4Z6DA

Structure of human dna polymerase beta 279na mutant complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFAKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Insights into the effect of minor groove interactions and metal cofactors on mutagenic replication by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4z6dA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4z6dA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4z6dA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4z6dA03
4UB2A 5KFIA 9ICVA 2ASJA 2NRTA 2I1QA 5CP2A 5KFZA 1U47A 5KFUA 2PI5A 2BE3A 2ZH8A 4RWNA 1ZQZA 2W9BB 4JV0A 3G6XA 4DFKA 2B21A 4IQVA 3EZ5A 4EYHB 1ZQNA 3EYZA 2BQRA 1X2IA 5J2EA 1ZQQA 4WBYA 4UQGA 1N56A 1MSWD 2R8GA 4O5KA 1VJ7A 1LV5A 4RNNA 1QSYA 4X0BA 5CB1A 4YN4A 3LWMA 1HUOA 4I29A 5IIOA 4KLTA 1NK6A 2KFNA 3JYYA 4KN4A 5HMLA 3Q8LA 8ICCA 7ICPA 3V6KA 2XCAA 4KLJA 3UXNA 2XY7A 7ICRA 3WFSC 1XC9A 1NO5A 9ICHA 2P66A 2ZUBA 4IQTA 1Q79A 3V72A 4DOBA 4TQSA 3RBDA 1L3VA 3SI8A 4M5DA 1RXWA 9ICCA 4I2AA 2XY6A 1BPYA 3PX6A 3GIJA 2C28A 1SKWA 7ICFA 5HR9A 1KDHA 3TARA 1MIVA 3ISCA 2ATLA 4KLIA 2F1HA 1ZQJA 5KT7A 7ICMA 1U48A 3G6VA 1NK7A 2HHUA 3IM1A 2R8IA 4R65A 4QZCA 3HJ1A 3RJHA 3PO4A 2R8HA 3SV4A 5J2KA 2VA3A 4B9VA 8ICVA 5HC9A 1VFGA 4YQWA 1K1QA 4I2IA 4DSLA 4YR3A 5EWGA 4P4MA 4RUAA 4DSFA 4MF2A 4YR0A 3N4MB 4Z6CA 2P6RA 4WC5A 3MR5A 4J9SA 3KHRA 1EXNA 4DQSA 4M9GA 5KFSA 5KG1A 4Q43A 4PGQA 3HT3A 4EBDA 4X4NA 4IR1A 1KSPA 4MFCA 8ICLA 4NKUA 3K4GA 4QZBA 4M6WA 1JX4A 4IRKA 3PX0A 4M9HA 3B0YA 2KTQA 2ASDA 5DKWA 8ICZA 5J2JA 5J2BA 4J9QA 2H5XA 2C2EA 2PFPA 1R89A 2VA8A 5KFDA 3C23A 4ECSA 4GXJA 3RAQA 1NJXA 9ICTA 5CA7A 4QZHA 4I2DA 2JEFA 4EBCA 2F1IA 4PHPA 4YP3A 2HHWA 1NK9A 2W9BA 3BJYA 1ZQVA 3PW7A 1L3TA 1S9FA 2I9GA 4ATBB 1ZQXA 3M9MB 4FH5A 4WC6A 9ICKA 2NRZA 5DB7A 5DB9A 3V7LA 4RQ0A 4RQ2A 4F5OA 1T7PA 4ELUA 3HW8A 3H3AA 2AJQA 3V6HA 5KFMA 3Q8SB 2ISOA 4I2GA 1YLQA 1NKEA 4O3NA 5JUMA 3PMNA 3MFIA 3MDCA 3G6YA 2HVIA 4DL2A 2W8KA 3UPQA 1ZQIA 1XSLA 3PW5A 2ZTEA 3PMLA 8ICUA 7ICSA 4IR9A 8ICWA 2C22A 4DEZA 8ICJA 2BCUA 5KFRA 4XQ8A 4QZDA 5TZVA 3UPSA 2DFLA 1ZETA 4RQ4A 9ICEA 2BCVA 4I2JA 4DOAA 3UQ0A 2DPJA 4KLMA 1BPDA 4RPXA 5HRIA 1TFYA 5J0SA 3OJUA 1KFDA 8ICYA 7ICUA 5J2GA 1NK8A 2FLNA 5J2IA 8ICPA 3H8JA 4FHPA 2OWOA 4IG8A 1ZQTA 3PVXA 1QSLA 9ICBA 4DF8A 4FHVA 4F4KA 4NLGA 2V4RA 4KLDA 4DQRA 3OV7A 1OU5A 3RH4A 4QZGA 4M04A 3ETLA 1JIHA 2ID1A 4M9LA 2BCQA 4UB1A 5J0TA 3EPGA 1IM4A 4F5NA 1JXLA 1ZQAA 4WCWA 3NYBA 4UBCA 3C5GA 9ICAA 8ICHA 3TAPA 5KG6A 4DS4A 3T5KA 5KFAA 2FLPA 4TUQA 7ICOA 2RDJA 4O3RA 3HIYA 3ZD8A 4O5CA 4UAWA 4GLXA 5IIKA 2XGPA 3AU6A 4G3IA 4FHXA 4I27A 4E80A 4ECTA 1NZPA 4ED1A 4C8KA 1TKDA 4M2YA 2FPLA 4F91B 1S0MA 2KZZA 4DL3A 4B9NA 4E8FA 4DOCA 4TURA 1NKCA 4C8MA 5CJ7A 2V4QA 5EWEA 4O0IA 5DLFA 4WC0A 1XO1A 5IIIA 5DBAA 2W9CB 5L1JA 3RAXA 1ZQEA 4PH5A 4F2RA 1KLNA 4WC4A 8ICMA 1UA1A 3GILA 9ICWA 3MR2A 1SL2A 4KLHA 7ICHA 4KLEA 4R64A 4UAYA 3PR5B 2MUTA 5IIJA 4PPXA 3V7KA 2P6UA 3PW2A 1UT5A 3C1YA 1ZQHA 7ICJA 1XSPA 4ATBA 3PW4A 1S0NA 9ICJA 4WC1A 1Z3EB 1BVSA 2BHNA 1PX5A 5DQHA 3AQMA 4LT6A 2JZBB 5KFWA 4KLUA 5DB8A 3GV5B 3JPPA 4XA5A 4EZ6A 1ZJMA 2IA6A 4DWIA 3JPNA 5J2HA 4J9NA 1X9WA 2J6TA 4O3QA 4Q44A 4AT9A 9ICPA 2KZMA 4JUZA 3RB4A 3WFQE 2DRAA 3EPIA 4JV1A 4F92B 4XUSA 3BQ1A 4EP7A 2M2WA 4BXOB 4YMOA 3H7IA 1NJWA 2UVWA 3HJ4A 4RUCA 3TFSA 5KFFA 4ECRA 1U9LA 5KT5A 5J2FA 4ECUA 4X4UA 4M9NA 2ZJ5A 5DB6A 4GXIA 3E2EA 7ICKA 8ICXA 1XS9D 1ZQBA 1JAJA 2PBEA 5KFKA 1KFSA 2FLLA 4CCHA 4QW8A 2M2VA 4WBZA 3BQ2A 1RXVA 4E7XA 1ZJNA 3M9NB 4BDPA 5KFJA 4ED3A 2BPCA 1WCLA 2XO7A 2C2RA 2ZH1A 2IMWP 4YMNA 5DG9A 3M8RA 1SL1A 3WFPA 1ZQOA 5BOLA 4WC7A 3PW0A 4KMUA 5HRDA 2ZJ8A 4RPYA 2AGQA 4EBEA 1CUKA 3WFRE 1JQRA 3GIMA 4DQIA 3NGDA 4F3OA 4TUSA 4FHYA 1LB2B 4FO6A 3RR8A 4I2EA 1ZYQA 3AQLA 4GXKA 1S0OA 5KFBA 4X4VA 3RH5A 1TK5A 2UVRA 1S0VA 4KLOA 7ICQA 1SL0A 4XRHA 2HHQA 2W9CA 2UVVA 4IQUA 3HWTA 4J9OA 4DL7A 3JPRA 8ICIA 3OGUA 2Q66A 1ZQMA 5IILA 1A77A 4M47A 1R8BA 1A76A 4YG2A 5C5JA 4I28A 5KFXA 3JPSA 7ICGA 3V6JA 9ICOA 4RWPA 4I2BA 4ED7A 5KG3A 1X9MA 4KLQA 2GWSA 5KFOA 4IRCA 3ZDAA 5HRGA 2ZTDA 3H40A 2NRXA 3N97B 1L3SA 2R8KA 4JV2A 1MIYA 3T5JA 3T5LA 1NOMA 2VA2A 4RZRA 2ZJAA 4LZDA 5F9NA 4PHDA 3H8SA 1BPXA 3PR4A 2AQ0A 3Q8MA 1D9FA 4C8NA 3RJFA 4ZH4A 5KFEA 4ECWA 3RB0A 4J9MA 2R8JA 3ZDBA 4O3SA 1DK3A 2HHPA 5L1KA 3TANA 3H39A 4LZGA 4RQ5A 4RPZA 3ISBA 2DR5A 1UA0A 3HX0A 8ICNA 1L5UA 4MEYA 2KZ3A 1C7YA 7ICEA 3ORYA 4RT3A 4P4PA 4R8UB 3M8SA 2ZH7A 4RQ7A 1MIWA 9ICFA 3MBYA 1U4BA 1DGSA 2A1JB 3M9OB 3MGIA 1ZQLA 1ZQDA 4NLNA 1Q78A 4K4IA 5HHIA 5DECA 3C1ZA 1QLNA 3RB6A 2BDPA 4RU9A 1S77D 8ICFA 4QZAA 5J0UA 2HW3A 5F2VO 4ELVA 4C8LA 5D49A 1D8YA 2JEIA 2BGWA 4YXMA 4MEXA 4B9SA 4NLKA 1H38A 2O1PA 4RNOA 5HMMA 3C18A 2PFOA 3GFKB 9ICSA 1BPBA 7ICIA 4RWQA 4UBBA 3OHAA 2XC9A 5J0WA 1V9PA 2WTFA 4DS5A 4ED6A 1ZQCA 4AT7B 2ISPA 4UB3A 5BPCA 3TAQA 5F9LA 2BPFA 3QE9Y 5J0QA 5DQGA 5HRKA 1R8AA 4DLEA 5J0RA 4KN7A 5EOZA 4Z6DA 1BPEA 4YD2A 5KFTA 4J9KA 2DPIA 5J2CA 2KP7A 2ZH5A 4X5VA 5KTQA 8ICSA 3QZ8A 1BNOA 4F4XA 1UETA 5KFCA 3GQCA 4DSEA 2XY5A 1RYRA 1D9DA 4FHWA 2AU0A 3ISDA 1KFTA 4F5QA 2W8LA 4FS1A 4E0DA 3TQ1A 2ZH6A 3RBEA 4DQPA 1S10A 8ICKA 5DBCA 4S3NA 3KHLA 5DQIA 4O3OA 4QWEA 2AGPA 5KFNA 1ZQGA 4MF8A 5KFYA 4PHEA 3UXPA 3C66A 4B9LA 4UD4A 3H37A 4QZ8A 4X4SA 4F5RA 3FYHA 3WFOA 3UXOA 1TV9A 4ECXA 4DFJA 4TQRA 3T3FA 1N48A 2FMPA 3OHBA 3FDSA 4X4RA 4F4WA 4O5EA 1CEZA 2ZUDA 4GC7A 5DG7A 1BGXT 5KT4A 3Q8KA 1ZQPA 3PO5A 9ICMA 2M2UA 1UEUA 2ZH9A 4O3PA 3JPQA 4X4QA 5IINA 4QWBA 3MR6A 4QW9A 2Q0ZX 2ZUCA 5KG4A 1RYSA 4WC3A 4NXZA 4QWDA 4DSIA 2JEGA 1R8CA 4J9LA 8ICGA 4AT8B 1IXRA 5KT6A 2XGQA 5DBBA 4ECYA 4R8UA 8ICQA 1ZQYA 3OJSA 2A1JA 3RJGA 1WOTA 1DK2A 4X4OA 5KG0A 2FPKA 3PNCA 1ZQRA 2HHXA 4I2FA 4EZ9A 5DGBA 7ICTA 7ICLA 1KNYA 1KRPA 5L1IA 4B9MA 1WCNA 1KEJA 4P2HA 3SV3A 1COOA 3V7JA 4Q8EA 3C2KA 5KFLA 3QEBZ 4O9MA 4DQQA 2ZH3A 3RR7A 4B9UA 9ICGA 4TUPA 1KTQA 3RTVA 1ZQUA 5HRLA 3AQKA 4NKTA 4AT7A 5HRFA 4QZEA 5BOMA 2IBKA 5DLGA 3HPOA 5KFVA 4NM2A 4YCXA 