZD 4QQIA 5BXOA 5CEAA 4A63B 1YCSB 2F8YA 1YMPA 2F37A 5ENSD 4ZHBA 3DEOA 4G8LA 2A5EA 5CERB 4K5CA 4TUMA 2ETAA 3UTMA 4F6RD 5AQAA 4O60A 5CBNA 3TWXA 4BESA 3C5RA 4HRMB 5KNGA 3JXJA 1BLXB 5EN5D 4HBDA 2KBXA 2NYJA 5AQBA 3W9FA 1MYOA 4GPMA 1MX6A 4OAVB 4DX1A 5AN8A 4JB8P 3W9GA
chains in the Genus database with same CATH superfamily
3E34A 3ZXSA 3Q73A 4LRZA 2FI7A 3QWVA 4O1PA 4I9CA 2WXRA 1OWMA 3BG0B 3L16A 4PH4B 5J08A 5ITZF 3VLFA 3B7RL 4ILGA 2VGYA 2V0PA 2DZOA 2PM6A 3LEWA 2VGEA 1NI1A 3N71A 2IFUA 5B1BE 3RAUA 1SQMA 1U2VG 3B13A 3HYMB 3TGOA 5AJLA 1A5EA 4K5BA 3KSLA 1P5QA 1N11A 1D9SA 3Q4AB 3LJ3A 4FHKA 3LVQE 1E8XA 4XE0A 2LAIA 3SZ7A 1K1AA 5CHEE 2ILRA 4KZCA 4B0ZA 4HRLA 3R9AB 4RG9A 3D3MA 4FHJA 1TJCA 2KATA 5AIJA 5BXOA 3LY8A 2OEWA 4ZHBA 5IY5E 1V54E 1LTXA 4ANXA 3APCA 4LNGA 4UI9J 4GCNA 3JXJA 3CGHA 4I2WA 4TV3A 4JB8P 3DBSA 5FZRA 2VYIA 5FQ6A 2LAHA 3RJVA 3L6AA 5JJ6A 3ZYQA 3ZW3A 4UWLA 4G26A 2L6JA 4HLLA 3SNXA 4ACKA 4EECA 5JMND 3QB2A 4K0RA 4BWRA 5LCWC 2IU1A 2P9KG 5HS0A 2R02A 4GMJA 1KZOA 3GZ2A 3ULQA 3J5PA 3FTZA 3PZ4A 4RG6A 3V2OA 4UWKA 5KJKA 4HNAD 4ACLA 5A23A 1HXIA 2VGXB 4XKBA 3DSTA 3DEPA 3QC1A 3TWSA 4HI9A 4C0EA 1TJFA 3ZPJA 5ENPD 3B7SA 5J90A 1GW6A 2HYZA 3APDA 4G25A 2WXHA 3QK0A 2J4BA 4PUCA 4I2ZA 5CBNA 4M7CA 3G2WA 2KXPC 4ZFHA 4G23A 1K8KG 1ELWA 1N4SA 3FU5A 3RRUA 5G04J 4MRUA 3SQVA 4JD2G 4XZ4A 4BX9A 4HXIA 1QNFA 3D9NA 4F6RD 4BESA 1BLXB 5T3RA 3TXNA 3JXIA 1TNYA 1IQRA 5D0QD 3S7FA 1DVPA 2YHCA 3UQ3A 3U9WA 3MYVA 4CCAA 2EILE 1S0PA 4AOFA 5AQ7A 4K5AB 4BSZB 5AJDA 3ZXPA 4ME2A 3ML8A 4HOSA 3KS2A 4AJWA 2V4HC 3CVXA 4P29A 2CHWA 1JCRA 4DI3A 3HIZA 2DWZA 3DXMG 3LVRE 1PC2A 4DJAA 4JC8A 5ARGA 3QNKA 3OXGA 4XKCA 2V8SE 3ESLA 4HI8A 3DSWA 1G3NB 1OUVA 4YDYA 2Y1LE 2QFCA 3APFA 3PREA 4RQIA 4OYSA 3PNTB 3TG4A 3ABLE 3CVPA 2MYOA 5G05J 2I1KA 4NACA 4JZYA 2XS8A 4RLYA 2VJ8A 1IHGA 2EQXA 3G2TA 3ZIMA 3DSVA 2Y4TA 4KVOA 5DBKA 5AQAA 4O60A 4PDXA 3CVNA 5EN5D 3LY7A 3DWLG 1Q2ZA 1PAQA 4A3VA 3Q49B 1OCZE 3KSQA 5HI7A 3I3NA 2RKKA 4DX2A 3UXGA 3GYZA 4WAFA 2R5SA 2IF4A 3L82A 4GTOA 4LEUA 4U04A 4GTQA 2DVWA 4YNDA 5KJMA 2WXLA 1H19A 2RG8A 2CG3A 4FLBA 4JA9A 3AU5A 2WXNA 2WVIA 4N3BA 2VTBA 4RVBA 4N3CA 2QY7A 4K03A 3L22A 4F53A 1UJKA 2WM9A 3C3RA 1WDYA 5EYLA 1DNPA 2NXPA 3Q5MA 5BXUA 4GB9A 1MHQA 3RK6A 4N3AA 1FPPA 4JA7A 5EIBE 3ASGA 1IYGA 2E2EA 3SY2A 4O1OA 5ANRA 1OWLA 1N95A 4WWOA 3CK9A 2J07A 3BUAA 2QYJA 4H7YA 3C72A 3EU9A 3ZVVA 3CK8A 3ZYLA 1LD8A 3EHMA 4CGVA 1H6OA 5E76A 2IOLA 2E0IA 4QQIA 1YCSB 1LD7A 1YMPA 3O48A 2J49A 2R2LA 4TUMA 3MZLB 3SHFA 2P9UG 3BQOA 3R9MA 3CR3A 2CHXA 3QAQA 4U8HA 1MYOA 4YDOA 5AN8A 3KEZA 4L23A 3EHRA 2R03A 1ELRA 5HRYA 1N52A 1E90A 1NFIE 4GZ5A 4FADA 3NOCD 1FCHA 1HO8A 2ZIRA 4U07A 1OCCE 1BD8A 4L9PA 2OOEA 1HF8A 4EZLA 1HG5A 3C3QA 1H0AA 3HHMA 1EYHA 2BKGA 4JVSA 2MOWA 3UT4A 3CSFA 4GTVA 4WWPA 4A1SA 3FTYA 3MV3B 2UWJG 5FTPA 4JXTA 4I1OB 2XCCA 5CBOA 3E32A 4AXHA 2DBAA 4PS8A 2L6BA 2X38A 3FH5A 4XX5A 2J08A 3Q79A 3ZU7B 3LPZA 3ZYMA 2BKKB 4J6IA 5AAOA 4L1BA 3RIBA 3FU3A 3F6QA 1KLXA 3AG4E 1H2UA 1VDYA 4N5CA 4PS3A 4JHRA 1DCQA 4DLOA 4FA6A 3L17A 3DSUA 1KT1A 3ONLA 3L08A 1JUQA 3URZA 2YINA 4LCTA 2PQNA 2XCBA 1Z3YA 2IQCA 4GTSA 3E30A 3P2BA 4OAVB 4DX1A 2GROB 2P9NG 2I6HA 4R7LA 2KZTB 2HO1A 3SO8A 4BT8A 1SA5A 3NBNB 4Q94A 3ASDA 4U8VD 4UUCA 3P1UA 3WG7E 4BERA 4YVQC 1NZNA 2P9SG 3JCKC 2B0OE 3ZHEB 4G8KA 2DYRE 3FUFA 2EIJE 5FIOA 4H7XA 2ETCA 5BW8C 4APFA 3PRZA 3RO3A 4AIFA 3CVUA 3RKVA 4F3VA 3HXFA 5ENQD 3CHRA 4N39A 2PNNA 1XNFA 5JHBA 1KPSB 3TWUA 4E6HA 4BEPA 2KCVA 3DRAA 4KBQA 3AS5A 2XEHA 2C2LA 2VQ2A 3MKQB 2P58C 4HQDA 1S70B 3TXMA 5CEAA 3R7QA 4UI9K 1JCQA 4EHMA 3UPVA 4ATGA 3VLDA 2DIWA 2P9PG 