4Z68A

Hybrid structural analysis of the arp2/3 regulator arpin identifies its acidic tail as a primary binding epitope
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tankyrase-2
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4z68A00
4CYMD 4ATZD 1K3ZD 3LJNA 4B93B 1SVXA 3SO8A 5CBNA 1WDYA 5KNGA 1K1BA 4J7WA 5CEAA 3NOCD 4OAVB 3UXGA 3HG0D 5ENRD 4DRXE 2B0OE 2QC9A 4DX7D 4ZHBA 1OY3D 5EYPF 5FIOA 1MYOA 3UI2A 1AP7A 4O1PA 4F1PA 3TWXA 5AN8A 3T8KA 4O1OA 4HRLA 2RFMA 3JXJA 2J8SD 3JXIA 2ETAA 5AARA 2PNNA 4BERA 4DUIA 1D9SA 2KXPC 5EIDA 3HRAA 3F6QA 1MX6A 3ZUVB 3KEAA 3DEPA 5EIBE 3V30A 2DZNA 3V2XA 5ENOD 2XEHA 1N11A 4DX2A 1K1AA 4DX5D 4Z68A 3J5QB 4G8KA 5EILA 5AQAA 4ZFHA 5AQ7A 2ETBA 5CERB 4BESA 2ZGGA 2AJAA 4HQDA 2XZTG 3TWVA 2F8YA 3W9GA 5KBAA 1AWCB 5BXUA 1YCSB 3B95A 2VGEA 3V79K 5ENQD 5HKPA 3ZKJA 4BETA 4J8YA 1G3NB 3D9HA 2ETCA 2ZGDA 1BI7B 1BU9A 2FO1E 1S70B 4GPMA 2DVWA 4LG6A 2A5EA 5KWDA 2F8XK 3V2OA 4U8VD 5AQ9A 4C48B 1BI8B 4YDYA 2KBXA 2JABA 4O60A 3TWQA 2QYJA 3ZNGA 5ENSD 3TWUA 1DCQA 2BKKB 4F6RD 1TR4A 4U96D 4JB8P 1IXVA 4LSZE 4LNUD 4DX6D 4RLYA 4GMRA 3NBNB 1YMPA 4HRNA 3EU9A 3V31A 1SW6A 3W9FA 1OT8A 3Q9NC 4N5QA 2V5QC 2XENA 3C5RA 3IXEA 1A5EA 2F37A 3TWSA 2P2CP 3B7BA 2BKGA 4BEPA 4HI8A 5ENPD 2MYOA 4NIKA 3Q9UC 5AAOA 2Y1LE 3AAAC 2Y0BG 5HS0A 3J5PA 5ENTD 3AJIA 4U95D 5JMND 4G8LA 3TWRA 5HRYA 3NOGD 4HNAD 1MX2A 1MJ0A 4DX1A 2V4HC 5EYLA 2NYJA 5EN5D 4OAUC 1BLXB 2XZDG 1NFIE 1IKND 4QFVA 5AQBA 5ITZF 3UTMA 4QQIA 4HB5A 1UOHA 4HLLA 4YDWA 2DZOA 5FINA 1BD8A 3EHRA 3ZU7B 4TUMA 2RFAA 5KNHD 3DEOA 4U8YD 2XEEA 1QYMA 3TWWA 4K5BA 5CEDB 4HBDA 1IHBA 1WG0A 5JA4D 3T9KA 4UUCA 1MX4A 3JUEA 4K5CA 1N0QA 2HE0A 2L6BA 3EHQA 5D66A 4BSZB 5BXOA 4K5AB 5CECB 1N0RA 4HI9A 3TWTA 4A63B 2DWZA 1YYHA 4CZ2D 4HRMB 1DC2A 5CBOA
chains in the Genus database with same CATH superfamily
4ATZD 4EZLA 2GRQB 3CVNA 4TV3A 3SBTB 2VGXB 1HH8A 1LD7A 1Y8MA 5EYPF 3T8KA 4KXKB 3JXJA 4ATGA 4B0ZA 2KXPC 3F6QA 2FF4A 2R03A 2WXQA 4YNDA 4G8KA 2WM9A 2KCKA 2XHEA 3NZUA 1N94A 3FU6A 4BETA 3DSVA 3PZ3A 2FO1E 4A3VA 3QDNA 4GPMA 4BFRA 5LCWJ 2PM7A 4HOSA 3HXCA 4GZDA 3AU4A 1YMPA 3UQ3A 3W9FA 2V8SE 3K9IA 2EIME 2WPVA 3SFXA 2JEKA 4I1OB 3PNTB 3FUIA 3TXMA 1NZNA 5EYLA 4H7XA 3RRUA 2FO7A 3ASHA 3D9IA 1X5BA 3CSTA 3B7UX 1Y6IA 4JD2G 2L6BA 5D66A 5M72A 4U8HA 4HI9A 3DSXA 1TN8A 2BUGA 5CBOA 2WXKA 5FZQA 3QKYA 4JC8A 2QC9A 1ZB1A 2VJ8A 4RVBA 1GW6A 1KZOA 2H6IA 2YHCA 3RJVA 1Z3YA 2V0PA 2CHXA 4XKBA 3PS6A 4Z68A 1FT1A 2YINA 2DYRE 4YDEA 4KVOA 2X6KA 4UWGA 3B7SA 4J8YA 1BPOA 3PEVB 3S7FA 3TWQA 3SBSA 4XKCA 3FH5A 2AW6A 4ANXA 2J4BA 3MA5A 5G55A 4HOUA 3U66A 4DPRA 2RG8A 3AG1E 2E2EA 2WQ6A 3D9KA 4FADA 1X81A 2C0MA 3OXLA 2YNQA 2DBAA 1ELRA 1H6OA 2NYJA 3U64A 2LO6A 4EZJA 4QFVA 2CFUA 3HXEA 2I1JA 4UWHA 3FY4A 2FBNA 2IFUA 5KNHD 2XEEA 4ANWA 3CHRA 3FH8A 4UQZA 3T5XA 2X6FA 4APFA 2ONDA 1UN8A 3C72A 1E7UA 2WXJA 3NB2A 1K1BA 1FPPA 5CEAA 3D9LA 3UXGA 2DIWA 4DX7D 3CEQA 1HE8A 2V5FA 1INZA 4PS8A 2H6HA 2WQHA 3JXIA 2ETAA 3FTYA 2CG3A 3PREA 5EIBE 3D9PA 2XRYA 4A3TA 1N11A 4RG6A 1W3BA 5AENA 2PQRA 3ULQA 2P9IG 3Q47B 3UM0A 4DJAA 4C0EA 1BI8B 3LJ3A 4XX5A 3E30A 3EU9A 4JPSA 4A1GA 3RK6A 1D8EA 4L2YA 1L5JA 3R9AB 1UW4B 3CVXA 3Q7FA 3KAEA 1OWPA 4ACKA 4APOA 4HVBA 1WM5A 1NI1A 2DCPA 3JUIA 3FU0A 2C0LA 2P9NG 2RFAA 3S2AA 2OOEA 4GTOA 3T9KA 2KATA 3EU5A 2XGSA 4A63B 3S7JA 3IV0A 3MX3A 4WNFA 5JJTA 3QWPA 4BT9A 5CHEE 4BERA 2CHZA 2P9LG 4BWRA 4TUUA 3WXXA 2ZGGA 3E34A 4HQDA 2RD0A 5KJLA 3W9GA 3B95A 3FU3A 4YVOA 2VGEA 2LXLA 3VLFA 3ZYMA 1BI7B 3FUJA 1O5MA 4LG6A 4UWFA 4I2WA 3NQPA 1OWLA 4FU3A 1DCQA 1JWFA 5D0OD 5C1DA 5CRVA 3O48A 3ZYLA 4M7CA 4HOTA 3V31A 4OYSA 2OCCE 3FP3A 4UI9K 5EX0A 2X6HA 2XGOA 5JHBA 2HYZA 3QK0A 3J5PA 4U95D 3BEEA 4CCAA 1TJCA 3P2BA 3SFYA 1UG3A 2R05A 2V4HC 4N2QA 2X38A 1BLXB 1N52A 5FZRA 3RSEG 4PUCA 2XS8A 5AJLA 1OCRE 