4ECVA 2NRVA 4X4PA 3ZDCA 4F4YA 4BWMA 3PV8A 4B9TA 4DF4A 2FPMA 5J2DA 3TI0A 3OVSA 4FBTA 4LVSA 3JZ0A 4DSJA 9ICQA 4YR2A 3LK9A 3SZ2A 1B43A 1BNPA 1TK0A 1NJYA 3KHHA 1ZQKA 1NK5A 4NY8A 1TFRA 3ZD9A 1TK8A 1UT8A 3EWAA 5IIMA 2NRKA 4KITB 3HP6A 3RJIA 3H8WA 5J2AA 2UVUA 1V4AA 4RT2A 1Z00B 4PGXA 1JN3A 2W9AA 2BQUA 2ZTCA 1T3NA 3LQCB 2VANA 2C2DA 4R66A 4KTQA 1XWLA 2LYHA 9ICUA 1MC8A 3RH6A 3RJEA 5J0PA 4DSKA 1D8LA 4UB4A 4MFAA 3UQ2A 4YFKA 2KFZA 5HREA 5HRHA 3RRGA 5KG5A 3RJKA 4RQ6A 3PY8A 3KHGA 1BPZA 4J9RA 4GC6A 3OSPA 3H38A 2HVHA 4C8OA 1AROP 3TFRA 2DR9A 2JZBA 3JPOA 1NKBA 3MDAA 4FS2A 2BR0A 1TFWA 2M9NA 1U49A 3GV7B 5KG7A 4YMMA 4DL6A 8ICEA 1FA0A 4UB5A 1ZQFA 4RNMA 1L3UA 2ALZA 1PZNA 5DDYA 3K75D 5KG2A 5KT3A 2FMQA 1HJPA 4AT8A 3OUYB 7ICNA 4ED8A 9ICRA 1NK0A 4BXOA 4ED0A 4JWMA 2HHVA 3OVBA 1MQ2A 4DO9A 3BQ0A 3L9DA 2AQ4A 3Q8RB 2ZH2A 4YXJA 4ED2A 5J0OA 4UD5A 4YVZA 4EBJA 4F5PA 4EBKA 2MUTB 3MGHA 2W9MA 2XCPA 2PXIA 8ICBA 5CWRA 4HYKA 3C5FA 4DFPA 2J6SA 4KLGA 5CR0A 4DLGA 2M2TA 5HP4A 3RRHA 9ICNA 1K1SA 3KTQA 1XSNA 4NLZA 8ICOA 4YD1A 8ICAA 2MAXA 3AU2A 9ICIA 4MFFA 5DG8A 3C2LA 3OSNA 5KFPA 4WC2A 9ICLA 4AT9B 3QEAZ 4K4HA 3B0XA 2DR8A 5KFGA 3NTUA 2DVIA 3LDAA 2F1JA 4DL5A 2ASLA 2V9WA 2ZH4A 4UAZA 4Z6FA 3GDXA 3MABA 4QZIA 3Q8QB 3RB3A 1MQ3A 1HUZA 3RJJA 5DDMA 4BGDA 1ZQSA 4I2HA 4JWNA 3OVAA 3ZDEA 2AGOA 1Z00A 5HHHA 4R63A 2BQ3A 4RWOA 1T4GA 4Z6EA 3H4BA 5L1LA 4F2SA 2O5AA 1S97A 5L9XA 3BQTA 1TVAA 4KLLA 1TAQA 2HHTA 4BWJA 4DFMA 4KLFA 4F50A 4EEYA 1JXEA 5D46A 4DL4A 4EYIB 1Y88A 1QTMA 2PFQA 4I2CA 4FH3A 4ECZA 1JMSA 4XQ7A 2JEJA 4F4ZA 4J9PA 5J0YA 3H4DA 3SYZA 5D4BA 4FBUA 4KLSA 3T5HA 4JK1A 1F5AA 1NK4A 5J0XA 4RQ1A 3JPTA 3ZDDA 1TAUA 5EWFA 3LWLA 1NJZA 1S76D 2FMSA 4IQWA 2HHSA 3C21A 5DGAA 2BPGA 4ECQA 4Q8FA 1SKSA 4P4OA 1DOQA 4QZ9A 1UEVA 8ICTA 2IHMA 9ICXA 3GIIA 4Q45A 4X4TA 1XU4A 1RZTA 1T8EA 3Q8PB 3EW9A 4QWCA 3QZ7A 1SZPA 2RDIA 4RQ8A 3BDPA 2NRWA 2BKEA 3OUYA 5KFHA 3GV8B 2Y1IA 2BCRA 4F8RA 4RQ3A 5KFQA 1QSSA 1B22A 5CHGA 2Y1JA 2BCSA 4ELTA 2PFNA 1ZQWA 4QZFA 3PX4A 2J6UA 5DEDA 4PHAA 2PI4A 5KT2A 4X0AA 3IHQB 2IHNA 2ZHAA 4F93B 4M6WB 2DRBA 4PGYA 2RFFA 3MR3A 4IRDA 1U45A 5HRBA 2KN7A 4M9JA 1X9SA 1RPLA 3THVA 5HNKA 2ZHBA 7ICVA 4K4GA 4QWAA 3GIKA 3C2MA 4M0AA 8ICRA 3MFHA 3AQNA 5J29A 4NM1A 1SKRA 3AUOA 2DR7A
chains in the Genus database with same CATH superfamily
1PK3A 4UB2A 5CP2A 1AQ6A 1N61A 5KFZA 3NVZA 5KFUA 4OAFA 4RWNA 2W9BB 4JV0A 2B21A 1ZQNA 5HR7A 1ZQQA 1N56A 1MSWD 1VJ7A 2JRZA 5AIBA 1X42A 4KN4A 1SWWA 2XCAA 4KLJA 2KE7A 1UQVA 4BUGA 2ZUBA 4IQTA 2B4VA 4TQSA 2LHTA 4UB8U 1BPYA 7ICFA 3AM9A 1KDHA 2ZG6A 3ISCA 2KJ8A 4KLIA 2K4IA 3HKZF 2G0AA 1J97A 2CPRA 1OW5A 1NK7A 2R8IA 4R65A 2R8HA 8ICVA 5HC9A 3SAGA 2P6RA 4Z6CA 3MR5A 4J9SA 3NS1A 3ONNA 4O3MA 4PGQA 2G07A 3QU7A 1KSPA 5AI8A 4M6WA 3PX0A 2ASDA 2H5XA 2PFPA 3C23A 5TISU 2KV2A 5ALYA 4EBCA 2W43A 2H3IA 2HHWA 2KIWA 1NK9A 1S9FA 4NXUA 5DB9A 4ELUA 1T7PA 4IC9A 4I2GA 8ICUA 1XSLA 2ZTEA 3PMLA 4IR9A 8ICJA 5KFRA 2MRLA 4QZDA 9ICEA 4I2JA 5HRIA 5J0SA 1S8OA 8ICYA 5J2GA 1NK8A 2FLNA 3H8JA 1ZQTA 4DF8A 3FAHA 4KLDA 1OU5A 5KL8B 3EPGA 4F5NA 2RDJA 2Y9TA 4FHXA 4UAWA 5IIKA 5AKJA 1JALA 4M2YA 2QB1A 4TURA 1NKCA 5AKXA 1VLBA 5EWEA 5IIIA 3RAXA 2W9CB 8ICMA 4P0QB 7ICHA 3QYPA 4C0ZA 2HBLA 3PR5B 4PPXA 3V7KA 2NO5A 3WKBA 2XI9A 3PW4A 1S0NA 9ICJA 1N63A 1Q3UA 1PX5A 5DQHA 4O69A 3WK4A 3GV5B 3JPPA 4EZ6A 5AKZA 3JPNA 4J9NA 4NXXA 1X9WA 2HBKA 4AT9A 2KZMA 2DRAA 1COKA 4F92B 2YMPA 2M2WA 3R9KA 3HJ4A 5KAFU 1GPJA 3TFSA 2IUBA 1U9LA 4N7RA 4X4UA 4IL6U 2PBEA 1ZRMA 2FLLA 4WH5A 2LI6A 4QW8A 4WBZA 5CFUA 4E7XA 2K4HA 3M9NB 1KL9A 5KFJA 4BDPA 4CNQA 1WCLA 4YMNA 1SL1A 1LVHA 1CUKA 3L3FX 3GIMA 4DQIA 4TUSA 4FHYA 1LB2B 1XO0A 4FO6A 3RR8A 3AQLA 1MA7A 2IHOA 5KFBA 4X4VA 2UVRA 1SGGA 3QUTA 2M0NA 2UVVA 3JPRA 2Q66A 1ZQMA 4UARA 3SR6A 1A77A 2ZXHA 1R8BA 4JMUA 3JPSA 7ICGA 9ICOA 4I2BA 1L7PA 5AKYA 2ZTDA 4JV2A 2R8KA 1N5XA 4KLTA 1D9FA 3RFAA 3Q8MA 2AQ0A 1PK1B 2WAQF 4C8NA 3U26A 3RB0A 4O67A 3BZKA 4J9MA 3WK5A 3ISBA 1UA0A 3NASA 5JTIA 8ICNA 2JMGA 4O6AA 5AKIA 3SD7A 4R8UB 3D2SA 2EAOA 4K4IA 3L4PA 2K4PA 2BDPA 4QZAA 5J0UA 2HW3A 3A0BU 5F2VO 1HIWA 1D8YA 2Y0SC 4FZLA 4MEXA 4B9SA 1H38A 3CYMA 4UAUA 5HMMA 7ICIA 5BPCA 3TAQA 3EF2A 2K4EA 5F9LA 2BPFA 3QE9Y 4Z6DA 2DPIA 5J2CA 2KP7A 3TADC 4EX7A 3GQCA 3WK6A 1KFTA 5DQIA 4O3OA 2AGPA 1SXEA 1ZQGA 5KFYA 4PHEA 3H37A 5KL1B 4C7ZA 2B6GA 5D63A 4ECXA 2FMPA 3T3FA 1N48A 2ZUDA 4GC7A 1UEUA 9ICMA 3BS5B 3PO5A 3JPQA 3MR6A 3PSPA 1RYSA 4LEYA 5DBBA 4ECYA 1ZQYA 4AYBF 3OJSA 2A1JA 4F71A 1ZQRA 7ICTA 3PSIA 5DGBA 1KEJA 4LEWA 2HOFA 3QEBZ 4B9UA 2A19A 1KTQA 4NKTA 4PJ0U 4NXWA 5BOMA 1A0PA 1SXDA 5KFVA 4NM2A 4ECVA 2NRVA 1JUDA 4DF4A 2WF9A 5J2DA 3OVSA 4YR2A 1TK0A 3KHHA 2KKVA 5J8YA 3EWAA 3DV9A 1KQQA 2NRKA 3RJIA 1Z00B 4PZNA 2BQUA 2W9AA 2KSOB 2IOFA 2W3SA 2E5SA 4KTQA 2LYHA 3F2CA 3HJEA 5ALQA 2KOBA 2KFZA 1D8LA 5HRHA 2FI1A 1WUDA 2YB4A 5AKGA 4KB6A 1UHUA 1FO4A 3PY8A 2YMQA 4J9RA 4WQKA 3H38A 3IG5A 1OUQA 4C8OA 3JPOA 4FS2A 2BR0A 4YMMA 1FA0A 4UB5A 1L3UA 4ED8A 2G08A 5AKHA 2LM1A 2YMLA 4JWMA 3OVBA 4U7CA 1MQ2A 1LKYB 4DO9A 3BQ0A 3L9DA 5J0OA 4YVZA 4EBJA 5B5EU 2MUTB 3K1ZA 4Y2YA 3IRUA 3C5FA 3NKUA 5HP4A 3WK7A 2D3DA 8ICOA 4MFFA 5DG8A 1M6YA 5KFGA 1JRPA 2ASLA 2HN2A 1B0XA 3GDXA 1MQ3A 1HUZA 2DQNB 3I28A 3OVAA 4LEZA 3GZFA 4RWOA 2WB1F 1T4GA 4Z6EA 3H4BA 4F2SA 1TAQA 3QX7A 4BWJA 2N1RA 4EYIB 4NLCA 1QTMA 1JMSA 2ZIWB 2GAFD 4F4ZA 4J9PA 4NL9A 5ALUA 1F5AA 2QARB 5EWFA 2HHSA 1NJZA 3CK6A 2BPGA 4P4OA 1DOQA 4QZ9A 1UEVA 3MGVA 4Q45A 1XU4A 1T8EA 1KBUA 3GV8B 2BCRA 2PFNA 4QZFA 3QUBA 2J6UA 3BS7A 4F93B 2DRBA 4PGYA 2RFFA 1X9SA 2BDUA 7ICVA 3C2MA 3MFHA 3O0FA 3OTQA 1CI4A 9ICVA 2NRTA 2ZH8A 2BE3A 4DFKA 3G6XA 4IQVA 3WKEA 5JU5A 2BQRA 1ZRNA 1X2IA 2E8PA 2QB0B 4RNNA 5CB1A 1T3QA 4I29A 5IIOA 1NK6A 3JYYA 7ICPA 7ICRA 3WFSC 2XY7A 1XC9A 9ICHA 5ALSA 5KNIA 5AK4A 2IOFK 2WHEA 2C28A 1SKWA 4K96A 2F1HA 5KT7A 2ZIXA 1U48A 4WOYA 3KD3A 4YQWA 2FJ6A 4I2IA 4DSFA 3N4MB 4WC5A 3NVVA 5ALFA 1N60A 5KFSA 5KG1A 3QU4A 4Q43A 4IR1A 4MFCA 3K4GA 4QZBA 1JX4A 2KTQA 3F53A 5DKWA 8ICZA 2WF5A 5J2JA 