3FEYA 3CVWA 3QWWA 2Y4UA 4FJZA 4CDRA 3CVYA 1H2VC 5FQ4A 5HQ8A 4UQZA 1S64A 4WNEA 5C1DA 4JEHA 3UIPC 1FVHA 3ONKA 3B7BA 3FUJA 3GW4A 3B95A 3FUMA 1NA0A 4Z68A 4U63A 3GZSA 3IHYA 3SFXA 4PS7A 5CMYA 2BF0X 4C0MA 3JUEA 3UKUG 4ANVA 3D9KA 5BV0A 1AP7A 4CYMD 4NQ0A 4JEUA 3S7BA 1WAO1 4UWHA 4F1SA 3K9IA 1MQSA 3TWRA 2GGFA 3Q9UC 4A55A 4HLEA 2X3MA 1E7UA 3KAEA 1WG0A 2PM7A 1N0QA 3IV0A 5FT9A 2YQ8A 1UG3A 3MCXA 4GU5A 2MHKA 4HRNA 2OEVA 4ILHB 1X5BA 3MKRA 2XEEA 1SZ9A 2F8YA 3SBTB 4GYOA 2CG2A 3U3WA 1QQEA 3LY9A 4CRWA 2XGSA 3RO2A 3SFYA 5ARFA 4N2QA 4HBDA 1N4PA 4MS6A 3IHVA 3I4RB 3CHSA 2KM4A 2ZU6B 5B3SE 4BFRA 1Z6TA 2AXZA 3PEVB 2GW1A 5CCLA 4J8SA 1YYHA 4XIFA 4JHKA 3T5XA 5G2NA 3D9LA 5KWDA 4DX5D 3E37A 3NZSA 3CQGB 4TRQA 4CEMA 4GTRA 3T8KA 3TWQA 1AWCB 2ZXWE 3FUDA 2BTDA 1X81A 3EIQC 5BV1A 3OXLA 4TXQA 4AEZC 2X6KA 2J4DA 2LNIA 2XZDG 3UX4A 1IHBA 1U3DA 3QJZA 2NC9A 3JYSA 2OCCE 4HOQA 1JWGA 3OXFA 2XHEA 5CECB 3IEGA 5EILA 4BTBA 3FTUA 3UT7A 4YVOA 3MGBA 4CT4A 2FEZA 2WMOA 1DC2A 3BEEA 4UI9C 5T4YA 5KNHD 4GAAA 1JPLA 2IO2C 5LFAA 5AENA 3ASHA 4A63B 3ZFWA 4LNBA 3HVEB 1PY1A 1L5JA 2XGMA 3NAWA 3SBSA 5D0OD 4A1GA 1TNUA 3C5RA 4RSYA 4V3IA 2GRMA 2LXLA 4TUUA 3FULA 5KCMA 3CLJA 1N94A 1V55E 4U0UA 2C0MA 5EX0A 3J5QB 4DI4A 3S7DA 4ANWA 4GZDA 3V2XA 4U8YD 3G2UA 3CHOA 2IONA 3ULYA 1KT0A 3VLEA 2H6GA 2P2CP 3T5VA 5EIDA 1HU3A 2QC9A 4BY6A 4U0SA 3PVLA 3EDTB 1QZ2A 3X2QE 4B8AA 4HS2A 4DK5A 2IOSA 3ZN3A 4XEIG 5G04C 1TN8A 1FVFA 3FTXA 4KMOA 2XRZA 2NSZA 2CHZA 1OCOE 3CHQA 1E8ZA 3MV2B 3RRMB 4N2SA 3TWTA 2WXKA 4D10C 4LNUD 2KZTA 3FH7A 2IEJA 2L0IA 4I43A 3FU6A 3TG5A 5ANLA 3CK7A 1LF8A 4I1MA 4LUNU 2FULA 4CT0A 4EBAG 5BPPA 2R17C 3ZHEA 3W9GA 4G2VA 2VSOE 1SA4A 2DZNA 2LXMA 3PS6A 1H6PA 5FQ7A 2RFMA 4ATZD 3SF4A 2WXJA 5FINA 5LX8A 3MX3A 4BETA 4DUIA 3AG3E 2BEDA 4F1PA 3ZGQA 3QOUA 4Q96A 4JW1A 2XZTG 1O5MA 3DXKG 1N9AA 4NURA 2EIKE 3ASNE 3MKQA 3MA5A 4W9RA 1HFAA 2FO7A 2Y0BG 4G24A 2Y69E 3EUVA 4CDMA 1BU9A 5ENOD 5G05C 4B89A 2WXQA 3UINC 3HRAA 1IXVA 4I6JA 1O1TA 3V79K 4AVXA 3AG2E 4N5QA 3R7RA 2IY0C 3Q7FA 3MEKA 4CZ2D 5M72A 2C0LA 3LJNA 4HOTA 1TNZA 4EQFA 2I1JA 4TXRA 4UWFA 4FU3A 4GYWA 3UTMA 1OXJA 5JHAA 1OWNA 3DPDA 1TEZA 4AY5A 5C2YA 3ZYKA 2CFUA 4HVBA 2KBXA 5AQBA 3W9FA 1B89A 3ISMC 3FTWA 3CVVA 2ZISA 4B94A 4J8FA 4CDNA 1ZBPA 1TYQG 4GTMA 2KCLA 2XPIA 4OVVA 3EU5A 1IKND 1W3BA 1E8YA 4WNDA 3FUIA 4J8YA 2WXFA 3CV0A 2DCPA 4JL0A 4X8QA 4OVUA 3G2VA 1EDUA 2QZAA 1SVXA 2BUGA 4U96D 4UWGA 2A4ZA 3AS4A 3NB2A 1WM5A 3NQPA 4KVMA 5LCWJ 1QBQA 5CEDB 4G1TA 3OAWA 2VGXA 3T9KA 2RD0A 4ANUA 4J8EA 1UW4B 2EINE 2V5FA 2YHEA 3UT8A 1EPUA 3D9MA 4U7EB 3I5PA 2OVBA 2JEKA 3T8MA 4ABNA 4KXKB 1YA0A 2IO3C 4WNGA 3L54A 4Q69A 2L9BA 3EHNA 1HX8A 1E7VA 4GYYA 2H6IA 2MRIA 5ENNA 1E8WA 2WB2A 3FUEA 3NOGD 3FTSA 5KJLA 1K3ZD 3UM2A 4MLPA 2F37A 2A5EA 4K5CA 1TN7A 3D9IA 3FUHA 3DSSA 2GRRB 3QWPA 5KNGA 4DLQA 1ELKA 3Q75A 1DCEA 2LSUA 1U3CA 1N4RA 4I9EA 4JPSA 3PH0C 5A7DB 4WUYA 3IKOB 4TXPA 3D9PA 4GTTA 3BG1B 4OAUC 3RRNB 4KT6B 4ILIA 3CVQA 4DX6D 3ESKA 3PZ1A 5AARA 1JCSA 2ETBA 2AWIA 2X6IA 4C48B 2WXGA 2GRQB 4FP7A 1TN6A 3EIJA 4AM9A 2UY1B 1MX2A 3FWVA 3SGHA 3ULEG 2V5QC 3HXBA 3CHPA 3D9OA 1O1RA 3UIOC 2VSYA 3FTVA 5AQ9A 3FEXA 4LSZE 2I9CA 5CMWA 3HG0D 4EZJA 4DRXE 1UN9A 3O4ZA 3HVEA 4IULA 3FH8A 4Y6CA 5EX3A 2ZGGA 4GA0A 3ASFA 4NIKA 1RW2A 2CFZA 3HDXA 4KZ0A 4KYOB 2XPZA 5CRUA 3DSXA 4L7TA 2FO1E 4EPZA 3MJWA 2WPVA 5ENSD 4L2YA 2OV8A 5CERB 2ETAA 4GPKA 4I6GA 2QYUA 3UM0A 1D8EA 3B7UX 4GZ6A 4U0ZA 4MKTA 3PEUB 3EJNA 3CKCA 1WY6A 5BT1A 2XEVA 5ENTD 3CEQA 1BI7B 3CSTA 3UM3A 1FT1A 1SW6A 3TJPA 5ENRD 3OTNA 3B7TA 2B6CA 3Q9NC 3JQ1A 5JA4D 2J9QA 2HR2A 2HE0A 1H2TC 2AJAA 4GA1A 2EIME 1E96B 2JABA 