5D2MC 3SD5A 4KZ0A 2DZOA 1VDYA 3PNLB 3JCKC 3CLJA 4IRUA 2MHKA 5T4YA 2WXHA 1RZ4A 3L9TA 2IU1A 1ELKA 3SO8A 2F0YA 4B89A 3CQGB 4OVUA 3G2SA 2CG2A 5BPPA 4CGWA 4J8FA 2EQXA 4DUIA 2XEVA 4BX8A 3FEYA 4JZYA 3V30A 3UT4A 2KZTA 1K1AA 5C2YA 2HR2A 1ZU2A 5AQ7A 4L7TA 2A4ZA 3SFZA 3HVEA 3N71A 3UKRG 1LF8A 3GZ2A 3D9HA 3QWVA 3DSSA 4Y6CA 3CHSA 4V3IA 5FJYA 3PE3A 2BKKB 3X2QE 3CGHA 2UWJG 4YDOA 1OT8A 3SQVA 5KJMA 3E37A 2VSXE 4BEPA 3KD7A 4K0RA 4NIKA 4LCTA 4BTAA 4TXPA 4C0MA 5LFAA 2VGYA 4TXQA 1JCSA 1MZCA 3EDTB 5JMND 2XCCA 5LCWC 4UWLA 3UIPC 1EDUA 3QWWA 4GTPA 3T5VA 5EX3A 4JW1A 2PZIA 5CEDB 4B8CB 2FI7A 2LSVA 1IYGA 4GCOA 1MX4A 3LY9A 1N0QA 3EHQA 5IY5E 1YYHA 2GROB 2R2LA 3TAXA 5HI7A 4HLEA 4OAVB 5ENRD 5FIOA 5AARA 2PNNA 3ZUVB 2Y4UA 4HOQA 4DX2A 4DX5D 3ASOE 2GRPB 1A17A 3LVRE 2M63A 3LXUX 3I4GA 3CHPA 5EDSA 2WMNA 1YCSB 3KS2A 4J0UA 4AM9A 4EECA 1G3NB 3FTUA 1YA0A 1E90A 3TWUA 2BF0X 3DXKG 3EIJA 1IXVA 2Q7FA 4RLYA 4DI3A 3NBNB 4GMRA 4HRNA 3TXNA 4AP2A 4FULA 4GTQA 4J6IA 2WXFA 5AAOA 3B7RL 1E8ZA 5KCMA 4MS6A 2OVBA 2EIKE 3Q75A 4KBQA 2KM4A 3QAQA 1HO8A 2NSZA 1HU3A 3HIZA 2J4DA 4N5CA 3CHOA 1HS6A 1UOHA 3CVUA 4F1SA 2X6JA 2OEWA 4IYPA 3ML8A 2CFZA 3TWWA 4CT0A 3JUEA 4FJZA 1V55E 2X3MA 3ZXSA 1MHQA 4U0SA 5B1AE 5BV1A 4JEHA 3G2WA 5T3RA 4F1PA 3JQ1A 3LDZA 2Y4TA 3G2TA 3G2UA 4WNGA 1UJJA 2L0IA 4JHJA 3QJZA 5EILA 5AQAA 1LD8A 2P9PG 3SI5A 3ONLA 3L08A 4LUNU 3ULYA 3JYSA 3ZKJA 3ESKA 1BU9A 2WXRA 4U7EB 3MV2B 1Z5SC 1B89A 3UMVA 4YVQC 2AXZA 4F3VA 5A23A 3LY8A 1N9AA 2V5QC 3C5RA 3MKRA 4GZCA 4U07A 4HXIA 2NC9A 4ABNA 2BKGA 4U0ZA 4LERA 4LRZA 3TWRA 3NOGD 5BV0A 3TL5A 5DIZA 4Q96A 1P5QA 2WXNA 4B8AA 3ZGQA 2GW1A 2IJGX 2ZISA 1U2VG 3CHMA 4ANVA 4TUMA 3RRNB 3DEOA 4X8QA 5E76A 1QYMA 3PEUB 3VLDA 2UY1A 3FFLA 4KMOA 4BSZB 3LEWA 4K5AB 4JA9A 1K3ZD 3CHQA 3CVPA 3FTXA 5KNGA 3TJPA 4XI9A 2AVPA 4DRXE 2B0OE 4ZHBA 1AP7A 3UI2A 3FH7A 3VTYA 3R7RA 4PS3A 5EIDA 4TXRA 3FUHA 3MCXA 3KEAA 3C3OA 5FQ7A 5KJKA 3OXGA 4LEUA 4XE0A 2IONA 3RO2A 3ABKE 4I6JA 4GB9A 3ZHEB 2IF4A 4J8SA 1K8KG 3PDNA 3ZPJA 5H7PA 5JJ7A 4MRUA 1QZ2A 2XQ0A 2QYJA 4HS2A 4M3OA 2EIJE 1JWGA 2XRZA 2MRIA 1H2UA 2WXPA 3LKUA 4G25A 4ACLA 4BSXA 4I43A 5E75A 2GRRB 3SGHA 1FVFA 4NRHB 3IEGA 4GTSA 2IEJA 3FUNA 4G8LA 5HRYA 3URZA 4CRWA 2J07A 5FT9A 4QQIA 2AXUA 4HB5A 4AVXA 1BD8A 3ULEG 4WWOA 3ZHEA 3QB2A 2IO2C 3CVVA 4AV7A 1TEZA 5FTPA 3WG7E 3JQ0A 4GU5A 3U4TA 2A5UA 1WDYA 2LUHA 2C2LA 4RSYA 5J08A 4GCNA 4N3CA 3TWXA 5AN8A 3FDHA 3LS8A 1JUQA 2FEZA 2J8SD 3SNXA 3OXFA 1MX6A 3AS4A 3BG1B 2CHWA 5ENOD 1XNFA 4I9CA 2GRNB 4MBGA 2RKKA 2EILE 2QY7A 3Q15A 4FC8A 2DVWA 1N95A 4UQYA 4C48B 3PE4A 1N4RA 5J90A 2VQ2A 4U96D 2LNIA 4LNUD 1TNZA 2XENA 3ZEFA 3TWSA 3B7BA 2J9QA 3DRAA 1V54E 4AY5A 1OWNA 2J49A 3CK9A 3HXBA 4WUYA 3SZ7A 4Q69A 4JEUA 4GZ3A 4OAUC 3ASFA 1MQSA 3CVYA 4C9BB 4GTTA 1KPSB 1Q2ZA 2ILRA 4EBAA 3EHNA 4XI0A 3D3MA 4K5CA 2BEDA 2HE0A 2NXPA 5CECB 1KT0A 4NACA 4CZ2D 3O4ZA 1FCHA 3SHFA 3CK7A 3L17A 5DBKA 2JLBA 4J7WA 2V4LA 3HHMA 4N2SA 4O1PA 3PUKA 2VSNA 4HRLA 1D9SA 1WAO1 1N4SA 2E0IA 4UQXA 1O1TA 1ELWA 3T8MA 1SZ9A 5AYWD 2J08A 4NQ0A 4EHMA 1QQEA 2XEHA 3DXMG 3Q78A 1SA4A 3VLEA 1N4PA 1RW2A 4FHJA 2IOSA 4R7LA 4G1TA 2KBXA 4K03A 3CKCA 4F6RD 1N54A 2WMOA 3GZ1A 2P9SG 4DX6D 3D9MA 2ZXWE 1A5EA 4A1SA 4GTRA 4URKA 1S0PA 3QARA 3Q9UC 1UN9A 3MV3B 3UPVA 3P1UA 1O1SA 2GRLA 4L23A 4KVMA 4AOFA 1N4QA 1H6KA 3E33A 1TNYA 3ASDA 4AEZC 2ZU6B 2R17C 3UTMA 4E6HA 3B13A 1NA0A 2GRMA 1HXIA 4FHKA 3UM2A 3Q5MA 3FTWA 2BTDA 2OEVA 4FJYA 1HG2A 3FWVA 2X6IA 2I1KA 2HO1A 4PDXA 4ME2A 3PRZA 3PZDA 1EPUA 2WQ7A 3KSQA 3FUMA 4KT6B 3Q49B 2XPYA 3PVLA 4MLPA 3C98A 3AS8A 2VTBA 1Z3XA 4BTBA 3C3RA 2LAHA 3Q73A 5FWQA 3OTNA 1WY6A 2DZNA 3AG2E 1D8DA 5CRUA 2IY0C 3VTXA 4A55A 4ZFHA 2UY1B 3TWVA 2H6GA 3MZLB 3FEXA 3MYVA 3CSFA 3ZXPA 3V2OA 1HF8A 4I2ZA 2R59A 1TR4A 4F7AA 1PY1A 1DNPA 5D0QD 3E4BA 3GYZA 3FHEA 5KJNA 1H0AA 4U04A 