5J2BA 2C2EA 1R89A 5KFDA 4ECSA 3RAQA 3D2QA 2W03A 1GO3F 2JEFA 2F1IA 4YP3A 2W9BA 4QIWF 4ATBB 4Y2RA 1ZQXA 9ICKA 2OEHA 3V7LA 2KIVA 2GO7A 3HW8A 3V6HA 2ISOA 2ZIUB 7ICSA 5TZVA 1ZETA 2BCVA 2DPJA 1BPDA 3OJUA 2CXYA 2OWOA 4IG8A 9ICBA 4RQMA 4JLZA 4F4KA 4DQRA 1P7DA 4QZGA 3PSTA 4M9LA 2BCQA 4UB1A 5J0TA 1JXLA 3N7PD 4UBCA 8ICHA 5KG6A 4DS4A 3T5KA 3E0FA 5ALZA 1YZ7A 3AU6A 4I27A 4ED1A 2R18A 1Q8KA 3N7RC 2KZZA 4E8FA 4DL3A 1RDFA 4B6JA 1S5LU 1QQ6A 5DLFA 2ZH2A 5DBAA 1ZQEA 5L1JA 2PMZC 4PH5A 2LYBA 2MU2A 1SV0C 3GILA 9ICWA 2DUYA 3MR2A 1X40A 4EENA 3KZXA 1UT5A 3C1YA 1ZQHA 1QQ5A 4WC1A 3WK9A 2JZBB 5AM3A 4DWIA 5J2HA 9ICPA 4JV1A 3BQ1A 4BXOB 3H7IA 4RUCA 5KFFA 5KT5A 4GIBA 4M9NA 1J2NA 1JAJA 3B9JA 5AM2A 1ZQBA 2WF8A 5ALTA 1KKXA 3H0LB 2C2RA 2ZH1A 3PW0A 5ALRA 3BQ7A 4KMUA 5HRDA 5CRXA 4RPYA 2AGQA 1IG6A 2JXJA 2ZXIA 1KN5A 2E8NA 1S0OA 1WYGA 3RH5A 5D62A 1S0VA 7ICQA 1DGJA 1Q3VA 1V38A 2W9CA 3NWIA 2FCLA 1ZD4A 2LMRA 5IILA 4M47A 4YG2A 2HI0A 5KFXA 4RWPA 5AI5A 1FFVA 4ED7A 5KFOA 5AI4A 1QH9A 2NRXA 3T5JA 1O08A 5AK6A 4LZDA 1FEZA 3H8SA 3PR4A 5KFEA 4ECWA 1V85A 2HHPA 5ALXA 5EE9A 4RQ5A 4RPZA 5HR6A 1KW4A 4MEYA 7ICEA 3ORYA 4P4PA 2ZH7A 4RQ7A 4ZOHC 1U4BA 3MGIA 2KMDA 5HHIA 1WG8A 3C1ZA 1QLNA 5D61A 3RB6A 1S77D 4CF4A 5D49A 2O1PA 2PFOA 4RWQA 2XC9A 3UM9A 2EQYA 1R8AA 4DLEA 4KN7A 1UPHA 5EOZA 4J9KA 2DKZA 4X5VA 2ZH5A 3ICXA 2ZIVB 1BNOA 4F4XA 5KFCA 4DSEA 3TACB 2AU0A 1RM6C 2W8LA 4F5QA 4E0DA 4HAIA 5DBCA 5KFNA 4C4SA 3PHZA 4PL2A 3C66A 4X4SA 4F5RA 3BZCA 3AMZA 3UXOA 1TV9A 3FC4A 3FDSA 1HEKA 1CEZA 5DG7A 1BGXT 1PK1A 4O3PA 3IV6A 1X66A 2ZUCA 4DSIA 4AYBC 1R8CA 5ALGA 4AT8B 1IXRA 4DCCA 1SWVA 3HRDD 4R8UA 2NV3A 3LVVA 2HOQA 1DK2A 5KG0A 2FPKA 4EZ9A 2W54A 4B9MA 1WCNA 5C0YA 2JH7A 4Q8EA 2ZH3A 3H8MA 4TUPA 3N7SC 5HRFA 4QZEA 3HPOA 1ZD5A 3M6KA 2I5HA 3K7DA 4MHVA 1Z4OA 2HN1A 4FBTA 2AH5A 3VCBA 1B43A 4FFDA 1NJYA 1NK5A 3ZD9A 4OJ5A 5J2AA 4RT2A 4PGXA 1JN3A 5EE3A 3LQCB 1T3NA 2JR5A 2C2DA 4R66A 1XWLA 2O6KA 4DSKA 1PUZA 1C20A 3RRGA 3H0RB 3QU9A 5E79U 3KHGA 4GC6A 3BS5A 5ALIA 2DR9A 3MDAA 3GV7B 2Q4TA 1N62A 1ZQFA 2HHQA 3K75D 5KT3A 4Y2JA 1NK0A 1Z1BA 1X6IA 1SZHA 3NVYA 1JI7A 5AM1A 3K1RB 4YXJA 1Q46A 4EBKA 4F5PA 4PZOA 3MGHA 4GFJA 4DFPA 5CR0A 4NV0A 1K1SA 4C4RA 8ICAA 9ICIA 3AQEA 3JCFA 4AT9B 4K4HA 3NTUA 4DL5A 3AN1A 2V9WA 4UAZA 3MABA 4QZIA 3Q8QB 3RB3A 3RJJA 2ESEA 4I2HA 1Z00A 4A8EA 5HHHA 4R63A 2BQ3A 2OCEA 2KSOA 2O5AA 4MKPA 3KZIU 1TVAA 2HHTA 2F44A 4FE3A 4CE6A 4KLSA 3T5HA 4JK1A 1NK4A 3JPTA 2E1EA 2Y9UA 5ALLA 4AP9A 3LWLA 2JGAA 2FMSA 5DGAA 4EV6A 1SKSA 2IHMA 9ICXA 3GIIA 2LYAA 7ICNA 4QWCA 4RQ8A 2Y1IA 1TAMA 5CHGA 2Y1JA 2KHVA 1LKYA 2E3TA 4JLXA 3L5KA 4CF5A 3SAHA 2PI4A 3IHQB 2IHNA 2EANA 2VJ5A 2KN7A 3KKAC 1RPLA 3THVA 4WBYA 3OPXA 1NNLA 4QWAA 3AQNA 1SKRA 3AUOA 2DR7A 4Y2UA 5KFIA 1RQLA 2ASJA 1U47A 2PI5A 1ZQZA 2KEYA 5AM5A 2XIDA 5CHEA 4Y2QA 5A0LA 3EYZA 1CRXA 2R8GA 4X0BA 4YN4A 5G5HA 4IS7A 3Q8LA 8ICCA 2EZZA 2KJ9A 1NO5A 2VJ4A 1Q79A 1L3VA 4M5DA 1RXWA 3N28A 1MIVA 3TARA 2ATLA 3C28A 2HHUA 1D8BA 3HJ1A 3PO4A 2VA3A 3SV4A 4B9VA 2XVTA 4K8VA 5T14A 1VFGA 1K1QA 5ALNA 5EWGA 4YR0A 3ED5A 4DQSA 4M9GA 3HT3A 4EBDA 4NKUA 5ALDA 3B0YA 2F77X 2DWQA 3F5EA 3UMGA 4J9QA 2QLTA 1TE2A 2D6FC 4GXJA 3F2BA 9ICTA 4QIWC 4QZHA 4I2DA 2DF4B 3BJYA 1L3TA 4K98A 3HILA 4ICAA 3M9MB 4WC6A 2QB0A 2W3RA 3H3AA 2MA1A 5AI0A 2AJQA 5AI9A 1YLQA 4OCZA 3IN5A 4O3NA 3DEEA 3PMNA 3MFIA 3G6YA 2HVIA 4EEBA 8ICWA 2C22A 4DEZA 5ALPA 2DFLA 4RQ4A 4DOAA 4KLMA 4RPXA 4PL1A 1KFDA 2K89A 1YZ6A 4FHPA 2ES6A 3PVXA 1QSLA 4FHVA 2K60A 2V4RA 2L5YA 1PVRA 3OV7A 2VIXA 2Y0SF 4M04A 2K8CB 3ETLA 4Y2XA 1IM4A 1ZQAA 4WCWA 3C5GA 2ODGA 2YN4A 5KFAA 2FLPA 4TUQA 4O3RA 3HIYA 3S6JA 3ZD8A 4GLXA 2XGPA 4G3IA 1NZPA 4ECTA 3WU2U 2FPLA 4F91B 1A6SA 2FDRA 4C8MA 5CJ7A 5JRTA 4O0IA 1WWUA 2LPEA 2V4QA 1XO1A 3NRZA 4F2RA 1KLNA 4UATA 1SL2A 4KLHA 4KLEA 4R64A 4UAYA 2RHFA 4OAGA 3GU3A 7ICJA 1XSPA 4ATBA 1Z3EB 1ZD2P 3AQMA 4LT6A 2F8KA 2OH2A 3M1YA 1ZJMA 2ZIUA 2IA6A 3NRWA 2J6TA 3RB4A 2AXTU 2A3VA 2GH1A 2W04A 4YMOA 1NJWA 4G9BA 2UVWA 5J2FA 4ECUA 1VDVA 2ZJ5A 3E2EA 5KFKA 2HCFA 1ZD3A 2M2VA 3BQ2A 1L8OA 4O68A 1ZJNA 5ALVA 3HKZC 5B3PA 4ED3A 3QXGA 2BPCA 4NLBA 2RQ5A 5AM4A 3FM9A 2XO7A 1OXJA 4CGZA 5DG9A 5EE0A 3M8RA 4WC7A 3CNHA 2XICA 1QQ7A 1JQRA 2HOIA 3NGDA 4F3OA 1ZYQA 3H0MB 1NZBA 1TK5A 4Y2SA 2JH1A 4XRHA 1QCKA 4IQUA 3QUCA 3HWTA 8ICIA 2DKXA 5L1MA 1ZOLA 3DDHA 3SAFA 4I28A 3TADA 3V6JA 1X9MA 4IRCA 4NXTA 3H40A 1L3SA 2VA2A 1NOMA 4RZRA 2ZJAA 5F9NA 4PHDA 1BPXA 2BCSA 3RJFA 4ELTA 2LKYA 4ZH4A 1Z4NA 3SMVA 3ZDBA 1F44A 3TANA 3H39A 2FE9A 5K4LA 5CFTA 2DR5A 3HX0A 1ZXIA 2KZ3A 1C7YA 3OWGA 4OJ6A 3MBYA 2K8AA 4NLNA 1Q78A 5EE1A 3F5AA 4US8A 4WQLA 3IDWA 4C8LA 5H2FU 3J81j 4NLKA 4RNOA 4C80A 3C18A 1URJA 9ICSA 4AT7B 2RP5A 1ZQCA 2LM4A 2NYVA 5J0QA 5HRKA 2W7PA 2G5IB 4EGWA 5KFTA 5GTIU 8ICSA 2H3VA 1RYRA 1D9DA 4FHWA 2ZH6A 4J03A 3TQ1A 1S10A 8ICKA 4S3NA 3KHLA 4QWEA 4MF8A 3UXPA 4UB6U 4UD4A 4QZ8A 4OD0A 3VC8A 2ZIXB 3WFOA 4TQRA 3MCRA 4F4WA 1ZQPA 3Q8KA 2ZH9A 5IINA 2E8MA 4NWIA 4NXZA 3KOOA 4P0PB 2JV3A 8ICGA 5KT6A 2EH9A 2XGQA 2HDOA 8ICQA 4QNLA 4K9BA 3T79A 3CW2C 4X4OA 3PNCA 2HHXA 4I2FA 1KNYA 7ICLA 5L1IA 1SIJA 3V7JA 3C2KA 5KFLA 4DQQA 9ICGA 3AQFA 5AKKA 1ZQUA 3AQKA 2BBJA 2WF7A 4X4PA 4F4YA 3PV8A 2FPMA 9ICQA 3LK9A 3SZ2A 1ZQKA 2ZIVA 4NY8A 1SB3C 1IIPA 5IIMA 3ER8C 3ZI4A 2UVUA 1V4AA 2VANA 9ICUA 1MC8A 3RJEA 1O03A 4UASA 4MFAA 4P0QA 4YFKA 2KNJA 5KG5A 1T94A 1BPZA 2YX8A 2DBYA 3OSPA 1L7MA 2WAQC 4DFDA 1TFWA 2M9NA 3NVWA 4DL6A 2KD1A 4AT8A 1ZQ1C 1HJPA 3OUYB 9ICRA 4ED0A 1X6JA 2YMMA 2KG5A 1J2MA 2VKQA 2EWRA 4K97A 3WKDA 3Q8RB 2AQ4A 1N2XA 4ED2A 4UD5A 2W9MA 2PXIA 2J6SA 4EEDA 9ICNA 5J8YC 3KTQA 3AU2A 2KHQA 1X9XA 3C2LA 3OSNA 2WFAA 9ICLA 3QEAZ 2DVIA 3B0XA 2DR8A 3LDAA 2F1JA 2B56A 2KVSA 4BGDA 4JWNA 3ZDEA 2AGOA 5AM0A 4F50A 4EEYA 5D46A 4DL4A 3QNMA 4C7YA 2PFQA 4EELA 4I2CA 3ER9B 4ECZA 2JEJA 4FZNA 5J0YA 4CRXA 4FBUA 1F5SA 1FFUA 3F2DA 4RQ1A 3SEIA 1TAUA 2F2AB 4IQWA 4ECQA 4Q8FA 2OYYA 4I0UA 4OAIZ 3Q8PB 3QZ7A 3BDPA 5ALWA 2NRWA 2BKEA 4OJPA 1PVPA 5KFQA 1ZQWA 4PHAA 5KT2A 2ZHAA 4M6WB 3MR3A 4IRDA 