1K1BA 4YDEA 1N4QA 2IJGX 5FZSA 3TWWA 3AU4A 3PDNA 2XGOA 3FU0A 1D8DA 1TR4A 3DPYA 1XGWA 3FUNA 4B93B 4GA2A 3E33A 1OT8A 3UM1A 3C98A 5BNWA 5HKPA 4GZ3A 2R59A 1N0RA 2LUHA 3TAXA 5BUZA 3QKYA 5JJ7A 3QARA 1KZPA 3KD7A 2AXUA 3AG1E 3Q15A 4IRUA 3LKUA 3LXUX 2VSNA 3PUJA 4BT9A 3PE4A 2JLBA 1NP7A 2KCKA 1Y8MA 1EF1C 4I6EA 3VTYA 2Y3AA 4CGWA 3QDNA 3L13A 3UMVA 2OVFA 2LO6A 5EDSA 2KC7A 3C3OA 3FP3A 3EHQA 2XRYA 3CIAA 1TNOA 5D66A 1TNBA 4B8CB 4J8DA 2A5UA 1HG2A 3JUIA 2GRLA 5KJNA 2L0TB 3CHMA 3S2AA 1RZ4A 4GZCA 5AYWD 3HXCA 4AP2A 3JQ0A 1NA3A 4J7WA 4C9BB 3TL5A 2F8XK 3NZUA 3LYAA 2ONDA 3AS8A 1H6KA 5LP0A 5KBAA 5G55A 4U95D 5FWQA 4MBGA 3BU8A 1S63A 2V4LA 1Z3XA 1FT2A 3IXEA 2J8SD 2XPYA 3NF1A 2GRPB 5E75A 4IYPA 1MJ0A 1QYMA 4GMRA 3FFLA 3ABME 3ZKJA 4UQXA 3SI5A 1OCRE 4WNFA 1ZU2A 5CRVA 1BI8B 3PZDA 1O1SA 4Y6WA 3Q78A 4LERA 3VTXA 5FQ8A 2WQ6A 3DEOA 3E4BA 3UKRG 2FF4A 3FY4A 3PZ3A 4GTPA 2PL2A 2WXIA 4XI0A 4HRMB 2DYSE 2NYJA 3S7JA 3RU0A 4E85A 3U4TA 1NL4A 3G2SA 3FDHA 3D9HA 3HXEA 3U66A 2PZIA 2WXOA 5LOZA 1HE8A 2H6FA 4QFVA 4AV7A 2XENA 4HB5A 4M3OA 3LCAA 5EYPF 4I17A 4FLHA 4G11A 2X6JA 2X6HA 3KEAA 4NRHB 3PZ2A 1N54A 2VSXE 3PNLB 1UOHA 2RFAA 5D2MC 1HZ4A 4FULA 3AJIA 2AW6A 3Q7AA 4HOUA 4DPRA 4UQYA 2ZGDA 5FJYA 2J09A 1INZA 3CKBA 3Q47B 1OY3D 1HS6A 4LG6A 1MX4A 5A6CA 4BTAA 2H6HA 4O6FA 5JJTA 4URKA 3L9TA 1BPOA 4I1AA 1OWPA 1MZCA 4G8LA 4GMLA 2WMNA 3ENEA 2WQ7A 3SD5A 3TWXA 1HH8A 4APOA 2WQHA 1OWOA 4GPMA 3ZEFA 1Z5SC 3LS8A 4HFGA 4BSXA 5H7PA 3ZRHA 2LSVA 3U64A 5EKQD 2XS1A 4GCOA 4F7AA 3UUXA 2UY1A 3ZUVB 5T8IA 3CQCB 2M63A 4FC8A 2X6FA 5DIZA 3AAAC 5CCMA 4XI9A 1IQUA 3PUKA 3V30A 1SZAA 4AY6A 3V31A 2R05A 4BX8A 2XQ0A 4L2LA 3FUKA 3PE3A 2VTBB 3LDZA 1A17A 4DX7D 2P9IG 2WXPA 1Y6IA 3ASOE 2WXMA 3SFZA 2AXVA 2Q7FA 2HM8A 2I2OA 1ZB1A 3I4GA 2FBNA 2P9LG 2F0YA 2YNQA 5FZQA 1JWFA 3ABKE 3ML9A 4HORA 2AVPA 4YDWA 1UJJA 4WWNA 1UN8A 4FJYA 2GRNB 3TWVA 4EZKA 3UI2A 3ZNGA 3WXXA 4IN3B 3FHEA 3HXDA 3IBEA 5B1AE 3RSEG 3GZ1A 4J0UA 3D9JA 2PQRA 4EBAA 4A3TA 3CVLA 1MX6A 4JHJA
chains in the Genus database with same CATH topology
3JXIA 2DZNA 5ENTD 3EHRA 3D9HA 4O1PA 1BI7B 4DX2A 5HRYA 3UXGA 3SO8A 1NFIE 3NBNB 3J5QB 2RFMA 4ATZD 3NOCD 4OAUC 1SW6A 4U8VD 4UUCA 1IKND 5ENRD 3ZUVB 2DVWA 5ITZF 4HLLA 1YYHA 4BERA 3Q9NC 3EHQA 4QFVA 4DX6D 1BD8A 5AARA 5JA4D 3V2XA 5JMND 2DZOA 3AAAC 4U8YD 4J8YA 5D66A 2B0OE 5AQ7A 4DX5D 2XENA 4HB5A 5FINA 4K5AB 2VGEA 5EYPF 4BETA 4BSZB 2ETBA 5KWDA 4G8KA 2BKGA 4DUIA 3B7BA 5HS0A 4F1PA 2P2CP 3KEAA 5FIOA 4C48B 2ETCA 2V4HC 3T8KA 3B95A 3J5PA 3TWQA 1WDYA 3V30A 1AWCB 2HE0A 2DWZA 1SVXA 2XZTG 5EYLA 4U96D 4Z68A 2AJAA 3V2OA 5EIDA 1MX2A 2QC9A 3V31A 4HNAD 2JABA 5BXUA 2V5QC 5CEDB 1K1BA 5CBOA 1A5EA 3T9KA 1UOHA 2RFAA 5ENQD 4J7WA 3DEPA 5AQ9A 4K5BA 3JUEA 4HI9A 3TWSA 3TWWA 3AJIA 2F8XK 4HI8A 2L6BA 1AP7A 2Y0BG 4LSZE 2PNNA 4CYMD 5ENPD 4DX7D 1N11A 1G3NB 2XZDG 4YDYA 1IHBA 1TR4A 5KBAA 3TWRA 3HG0D 5EIBE 5ENOD 3TWUA 4DRXE 1BU9A 1D9SA 4U95D 4BEPA 2Y1LE 3HRAA 3Q9UC 2ZGDA 3ZU7B 4B93B 1IXVA 1OT8A 3IXEA 4O1OA 2ZGGA 2BKKB 2J8SD 5HKPA 3V79K 5AAOA 5CECB 1OY3D 2XEHA 1N0RA 4LG6A 1MX4A 1K1AA 3F6QA 2QYJA 4N5QA 2KXPC 1WG0A 5EILA 4NIKA 1N0QA 1MJ0A 1QYMA 3EU9A 4GMRA 4ZFHA 2MYOA 4HQDA 4HRLA 1DC2A 3ZKJA 4YDWA 4CZ2D 4HRNA 5KNHD 3LJNA 2FO1E 1S70B 3TWTA 3NOGD 4RLYA 1DCQA 4LNUD 3TWVA 1BI8B 2XEEA 3UI2A 3ZNGA 1K3ZD 4QQIA 5BXOA 5CEAA 4A63B 1YCSB 2F8YA 1YMPA 2F37A 5ENSD 4ZHBA 3DEOA 4G8LA 2A5EA 5CERB 4K5CA 4TUMA 2ETAA 3UTMA 4F6RD 5AQAA 4O60A 5CBNA 3TWXA 4BESA 3C5RA 4HRMB 5KNGA 3JXJA 1BLXB 5EN5D 4HBDA 2KBXA 2NYJA 5AQBA 3W9FA 1MYOA 4GPMA 1MX6A 4OAVB 4DX1A 5AN8A 4JB8P 3W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  