4HI8A 2FULA 5CCLA 4MKTA 3AG3E 2R02A 1H2VC 5HS0A 3CVQA 4DX1A 3D9JA 2ZIRA 4AY6A 4AIFA 4N3BA 3SY2A 2R5SA 2P9KG 5JA4D 4GPKA 1JCQA 2WXMA 3EJNA 3LCAA 2PM6A 4GA0A 1HZ4A 4NURA 3UUXA 1DC2A 3MJWA 1TYQG 4I9EA 2L6JA 3LJNA 4B93B 3FU5A 3NZSA 4PH4B 1IQRA 3UT7A 4G23A 1OY3D 1MYOA 3GW4A 3ZFWA 3DEPA 3HDXA 3BG0B 2XPIA 4XEIG 2DYSE 5LX8A 4ILHB 2VSOE 4IN3B 5CERB 2ETBA 3FUDA 2I6HA 1SA5A 2XZTG 1OCZE 5AJDA 3BUAA 2L9BA 1SQMA 4KZCA 5BXUA 2P9UG 2L0TB 4H7YA 1S70B 4JHRA 2A5EA 4E85A 2H6FA 3ONKA 5FQ6A 5CMWA 1DVPA 4GA1A 4G24A 4GZ5A 4LSZE 4Y6WA 2PL2A 4Q94A 1SW6A 4GA2A 2XGMA 5JHAA 4B94A 4I6EA 3CKBA 4UI9J 1XGWA 4I6GA 3ZIMA 3APCA 5HQ8A 3KEZA 3Q4AB 3AAAC 2Y0BG 2GGFA 3UINC 4HNAD 4L1BA 4F53A 2XZDG 3NF1A 1EF1C 3FUKA 3MEKA 3ZU7B 4GAAA 3HXFA 1IHBA 4GTVA 3ZYKA 1FT2A 3ENEA 3RKVA 3ESLA 5BXOA 3BU8A 1ZBPA 1E8XA 1TN7A 1NL4A 1O1RA 4RG9A 2VGXA 3DPDA 3HG0D 4J8EA 3AS5A 4D10C 4JA7A 1IQUA 2LAIA 5G05J 3HYMB 2PQNA 5T8IA 1E96B 2IO3C 3V2XA 3ZYQA 3CIAA 4ILGA 4CT4A 2AJAA 3FTVA 4EZKA 1AWCB 3HVEB 3CVWA 2I2OA 5ENQD 2IQCA 4WNDA 2ETCA 2ZGDA 3ML9A 4U8VD 5AQ9A 1U3DA 2KCLA 4O60A 3ZNGA 2MOWA 3Q79A 3LVQE 3UIOC 2VSYA 3ABLE 2WXGA 5ANLA 3IHYA 3L82A 2F37A 1U3CA 3SF4A 4KYOB 4GMJA 1UJKA 3TG5A 1TJFA 4W9RA 5ENTD 2XCBA 1NFIE 1IKND 5AQBA 4AXHA 4JL0A 4ILIA 2B6CA 4P29A 4U8YD 1KLXA 1WG0A 3I3NA 3G2VA 1N0RA 1IHGA 3EUVA 3QOUA 4CYMD 3CV0A 5A7DB 5AIJA 3BQOA 1E8WA 3L13A 5ARGA 1FVHA 2YQ8A 4XZ4A 2EINE 3EIQC 4ANUA 1E7VA 2RFMA 3ASNE 2J09A 4CGVA 1HFAA 3UKUG 2IOLA 3U9WA 4LNGA 1HG5A 2QFCA 4GYOA 4EPZA 2WB2A 3UM3A 4FLHA 2WXOA 2HM8A 3IBEA 3R7QA 1DCEA 2I9CA 3L22A 4YDYA 4TRQA 2JABA 4GTMA 4U63A 5ENNA 3UM1A 1JPLA 3DSWA 4JB8P 3CR3A 1TNBA 3UX4A 4WWNA 2LXMA 3OAWA 3Q9NC 4N5QA 4I1MA 4PS7A 4I17A 2P2CP 4WNEA 5CMYA 2Y69E 3IKOB 3C3QA 5ENPD 3L6AA 3NAWA 4CEMA 2KC7A 3AJIA 5BNWA 1E8YA 4CDNA 3IHVA 3MKQA 2KZTB 3APFA 4DI4A 4FP7A 3D9NA 3EHRA 1OWOA 5G04J 4UUCA 4UI9C 4WWPA 2OV8A 5FZSA 5B1BE 3TWTA 5LOZA 1SVXA 1OCOE 5CBNA 1S63A 3NOCD 4O6FA 1HX8A 3PZ4A 4O1OA 3DBSA 1NP7A 3DSTA 3HRAA 3LY7A 1OWMA 3KSLA 1NA3A 4CDRA 3J5QB 3FUEA 4BESA 3ISMC 4BT8A 3I5PA 4BX9A 3V79K 2WXIA 4HORA 2F8XK 3DPYA 5JJ6A 3RU0A 3ASGA 4U0UA 2XS1A 3L16A 1PAQA 5G05C 5BT1A 3AU5A 2YHEA 5ARFA 4J8DA 1TNOA 1LTXA 5G04C 4G2VA 4L9PA 2QZAA 3PH0C 5EKQD 3UT8A 3L54A 2P58C 4N3AA 4JXTA 3PZ1A 3ZN3A 4DLOA 2MYOA 3D9OA 4LNBA 2Y1LE 3AG4E 4AJWA 3S7BA 2AWIA 2AXVA 3MGBA 5BUZA 1QNFA 4EQFA 3S7DA 1MJ0A 4HFGA 3PUJA 5EN5D 1KZPA 4YDWA 3QC1A 4OVVA 4FLBA 4JHKA 4BY6A 3ZRHA 4DK5A 3RAUA 3LYAA 2WXLA 3QNKA 1S64A 5A6CA 2DWZA 5KWDA 4HRMB 5B3SE 3Q7AA 1QBQA 3FTSA 1OUVA 5ANRA 4N39A 2OVFA 3ABME 3CQCB 3EHMA 1PC2A 4GYYA 3DSUA 5FQ8A 3ZW3A 3E32A 1Z6TA 2VYIA 3R9MA 3RRMB 2QYUA 4G11A 2F8YA 3GZSA 5KBAA 1JCRA 4FA6A 1TN6A 3FUFA 3HXDA 5HKPA 4GMLA 5LP0A 5FQ4A 4JVSA 1TNUA 4UWKA 3DWLG 1H6PA 3B7TA 5ENSD 2XPZA 3CVLA 3I4RB 3IXEA 4RQIA 3MKQB 1SZAA 3ZVVA 2VTBB 1OXJA 4DLQA 4L2LA 5BW8C 4EBAG 1MX2A 5G2NA 4GZ6A 3U3WA 1OCCE 3FTZA 5ITZF 4XIFA 4CDMA 1H19A 5CCMA 3CK8A 3TGOA 1KT1A 4HLLA 1H2TC 4GYWA 5FINA 2WVIA 4I1AA 3RIBA 3PZ2A 4K5BA 2Y3AA 4HBDA 1EYHA 4G26A 3LPZA 2LSUA 4IULA 3FULA 4WAFA 3APDA 3TG4A 2KCVA 3RO3A
chains in the Genus database with same CATH topology
4CYMD 4ATZD 1K3ZD 3LJNA 4B93B 1SVXA 3SO8A 5CBNA 1WDYA 5KNGA 1K1BA 4J7WA 5CEAA 3NOCD 4OAVB 3UXGA 3HG0D 5ENRD 4DRXE 2B0OE 2QC9A 4DX7D 4ZHBA 1OY3D 5EYPF 5FIOA 1MYOA 3UI2A 1AP7A 4O1PA 4F1PA 3TWXA 5AN8A 3T8KA 4O1OA 4HRLA 2RFMA 3JXJA 2J8SD 3JXIA 2ETAA 5AARA 2PNNA 4BERA 4DUIA 1D9SA 2KXPC 5EIDA 3HRAA 3F6QA 1MX6A 3ZUVB 3KEAA 3DEPA 5EIBE 3V30A 2DZNA 3V2XA 5ENOD 2XEHA 1N11A 4DX2A 1K1AA 4DX5D 4Z68A 3J5QB 4G8KA 5EILA 5AQAA 4ZFHA 5AQ7A 2ETBA 5CERB 4BESA 2ZGGA 2AJAA 4HQDA 2XZTG 3TWVA 2F8YA 3W9GA 5KBAA 1AWCB 5BXUA 1YCSB 3B95A 2VGEA 3V79K 5ENQD 5HKPA 3ZKJA 4BETA 4J8YA 1G3NB 3D9HA 2ETCA 2ZGDA 