1U45A 2PMZF 4K4GA 3LYSA 5J29A 5AK5A 2I1QA 4EYHB 3EZ5A 3A0HU 5GTHU 4LEVA 5J2EA 1UCVA 4UQGA 4O5KA 1LV5A 1VJ5A 1QSYA 3LWMA 1HUOA 2KFNA 5HMLA 3V6KA 3UXNA 4NL9C 2P66A 3V72A 4DOBA 3RBDA 2HMXA 3RF9A 3SI8A 4CDGA 9ICCA 4I2AA 2XY6A 3D6JA 3PX6A 3GIJA 5HR9A 1DXSA 3QU2A 1PVQA 2AHOB 3PZPA 1ZQJA 7ICMA 3G6VA 3IM1A 1IV8A 4QZCA 3RJHA 5ALJA 4XJEA 5J2KA 4DSLA 4YR3A 4P4MA 3JZ0A 5AK3A 4RUAA 4MF2A 1B4FA 1WWVA 3KHRA 1EXNA 4X4NA 2P35A 8ICLA 2RRDA 3I1YA 2Z7JA 4IRKA 4NXVA 4M9HA 2G06A 2VA8A 2F76X 4UAVA 1NJXA 5CA7A 2KJ5A 2JHDA 4K9AA 2YTUA 4PHPA 1L6NA 1ZQVA 3PW7A 2I9GA 4U6PA 4FH5A 2NRZA 1SV0A 5DB7A 2OHFA 4RQ0A 4RQ2A 4F5OA 5AKEA 2BBHA 5KFMA 3Q8SB 1NKEA 2I6XA 1RQNA 5JUMA 3MDCA 4DL2A 2W8KA 3UPQA 1ZQIA 3PW5A 2BCUA 2WB1C 3KBBA 4XQ8A 3UPSA 3M7DA 1N5WA 2OM6A 5B3QA 4F72A 3UQ0A 1TFYA 3CP8A 7ICUA 8ICPA 5J2IA 2D8CA 4NLGA 1YT3A 3AEVA 3RH4A 5AKLA 1JIHA 2ID1A 2BZFA 2IOHA 3NYBA 9ICAA 3TAPA 3QUQA 1L7NA 7ICOA 3WKCA 4O5CA 4E80A 4C8KA 1TKDA 4JB3A 1S0MA 4B9NA 4KM5A 4DOCA 3EUB2 3ERCC 4WC0A 2NO4A 4WC4A 3SQIA 1UA1A 2W11A 2MUTA 5IIJA 3IP4B 2P6UA 3PW2A 4Y2PA 1MN8A 1BVSA 2BHNA 5CFSA 5KFWA 4KLUA 2HBJA 5DB8A 5B66U 4XA5A 5JTGA 4O3QA 4Q44A 5AIAA 3WFQE 4JUZA 2EDUA 3EPIA 1NI3A 2W7OA 4XUSA 2GA9D 4EP7A 3ETRA 4K99A 4ECRA 5DB6A 4GXIA 7ICKA 8ICXA 1XS9D 1KFSA 4CCHA 1RXVA 4OO1J 2YQEA 3ALRA 2PKEA 2ZIWA 2E1FA 2GLEA 2IMWP 3WFPA 1ZQOA 5BOLA 2QARA 3D2NA 1SV4A 2ZJ8A 4EBEA 3WFRE 4I2EA 4GXKA 4EEKA 1F0MA 4UW9A 4KLOA 1SL0A 4Y2VA 2KICA 4J9OA 4DL7A 3M6ZA 3OGUA 2EZYA 4EX6A 1A76A 2HBMA 5C5JA 4ACOA 5KG3A 4KLQA 2GWSA 3ZDAA 5HRGA 3N97B 1MIYA 2KKPA 3T5LA 3LVWA 3IG8A 1DK3A 4O3SA 2R8JA 5L1KA 1RG6A 4LZGA 2MSNA 5AICA 1L5UA 4OJOA 4RT3A 2YY6A 3M8SA 1MIWA 9ICFA 1DGSA 2A1JB 3M9OB 1ZQLA 1ZQDA 5DECA 2CN1A 4RU9A 8ICFA 4ELVA 2DGZA 5G5GA 2JEIA 2BGWA 4YXMA 3NUQA 3GFKB 1BPBA 2F8LA 4UBBA 3OHAA 1RYUA 1V9PA 5J0WA 4KX5A 2WTFA 4ED6A 4DS5A 4US9A 1L7OA 4UB3A 2ISPA 4HX0A 5DQGA 5J0RA 1BPEA 4YD2A 5KTQA 5F3XB 3QZ8A 3C29A 2LBOA 1UETA 2XY5A 2B0CA 3MC1A 3ISDA 2QKQA 2EZXA 4FS1A 2H3QA 3PSFA 5CEHA 2RLTA 3RBEA 4DQPA 1ED1A 4OAHA 4B9LA 1V97A 3FYHA 3NVOA 4USAA 4DFJA 3CRXA 3OHBA 4X4RA 4O5EA 5KT4A 2DL0A 2M2UA 4X4QA 2H3FA 4QWBA 4QW9A 2Q0ZX 5ALEA 5KG4A 4WC3A 4QWDA 2JEGA 5AHXA 4J9LA 2OXOA 4FO1A 5AI6A 3RJGA 1WOTA 3QU5A 1KRPA 1XNSA 2KK0A 1Z19A 4P2HA 3SV3A 1COOA 4QJFB 3WK8A 4O9MA 3RR7A 2CRXA 3RTVA 5HRLA 4AT7A 2IBKA 5DLGA 4YCXA 3ZDCA 4LJXA 4NJ8A 4BWMA 4B9TA 3TI0A 4LVSA 4DSJA 1BNPA 5ALMA 3UMCA 1TFRA 1TK8A 1UT8A 3E58A 4KITB 3HP6A 2A1AA 3H8WA 4CF3A 2EAMA 2ZTCA 4OJLA 5KAIU 1ECWA 3RH6A 5J0PA 5HREA 4UB4A 3UQ2A 3RJKA 4RQ6A 2W55A 3SENA 2F3NA 2G09A 3UMBA 4BJQA 2HVHA 1AROP 3TFRA 2JZBA 1NKBA 1U49A 5KG7A 4P0PA 8ICEA 4KX3A 1DRGA 3TKAA 4RNMA 2ALZA 1PZNA 5DDYA 1Z1VA 5KG2A 5ALHA 2FMQA 4BXOA 2K8BB 2HHVA 1K5OA 2HSZA 4FZMA 2XCPA 8ICBA 5CWRA 4HYKA 4KLGA 4DLGA 2M2TA 3RRHA 1FIQA 1XSNA 4NLZA 4YD1A 2MAXA 2EAPA 2G5HB 3KKAA 5KFPA 4WC2A 3I76A 2ZH4A 4Y2TA 4Z6FA 2E8OA 5DDMA 1ZQSA 4WJ3B 4RQNA 5L1LA 1S97A 5L9XA 3BQTA 4KLLA 4DFMA 4KLFA 2H3ZA 1JXEA 1Y88A 4FH3A 4XQ7A 3SYZA 2YB1A 3H4DA 5D4BA 2B51A 5J0XA 2WF6A 3ZDDA 1S76D 3C21A 8ICTA 2GOLA 4C4TA 4X4TA 1RZTA 3EW9A 1SZPA 2RDIA 5FP0A 3OUYA 5KFHA 5ALKA 1L8LA 4F8RA 3WKAA 1JROA 4RQ3A 1QSSA 1B22A 3KFUF 5DEDA 3PX4A 4X0AA 2KVCA 5HRBA 4M9JA 4KMOB 5HNKA 2ZHBA 4BX9C 4M0AA 5ALOA 3GIKA 8ICRA 4NM1A 3AL0B
chains in the Genus database with same CATH topology
4UB2A 5KFIA 9ICVA 2ASJA 2NRTA 2I1QA 5CP2A 5KFZA 1U47A 5KFUA 2PI5A 2BE3A 2ZH8A 4RWNA 1ZQZA 2W9BB 4JV0A 3G6XA 4DFKA 2B21A 4IQVA 3EZ5A 4EYHB 1ZQNA 3EYZA 2BQRA 1X2IA 5J2EA 1ZQQA 4WBYA 4UQGA 1N56A 1MSWD 2R8GA 4O5KA 1VJ7A 1LV5A 4RNNA 1QSYA 4X0BA 5CB1A 4YN4A 3LWMA 1HUOA 4I29A 5IIOA 4KLTA 1NK6A 2KFNA 3JYYA 4KN4A 5HMLA 3Q8LA 8ICCA 7ICPA 3V6KA 2XCAA 4KLJA 3UXNA 2XY7A 7ICRA 3WFSC 1XC9A 1NO5A 9ICHA 2P66A 2ZUBA 4IQTA 1Q79A 3V72A 4DOBA 4TQSA 3RBDA 1L3VA 3SI8A 4M5DA 1RXWA 9ICCA 4I2AA 2XY6A 1BPYA 3PX6A 3GIJA 2C28A 1SKWA 7ICFA 5HR9A 1KDHA 3TARA 1MIVA 3ISCA 2ATLA 4KLIA 2F1HA 1ZQJA 5KT7A 7ICMA 1U48A 3G6VA 1NK7A 2HHUA 3IM1A 2R8IA 4R65A 4QZCA 3HJ1A 3RJHA 3PO4A 2R8HA 3SV4A 5J2KA 2VA3A 4B9VA 8ICVA 5HC9A 1VFGA 4YQWA 1K1QA 4I2IA 4DSLA 4YR3A 5EWGA 4P4MA 4RUAA 4DSFA 4MF2A 4YR0A 3N4MB 4Z6CA 2P6RA 4WC5A 3MR5A 4J9SA 3KHRA 1EXNA 4DQSA 4M9GA 5KFSA 5KG1A 4Q43A 4PGQA 3HT3A 4EBDA 4X4NA 4IR1A 1KSPA 4MFCA 8ICLA 4NKUA 3K4GA 4QZBA 4M6WA 1JX4A 4IRKA 3PX0A 4M9HA 3B0YA 2KTQA 2ASDA 5DKWA 8ICZA 5J2JA 5J2BA 4J9QA 2H5XA 2C2EA 2PFPA 1R89A 2VA8A 5KFDA 3C23A 4ECSA 4GXJA 3RAQA 1NJXA 9ICTA 5CA7A 4QZHA 4I2DA 2JEFA 4EBCA 2F1IA 4PHPA 4YP3A 2HHWA 1NK9A 2W9BA 3BJYA 1ZQVA 3PW7A 1L3TA 1S9FA 2I9GA 4ATBB 1ZQXA 3M9MB 4FH5A 4WC6A 9ICKA 2NRZA 5DB7A 5DB9A 3V7LA 4RQ0A 4RQ2A 4F5OA 1T7PA 4ELUA 3HW8A 3H3AA 2AJQA 3V6HA 5KFMA 3Q8SB 2ISOA 4I2GA 1YLQA 1NKEA 4O3NA 5JUMA 3PMNA 3MFIA 3MDCA 3G6YA 2HVIA 4DL2A 2W8KA 3UPQA 1ZQIA 1XSLA 3PW5A 2ZTEA 3PMLA 8ICUA 7ICSA 4IR9A 8ICWA 2C22A 4DEZA 8ICJA 2BCUA 5KFRA 4XQ8A 4QZDA 5TZVA 3UPSA 2DFLA 1ZETA 4RQ4A 9ICEA 2BCVA 4I2JA 4DOAA 3UQ0A 2DPJA 4KLMA 1BPDA 4RPXA 5HRIA 1TFYA 5J0SA 3OJUA 1KFDA 8ICYA 7ICUA 5J2GA 1NK8A 2FLNA 5J2IA 8ICPA 3H8JA 4FHPA 2OWOA 4IG8A 1ZQTA 3PVXA 1QSLA 9ICBA 4DF8A 4FHVA 4F4KA 4NLGA 2V4RA 4KLDA 4DQRA 3OV7A 1OU5A 3RH4A 4QZGA 4M04A 3ETLA 1JIHA 2ID1A 4M9LA 2BCQA 4UB1A 5J0TA 3EPGA 1IM4A 4F5NA 1JXLA 1ZQAA 4WCWA 3NYBA 4UBCA 3C5GA 9ICAA 8ICHA 3TAPA 5KG6A 4DS4A 3T5KA 5KFAA 2FLPA 4TUQA 7ICOA 2RDJA 4O3RA 3HIYA 3ZD8A 4O5CA 4UAWA 4GLXA 5IIKA 2XGPA 3AU6A 4G3IA 4FHXA 4I27A 4E80A 4ECTA 1NZPA 4ED1A 4C8KA 1TKDA 4M2YA 2FPLA 4F91B 1S0MA 2KZZA 4DL3A 4B9NA 4E8FA 4DOCA 4TURA 1NKCA 4C8MA 5CJ7A 2V4QA 5EWEA 4O0IA 5DLFA 4WC0A 1XO1A 5IIIA 5DBAA 2W9CB 5L1JA 3RAXA 1ZQEA 4PH5A 4F2RA 1KLNA 4WC4A 8ICMA 1UA1A 3GILA 9ICWA 3MR2A 1SL2A 4KLHA 7ICHA 4KLEA 4R64A 4UAYA 3PR5B 2MUTA 5IIJA 4PPXA 3V7KA 2P6UA 3PW2A 1UT5A 3C1YA 1ZQHA 7ICJA 1XSPA 4ATBA 3PW4A 1S0NA 9ICJA 4WC1A 1Z3EB 1BVSA 2BHNA 1PX5A 5DQHA 3AQMA 4LT6A 2JZBB 5KFWA 4KLUA 5DB8A 3GV5B 3JPPA 