2DZN A;  5ENT D;  3EHR A;  3D9H A;  4O1P A;  1BI7 B;  4DX2 A;  5HRY A;  3UXG A;  3SO8 A;  1NFI E;  3NBN B;  3J5Q B;  2RFM A;  4ATZ D;  3NOC D;  4OAU C;  1SW6 A;  4U8V D;  4UUC A;  1IKN D;  5ENR D;  3ZUV B;  2DVW A;  5ITZ F;  4HLL A;  1YYH A;  4BER A;  3Q9N C;  3EHQ A;  4QFV A;  4DX6 D;  1BD8 A;  5AAR A;  5JA4 D;  3V2X A;  5JMN D;  2DZO A;  3AAA C;  4U8Y D;  4J8Y A;  5D66 A;  2B0O E;  5AQ7 A;  4DX5 D;  2XEN A;  4HB5 A;  5FIN A;  4K5A B;  2VGE A;  5EYP F;  4BET A;  4BSZ B;  2ETB A;  5KWD A;  4G8K A;  2BKG A;  4DUI A;  3B7B A;  5HS0 A;  4F1P A;  2P2C P;  3KEA A;  5FIO A;  4C48 B;  2ETC A;  2V4H C;  3T8K A;  3B95 A;  3J5P A;  3TWQ A;  1WDY A;  3V30 A;  1AWC B;  2HE0 A;  2DWZ A;  1SVX A;  2XZT G;  5EYL A;  4U96 D;  4Z68 A;  2AJA A;  3V2O A;  5EID A;  1MX2 A;  2QC9 A;  3V31 A;  4HNA D;  2JAB A;  5BXU A;  2V5Q C;  5CED B;  1K1B A;  5CBO A;  1A5E A;  3T9K A;  1UOH A;  2RFA A;  5ENQ D;  4J7W A;  3DEP A;  5AQ9 A;  4K5B A;  3JUE A;  4HI9 A;  3TWS A;  3TWW A;  3AJI A;  2F8X K;  4HI8 A;  2L6B A;  1AP7 A;  2Y0B G;  4LSZ E;  2PNN A;  4CYM D;  5ENP D;  4DX7 D;  1N11 A;  1G3N B;  2XZD G;  4YDY A;  1IHB A;  1TR4 A;  5KBA A;  3TWR A;  3HG0 D;  5EIB E;  5ENO D;  3TWU A;  4DRX E;  1BU9 A;  1D9S A;  4U95 D;  4BEP A;  2Y1L E;  3HRA A;  3Q9U C;  2ZGD A;  3ZU7 B;  4B93 B;  1IXV A;  1OT8 A;  3IXE A;  4O1O A;  2ZGG A;  2BKK B;  2J8S D;  5HKP A;  3V79 K;  5AAO A;  5CEC B;  1OY3 D;  2XEH A;  1N0R A;  4LG6 A;  1MX4 A;  1K1A A;  3F6Q A;  2QYJ A;  4N5Q A;  2KXP C;  1WG0 A;  5EIL A;  4NIK A;  1N0Q A;  1MJ0 A;  1QYM A;  3EU9 A;  4GMR A;  4ZFH A;  2MYO A;  4HQD A;  4HRL A;  1DC2 A;  3ZKJ A;  4YDW A;  4CZ2 D;  4HRN A;  5KNH D;  3LJN A;  2FO1 E;  1S70 B;  3TWT A;  3NOG D;  4RLY A;  1DCQ A;  4LNU D;  3TWV A;  1BI8 B;  2XEE A;  3UI2 A;  3ZNG A;  1K3Z D;  4QQI A;  5BXO A;  5CEA A;  4A63 B;  1YCS B;  2F8Y A;  1YMP A;  2F37 A;  5ENS D;  4ZHB A;  3DEO A;  4G8L A;  2A5E A;  5CER B;  4K5C A;  4TUM A;  2ETA A;  3UTM A;  4F6R D;  5AQA A;  4O60 A;  5CBN A;  3TWX A;  4BES A;  3C5R A;  4HRM B;  5KNG A;  3JXJ A;  1BLX B;  5EN5 D;  4HBD A;  2KBX A;  2NYJ A;  5AQB A;  3W9F A;  1MYO A;  4GPM A;  1MX6 A;  4OAV B;  4DX1 A;  5AN8 A;  4JB8 P;  3W9G A; 
#chains in the Genus database with same CATH topology
 3E34 A;  3ZXS A;  3Q73 A;  4LRZ A;  2FI7 A;  3QWV A;  4O1P A;  4I9C A;  2WXR A;  1OWM A;  3BG0 B;  3L16 A;  4PH4 B;  5J08 A;  5ITZ F;  3VLF A;  3B7R L;  4ILG A;  2VGY A;  2V0P A;  2DZO A;  2PM6 A;  3LEW A;  2VGE A;  1NI1 A;  3N71 A;  2IFU A;  5B1B E;  3RAU A;  1SQM A;  1U2V G;  3B13 A;  3HYM B;  3TGO A;  5AJL A;  1A5E A;  4K5B A;  3KSL A;  1P5Q A;  1N11 A;  1D9S A;  3Q4A B;  3LJ3 A;  4FHK A;  3LVQ E;  1E8X A;  4XE0 A;  2LAI A;  3SZ7 A;  1K1A A;  5CHE E;  2ILR A;  4KZC A;  4B0Z A;  4HRL A;  3R9A B;  4RG9 A;  3D3M A;  4FHJ A;  1TJC A;  2KAT A;  5AIJ A;  5BXO A;  3LY8 A;  2OEW A;  4ZHB A;  5IY5 E;  1V54 E;  1LTX A;  4ANX A;  3APC A;  4LNG A;  4UI9 J;  4GCN A;  3JXJ A;  3CGH A;  4I2W A;  4TV3 A;  4JB8 P;  3DBS A;  5FZR A;  2VYI A;  5FQ6 A;  2LAH A;  3RJV A;  3L6A A;  5JJ6 A;  3ZYQ A;  3ZW3 A;  4UWL A;  4G26 A;  2L6J A;  4HLL A;  3SNX A;  4ACK A;  4EEC A;  5JMN D;  3QB2 A;  4K0R A;  4BWR A;  5LCW C;  2IU1 A;  2P9K G;  5HS0 A;  2R02 A;  4GMJ A;  1KZO A;  3GZ2 A;  3ULQ A;  3J5P A;  3FTZ A;  3PZ4 A;  4RG6 A;  3V2O A;  4UWK A;  5KJK A;  4HNA D;  4ACL A;  5A23 A;  1HXI A;  2VGX B;  4XKB A;  3DST A;  3DEP A;  3QC1 A;  3TWS A;  4HI9 A;  4C0E A;  1TJF A;  3ZPJ A;  5ENP D;  3B7S A;  