1BI7B 1BU9A 2FO1E 1S70B 4GPMA 2DVWA 4LG6A 2A5EA 5KWDA 2F8XK 3V2OA 4U8VD 5AQ9A 4C48B 1BI8B 4YDYA 2KBXA 2JABA 4O60A 3TWQA 2QYJA 3ZNGA 5ENSD 3TWUA 1DCQA 2BKKB 4F6RD 1TR4A 4U96D 4JB8P 1IXVA 4LSZE 4LNUD 4DX6D 4RLYA 4GMRA 3NBNB 1YMPA 4HRNA 3EU9A 3V31A 1SW6A 3W9FA 1OT8A 3Q9NC 4N5QA 2V5QC 2XENA 3C5RA 3IXEA 1A5EA 2F37A 3TWSA 2P2CP 3B7BA 2BKGA 4BEPA 4HI8A 5ENPD 2MYOA 4NIKA 3Q9UC 5AAOA 2Y1LE 3AAAC 2Y0BG 5HS0A 3J5PA 5ENTD 3AJIA 4U95D 5JMND 4G8LA 3TWRA 5HRYA 3NOGD 4HNAD 1MX2A 1MJ0A 4DX1A 2V4HC 5EYLA 2NYJA 5EN5D 4OAUC 1BLXB 2XZDG 1NFIE 1IKND 4QFVA 5AQBA 5ITZF 3UTMA 4QQIA 4HB5A 1UOHA 4HLLA 4YDWA 2DZOA 5FINA 1BD8A 3EHRA 3ZU7B 4TUMA 2RFAA 5KNHD 3DEOA 4U8YD 2XEEA 1QYMA 3TWWA 4K5BA 5CEDB 4HBDA 1IHBA 1WG0A 5JA4D 3T9KA 4UUCA 1MX4A 3JUEA 4K5CA 1N0QA 2HE0A 2L6BA 3EHQA 5D66A 4BSZB 5BXOA 4K5AB 5CECB 1N0RA 4HI9A 3TWTA 4A63B 2DWZA 1YYHA 4CZ2D 4HRMB 1DC2A 5CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYM D;  4ATZ D;  1K3Z D;  3LJN A;  4B93 B;  1SVX A;  3SO8 A;  5CBN A;  1WDY A;  5KNG A;  1K1B A;  4J7W A;  5CEA A;  3NOC D;  4OAV B;  3UXG A;  3HG0 D;  5ENR D;  4DRX E;  2B0O E;  2QC9 A;  4DX7 D;  4ZHB A;  1OY3 D;  5EYP F;  5FIO A;  1MYO A;  3UI2 A;  1AP7 A;  4O1P A;  4F1P A;  3TWX A;  5AN8 A;  3T8K A;  4O1O A;  4HRL A;  2RFM A;  3JXJ A;  2J8S D;  3JXI A;  2ETA A;  5AAR A;  2PNN A;  4BER A;  4DUI A;  1D9S A;  2KXP C;  5EID A;  3HRA A;  3F6Q A;  1MX6 A;  3ZUV B;  3KEA A;  3DEP A;  5EIB E;  3V30 A;  2DZN A;  3V2X A;  5ENO D;  2XEH A;  1N11 A;  4DX2 A;  1K1A A;  4DX5 D;  4Z68 A;  3J5Q B;  4G8K A;  5EIL A;  5AQA A;  4ZFH A;  5AQ7 A;  2ETB A;  5CER B;  4BES A;  2ZGG A;  2AJA A;  4HQD A;  2XZT G;  3TWV A;  2F8Y A;  3W9G A;  5KBA A;  1AWC B;  5BXU A;  1YCS B;  3B95 A;  2VGE A;  3V79 K;  5ENQ D;  5HKP A;  3ZKJ A;  4BET A;  4J8Y A;  1G3N B;  3D9H A;  2ETC A;  2ZGD A;  1BI7 B;  1BU9 A;  2FO1 E;  1S70 B;  4GPM A;  2DVW A;  4LG6 A;  2A5E A;  5KWD A;  2F8X K;  3V2O A;  4U8V D;  5AQ9 A;  4C48 B;  1BI8 B;  4YDY A;  2KBX A;  2JAB A;  4O60 A;  3TWQ A;  2QYJ A;  3ZNG A;  5ENS D;  3TWU A;  1DCQ A;  2BKK B;  4F6R D;  1TR4 A;  4U96 D;  4JB8 P;  1IXV A;  4LSZ E;  4LNU D;  4DX6 D;  4RLY A;  4GMR A;  3NBN B;  1YMP A;  4HRN A;  3EU9 A;  3V31 A;  1SW6 A;  3W9F A;  1OT8 A;  3Q9N C;  4N5Q A;  2V5Q C;  2XEN A;  3C5R A;  3IXE A;  1A5E A;  2F37 A;  3TWS A;  2P2C P;  3B7B A;  2BKG A;  4BEP A;  4HI8 A;  5ENP D;  2MYO A;  4NIK A;  3Q9U C;  5AAO A;  2Y1L E;  3AAA C;  2Y0B G;  5HS0 A;  3J5P A;  5ENT D;  3AJI A;  4U95 D;  5JMN D;  4G8L A;  3TWR A;  5HRY A;  3NOG D;  4HNA D;  1MX2 A;  1MJ0 A;  4DX1 A;  2V4H C;  5EYL A;  2NYJ A;  5EN5 D;  4OAU C;  1BLX B;  2XZD G;  1NFI E;  1IKN D;  4QFV A;  5AQB A;  5ITZ F;  3UTM A;  4QQI A;  4HB5 A;  1UOH A;  4HLL A;  4YDW A;  2DZO A;  5FIN A;  1BD8 A;  3EHR A;  3ZU7 B;  4TUM A;  2RFA A;  5KNH D;  3DEO A;  4U8Y D;  2XEE A;  1QYM A;  3TWW A;  4K5B A;  5CED B;  4HBD A;  1IHB A;  1WG0 A;  5JA4 D;  3T9K A;  4UUC A;  1MX4 A;  3JUE A;  4K5C A;  1N0Q A;  2HE0 A;  2L6B A;  3EHQ A;  5D66 A;  4BSZ B;  5BXO A;  4K5A B;  5CEC B;  1N0R A;  4HI9 A;  3TWT A;  4A63 B;  2DWZ A;  1YYH A;  4CZ2 D;  4HRM B;  1DC2 A;  5CBO A; 
#chains in the Genus database with same CATH topology