4XA5A 4EZ6A 1ZJMA 2IA6A 4DWIA 3JPNA 5J2HA 4J9NA 1X9WA 2J6TA 4O3QA 4Q44A 4AT9A 9ICPA 2KZMA 4JUZA 3RB4A 3WFQE 2DRAA 3EPIA 4JV1A 4F92B 4XUSA 3BQ1A 4EP7A 2M2WA 4BXOB 4YMOA 3H7IA 1NJWA 2UVWA 3HJ4A 4RUCA 3TFSA 5KFFA 4ECRA 1U9LA 5KT5A 5J2FA 4ECUA 4X4UA 4M9NA 2ZJ5A 5DB6A 4GXIA 3E2EA 7ICKA 8ICXA 1XS9D 1ZQBA 1JAJA 2PBEA 5KFKA 1KFSA 2FLLA 4CCHA 4QW8A 2M2VA 4WBZA 3BQ2A 1RXVA 4E7XA 1ZJNA 3M9NB 4BDPA 5KFJA 4ED3A 2BPCA 1WCLA 2XO7A 2C2RA 2ZH1A 2IMWP 4YMNA 5DG9A 3M8RA 1SL1A 3WFPA 1ZQOA 5BOLA 4WC7A 3PW0A 4KMUA 5HRDA 2ZJ8A 4RPYA 2AGQA 4EBEA 1CUKA 3WFRE 1JQRA 3GIMA 4DQIA 3NGDA 4F3OA 4TUSA 4FHYA 1LB2B 4FO6A 3RR8A 4I2EA 1ZYQA 3AQLA 4GXKA 1S0OA 5KFBA 4X4VA 3RH5A 1TK5A 2UVRA 1S0VA 4KLOA 7ICQA 1SL0A 4XRHA 2HHQA 2W9CA 2UVVA 4IQUA 3HWTA 4J9OA 4DL7A 3JPRA 8ICIA 3OGUA 2Q66A 1ZQMA 5IILA 1A77A 4M47A 1R8BA 1A76A 4YG2A 5C5JA 4I28A 5KFXA 3JPSA 7ICGA 3V6JA 9ICOA 4RWPA 4I2BA 4ED7A 5KG3A 1X9MA 4KLQA 2GWSA 5KFOA 4IRCA 3ZDAA 5HRGA 2ZTDA 3H40A 2NRXA 3N97B 1L3SA 2R8KA 4JV2A 1MIYA 3T5JA 3T5LA 1NOMA 2VA2A 4RZRA 2ZJAA 4LZDA 5F9NA 4PHDA 3H8SA 1BPXA 3PR4A 2AQ0A 3Q8MA 1D9FA 4C8NA 3RJFA 4ZH4A 5KFEA 4ECWA 3RB0A 4J9MA 2R8JA 3ZDBA 4O3SA 1DK3A 2HHPA 5L1KA 3TANA 3H39A 4LZGA 4RQ5A 4RPZA 3ISBA 2DR5A 1UA0A 3HX0A 8ICNA 1L5UA 4MEYA 2KZ3A 1C7YA 7ICEA 3ORYA 4RT3A 4P4PA 4R8UB 3M8SA 2ZH7A 4RQ7A 1MIWA 9ICFA 3MBYA 1U4BA 1DGSA 2A1JB 3M9OB 3MGIA 1ZQLA 1ZQDA 4NLNA 1Q78A 4K4IA 5HHIA 5DECA 3C1ZA 1QLNA 3RB6A 2BDPA 4RU9A 1S77D 8ICFA 4QZAA 5J0UA 2HW3A 5F2VO 4ELVA 4C8LA 5D49A 1D8YA 2JEIA 2BGWA 4YXMA 4MEXA 4B9SA 4NLKA 1H38A 2O1PA 4RNOA 5HMMA 3C18A 2PFOA 3GFKB 9ICSA 1BPBA 7ICIA 4RWQA 4UBBA 3OHAA 2XC9A 5J0WA 1V9PA 2WTFA 4DS5A 4ED6A 1ZQCA 4AT7B 2ISPA 4UB3A 5BPCA 3TAQA 5F9LA 2BPFA 3QE9Y 5J0QA 5DQGA 5HRKA 1R8AA 4DLEA 5J0RA 4KN7A 5EOZA 4Z6DA 1BPEA 4YD2A 5KFTA 4J9KA 2DPIA 5J2CA 2KP7A 2ZH5A 4X5VA 5KTQA 8ICSA 3QZ8A 1BNOA 4F4XA 1UETA 5KFCA 3GQCA 4DSEA 2XY5A 1RYRA 1D9DA 4FHWA 2AU0A 3ISDA 1KFTA 4F5QA 2W8LA 4FS1A 4E0DA 3TQ1A 2ZH6A 3RBEA 4DQPA 1S10A 8ICKA 5DBCA 4S3NA 3KHLA 5DQIA 4O3OA 4QWEA 2AGPA 5KFNA 1ZQGA 4MF8A 5KFYA 4PHEA 3UXPA 3C66A 4B9LA 4UD4A 3H37A 4QZ8A 4X4SA 4F5RA 3FYHA 3WFOA 3UXOA 1TV9A 4ECXA 4DFJA 4TQRA 3T3FA 1N48A 2FMPA 3OHBA 3FDSA 4X4RA 4F4WA 4O5EA 1CEZA 2ZUDA 4GC7A 5DG7A 1BGXT 5KT4A 3Q8KA 1ZQPA 3PO5A 9ICMA 2M2UA 1UEUA 2ZH9A 4O3PA 3JPQA 4X4QA 5IINA 4QWBA 3MR6A 4QW9A 2Q0ZX 2ZUCA 5KG4A 1RYSA 4WC3A 4NXZA 4QWDA 4DSIA 2JEGA 1R8CA 4J9LA 8ICGA 4AT8B 1IXRA 5KT6A 2XGQA 5DBBA 4ECYA 4R8UA 8ICQA 1ZQYA 3OJSA 2A1JA 3RJGA 1WOTA 1DK2A 4X4OA 5KG0A 2FPKA 3PNCA 1ZQRA 2HHXA 4I2FA 4EZ9A 5DGBA 7ICTA 7ICLA 1KNYA 1KRPA 5L1IA 4B9MA 1WCNA 1KEJA 4P2HA 3SV3A 1COOA 3V7JA 4Q8EA 3C2KA 5KFLA 3QEBZ 4O9MA 4DQQA 2ZH3A 3RR7A 4B9UA 9ICGA 4TUPA 1KTQA 3RTVA 1ZQUA 5HRLA 3AQKA 4NKTA 4AT7A 5HRFA 4QZEA 5BOMA 2IBKA 5DLGA 3HPOA 5KFVA 4NM2A 4YCXA 4ECVA 2NRVA 4X4PA 3ZDCA 4F4YA 4BWMA 3PV8A 4B9TA 4DF4A 2FPMA 5J2DA 3TI0A 3OVSA 4FBTA 4LVSA 3JZ0A 4DSJA 9ICQA 4YR2A 3LK9A 3SZ2A 1B43A 1BNPA 1TK0A 1NJYA 3KHHA 1ZQKA 1NK5A 4NY8A 1TFRA 3ZD9A 1TK8A 1UT8A 3EWAA 5IIMA 2NRKA 4KITB 3HP6A 3RJIA 3H8WA 5J2AA 2UVUA 1V4AA 4RT2A 1Z00B 4PGXA 1JN3A 2W9AA 2BQUA 2ZTCA 1T3NA 3LQCB 2VANA 2C2DA 4R66A 4KTQA 1XWLA 2LYHA 9ICUA 1MC8A 3RH6A 3RJEA 5J0PA 4DSKA 1D8LA 4UB4A 4MFAA 3UQ2A 4YFKA 2KFZA 5HREA 5HRHA 3RRGA 5KG5A 3RJKA 4RQ6A 3PY8A 3KHGA 1BPZA 4J9RA 4GC6A 3OSPA 3H38A 2HVHA 4C8OA 1AROP 3TFRA 2DR9A 2JZBA 3JPOA 1NKBA 3MDAA 4FS2A 2BR0A 1TFWA 2M9NA 1U49A 3GV7B 5KG7A 4YMMA 4DL6A 8ICEA 1FA0A 4UB5A 1ZQFA 4RNMA 1L3UA 2ALZA 1PZNA 5DDYA 3K75D 5KG2A 5KT3A 2FMQA 1HJPA 4AT8A 3OUYB 7ICNA 4ED8A 9ICRA 1NK0A 4BXOA 4ED0A 4JWMA 2HHVA 3OVBA 1MQ2A 4DO9A 3BQ0A 3L9DA 2AQ4A 3Q8RB 2ZH2A 4YXJA 4ED2A 5J0OA 4UD5A 4YVZA 4EBJA 4F5PA 4EBKA 2MUTB 3MGHA 2W9MA 2XCPA 2PXIA 8ICBA 5CWRA 4HYKA 3C5FA 4DFPA 2J6SA 4KLGA 5CR0A 4DLGA 2M2TA 5HP4A 3RRHA 9ICNA 1K1SA 3KTQA 1XSNA 4NLZA 8ICOA 4YD1A 8ICAA 2MAXA 3AU2A 9ICIA 4MFFA 5DG8A 3C2LA 3OSNA 5KFPA 4WC2A 9ICLA 4AT9B 3QEAZ 4K4HA 3B0XA 2DR8A 5KFGA 3NTUA 2DVIA 3LDAA 2F1JA 4DL5A 2ASLA 2V9WA 2ZH4A 4UAZA 4Z6FA 3GDXA 3MABA 4QZIA 3Q8QB 3RB3A 1MQ3A 1HUZA 3RJJA 5DDMA 4BGDA 1ZQSA 4I2HA 4JWNA 3OVAA 3ZDEA 2AGOA 1Z00A 5HHHA 4R63A 2BQ3A 4RWOA 1T4GA 4Z6EA 3H4BA 5L1LA 4F2SA 2O5AA 1S97A 5L9XA 3BQTA 1TVAA 4KLLA 1TAQA 2HHTA 4BWJA 4DFMA 4KLFA 4F50A 4EEYA 1JXEA 5D46A 4DL4A 4EYIB 1Y88A 1QTMA 2PFQA 4I2CA 4FH3A 4ECZA 1JMSA 4XQ7A 2JEJA 4F4ZA 4J9PA 5J0YA 3H4DA 3SYZA 5D4BA 4FBUA 4KLSA 3T5HA 4JK1A 1F5AA 1NK4A 5J0XA 4RQ1A 3JPTA 3ZDDA 1TAUA 5EWFA 3LWLA 1NJZA 1S76D 2FMSA 4IQWA 2HHSA 3C21A 5DGAA 2BPGA 4ECQA 4Q8FA 1SKSA 4P4OA 1DOQA 4QZ9A 1UEVA 8ICTA 2IHMA 9ICXA 3GIIA 4Q45A 4X4TA 1XU4A 1RZTA 1T8EA 3Q8PB 3EW9A 4QWCA 3QZ7A 1SZPA 2RDIA 4RQ8A 3BDPA 2NRWA 2BKEA 3OUYA 5KFHA 3GV8B 2Y1IA 2BCRA 4F8RA 4RQ3A 5KFQA 1QSSA 1B22A 5CHGA 2Y1JA 2BCSA 4ELTA 2PFNA 1ZQWA 4QZFA 3PX4A 2J6UA 5DEDA 4PHAA 2PI4A 5KT2A 4X0AA 3IHQB 2IHNA 2ZHAA 4F93B 4M6WB 2DRBA 4PGYA 2RFFA 3MR3A 4IRDA 1U45A 5HRBA 2KN7A 4M9JA 1X9SA 1RPLA 3THVA 5HNKA 2ZHBA 7ICVA 4K4GA 4QWAA 3GIKA 3C2MA 4M0AA 8ICRA 3MFHA 3AQNA 5J29A 4NM1A 1SKRA 3AUOA 2DR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB2 A;  5KFI A;  9ICV A;  2ASJ A;  2NRT A;  2I1Q A;  5CP2 A;  5KFZ A;  1U47 A;  5KFU A;  2PI5 A;  2BE3 A;  2ZH8 A;  4RWN A;  1ZQZ A;  2W9B B;  4JV0 A;  3G6X A;  4DFK A;  2B21 A;  4IQV A;  3EZ5 A;  4EYH B;  1ZQN A;  3EYZ A;  2BQR A;  1X2I A;  5J2E A;  1ZQQ A;  4WBY A;  4UQG A;  1N56 A;  1MSW D;  2R8G A;  4O5K A;  1VJ7 A;  1LV5 A;  4RNN A;  1QSY A;  4X0B A;  5CB1 A;  4YN4 A;  3LWM A;  1HUO A;  4I29 A;  5IIO A;  4KLT A;  1NK6 A;  2KFN A;  3JYY A;  4KN4 A;  5HML A;  3Q8L A;  8ICC A;  7ICP A;  3V6K A;  2XCA A;  4KLJ A;  3UXN A;  2XY7 A;  7ICR A;  3WFS C;  1XC9 A;  1NO5 A;  9ICH A;  2P66 A;  2ZUB A;  4IQT A;  1Q79 A;  3V72 A;  4DOB A;  4TQS A;  3RBD A;  1L3V A;  3SI8 A;  4M5D A;  1RXW A;  9ICC A;  4I2A A;  2XY6 A;  1BPY A;  3PX6 A;  3GIJ A;  2C28 A;  1SKW A;  7ICF