5J90 A;  1GW6 A;  2HYZ A;  3APD A;  4G25 A;  2WXH A;  3QK0 A;  2J4B A;  4PUC A;  4I2Z A;  5CBN A;  4M7C A;  3G2W A;  2KXP C;  4ZFH A;  4G23 A;  1K8K G;  1ELW A;  1N4S A;  3FU5 A;  3RRU A;  5G04 J;  4MRU A;  3SQV A;  4JD2 G;  4XZ4 A;  4BX9 A;  4HXI A;  1QNF A;  3D9N A;  4F6R D;  4BES A;  1BLX B;  5T3R A;  3TXN A;  3JXI A;  1TNY A;  1IQR A;  5D0Q D;  3S7F A;  1DVP A;  2YHC A;  3UQ3 A;  3U9W A;  3MYV A;  4CCA A;  2EIL E;  1S0P A;  4AOF A;  5AQ7 A;  4K5A B;  4BSZ B;  5AJD A;  3ZXP A;  4ME2 A;  3ML8 A;  4HOS A;  3KS2 A;  4AJW A;  2V4H C;  3CVX A;  4P29 A;  2CHW A;  1JCR A;  4DI3 A;  3HIZ A;  2DWZ A;  3DXM G;  3LVR E;  1PC2 A;  4DJA A;  4JC8 A;  5ARG A;  3QNK A;  3OXG A;  4XKC A;  2V8S E;  3ESL A;  4HI8 A;  3DSW A;  1G3N B;  1OUV A;  4YDY A;  2Y1L E;  2QFC A;  3APF A;  3PRE A;  4RQI A;  4OYS A;  3PNT B;  3TG4 A;  3ABL E;  3CVP A;  2MYO A;  5G05 J;  2I1K A;  4NAC A;  4JZY A;  2XS8 A;  4RLY A;  2VJ8 A;  1IHG A;  2EQX A;  3G2T A;  3ZIM A;  3DSV A;  2Y4T A;  4KVO A;  5DBK A;  5AQA A;  4O60 A;  4PDX A;  3CVN A;  5EN5 D;  3LY7 A;  3DWL G;  1Q2Z A;  1PAQ A;  4A3V A;  3Q49 B;  1OCZ E;  3KSQ A;  5HI7 A;  3I3N A;  2RKK A;  4DX2 A;  3UXG A;  3GYZ A;  4WAF A;  2R5S A;  2IF4 A;  3L82 A;  4GTO A;  4LEU A;  4U04 A;  4GTQ A;  2DVW A;  4YND A;  5KJM A;  2WXL A;  1H19 A;  2RG8 A;  2CG3 A;  4FLB A;  4JA9 A;  3AU5 A;  2WXN A;  2WVI A;  4N3B A;  2VTB A;  4RVB A;  4N3C A;  2QY7 A;  4K03 A;  3L22 A;  4F53 A;  1UJK A;  2WM9 A;  3C3R A;  1WDY A;  5EYL A;  1DNP A;  2NXP A;  3Q5M A;  5BXU A;  4GB9 A;  1MHQ A;  3RK6 A;  4N3A A;  1FPP A;  4JA7 A;  5EIB E;  3ASG A;  1IYG A;  2E2E A;  3SY2 A;  4O1O A;  5ANR A;  1OWL A;  1N95 A;  4WWO A;  3CK9 A;  2J07 A;  3BUA A;  2QYJ A;  4H7Y A;  3C72 A;  3EU9 A;  3ZVV A;  3CK8 A;  3ZYL A;  1LD8 A;  3EHM A;  4CGV A;  1H6O A;  5E76 A;  2IOL A;  2E0I A;  4QQI A;  1YCS B;  1LD7 A;  1YMP A;  3O48 A;  2J49 A;  2R2L A;  4TUM A;  3MZL B;  3SHF A;  2P9U G;  3BQO A;  3R9M A;  3CR3 A;  2CHX A;  3QAQ A;  4U8H A;  1MYO A;  4YDO A;  5AN8 A;  3KEZ A;  4L23 A;  3EHR A;  2R03 A;  1ELR A;  5HRY A;  1N52 A;  1E90 A;  1NFI E;  4GZ5 A;  4FAD A;  3NOC D;  1FCH A;  1HO8 A;  2ZIR A;  4U07 A;  1OCC E;  1BD8 A;  4L9P A;  2OOE A;  1HF8 A;  4EZL A;  1HG5 A;  3C3Q A;  1H0A A;  3HHM A;  1EYH A;  2BKG A;  4JVS A;  2MOW A;  3UT4 A;  3CSF A;  4GTV A;  4WWP A;  4A1S A;  3FTY A;  3MV3 B;  2UWJ G;  5FTP A;  4JXT A;  4I1O B;  2XCC A;  5CBO A;  3E32 A;  4AXH A;  2DBA A;  4PS8 A;  2L6B A;  2X38 A;  3FH5 A;  4XX5 A;  2J08 A;  3Q79 A;  3ZU7 B;  3LPZ A;  3ZYM A;  2BKK B;  4J6I A;  5AAO A;  4L1B A;  3RIB A;  3FU3 A;  3F6Q A;  1KLX A;  3AG4 E;  1H2U A;  1VDY A;  4N5C A;  4PS3 A;  4JHR A;  1DCQ A;  4DLO A;  4FA6 A;  3L17 A;  3DSU A;  1KT1 A;  3ONL A;  3L08 A;  1JUQ A;  3URZ A;  2YIN A;  4LCT A;  2PQN A;  2XCB A;  1Z3Y A;  2IQC A;  4GTS A;  3E30 A;  3P2B A;  4OAV B;  4DX1 A;  2GRO B;  2P9N G;  2I6H A;  4R7L A;  2KZT B;  2HO1 A;  3SO8 A;  4BT8 A;  1SA5 A;  3NBN B;  4Q94 A;  3ASD A;  4U8V D;  4UUC A;  3P1U A;  3WG7 E;  4BER A;  4YVQ C;  1NZN A;  2P9S G;  3JCK C;  2B0O E;  3ZHE B;  4G8K A;  2DYR E;  3FUF A;  2EIJ E;  5FIO A;  4H7X A;  2ETC A;  5BW8 C;  4APF A;  3PRZ A;  3RO3 A;  4AIF A;  3CVU A;  3RKV A;  4F3V A;  3HXF A;  5ENQ D;  3CHR A;  4N39 A;  2PNN A;  1XNF A;  5JHB A;  1KPS B;  3TWU A;  4E6H A;  4BEP A;  2KCV A;  3DRA A;  4KBQ A;  3AS5 A;  2XEH A;  2C2L A;  2VQ2 A;  3MKQ B;  2P58 C;  4HQD A;  1S70 B;  3TXM A;  5CEA A;  3R7Q A;  4UI9 K;  1JCQ A;  4EHM A;  3UPV A;  4ATG A;  