 4ATZ D;  4EZL A;  2GRQ B;  3CVN A;  4TV3 A;  3SBT B;  2VGX B;  1HH8 A;  1LD7 A;  1Y8M A;  5EYP F;  3T8K A;  4KXK B;  3JXJ A;  4ATG A;  4B0Z A;  2KXP C;  3F6Q A;  2FF4 A;  2R03 A;  2WXQ A;  4YND A;  4G8K A;  2WM9 A;  2KCK A;  2XHE A;  3NZU A;  1N94 A;  3FU6 A;  4BET A;  3DSV A;  3PZ3 A;  2FO1 E;  4A3V A;  3QDN A;  4GPM A;  4BFR A;  5LCW J;  2PM7 A;  4HOS A;  3HXC A;  4GZD A;  3AU4 A;  1YMP A;  3UQ3 A;  3W9F A;  2V8S E;  3K9I A;  2EIM E;  2WPV A;  3SFX A;  2JEK A;  4I1O B;  3PNT B;  3FUI A;  3TXM A;  1NZN A;  5EYL A;  4H7X A;  3RRU A;  2FO7 A;  3ASH A;  3D9I A;  1X5B A;  3CST A;  3B7U X;  1Y6I A;  4JD2 G;  2L6B A;  5D66 A;  5M72 A;  4U8H A;  4HI9 A;  3DSX A;  1TN8 A;  2BUG A;  5CBO A;  2WXK A;  5FZQ A;  3QKY A;  4JC8 A;  2QC9 A;  1ZB1 A;  2VJ8 A;  4RVB A;  1GW6 A;  1KZO A;  2H6I A;  2YHC A;  3RJV A;  1Z3Y A;  2V0P A;  2CHX A;  4XKB A;  3PS6 A;  4Z68 A;  1FT1 A;  2YIN A;  2DYR E;  4YDE A;  4KVO A;  2X6K A;  4UWG A;  3B7S A;  4J8Y A;  1BPO A;  3PEV B;  3S7F A;  3TWQ A;  3SBS A;  4XKC A;  3FH5 A;  2AW6 A;  4ANX A;  2J4B A;  3MA5 A;  5G55 A;  4HOU A;  3U66 A;  4DPR A;  2RG8 A;  3AG1 E;  2E2E A;  2WQ6 A;  3D9K A;  4FAD A;  1X81 A;  2C0M A;  3OXL A;  2YNQ A;  2DBA A;  1ELR A;  1H6O A;  2NYJ A;  3U64 A;  2LO6 A;  4EZJ A;  4QFV A;  2CFU A;  3HXE A;  2I1J A;  4UWH A;  3FY4 A;  2FBN A;  2IFU A;  5KNH D;  2XEE A;  4ANW A;  3CHR A;  3FH8 A;  4UQZ A;  3T5X A;  2X6F A;  4APF A;  2OND A;  1UN8 A;  3C72 A;  1E7U A;  2WXJ A;  3NB2 A;  1K1B A;  1FPP A;  5CEA A;  3D9L A;  3UXG A;  2DIW A;  4DX7 D;  3CEQ A;  1HE8 A;  2V5F A;  1INZ A;  4PS8 A;  2H6H A;  2WQH A;  3JXI A;  2ETA A;  3FTY A;  2CG3 A;  3PRE A;  5EIB E;  3D9P A;  2XRY A;  4A3T A;  1N11 A;  4RG6 A;  1W3B A;  5AEN A;  2PQR A;  3ULQ A;  2P9I G;  3Q47 B;  3UM0 A;  4DJA A;  4C0E A;  1BI8 B;  3LJ3 A;  4XX5 A;  3E30 A;  3EU9 A;  4JPS A;  4A1G A;  3RK6 A;  1D8E A;  4L2Y A;  1L5J A;  3R9A B;  1UW4 B;  3CVX A;  3Q7F A;  3KAE A;  1OWP A;  4ACK A;  4APO A;  4HVB A;  1WM5 A;  1NI1 A;  2DCP A;  3JUI A;  3FU0 A;  2C0L A;  2P9N G;  2RFA A;  3S2A A;  2OOE A;  4GTO A;  3T9K A;  2KAT A;  3EU5 A;  2XGS A;  4A63 B;  3S7J A;  3IV0 A;  3MX3 A;  4WNF A;  5JJT A;  3QWP A;  4BT9 A;  5CHE E;  4BER A;  2CHZ A;  2P9L G;  4BWR A;  4TUU A;  3WXX A;  2ZGG A;  3E34 A;  4HQD A;  2RD0 A;  5KJL A;  3W9G A;  3B95 A;  3FU3 A;  4YVO A;  2VGE A;  2LXL A;  3VLF A;  3ZYM A;  1BI7 B;  3FUJ A;  1O5M A;  4LG6 A;  4UWF A;  4I2W A;  3NQP A;  1OWL A;  4FU3 A;  1DCQ A;  1JWF A;  5D0O D;  5C1D A;  5CRV A;  3O48 A;  3ZYL A;  4M7C A;  4HOT A;  3V31 A;  4OYS A;  2OCC E;  3FP3 A;  4UI9 K;  5EX0 A;  2X6H A;  2XGO A;  5JHB A;  2HYZ A;  3QK0 A;  3J5P A;  4U95 D;  3BEE A;  4CCA A;  1TJC A;  3P2B A;  3SFY A;  1UG3 A;  2R05 A;  2V4H C;  4N2Q A;  2X38 A;  1BLX B;  1N52 A;  5FZR A;  3RSE G;  4PUC A;  2XS8 A;  5AJL A;  1OCR E;  5D2M C;  3SD5 A;  4KZ0 A;  2DZO A;  1VDY A;  3PNL B;  3JCK C;  3CLJ A;  4IRU A;  2MHK A;  5T4Y A;  2WXH A;  1RZ4 A;  3L9T A;  2IU1 A;  1ELK A;  3SO8 A;  2F0Y A;  4B89 A;  3CQG B;  4OVU A;  3G2S A;  2CG2 A;  5BPP A;  4CGW A;  4J8F A;  2EQX A;  4DUI A;  2XEV A;  4BX8 A;  3FEY A;  4JZY A;  3V30 A;  3UT4 A;  2KZT A;  1K1A A;  5C2Y A;  2HR2 A;  1ZU2 A;  5AQ7 A;  4L7T A;  2A4Z A;  3SFZ A;  3HVE A;  3N71 A;  3UKR G;  1LF8 A;  3GZ2 A;  3D9H A;  3QWV A;  3DSS A;  4Y6C A;  3CHS A;  4V3I A;  5FJY A;  3PE3 A;  2BKK B;  3X2Q E;  3CGH A;  2UWJ G;  4YDO A;  1OT8 A;  3SQV A;  5KJM A;  3E37 A;  2VSX E;  4BEP A;  3KD7 A;  4K0R A;  4NIK A;  4LCT A;  4BTA A;  4TXP A;  4C0M A;  5LFA A;  2VGY A;  4TXQ A;  1JCS A;  1MZC A;  3EDT B;  5JMN D;  2XCC A;  5LCW C;  4UWL A;  3UIP C;  1EDU A;  3QWW A;  4GTP A;  3T5V A;  5EX3 A;  4JW1 A;  2PZI A;  5CED B;  4B8C B;  2FI7 A;  2LSV A;  1IYG A;  4GCO A;  1MX4 A;  3LY9 A;  1N0Q A;  3EHQ A;  5IY5 E;  1YYH A;  2GRO B;  2R2L A;  3TAX A;  5HI7 A;  4HLE A;  4OAV B;  5ENR D;  5FIO A;  5AAR A;  2PNN A;  3ZUV B;  2Y4U A;  4HOQ A;  4DX2 A;  4DX5 D;  3ASO E;  2GRP B;  1A17 A;  3LVR E;  2M63 A;  3LXU X;  3I4G A;  3CHP A;  5EDS A;  2WMN A;  1YCS B;  3KS2 A;  4J0U A;  4AM9 A;  4EEC A;  1G3N B;  3FTU A;  1YA0 A;  1E90 A;  3TWU A;  2BF0 X;  3DXK G;  3EIJ A;  1IXV A;  2Q7F A;  