A;  5HR9 A;  1KDH A;  3TAR A;  1MIV A;  3ISC A;  2ATL A;  4KLI A;  2F1H A;  1ZQJ A;  5KT7 A;  7ICM A;  1U48 A;  3G6V A;  1NK7 A;  2HHU A;  3IM1 A;  2R8I A;  4R65 A;  4QZC A;  3HJ1 A;  3RJH A;  3PO4 A;  2R8H A;  3SV4 A;  5J2K A;  2VA3 A;  4B9V A;  8ICV A;  5HC9 A;  1VFG A;  4YQW A;  1K1Q A;  4I2I A;  4DSL A;  4YR3 A;  5EWG A;  4P4M A;  4RUA A;  4DSF A;  4MF2 A;  4YR0 A;  3N4M B;  4Z6C A;  2P6R A;  4WC5 A;  3MR5 A;  4J9S A;  3KHR A;  1EXN A;  4DQS A;  4M9G A;  5KFS A;  5KG1 A;  4Q43 A;  4PGQ A;  3HT3 A;  4EBD A;  4X4N A;  4IR1 A;  1KSP A;  4MFC A;  8ICL A;  4NKU A;  3K4G A;  4QZB A;  4M6W A;  1JX4 A;  4IRK A;  3PX0 A;  4M9H A;  3B0Y A;  2KTQ A;  2ASD A;  5DKW A;  8ICZ A;  5J2J A;  5J2B A;  4J9Q A;  2H5X A;  2C2E A;  2PFP A;  1R89 A;  2VA8 A;  5KFD A;  3C23 A;  4ECS A;  4GXJ A;  3RAQ A;  1NJX A;  9ICT A;  5CA7 A;  4QZH A;  4I2D A;  2JEF A;  4EBC A;  2F1I A;  4PHP A;  4YP3 A;  2HHW A;  1NK9 A;  2W9B A;  3BJY A;  1ZQV A;  3PW7 A;  1L3T A;  1S9F A;  2I9G A;  4ATB B;  1ZQX A;  3M9M B;  4FH5 A;  4WC6 A;  9ICK A;  2NRZ A;  5DB7 A;  5DB9 A;  3V7L A;  4RQ0 A;  4RQ2 A;  4F5O A;  1T7P A;  4ELU A;  3HW8 A;  3H3A A;  2AJQ A;  3V6H A;  5KFM A;  3Q8S B;  2ISO A;  4I2G A;  1YLQ A;  1NKE A;  4O3N A;  5JUM A;  3PMN A;  3MFI A;  3MDC A;  3G6Y A;  2HVI A;  4DL2 A;  2W8K A;  3UPQ A;  1ZQI A;  1XSL A;  3PW5 A;  2ZTE A;  3PML A;  8ICU A;  7ICS A;  4IR9 A;  8ICW A;  2C22 A;  4DEZ A;  8ICJ A;  2BCU A;  5KFR A;  4XQ8 A;  4QZD A;  5TZV A;  3UPS A;  2DFL A;  1ZET A;  4RQ4 A;  9ICE A;  2BCV A;  4I2J A;  4DOA A;  3UQ0 A;  2DPJ A;  4KLM A;  1BPD A;  4RPX A;  5HRI A;  1TFY A;  5J0S A;  3OJU A;  1KFD A;  8ICY A;  7ICU A;  5J2G A;  1NK8 A;  2FLN A;  5J2I A;  8ICP A;  3H8J A;  4FHP A;  2OWO A;  4IG8 A;  1ZQT A;  3PVX A;  1QSL A;  9ICB A;  4DF8 A;  4FHV A;  4F4K A;  4NLG A;  2V4R A;  4KLD A;  4DQR A;  3OV7 A;  1OU5 A;  3RH4 A;  4QZG A;  4M04 A;  3ETL A;  1JIH A;  2ID1 A;  4M9L A;  2BCQ A;  4UB1 A;  5J0T A;  3EPG A;  1IM4 A;  4F5N A;  1JXL A;  1ZQA A;  4WCW A;  3NYB A;  4UBC A;  3C5G A;  9ICA A;  8ICH A;  3TAP A;  5KG6 A;  4DS4 A;  3T5K A;  5KFA A;  2FLP A;  4TUQ A;  7ICO A;  2RDJ A;  4O3R A;  3HIY A;  3ZD8 A;  4O5C A;  4UAW A;  4GLX A;  5IIK A;  2XGP A;  3AU6 A;  4G3I A;  4FHX A;  4I27 A;  4E80 A;  4ECT A;  1NZP A;  4ED1 A;  4C8K A;  1TKD A;  4M2Y A;  2FPL A;  4F91 B;  1S0M A;  2KZZ A;  4DL3 A;  4B9N A;  4E8F A;  4DOC A;  4TUR A;  1NKC A;  4C8M A;  5CJ7 A;  2V4Q A;  5EWE A;  4O0I A;  5DLF A;  4WC0 A;  1XO1 A;  5III A;  5DBA A;  2W9C B;  5L1J A;  3RAX A;  1ZQE A;  4PH5 A;  4F2R A;  1KLN A;  4WC4 A;  8ICM A;  1UA1 A;  3GIL A;  9ICW A;  3MR2 A;  1SL2 A;  4KLH A;  7ICH A;  4KLE A;  4R64 A;  4UAY A;  3PR5 B;  2MUT A;  5IIJ A;  4PPX A;  3V7K A;  2P6U A;  3PW2 A;  1UT5 A;  3C1Y A;  1ZQH A;  7ICJ A;  1XSP A;  4ATB A;  3PW4 A;  1S0N A;  9ICJ A;  4WC1 A;  1Z3E B;  1BVS A;  2BHN A;  1PX5 A;  5DQH A;  3AQM A;  4LT6 A;  2JZB B;  5KFW A;  4KLU A;  5DB8 A;  3GV5 B;  3JPP A;  4XA5 A;  4EZ6 A;  1ZJM A;  2IA6 A;  4DWI A;  3JPN A;  5J2H A;  4J9N A;  1X9W A;  2J6T A;  4O3Q A;  4Q44 A;  4AT9 A;  9ICP A;  2KZM A;  4JUZ A;  3RB4 A;  3WFQ E;  2DRA A;  3EPI A;  4JV1 A;  4F92 B;  4XUS A;  3BQ1 A;  4EP7 A;  2M2W A;  4BXO B;  4YMO A;  3H7I A;  1NJW A;  2UVW A;  3HJ4 A;  4RUC A;  3TFS A;  5KFF A;  4ECR A;  1U9L A;  5KT5 A;  5J2F A;  4ECU A;  4X4U A;  4M9N A;  2ZJ5 A;  5DB6 A;  4GXI A;  3E2E A;  7ICK A;  8ICX A;  1XS9 D;  1ZQB A;  1JAJ A;  2PBE A;  5KFK A;  1KFS A;  2FLL A;  4CCH A;  4QW8 A;  2M2V A;  4WBZ A;  3BQ2 A;  1RXV A;  4E7X A;  1ZJN A;  3M9N B;  4BDP A;  5KFJ A;  4ED3 A;  2BPC A;  1WCL A;  2XO7 A;  2C2R A;  2ZH1 A;  2IMW P;  4YMN A;  5DG9 A;  3M8R A;  1SL1 A;  3WFP A;  1ZQO A;  5BOL A;  4WC7 A;  3PW0 A;  4KMU A;  5HRD A;  2ZJ8 A;  4RPY A;  2AGQ A;  4EBE A;  1CUK A;  3WFR E;  1JQR A;  3GIM A;  4DQI A;  3NGD A;  4F3O A;  4TUS A;  4FHY A;  1LB2 B;  4FO6 A;  3RR8 A;  4I2E A;  1ZYQ A;  3AQL A;  4GXK A;  1S0O A;  5KFB A;  4X4V A;  3RH5 A;  1TK5 A;  2UVR A;  1S0V A;  4KLO A;  7ICQ A;  1SL0 A;  4XRH A;  2HHQ A;  2W9C A;  2UVV A;  4IQU A;  3HWT A;  4J9O A;  4DL7 A;  3JPR A;  8ICI A;  3OGU A;  2Q66 A;  1ZQM A;  5IIL A;  1A77 A;  4M47 A;  1R8B A;  1A76 A;  4YG2 A;  5C5J A;  4I28 A;  5KFX A;  3JPS A;  7ICG A;  3V6J A;  9ICO A;  4RWP A;  4I2B A;  4ED7 A;  5KG3 A;  1X9M A;  4KLQ A;  2GWS A;  5KFO A;  4IRC A;  3ZDA A;  5HRG A;  2ZTD A;  3H40 A;  2NRX A;  3N97 B;  1L3S A;  2R8K A;  4JV2 A;  1MIY A;  3T5J A;  3T5L A;  1NOM A;  2VA2 A;  4RZR A;  2ZJA A;  4LZD A;  5F9N A;  4PHD A;  3H8S A;  1BPX A;  3PR4 A;  2AQ0 A;  3Q8M A;  1D9F A;  4C8N A;  3RJF A;  4ZH4 A;  5KFE A;  4ECW A;  3RB0 A;  4J9M A;  2R8J A;  3ZDB A;  4O3S A;  1DK3 A;  2HHP A;  5L1K A;  3TAN A;  3H39 A;  4LZG A;  4RQ5 A;  4RPZ A;  3ISB A;  2DR5 A;  1UA0 A;  3HX0 A;  8ICN A;  1L5U A;  4MEY A;  2KZ3 A;  1C7Y A;  7ICE A;  3ORY A;  4RT3 A;  4P4P A;  4R8U B;  3M8S A;  2ZH7 A;  4RQ7 A;  1MIW A;  9ICF A;  3MBY A;  1U4B A;  1DGS A;  2A1J B;  3M9O B;  3MGI A;  1ZQL A;  1ZQD A;  4NLN A;  1Q78 A;  4K4I A;  5HHI A;  5DEC A;  3C1Z A;  1QLN A;  3RB6 A;  2BDP A;  4RU9 A;  1S77 D;  8ICF A;  4QZA A;  5J0U A;  2HW3 A;  5F2V O;  4ELV A;  4C8L A;  5D49 A;  1D8Y A;  2JEI A;  2BGW A;  4YXM A;  4MEX A;  4B9S A;  4NLK A;  1H38 A;  2O1P A;  4RNO A;  5HMM A;  3C18 A;  2PFO A;  3GFK B;  9ICS A;  1BPB A;  7ICI A;  4RWQ A;  4UBB A;  3OHA A;  2XC9 A;  5J0W A;  1V9P A;  2WTF A;  4DS5 A;  4ED6 A;  1ZQC A;  4AT7 B;  2ISP A;  4UB3 A;  5BPC A;  3TAQ A;  5F9L A;  2BPF A;  3QE9 Y;  5J0Q A;  5DQG A;  5HRK A;  1R8A A;  4DLE A;  5J0R A;  4KN7 A;  5EOZ A;  4Z6D A;  1BPE A;  4YD2 A;  5KFT A;  4J9K A;  2DPI A;  5J2C A;  2KP7 A;  2ZH5 A;  4X5V A;  5KTQ A;  8ICS A;  3QZ8 A;  1BNO A;  4F4X A;  1UET A;  5KFC A;  3GQC A;  4DSE A;  2XY5 A;  1RYR A;  1D9D A;  4FHW A;  2AU0 