3VLD A;  2DIW A;  2P9P G;  3FEY A;  3CVW A;  3QWW A;  2Y4U A;  4FJZ A;  4CDR A;  3CVY A;  1H2V C;  5FQ4 A;  5HQ8 A;  4UQZ A;  1S64 A;  4WNE A;  5C1D A;  4JEH A;  3UIP C;  1FVH A;  3ONK A;  3B7B A;  3FUJ A;  3GW4 A;  3B95 A;  3FUM A;  1NA0 A;  4Z68 A;  4U63 A;  3GZS A;  3IHY A;  3SFX A;  4PS7 A;  5CMY A;  2BF0 X;  4C0M A;  3JUE A;  3UKU G;  4ANV A;  3D9K A;  5BV0 A;  1AP7 A;  4CYM D;  4NQ0 A;  4JEU A;  3S7B A;  1WAO 1;  4UWH A;  4F1S A;  3K9I A;  1MQS A;  3TWR A;  2GGF A;  3Q9U C;  4A55 A;  4HLE A;  2X3M A;  1E7U A;  3KAE A;  1WG0 A;  2PM7 A;  1N0Q A;  3IV0 A;  5FT9 A;  2YQ8 A;  1UG3 A;  3MCX A;  4GU5 A;  2MHK A;  4HRN A;  2OEV A;  4ILH B;  1X5B A;  3MKR A;  2XEE A;  1SZ9 A;  2F8Y A;  3SBT B;  4GYO A;  2CG2 A;  3U3W A;  1QQE A;  3LY9 A;  4CRW A;  2XGS A;  3RO2 A;  3SFY A;  5ARF A;  4N2Q A;  4HBD A;  1N4P A;  4MS6 A;  3IHV A;  3I4R B;  3CHS A;  2KM4 A;  2ZU6 B;  5B3S E;  4BFR A;  1Z6T A;  2AXZ A;  3PEV B;  2GW1 A;  5CCL A;  4J8S A;  1YYH A;  4XIF A;  4JHK A;  3T5X A;  5G2N A;  3D9L A;  5KWD A;  4DX5 D;  3E37 A;  3NZS A;  3CQG B;  4TRQ A;  4CEM A;  4GTR A;  3T8K A;  3TWQ A;  1AWC B;  2ZXW E;  3FUD A;  2BTD A;  1X81 A;  3EIQ C;  5BV1 A;  3OXL A;  4TXQ A;  4AEZ C;  2X6K A;  2J4D A;  2LNI A;  2XZD G;  3UX4 A;  1IHB A;  1U3D A;  3QJZ A;  2NC9 A;  3JYS A;  2OCC E;  4HOQ A;  1JWG A;  3OXF A;  2XHE A;  5CEC B;  3IEG A;  5EIL A;  4BTB A;  3FTU A;  3UT7 A;  4YVO A;  3MGB A;  4CT4 A;  2FEZ A;  2WMO A;  1DC2 A;  3BEE A;  4UI9 C;  5T4Y A;  5KNH D;  4GAA A;  1JPL A;  2IO2 C;  5LFA A;  5AEN A;  3ASH A;  4A63 B;  3ZFW A;  4LNB A;  3HVE B;  1PY1 A;  1L5J A;  2XGM A;  3NAW A;  3SBS A;  5D0O D;  4A1G A;  1TNU A;  3C5R A;  4RSY A;  4V3I A;  2GRM A;  2LXL A;  4TUU A;  3FUL A;  5KCM A;  3CLJ A;  1N94 A;  1V55 E;  4U0U A;  2C0M A;  5EX0 A;  3J5Q B;  4DI4 A;  3S7D A;  4ANW A;  4GZD A;  3V2X A;  4U8Y D;  3G2U A;  3CHO A;  2ION A;  3ULY A;  1KT0 A;  3VLE A;  2H6G A;  2P2C P;  3T5V A;  5EID A;  1HU3 A;  2QC9 A;  4BY6 A;  4U0S A;  3PVL A;  3EDT B;  1QZ2 A;  3X2Q E;  4B8A A;  4HS2 A;  4DK5 A;  2IOS A;  3ZN3 A;  4XEI G;  5G04 C;  1TN8 A;  1FVF A;  3FTX A;  4KMO A;  2XRZ A;  2NSZ A;  2CHZ A;  1OCO E;  3CHQ A;  1E8Z A;  3MV2 B;  3RRM B;  4N2S A;  3TWT A;  2WXK A;  4D10 C;  4LNU D;  2KZT A;  3FH7 A;  2IEJ A;  2L0I A;  4I43 A;  3FU6 A;  3TG5 A;  5ANL A;  3CK7 A;  1LF8 A;  4I1M A;  4LUN U;  2FUL A;  4CT0 A;  4EBA G;  5BPP A;  2R17 C;  3ZHE A;  3W9G A;  4G2V A;  2VSO E;  1SA4 A;  2DZN A;  2LXM A;  3PS6 A;  1H6P A;  5FQ7 A;  2RFM A;  4ATZ D;  3SF4 A;  2WXJ A;  5FIN A;  5LX8 A;  3MX3 A;  4BET A;  4DUI A;  3AG3 E;  2BED A;  4F1P A;  3ZGQ A;  3QOU A;  4Q96 A;  4JW1 A;  2XZT G;  1O5M A;  3DXK G;  1N9A A;  4NUR A;  2EIK E;  3ASN E;  3MKQ A;  3MA5 A;  4W9R A;  1HFA A;  2FO7 A;  2Y0B G;  4G24 A;  2Y69 E;  3EUV A;  4CDM A;  1BU9 A;  5ENO D;  5G05 C;  4B89 A;  2WXQ A;  3UIN C;  3HRA A;  1IXV A;  4I6J A;  1O1T A;  3V79 K;  4AVX A;  3AG2 E;  4N5Q A;  3R7R A;  2IY0 C;  3Q7F A;  3MEK A;  4CZ2 D;  5M72 A;  2C0L A;  3LJN A;  4HOT A;  1TNZ A;  4EQF A;  2I1J A;  4TXR A;  4UWF A;  4FU3 A;  4GYW A;  3UTM A;  1OXJ A;  5JHA A;  1OWN A;  3DPD A;  1TEZ A;  4AY5 A;  5C2Y A;  3ZYK A;  2CFU A;  4HVB A;  2KBX A;  5AQB A;  3W9F A;  1B89 A;  3ISM C;  3FTW A;  3CVV A;  2ZIS A;  4B94 A;  4J8F A;  4CDN A;  1ZBP A;  1TYQ G;  4GTM A;  2KCL A;  2XPI A;  4OVV A;  3EU5 A;  1IKN D;  1W3B A;  1E8Y A;  4WND A;  3FUI A;  4J8Y A;  2WXF A;  3CV0 A;  2DCP A;  4JL0 A;  4X8Q A;  4OVU A;  3G2V A;  1EDU A;  2QZA A;  