4RLY A;  4DI3 A;  3NBN B;  4GMR A;  4HRN A;  3TXN A;  4AP2 A;  4FUL A;  4GTQ A;  4J6I A;  2WXF A;  5AAO A;  3B7R L;  1E8Z A;  5KCM A;  4MS6 A;  2OVB A;  2EIK E;  3Q75 A;  4KBQ A;  2KM4 A;  3QAQ A;  1HO8 A;  2NSZ A;  1HU3 A;  3HIZ A;  2J4D A;  4N5C A;  3CHO A;  1HS6 A;  1UOH A;  3CVU A;  4F1S A;  2X6J A;  2OEW A;  4IYP A;  3ML8 A;  2CFZ A;  3TWW A;  4CT0 A;  3JUE A;  4FJZ A;  1V55 E;  2X3M A;  3ZXS A;  1MHQ A;  4U0S A;  5B1A E;  5BV1 A;  4JEH A;  3G2W A;  5T3R A;  4F1P A;  3JQ1 A;  3LDZ A;  2Y4T A;  3G2T A;  3G2U A;  4WNG A;  1UJJ A;  2L0I A;  4JHJ A;  3QJZ A;  5EIL A;  5AQA A;  1LD8 A;  2P9P G;  3SI5 A;  3ONL A;  3L08 A;  4LUN U;  3ULY A;  3JYS A;  3ZKJ A;  3ESK A;  1BU9 A;  2WXR A;  4U7E B;  3MV2 B;  1Z5S C;  1B89 A;  3UMV A;  4YVQ C;  2AXZ A;  4F3V A;  5A23 A;  3LY8 A;  1N9A A;  2V5Q C;  3C5R A;  3MKR A;  4GZC A;  4U07 A;  4HXI A;  2NC9 A;  4ABN A;  2BKG A;  4U0Z A;  4LER A;  4LRZ A;  3TWR A;  3NOG D;  5BV0 A;  3TL5 A;  5DIZ A;  4Q96 A;  1P5Q A;  2WXN A;  4B8A A;  3ZGQ A;  2GW1 A;  2IJG X;  2ZIS A;  1U2V G;  3CHM A;  4ANV A;  4TUM A;  3RRN B;  3DEO A;  4X8Q A;  5E76 A;  1QYM A;  3PEU B;  3VLD A;  2UY1 A;  3FFL A;  4KMO A;  4BSZ B;  3LEW A;  4K5A B;  4JA9 A;  1K3Z D;  3CHQ A;  3CVP A;  3FTX A;  5KNG A;  3TJP A;  4XI9 A;  2AVP A;  4DRX E;  2B0O E;  4ZHB A;  1AP7 A;  3UI2 A;  3FH7 A;  3VTY A;  3R7R A;  4PS3 A;  5EID A;  4TXR A;  3FUH A;  3MCX A;  3KEA A;  3C3O A;  5FQ7 A;  5KJK A;  3OXG A;  4LEU A;  4XE0 A;  2ION A;  3RO2 A;  3ABK E;  4I6J A;  4GB9 A;  3ZHE B;  2IF4 A;  4J8S A;  1K8K G;  3PDN A;  3ZPJ A;  5H7P A;  5JJ7 A;  4MRU A;  1QZ2 A;  2XQ0 A;  2QYJ A;  4HS2 A;  4M3O A;  2EIJ E;  1JWG A;  2XRZ A;  2MRI A;  1H2U A;  2WXP A;  3LKU A;  4G25 A;  4ACL A;  4BSX A;  4I43 A;  5E75 A;  2GRR B;  3SGH A;  1FVF A;  4NRH B;  3IEG A;  4GTS A;  2IEJ A;  3FUN A;  4G8L A;  5HRY A;  3URZ A;  4CRW A;  2J07 A;  5FT9 A;  4QQI A;  2AXU A;  4HB5 A;  4AVX A;  1BD8 A;  3ULE G;  4WWO A;  3ZHE A;  3QB2 A;  2IO2 C;  3CVV A;  4AV7 A;  1TEZ A;  5FTP A;  3WG7 E;  3JQ0 A;  4GU5 A;  3U4T A;  2A5U A;  1WDY A;  2LUH A;  2C2L A;  4RSY A;  5J08 A;  4GCN A;  4N3C A;  3TWX A;  5AN8 A;  3FDH A;  3LS8 A;  1JUQ A;  2FEZ A;  2J8S D;  3SNX A;  3OXF A;  1MX6 A;  3AS4 A;  3BG1 B;  2CHW A;  5ENO D;  1XNF A;  4I9C A;  2GRN B;  4MBG A;  2RKK A;  2EIL E;  2QY7 A;  3Q15 A;  4FC8 A;  2DVW A;  1N95 A;  4UQY A;  4C48 B;  3PE4 A;  1N4R A;  5J90 A;  2VQ2 A;  4U96 D;  2LNI A;  4LNU D;  1TNZ A;  2XEN A;  3ZEF A;  3TWS A;  3B7B A;  2J9Q A;  3DRA A;  1V54 E;  4AY5 A;  1OWN A;  2J49 A;  3CK9 A;  3HXB A;  4WUY A;  3SZ7 A;  4Q69 A;  4JEU A;  4GZ3 A;  4OAU C;  3ASF A;  1MQS A;  3CVY A;  4C9B B;  4GTT A;  1KPS B;  1Q2Z A;  2ILR A;  4EBA A;  3EHN A;  4XI0 A;  3D3M A;  4K5C A;  2BED A;  2HE0 A;  2NXP A;  5CEC B;  1KT0 A;  4NAC A;  4CZ2 D;  3O4Z A;  1FCH A;  3SHF A;  3CK7 A;  3L17 A;  5DBK A;  2JLB A;  4J7W A;  2V4L A;  3HHM A;  4N2S A;  4O1P A;  3PUK A;  2VSN A;  4HRL A;  1D9S A;  1WAO 1;  1N4S A;  2E0I A;  4UQX A;  1O1T A;  1ELW A;  3T8M A;  1SZ9 A;  5AYW D;  2J08 A;  4NQ0 A;  4EHM A;  1QQE A;  2XEH A;  3DXM G;  3Q78 A;  1SA4 A;  3VLE A;  1N4P A;  1RW2 A;  4FHJ A;  2IOS A;  4R7L A;  4G1T A;  2KBX A;  4K03 A;  3CKC A;  4F6R D;  1N54 A;  2WMO A;  3GZ1 A;  2P9S G;  4DX6 D;  3D9M A;  2ZXW E;  1A5E A;  4A1S A;  4GTR A;  4URK A;  1S0P A;  3QAR A;  3Q9U C;  1UN9 A;  3MV3 B;  3UPV A;  3P1U A;  1O1S A;  2GRL A;  4L23 A;  4KVM A;  4AOF A;  1N4Q A;  1H6K A;  3E33 A;  1TNY A;  3ASD A;  4AEZ C;  2ZU6 B;  2R17 C;  3UTM A;  4E6H A;  3B13 A;  1NA0 A;  2GRM A;  1HXI A;  4FHK A;  3UM2 A;  3Q5M A;  3FTW A;  2BTD A;  2OEV A;  4FJY A;  1HG2 A;  3FWV A;  2X6I A;  2I1K A;  2HO1 A;  4PDX A;  4ME2 A;  3PRZ A;  3PZD A;  1EPU A;  2WQ7 A;  3KSQ A;  3FUM A;  4KT6 B;  3Q49 B;  2XPY A;  3PVL A;  4MLP A;  3C98 A;  3AS8 A;  2VTB A;  1Z3X A;  4BTB A;  3C3R A;  2LAH A;  3Q73 A;  5FWQ A;  3OTN A;  1WY6 A;  2DZN A;  3AG2 E;  1D8D A;  5CRU A;  2IY0 C;  3VTX A;  4A55 A;  4ZFH A;  2UY1 B;  3TWV A;  2H6G A;  3MZL B;  3FEX A;  3MYV A;  3CSF A;  3ZXP A;  3V2O A;  1HF8 A;  4I2Z A;  2R59 A;  1TR4 A;  4F7A A;  1PY1 A;  1DNP A;  5D0Q D;  3E4B A;  3GYZ A;  3FHE A;  5KJN A;  1H0A A;  4U04 A;  4HI8 A;  2FUL A;  5CCL A;  4MKT A;  3AG3 E;  2R02 A;  1H2V C;  5HS0 A;  3CVQ A;  4DX1 A;  3D9J A;  2ZIR A;  4AY6 A;  4AIF A;  4N3B A;  3SY2 A;  2R5S A;  2P9K G;  5JA4 D;  4GPK A;  1JCQ A;  2WXM A;  3EJN A;  3LCA A;  2PM6 A;  4GA0 A;  1HZ4 A;  4NUR A;  3UUX A;  1DC2 A;  3MJW A;  1TYQ G;  4I9E A;  2L6J A;  3LJN A;  4B93 B;  3FU5 A;  3NZS A;  4PH4 B;  1IQR A;  3UT7 A;  4G23 A;  1OY3 D;  1MYO A;  3GW4 A;  3ZFW A;  3DEP A;  3HDX A;  3BG0 B;  2XPI A;  4XEI G;  2DYS E;  5LX8 A;  4ILH B;  2VSO E;  4IN3 B;  5CER B;  2ETB A;  3FUD A;  2I6H A;  1SA5 A;  2XZT G;  1OCZ E;  5AJD A;  3BUA A;  2L9B A;  1SQM A;  4KZC A;  5BXU A;  2P9U G;  2L0T B;  4H7Y A;  1S70 B;  4JHR A;  2A5E A;  4E85 A;  2H6F A;  3ONK A;  5FQ6 A;  5CMW A;  1DVP A;  4GA1 A;  4G24 A;  4GZ5 A;  4LSZ E;  4Y6W A;  2PL2 A;  4Q94 A;  1SW6 A;  4GA2 A;  2XGM A;  5JHA A;  4B94 A;  4I6E A;  3CKB A;  4UI9 J;  1XGW A;  4I6G A;  3ZIM A;  3APC A;  5HQ8 A;  3KEZ A;  3Q4A B;  3AAA C;  2Y0B G;  2GGF A;  3UIN C;  4HNA D;  4L1B A;  4F53 A;  2XZD G;  3NF1 A;  1EF1 C;  3FUK A;  3MEK A;  3ZU7 B;  4GAA A;  3HXF A;  1IHB A;  4GTV A;  3ZYK A;  1FT2 A;  3ENE A;  3RKV A;  3ESL A;  5BXO A;  3BU8 A;  1ZBP A;  1E8X A;  1TN7 A;  1NL4 A;  1O1R A;  4RG9 A;  2VGX A;  3DPD A;  3HG0 D;  4J8E A;  3AS5 A;  4D10 C;  4JA7 A;  1IQU A;  2LAI A;  5G05 J;  3HYM B;  2PQN A;  5T8I A;  1E96 B;  2IO3 C;  3V2X A;  3ZYQ A;  3CIA A;  4ILG A;  4CT4 A;  2AJA A;  3FTV A;  4EZK A;  1AWC B;  3HVE B;  3CVW A;  2I2O A;  5ENQ D;  2IQC A;  4WND A;  2ETC A;  2ZGD A;  3ML9 A;  4U8V D;  5AQ9 A;  1U3D A;  2KCL A;  4O60 A;  3ZNG A;  2MOW A;  3Q79 A;  3LVQ E;  3UIO C;  2VSY A;  3ABL E;  2WXG A;  5ANL A;  3IHY A;  3L82 A;  2F37 A;  1U3C A;  3SF4 A;  4KYO B;  4GMJ A;  1UJK A;  3TG5 A;  1TJF A;  4W9R A;  5ENT D;  2XCB A;  1NFI E;  1IKN D;  5AQB A;  4AXH A;  4JL0 A;  4ILI A;  2B6C A;  4P29 A;  4U8Y D;  1KLX A;  1WG0 A;  3I3N A;  3G2V A;  1N0R A;  1IHG A;  3EUV A;  3QOU A;  4CYM D;  3CV0 A;  5A7D B;  5AIJ A;  3BQO A;  1E8W A;  3L13 A;  5ARG A;  1FVH A;  2YQ8 A;  4XZ4 A;  2EIN E;  3EIQ C;  4ANU A;  1E7V A;  2RFM A;  3ASN E;  2J09 A;  4CGV A;  1HFA A;  3UKU G;  2IOL A;  3U9W A;  4LNG A;  1HG5 A;  2QFC A;  4GYO A;  4EPZ A;  2WB2 A;  3UM3 A;  4FLH A;  2WXO A;  2HM8 A;  3IBE A;  3R7Q A;  1DCE A;  2I9C A;  3L22 A;  4YDY A;  4TRQ A;  2JAB A;  4GTM A;  4U63 A;  5ENN A;  3UM1 A;  1JPL A;  3DSW A;  4JB8 P;  3CR3 A;  1TNB A;  3UX4 A;  4WWN A;  2LXM A;  3OAW A;  3Q9N C;  4N5Q A;  4I1M A;  4PS7 A;  4I17 A;  2P2C P;  4WNE A;  5CMY A;  2Y69 E;  3IKO B;  3C3Q A;  5ENP D;  3L6A A;  3NAW A;  4CEM A;  2KC7 A;  3AJI A;  5BNW A;  1E8Y A;  4CDN A;  3IHV A;  3MKQ A;  2KZT B;  3APF A;  4DI4 A;  4FP7 A;  3D9N A;  3EHR A;  1OWO A;  5G04 J;  4UUC A;  4UI9 C;  4WWP A;  2OV8 A;  5FZS A;  5B1B E;  3TWT A;  5LOZ A;  1SVX A;  1OCO E;  5CBN A;  1S63 A;  3NOC D;  4O6F A;  1HX8 A;  3PZ4 A;  4O1O A;  3DBS A;  1NP7 A;  3DST A;  3HRA A;  3LY7 A;  1OWM A;  3KSL A;  1NA3 A;  4CDR A;  3J5Q B;  3FUE A;  4BES A;  3ISM C;  4BT8 A;  3I5P A;  4BX9 A;  3V79 K;  2WXI A;  4HOR A;  2F8X K;  3DPY A;  5JJ6 A;  3RU0 A;  3ASG A;  4U0U A;  2XS1 A;  3L16 A;  1PAQ A;  5G05 C;  5BT1 A;  3AU5 A;  