1SVX A;  2BUG A;  4U96 D;  4UWG A;  2A4Z A;  3AS4 A;  3NB2 A;  1WM5 A;  3NQP A;  4KVM A;  5LCW J;  1QBQ A;  5CED B;  4G1T A;  3OAW A;  2VGX A;  3T9K A;  2RD0 A;  4ANU A;  4J8E A;  1UW4 B;  2EIN E;  2V5F A;  2YHE A;  3UT8 A;  1EPU A;  3D9M A;  4U7E B;  3I5P A;  2OVB A;  2JEK A;  3T8M A;  4ABN A;  4KXK B;  1YA0 A;  2IO3 C;  4WNG A;  3L54 A;  4Q69 A;  2L9B A;  3EHN A;  1HX8 A;  1E7V A;  4GYY A;  2H6I A;  2MRI A;  5ENN A;  1E8W A;  2WB2 A;  3FUE A;  3NOG D;  3FTS A;  5KJL A;  1K3Z D;  3UM2 A;  4MLP A;  2F37 A;  2A5E A;  4K5C A;  1TN7 A;  3D9I A;  3FUH A;  3DSS A;  2GRR B;  3QWP A;  5KNG A;  4DLQ A;  1ELK A;  3Q75 A;  1DCE A;  2LSU A;  1U3C A;  1N4R A;  4I9E A;  4JPS A;  3PH0 C;  5A7D B;  4WUY A;  3IKO B;  4TXP A;  3D9P A;  4GTT A;  3BG1 B;  4OAU C;  3RRN B;  4KT6 B;  4ILI A;  3CVQ A;  4DX6 D;  3ESK A;  3PZ1 A;  5AAR A;  1JCS A;  2ETB A;  2AWI A;  2X6I A;  4C48 B;  2WXG A;  2GRQ B;  4FP7 A;  1TN6 A;  3EIJ A;  4AM9 A;  2UY1 B;  1MX2 A;  3FWV A;  3SGH A;  3ULE G;  2V5Q C;  3HXB A;  3CHP A;  3D9O A;  1O1R A;  3UIO C;  2VSY A;  3FTV A;  5AQ9 A;  3FEX A;  4LSZ E;  2I9C A;  5CMW A;  3HG0 D;  4EZJ A;  4DRX E;  1UN9 A;  3O4Z A;  3HVE A;  4IUL A;  3FH8 A;  4Y6C A;  5EX3 A;  2ZGG A;  4GA0 A;  3ASF A;  4NIK A;  1RW2 A;  2CFZ A;  3HDX A;  4KZ0 A;  4KYO B;  2XPZ A;  5CRU A;  3DSX A;  4L7T A;  2FO1 E;  4EPZ A;  3MJW A;  2WPV A;  5ENS D;  4L2Y A;  2OV8 A;  5CER B;  2ETA A;  4GPK A;  4I6G A;  2QYU A;  3UM0 A;  1D8E A;  3B7U X;  4GZ6 A;  4U0Z A;  4MKT A;  3PEU B;  3EJN A;  3CKC A;  1WY6 A;  5BT1 A;  2XEV A;  5ENT D;  3CEQ A;  1BI7 B;  3CST A;  3UM3 A;  1FT1 A;  1SW6 A;  3TJP A;  5ENR D;  3OTN A;  3B7T A;  2B6C A;  3Q9N C;  3JQ1 A;  5JA4 D;  2J9Q A;  2HR2 A;  2HE0 A;  1H2T C;  2AJA A;  4GA1 A;  2EIM E;  1E96 B;  2JAB A;  1K1B A;  4YDE A;  1N4Q A;  2IJG X;  5FZS A;  3TWW A;  3AU4 A;  3PDN A;  2XGO A;  3FU0 A;  1D8D A;  1TR4 A;  3DPY A;  1XGW A;  3FUN A;  4B93 B;  4GA2 A;  3E33 A;  1OT8 A;  3UM1 A;  3C98 A;  5BNW A;  5HKP A;  4GZ3 A;  2R59 A;  1N0R A;  2LUH A;  3TAX A;  5BUZ A;  3QKY A;  5JJ7 A;  3QAR A;  1KZP A;  3KD7 A;  2AXU A;  3AG1 E;  3Q15 A;  4IRU A;  3LKU A;  3LXU X;  2VSN A;  3PUJ A;  4BT9 A;  3PE4 A;  2JLB A;  1NP7 A;  2KCK A;  1Y8M A;  1EF1 C;  4I6E A;  3VTY A;  2Y3A A;  4CGW A;  3QDN A;  3L13 A;  3UMV A;  2OVF A;  2LO6 A;  5EDS A;  2KC7 A;  3C3O A;  3FP3 A;  3EHQ A;  2XRY A;  3CIA A;  1TNO A;  5D66 A;  1TNB A;  4B8C B;  4J8D A;  2A5U A;  1HG2 A;  3JUI A;  2GRL A;  5KJN A;  2L0T B;  3CHM A;  3S2A A;  1RZ4 A;  4GZC A;  5AYW D;  3HXC A;  4AP2 A;  3JQ0 A;  1NA3 A;  4J7W A;  4C9B B;  3TL5 A;  2F8X K;  3NZU A;  3LYA A;  2OND A;  3AS8 A;  1H6K A;  5LP0 A;  5KBA A;  5G55 A;  4U95 D;  5FWQ A;  4MBG A;  3BU8 A;  1S63 A;  2V4L A;  1Z3X A;  1FT2 A;  3IXE A;  2J8S D;  2XPY A;  3NF1 A;  2GRP B;  5E75 A;  4IYP A;  1MJ0 A;  1QYM A;  4GMR A;  3FFL A;  3ABM E;  3ZKJ A;  4UQX A;  3SI5 A;  1OCR E;  4WNF A;  1ZU2 A;  5CRV A;  1BI8 B;  3PZD A;  1O1S A;  4Y6W A;  3Q78 A;  4LER A;  3VTX A;  5FQ8 A;  2WQ6 A;  3DEO A;  3E4B A;  3UKR G;  2FF4 A;  3FY4 A;  3PZ3 A;  4GTP A;  2PL2 A;  2WXI A;  4XI0 A;  4HRM B;  2DYS E;  2NYJ A;  3S7J A;  3RU0 A;  4E85 A;  3U4T A;  1NL4 A;  3G2S A;  3FDH A;  3D9H A;  3HXE A;  3U66 A;  2PZI A;  2WXO A;  5LOZ A;  1HE8 A;  2H6F A;  4QFV A;  4AV7 A;  2XEN A;  4HB5 A;  4M3O A;  3LCA A;  5EYP F;  4I17 A;  4FLH A;  4G11 A;  2X6J A;  2X6H A;  3KEA A;  4NRH B;  3PZ2 A;  1N54 A;  2VSX E;  3PNL B;  1UOH A;  2RFA A;  5D2M C;  1HZ4 A;  4FUL A;  3AJI