2YHE A;  5ARF A;  4J8D A;  1TNO A;  1LTX A;  5G04 C;  4G2V A;  4L9P A;  2QZA A;  3PH0 C;  5EKQ D;  3UT8 A;  3L54 A;  2P58 C;  4N3A A;  4JXT A;  3PZ1 A;  3ZN3 A;  4DLO A;  2MYO A;  3D9O A;  4LNB A;  2Y1L E;  3AG4 E;  4AJW A;  3S7B A;  2AWI A;  2AXV A;  3MGB A;  5BUZ A;  1QNF A;  4EQF A;  3S7D A;  1MJ0 A;  4HFG A;  3PUJ A;  5EN5 D;  1KZP A;  4YDW A;  3QC1 A;  4OVV A;  4FLB A;  4JHK A;  4BY6 A;  3ZRH A;  4DK5 A;  3RAU A;  3LYA A;  2WXL A;  3QNK A;  1S64 A;  5A6C A;  2DWZ A;  5KWD A;  4HRM B;  5B3S E;  3Q7A A;  1QBQ A;  3FTS A;  1OUV A;  5ANR A;  4N39 A;  2OVF A;  3ABM E;  3CQC B;  3EHM A;  1PC2 A;  4GYY A;  3DSU A;  5FQ8 A;  3ZW3 A;  3E32 A;  1Z6T A;  2VYI A;  3R9M A;  3RRM B;  2QYU A;  4G11 A;  2F8Y A;  3GZS A;  5KBA A;  1JCR A;  4FA6 A;  1TN6 A;  3FUF A;  3HXD A;  5HKP A;  4GML A;  5LP0 A;  5FQ4 A;  4JVS A;  1TNU A;  4UWK A;  3DWL G;  1H6P A;  3B7T A;  5ENS D;  2XPZ A;  3CVL A;  3I4R B;  3IXE A;  4RQI A;  3MKQ B;  1SZA A;  3ZVV A;  2VTB B;  1OXJ A;  4DLQ A;  4L2L A;  5BW8 C;  4EBA G;  1MX2 A;  5G2N A;  4GZ6 A;  3U3W A;  1OCC E;  3FTZ A;  5ITZ F;  4XIF A;  4CDM A;  1H19 A;  5CCM A;  3CK8 A;  3TGO A;  1KT1 A;  4HLL A;  1H2T C;  4GYW A;  5FIN A;  2WVI A;  4I1A A;  3RIB A;  3PZ2 A;  4K5B A;  2Y3A A;  4HBD A;  1EYH A;  4G26 A;  3LPZ A;  2LSU A;  4IUL A;  3FUL A;  4WAF A;  3APD A;  3TG4 A;  2KCV A;  3RO3 A; 
#chains in the Genus database with same CATH homology
 4CYM D;  4ATZ D;  1K3Z D;  3LJN A;  4B93 B;  1SVX A;  3SO8 A;  5CBN A;  1WDY A;  5KNG A;  1K1B A;  4J7W A;  5CEA A;  3NOC D;  4OAV B;  3UXG A;  3HG0 D;  5ENR D;  4DRX E;  2B0O E;  2QC9 A;  4DX7 D;  4ZHB A;  1OY3 D;  5EYP F;  5FIO A;  1MYO A;  3UI2 A;  1AP7 A;  4O1P A;  4F1P A;  3TWX A;  5AN8 A;  3T8K A;  4O1O A;  4HRL A;  2RFM A;  3JXJ A;  2J8S D;  3JXI A;  2ETA A;  5AAR A;  2PNN A;  4BER A;  4DUI A;  1D9S A;  2KXP C;  5EID A;  3HRA A;  3F6Q A;  1MX6 A;  3ZUV B;  3KEA A;  3DEP A;  5EIB E;  3V30 A;  2DZN A;  3V2X A;  5ENO D;  2XEH A;  1N11 A;  4DX2 A;  1K1A A;  4DX5 D;  4Z68 A;  3J5Q B;  4G8K A;  5EIL A;  5AQA A;  4ZFH A;  5AQ7 A;  2ETB A;  5CER B;  4BES A;  2ZGG A;  2AJA A;  4HQD A;  2XZT G;  3TWV A;  2F8Y A;  3W9G A;  5KBA A;  1AWC B;  5BXU A;  1YCS B;  3B95 A;  2VGE A;  3V79 K;  5ENQ D;  5HKP A;  3ZKJ A;  4BET A;  4J8Y A;  1G3N B;  3D9H A;  2ETC A;  2ZGD A;  1BI7 B;  1BU9 A;  2FO1 E;  1S70 B;  4GPM A;  2DVW A;  4LG6 A;  2A5E A;  5KWD A;  2F8X K;  3V2O A;  4U8V D;  5AQ9 A;  4C48 B;  1BI8 B;  4YDY A;  2KBX A;  2JAB A;  4O60 A;  3TWQ A;  2QYJ A;  3ZNG A;  5ENS D;  3TWU A;  1DCQ A;  2BKK B;  4F6R D;  1TR4 A;  4U96 D;  4JB8 P;  1IXV A;  4LSZ E;  4LNU D;  4DX6 D;  4RLY A;  4GMR A;  3NBN B;  1YMP A;  4HRN A;  3EU9 A;  3V31 A;  1SW6 A;  3W9F A;  1OT8 A;  3Q9N C;  4N5Q A;  2V5Q C;  2XEN A;  3C5R A;  3IXE A;  1A5E A;  2F37 A;  3TWS A;  2P2C P;  3B7B A;  2BKG A;  4BEP A;  4HI8 A;  5ENP D;  2MYO A;  4NIK A;  3Q9U C;  5AAO A;  2Y1L E;  3AAA C;  2Y0B G;  5HS0 A;  3J5P A;  5ENT D;  3AJI A;  4U95 D;  5JMN D;  4G8L A;  3TWR A;  5HRY A;  3NOG D;  4HNA D;  1MX2 A;  1MJ0 A;  4DX1 A;  2V4H C;  5EYL A;  2NYJ A;  5EN5 D;  4OAU C;  1BLX B;  2XZD G;  1NFI E;  1IKN D;  4QFV A;  5AQB A;  5ITZ F;  3UTM A;  4QQI A;  4HB5 A;  1UOH A;  4HLL A;  4YDW A;  2DZO A;  5FIN A;  1BD8 A;  3EHR A;  3ZU7 B;  4TUM A;  2RFA A;  5KNH D;  3DEO A;  4U8Y D;  2XEE A;  1QYM A;  3TWW A;  4K5B A;  5CED B;  4HBD A;  1IHB A;  1WG0 A;  5JA4 D;  3T9K A;  4UUC A;  1MX4 A;  3JUE A;  4K5C A;  1N0Q A;  2HE0 A;  2L6B A;  3EHQ A;  5D66 A;  4BSZ B;  5BXO A;  4K5A B;  5CEC B;  1N0R A;  4HI9 A;  3TWT A;  4A63 B;  2DWZ A;  1YYH A;  4CZ2 D;  4HRM B;  1DC2 A;  5CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...