A;  2AW6 A;  3Q7A A;  4HOU A;  4DPR A;  4UQY A;  2ZGD A;  5FJY A;  2J09 A;  1INZ A;  3CKB A;  3Q47 B;  1OY3 D;  1HS6 A;  4LG6 A;  1MX4 A;  5A6C A;  4BTA A;  2H6H A;  4O6F A;  5JJT A;  4URK A;  3L9T A;  1BPO A;  4I1A A;  1OWP A;  1MZC A;  4G8L A;  4GML A;  2WMN A;  3ENE A;  2WQ7 A;  3SD5 A;  3TWX A;  1HH8 A;  4APO A;  2WQH A;  1OWO A;  4GPM A;  3ZEF A;  1Z5S C;  3LS8 A;  4HFG A;  4BSX A;  5H7P A;  3ZRH A;  2LSV A;  3U64 A;  5EKQ D;  2XS1 A;  4GCO A;  4F7A A;  3UUX A;  2UY1 A;  3ZUV B;  5T8I A;  3CQC B;  2M63 A;  4FC8 A;  2X6F A;  5DIZ A;  3AAA C;  5CCM A;  4XI9 A;  1IQU A;  3PUK A;  3V30 A;  1SZA A;  4AY6 A;  3V31 A;  2R05 A;  4BX8 A;  2XQ0 A;  4L2L A;  3FUK A;  3PE3 A;  2VTB B;  3LDZ A;  1A17 A;  4DX7 D;  2P9I G;  2WXP A;  1Y6I A;  3ASO E;  2WXM A;  3SFZ A;  2AXV A;  2Q7F A;  2HM8 A;  2I2O A;  1ZB1 A;  3I4G A;  2FBN A;  2P9L G;  2F0Y A;  2YNQ A;  5FZQ A;  1JWF A;  3ABK E;  3ML9 A;  4HOR A;  2AVP A;  4YDW A;  1UJJ A;  4WWN A;  1UN8 A;  4FJY A;  2GRN B;  3TWV A;  4EZK A;  3UI2 A;  3ZNG A;  3WXX A;  4IN3 B;  3FHE A;  3HXD A;  3IBE A;  5B1A E;  3RSE G;  3GZ1 A;  4J0U A;  3D9J A;  2PQR A;  4EBA A;  4A3T A;  3CVL A;  1MX6 A;  4JHJ A; 
#chains in the Genus database with same CATH homology
 3JXI A;  2DZN A;  5ENT D;  3EHR A;  3D9H A;  4O1P A;  1BI7 B;  4DX2 A;  5HRY A;  3UXG A;  3SO8 A;  1NFI E;  3NBN B;  3J5Q B;  2RFM A;  4ATZ D;  3NOC D;  4OAU C;  1SW6 A;  4U8V D;  4UUC A;  1IKN D;  5ENR D;  3ZUV B;  2DVW A;  5ITZ F;  4HLL A;  1YYH A;  4BER A;  3Q9N C;  3EHQ A;  4QFV A;  4DX6 D;  1BD8 A;  5AAR A;  5JA4 D;  3V2X A;  5JMN D;  2DZO A;  3AAA C;  4U8Y D;  4J8Y A;  5D66 A;  2B0O E;  5AQ7 A;  4DX5 D;  2XEN A;  4HB5 A;  5FIN A;  4K5A B;  2VGE A;  5EYP F;  4BET A;  4BSZ B;  2ETB A;  5KWD A;  4G8K A;  2BKG A;  4DUI A;  3B7B A;  5HS0 A;  4F1P A;  2P2C P;  3KEA A;  5FIO A;  4C48 B;  2ETC A;  2V4H C;  3T8K A;  3B95 A;  3J5P A;  3TWQ A;  1WDY A;  3V30 A;  1AWC B;  2HE0 A;  2DWZ A;  1SVX A;  2XZT G;  5EYL A;  4U96 D;  4Z68 A;  2AJA A;  3V2O A;  5EID A;  1MX2 A;  2QC9 A;  3V31 A;  4HNA D;  2JAB A;  5BXU A;  2V5Q C;  5CED B;  1K1B A;  5CBO A;  1A5E A;  3T9K A;  1UOH A;  2RFA A;  5ENQ D;  4J7W A;  3DEP A;  5AQ9 A;  4K5B A;  3JUE A;  4HI9 A;  3TWS A;  3TWW A;  3AJI A;  2F8X K;  4HI8 A;  2L6B A;  1AP7 A;  2Y0B G;  4LSZ E;  2PNN A;  4CYM D;  5ENP D;  4DX7 D;  1N11 A;  1G3N B;  2XZD G;  4YDY A;  1IHB A;  1TR4 A;  5KBA A;  3TWR A;  3HG0 D;  5EIB E;  5ENO D;  3TWU A;  4DRX E;  1BU9 A;  1D9S A;  4U95 D;  4BEP A;  2Y1L E;  3HRA A;  3Q9U C;  2ZGD A;  3ZU7 B;  4B93 B;  1IXV A;  1OT8 A;  3IXE A;  4O1O A;  2ZGG A;  2BKK B;  2J8S D;  5HKP A;  3V79 K;  5AAO A;  5CEC B;  1OY3 D;  2XEH A;  1N0R A;  4LG6 A;  1MX4 A;  1K1A A;  3F6Q A;  2QYJ A;  4N5Q A;  2KXP C;  1WG0 A;  5EIL A;  4NIK A;  1N0Q A;  1MJ0 A;  1QYM A;  3EU9 A;  4GMR A;  4ZFH A;  2MYO A;  4HQD A;  4HRL A;  1DC2 A;  3ZKJ A;  4YDW A;  4CZ2 D;  4HRN A;  5KNH D;  3LJN A;  2FO1 E;  1S70 B;  3TWT A;  3NOG D;  4RLY A;  1DCQ A;  4LNU D;  3TWV A;  1BI8 B;  2XEE A;  3UI2 A;  3ZNG A;  1K3Z D;  4QQI A;  5BXO A;  5CEA A;  4A63 B;  1YCS B;  2F8Y A;  1YMP A;  2F37 A;  5ENS D;  4ZHB A;  3DEO A;  4G8L A;  2A5E A;  5CER B;  4K5C A;  4TUM A;  2ETA A;  3UTM A;  4F6R D;  5AQA A;  4O60 A;  5CBN A;  3TWX A;  4BES A;  3C5R A;  4HRM B;  5KNG A;  3JXJ A;  1BLX B;  5EN5 D;  4HBD A;  2KBX A;  2NYJ A;  5AQB A;  3W9F A;  1MYO A;  4GPM A;  1MX6 A;  4OAV B;  4DX1 A;  5AN8 A;  4JB8 P;  3W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...