A;  3ISD A;  1KFT A;  4F5Q A;  2W8L A;  4FS1 A;  4E0D A;  3TQ1 A;  2ZH6 A;  3RBE A;  4DQP A;  1S10 A;  8ICK A;  5DBC A;  4S3N A;  3KHL A;  5DQI A;  4O3O A;  4QWE A;  2AGP A;  5KFN A;  1ZQG A;  4MF8 A;  5KFY A;  4PHE A;  3UXP A;  3C66 A;  4B9L A;  4UD4 A;  3H37 A;  4QZ8 A;  4X4S A;  4F5R A;  3FYH A;  3WFO A;  3UXO A;  1TV9 A;  4ECX A;  4DFJ A;  4TQR A;  3T3F A;  1N48 A;  2FMP A;  3OHB A;  3FDS A;  4X4R A;  4F4W A;  4O5E A;  1CEZ A;  2ZUD A;  4GC7 A;  5DG7 A;  1BGX T;  5KT4 A;  3Q8K A;  1ZQP A;  3PO5 A;  9ICM A;  2M2U A;  1UEU A;  2ZH9 A;  4O3P A;  3JPQ A;  4X4Q A;  5IIN A;  4QWB A;  3MR6 A;  4QW9 A;  2Q0Z X;  2ZUC A;  5KG4 A;  1RYS A;  4WC3 A;  4NXZ A;  4QWD A;  4DSI A;  2JEG A;  1R8C A;  4J9L A;  8ICG A;  4AT8 B;  1IXR A;  5KT6 A;  2XGQ A;  5DBB A;  4ECY A;  4R8U A;  8ICQ A;  1ZQY A;  3OJS A;  2A1J A;  3RJG A;  1WOT A;  1DK2 A;  4X4O A;  5KG0 A;  2FPK A;  3PNC A;  1ZQR A;  2HHX A;  4I2F A;  4EZ9 A;  5DGB A;  7ICT A;  7ICL A;  1KNY A;  1KRP A;  5L1I A;  4B9M A;  1WCN A;  1KEJ A;  4P2H A;  3SV3 A;  1COO A;  3V7J A;  4Q8E A;  3C2K A;  5KFL A;  3QEB Z;  4O9M A;  4DQQ A;  2ZH3 A;  3RR7 A;  4B9U A;  9ICG A;  4TUP A;  1KTQ A;  3RTV A;  1ZQU A;  5HRL A;  3AQK A;  4NKT A;  4AT7 A;  5HRF A;  4QZE A;  5BOM A;  2IBK A;  5DLG A;  3HPO A;  5KFV A;  4NM2 A;  4YCX A;  4ECV A;  2NRV A;  4X4P A;  3ZDC A;  4F4Y A;  4BWM A;  3PV8 A;  4B9T A;  4DF4 A;  2FPM A;  5J2D A;  3TI0 A;  3OVS A;  4FBT A;  4LVS A;  3JZ0 A;  4DSJ A;  9ICQ A;  4YR2 A;  3LK9 A;  3SZ2 A;  1B43 A;  1BNP A;  1TK0 A;  1NJY A;  3KHH A;  1ZQK A;  1NK5 A;  4NY8 A;  1TFR A;  3ZD9 A;  1TK8 A;  1UT8 A;  3EWA A;  5IIM A;  2NRK A;  4KIT B;  3HP6 A;  3RJI A;  3H8W A;  5J2A A;  2UVU A;  1V4A A;  4RT2 A;  1Z00 B;  4PGX A;  1JN3 A;  2W9A A;  2BQU A;  2ZTC A;  1T3N A;  3LQC B;  2VAN A;  2C2D A;  4R66 A;  4KTQ A;  1XWL A;  2LYH A;  9ICU A;  1MC8 A;  3RH6 A;  3RJE A;  5J0P A;  4DSK A;  1D8L A;  4UB4 A;  4MFA A;  3UQ2 A;  4YFK A;  2KFZ A;  5HRE A;  5HRH A;  3RRG A;  5KG5 A;  3RJK A;  4RQ6 A;  3PY8 A;  3KHG A;  1BPZ A;  4J9R A;  4GC6 A;  3OSP A;  3H38 A;  2HVH A;  4C8O A;  1ARO P;  3TFR A;  2DR9 A;  2JZB A;  3JPO A;  1NKB A;  3MDA A;  4FS2 A;  2BR0 A;  1TFW A;  2M9N A;  1U49 A;  3GV7 B;  5KG7 A;  4YMM A;  4DL6 A;  8ICE A;  1FA0 A;  4UB5 A;  1ZQF A;  4RNM A;  1L3U A;  2ALZ A;  1PZN A;  5DDY A;  3K75 D;  5KG2 A;  5KT3 A;  2FMQ A;  1HJP A;  4AT8 A;  3OUY B;  7ICN A;  4ED8 A;  9ICR A;  1NK0 A;  4BXO A;  4ED0 A;  4JWM A;  2HHV A;  3OVB A;  1MQ2 A;  4DO9 A;  3BQ0 A;  3L9D A;  2AQ4 A;  3Q8R B;  2ZH2 A;  4YXJ A;  4ED2 A;  5J0O A;  4UD5 A;  4YVZ A;  4EBJ A;  4F5P A;  4EBK A;  2MUT B;  3MGH A;  2W9M A;  2XCP A;  2PXI A;  8ICB A;  5CWR A;  4HYK A;  3C5F A;  4DFP A;  2J6S A;  4KLG A;  5CR0 A;  4DLG A;  2M2T A;  5HP4 A;  3RRH A;  9ICN A;  1K1S A;  3KTQ A;  1XSN A;  4NLZ A;  8ICO A;  4YD1 A;  8ICA A;  2MAX A;  3AU2 A;  9ICI A;  4MFF A;  5DG8 A;  3C2L A;  3OSN A;  5KFP A;  4WC2 A;  9ICL A;  4AT9 B;  3QEA Z;  4K4H A;  3B0X A;  2DR8 A;  5KFG A;  3NTU A;  2DVI A;  3LDA A;  2F1J A;  4DL5 A;  2ASL A;  2V9W A;  2ZH4 A;  4UAZ A;  4Z6F A;  3GDX A;  3MAB A;  4QZI A;  3Q8Q B;  3RB3 A;  1MQ3 A;  1HUZ A;  3RJJ A;  5DDM A;  4BGD A;  1ZQS A;  4I2H A;  4JWN A;  3OVA A;  3ZDE A;  2AGO A;  1Z00 A;  5HHH A;  4R63 A;  2BQ3 A;  4RWO A;  1T4G A;  4Z6E A;  3H4B A;  5L1L A;  4F2S A;  2O5A A;  1S97 A;  5L9X A;  3BQT A;  1TVA A;  4KLL A;  1TAQ A;  2HHT A;  4BWJ A;  4DFM A;  4KLF A;  4F50 A;  4EEY A;  1JXE A;  5D46 A;  4DL4 A;  4EYI B;  1Y88 A;  1QTM A;  2PFQ A;  4I2C A;  4FH3 A;  4ECZ A;  1JMS A;  4XQ7 A;  2JEJ A;  4F4Z A;  4J9P A;  5J0Y A;  3H4D A;  3SYZ A;  5D4B A;  4FBU A;  4KLS A;  3T5H A;  4JK1 A;  1F5A A;  1NK4 A;  5J0X A;  4RQ1 A;  3JPT A;  3ZDD A;  1TAU A;  5EWF A;  3LWL A;  1NJZ A;  1S76 D;  2FMS A;  4IQW A;  2HHS A;  3C21 A;  5DGA A;  2BPG A;  4ECQ A;  4Q8F A;  1SKS A;  4P4O A;  1DOQ A;  4QZ9 A;  1UEV A;  8ICT A;  2IHM A;  9ICX A;  3GII A;  4Q45 A;  4X4T A;  1XU4 A;  1RZT A;  1T8E A;  3Q8P B;  3EW9 A;  4QWC A;  3QZ7 A;  1SZP A;  2RDI A;  4RQ8 A;  3BDP A;  2NRW A;  2BKE A;  3OUY A;  5KFH A;  3GV8 B;  2Y1I A;  2BCR A;  4F8R A;  4RQ3 A;  5KFQ A;  1QSS A;  1B22 A;  5CHG A;  2Y1J A;  2BCS A;  4ELT A;  2PFN A;  1ZQW A;  4QZF A;  3PX4 A;  2J6U A;  5DED A;  4PHA A;  2PI4 A;  5KT2 A;  4X0A A;  3IHQ B;  2IHN A;  2ZHA A;  4F93 B;  4M6W B;  2DRB A;  4PGY A;  2RFF A;  3MR3 A;  4IRD A;  1U45 A;  5HRB A;  2KN7 A;  4M9J A;  1X9S A;  1RPL A;  3THV A;  5HNK A;  2ZHB A;  7ICV A;  4K4G A;  4QWA A;  3GIK A;  3C2M A;  4M0A A;  8ICR A;  3MFH A;  3AQN A;  5J29 A;  4NM1 A;  1SKR A;  3AUO A;  2DR7 A; 
#chains in the Genus database with same CATH topology
 1PK3 A;  4UB2 A;  5CP2 A;  1AQ6 A;  1N61 A;  5KFZ A;  3NVZ A;  5KFU A;  4OAF A;  4RWN A;  2W9B B;  4JV0 A;  2B21 A;  1ZQN A;  5HR7 A;  1ZQQ A;  1N56 A;  1MSW D;  1VJ7 A;  2JRZ A;  5AIB A;  1X42 A;  4KN4 A;  1SWW A;  2XCA A;  4KLJ A;  2KE7 A;  1UQV A;  4BUG A;  2ZUB A;  4IQT A;  2B4V A;  4TQS A;  2LHT A;  4UB8 U;  1BPY A;  7ICF A;  3AM9 A;  1KDH A;  2ZG6 A;  3ISC A;  2KJ8 A;  4KLI A;  2K4I A;  3HKZ F;  2G0A A;  1J97 A;  2CPR A;  1OW5 A;  1NK7 A;  2R8I A;  4R65 A;  2R8H A;  8ICV A;  5HC9 A;  3SAG A;  2P6R A;  4Z6C A;  3MR5 A;  4J9S A;  3NS1 A;  3ONN A;  4O3M A;  4PGQ A;  2G07 A;  3QU7 A;  1KSP A;  5AI8 A;  4M6W A;  3PX0 A;  2ASD A;  2H5X A;  2PFP A;  3C23 A;  5TIS U;  2KV2 A;  5ALY A;  4EBC A;  2W43 A;  2H3I A;  2HHW A;  2KIW A;  1NK9 A;  1S9F A;  4NXU A;  5DB9 A;  4ELU A;  1T7P A;  4IC9 A;  4I2G A;  8ICU A;  1XSL A;  2ZTE A;  3PML A;  4IR9 A;  8ICJ A;  5KFR A;  2MRL A;  4QZD A;  9ICE A;  4I2J A;  5HRI A;  5J0S A;  1S8O A;  8ICY A;  5J2G A;  1NK8 A;  2FLN A;  3H8J A;  1ZQT A;  4DF8 A;  3FAH A;  4KLD A;  1OU5 A;  5KL8 B;  3EPG A;  4F5N A;  2RDJ A;  2Y9T A;  4FHX A;  4UAW A;  5IIK A;  5AKJ A;  1JAL A;  4M2Y A;  2QB1 A;  4TUR A;  1NKC A;  5AKX A;  1VLB A;  5EWE A;  5III A;  3RAX A;  2W9C B;  8ICM A;  4P0Q B;  7ICH A;  3QYP A;  4C0Z A;  2HBL A;  3PR5 B;  4PPX A;  3V7K A;  2NO5 A;  3WKB A;  2XI9 A;  3PW4 A;  1S0N A;  9ICJ A;  1N63 A;  1Q3U A;  1PX5 A;  5DQH A;  4O69 A;  3WK4 A;  3GV5 B;  3JPP A;  4EZ6 A;  5AKZ A;  3JPN A;  4J9N A;  4NXX A;  1X9W A;  2HBK A;  4AT9 A;  2KZM A;  2DRA A;  1COK A;  4F92 B;  2YMP A;  2M2W A;  3R9K A;  3HJ4 A;  5KAF U;  1GPJ A;  3TFS A;  2IUB A;  1U9L A;  4N7R A;  4X4U A;  4IL6 U;  2PBE A;  1ZRM A;  2FLL A;  4WH5 A;  2LI6 A;  4QW8 A;  4WBZ A;  5CFU A;  4E7X A;  2K4H A;  3M9N B;  1KL9 A;  5KFJ A;  4BDP A;  4CNQ A;  1WCL A;  4YMN A;  1SL1 A;  1LVH A;  1CUK A;  3L3F X;  3GIM A;  4DQI A;  4TUS A;  4FHY A;  1LB2 B;  1XO0 A;  4FO6 A;  3RR8 A;  3AQL A;  1MA7 A;  2IHO A;  5KFB A;  4X4V A;  2UVR A;  1SGG A;  3QUT A;  2M0N A;  2UVV A;  3JPR A;  2Q66 A;  1ZQM A;  4UAR A;  3SR6 A;  1A77 A;  2ZXH A;  1R8B A;  4JMU A;  3JPS A;  7ICG A;  9ICO A;  4I2B A;  1L7P A;  5AKY A;  2ZTD A;  4JV2 A;  2R8K A;  1N5X A;  4KLT A;  1D9F A;  3RFA A;  3Q8M A;  2AQ0 A;  1PK1 B;  2WAQ F;  4C8N A;  3U26 A;  3RB0 A;  4O67 A;  3BZK A;  4J9M A;  3WK5 A;  3ISB A;  1UA0 A;  3NAS A;  5JTI A;  8ICN A;  2JMG A;  4O6A A;  5AKI A;  3SD7 A;  4R8U B;  3D2S A;  2EAO A;  4K4I A;  3L4P A;  2K4P A;  2BDP A;  4QZA A;  5J0U A;  2HW3 A;  3A0B U;  5F2V O;  1HIW A;  1D8Y A;  2Y0S C;  4FZL A;  4MEX A;  4B9S A;  1H38 A;  3CYM A;  4UAU A;  5HMM A;  7ICI A;  5BPC A;  3TAQ A;  3EF2 A;  2K4E A;  5F9L A;  2BPF A;  3QE9 Y;  4Z6D A;  2DPI A;  5J2C A;  2KP7 A;  3TAD C;  4EX7 A;  3GQC A;  3WK6 A;  1KFT A;  5DQI A;  4O3O A;  2AGP A;  1SXE A;  1ZQG A;  5KFY A;  4PHE A;  3H37 A;  5KL1 B;  4C7Z A;  2B6G A;  5D63 A;  4ECX A;  2FMP A;  3T3F A;  1N48 A;  2ZUD A;  4GC7 A;  1UEU A;  9ICM A;  3BS5 B;  3PO5 A;  3JPQ A;  3MR6 A;  3PSP A;  1RYS A;  4LEY A;  5DBB A;  4ECY A;  1ZQY A;  4AYB F;  3OJS A;  2A1J A;  4F71 A;  1ZQR A;  7ICT A;  3PSI A;  5DGB A;  1KEJ A;  4LEW A;  2HOF A;  3QEB Z;  4B9U A;  2A19 A;  1KTQ A;  4NKT A;  4PJ0 U;  4NXW A;  5BOM A;  1A0P A;  1SXD A;  5KFV A;  4NM2 A;  4ECV A;  2NRV A;  1JUD A;  4DF4 A;  2WF9 A;  5J2D A;  3OVS A;  4YR2 A;  1TK0 A;  3KHH A;  2KKV A;  5J8Y A;  3EWA A;  3DV9 A;  1KQQ A;  2NRK A;  3RJI A;  1Z00 B;  4PZN A;  2BQU A;  2W9A A;  2KSO B;  2IOF A;  2W3S A;  2E5S A;  4KTQ A;  2LYH A;  3F2C A;  3HJE A;  5ALQ A;  2KOB A;  2KFZ A;  1D8L A;  5HRH A;  2FI1 A;  1WUD A;  2YB4 A;  5AKG A;  4KB6 A;  1UHU A;  1FO4 A;  3PY8 A;  2YMQ A;  4J9R A;  4WQK A;  3H38 A;  3IG5 A;  1OUQ A;  4C8O A;  3JPO A;  4FS2 A;  2BR0 A;  4YMM A;  1FA0 A;  4UB5 A;  1L3U A;  4ED8 A;  2G08 A;  5AKH A;  2LM1 A;  2YML A;  4JWM A;  3OVB A;  4U7C A;  1MQ2 A;  1LKY B;  4DO9 A;  3BQ0 A;  3L9D A;  5J0O A;  4YVZ A;  4EBJ A;  5B5E U;  2MUT B;  3K1Z A;  4Y2Y A;  3IRU A;  3C5F A;  3NKU A;  5HP4 A;  3WK7 A;  2D3D A;  8ICO A;  4MFF A;  5DG8 A;  1M6Y A;  5KFG A;  1JRP A;  2ASL A;  2HN2 A;  1B0X A;  3GDX A;  1MQ3 A;  1HUZ A;  2DQN B;  3I28 A;  3OVA A;  4LEZ A;  3GZF A;  4RWO A;  2WB1 F;  1T4G A;  4Z6E A;  3H4B A;  4F2S A;  1TAQ A;  3QX7 A;  4BWJ A;  2N1R A;  4EYI B;  4NLC A;  1QTM A;  1JMS A;  2ZIW B;  2GAF D;  4F4Z A;  4J9P A;  4NL9 A;  5ALU A;  1F5A A;  2QAR B;  5EWF A;  2HHS A;  1NJZ A;  3CK6 A;  2BPG A;  4P4O A;  1DOQ A;  4QZ9 A;  1UEV A;  3MGV A;  4Q45 A;  1XU4 A;  1T8E A;  1KBU A;  3GV8 B;  2BCR A;  2PFN A;  4QZF A;  3QUB A;  2J6U A;  3BS7 A;  4F93 B;  2DRB A;  4PGY A;  2RFF A;  1X9S A;  2BDU A;  7ICV A;  3C2M A;  3MFH A;  3O0F A;  3OTQ A;  1CI4 A;  9ICV A;  2NRT A;  2ZH8 A;  2BE3 A;  4DFK A;  3G6X A;  4IQV A;  3WKE A;  5JU5 A;  2BQR A;  1ZRN A;  1X2I A;  2E8P A;  2QB0 B;  4RNN A;  5CB1 A;  1T3Q A;  4I29 A;  5IIO A;  1NK6 A;  3JYY A;  7ICP A;  7ICR A;  3WFS C;  2XY7 A;  1XC9 A;  9ICH A;  5ALS A;  5KNI A;  5AK4 A;  2IOF K;  2WHE A;  2C28 A;  1SKW A;  4K96 A;  2F1H A;  5KT7 A;  2ZIX A;  1U48 A;  4WOY A;  3KD3 A;  4YQW A;  2FJ6 A;  4I2I A;  4DSF A;  3N4M B;  4WC5 A;  3NVV A;  5ALF A;  1N60 A;  5KFS A;  5KG1 A;  3QU4 A;  4Q43 A;  4IR1 A;  4MFC A;  3K4G A;  4QZB A;  1JX4 A;  2KTQ A;  3F53 A;  5DKW A;  8ICZ A;  2WF5 A;  5J2J A;  5J2B A;  2C2E A;  1R89 A;  5KFD A;  4ECS A;  3RAQ A;  3D2Q A;  2W03 A;  1GO3 F;  2JEF A;  2F1I A;  4YP3 A;  2W9B A;  4QIW F;  4ATB B;  4Y2R A;  1ZQX A;  9ICK A;  2OEH A;  3V7L A;  2KIV A;  2GO7 A;  3HW8 A;  3V6H A;  2ISO A;  2ZIU B;  7ICS A;  5TZV A;  1ZET A;  2BCV A;  2DPJ A;  1BPD A;  3OJU A;  2CXY A;  2OWO A;  4IG8 A;  9ICB A;  4RQM A;  4JLZ A;  4F4K A;  4DQR A;  1P7D A;  4QZG A;  3PST A;  4M9L A;  2BCQ A;  4UB1 A;  5J0T A;  1JXL A;  3N7P D;  4UBC A;  8ICH A;  5KG6 A;  4DS4 A;  3T5K A;  3E0F A;  5ALZ A;  1YZ7 A;  3AU6 A;  4I27 A;  4ED1 A;  2R18 A;  1Q8K A;  3N7R C;  2KZZ A;  4E8F A;  4DL3 A;  1RDF A;  4B6J A;  1S5L U;  1QQ6 A;  5DLF A;  2ZH2 A;  5DBA A;  1ZQE A;  5L1J A;  2PMZ C;  4PH5 A;  2LYB A;  2MU2 A;  1SV0 C;  3GIL A;  9ICW A;  2DUY A;  3MR2 A;  1X40 A;  4EEN A;  3KZX A;  1UT5 A;  3C1Y A;  1ZQH A;  1QQ5 A;  4WC1 A;  3WK9 A;  2JZB B;  5AM3 A;  4DWI A;  5J2H A;  9ICP A;  4JV1 A;  3BQ1 A;  4BXO B;  3H7I A;  4RUC A;  5KFF A;  5KT5 A;  4GIB A;  4M9N A;  1J2N A;  1JAJ A;  3B9J A;  5AM2 A;  1ZQB A;  2WF8 A;  5ALT A;  1KKX A;  3H0L B;  2C2R A;  2ZH1 A;  3PW0 A;  5ALR A;  3BQ7 A;  4KMU A;  5HRD A;  5CRX A;  4RPY A;  2AGQ A;  1IG6 A;  2JXJ A;  2ZXI A;  1KN5 A;  2E8N A;  1S0O A;  1WYG A;  3RH5 A;  5D62 A;  1S0V A;  7ICQ A;  1DGJ A;  1Q3V A;  1V38 A;  2W9C A;  3NWI A;  2FCL A;  1ZD4 A;  2LMR A;  5IIL A;  4M47 A;  4YG2 A;  2HI0 A;  5KFX A;  4RWP A;  5AI5 A;  1FFV A;  4ED7 A;  5KFO A;  5AI4 A;  1QH9 A;  2NRX A;  3T5J A;  1O08 A;  5AK6 A;  4LZD A;  1FEZ A;  3H8S A;  3PR4 A;  5KFE A;  4ECW A;  1V85 A;  2HHP A;  5ALX A;  5EE9 A;  4RQ5 A;  4RPZ A;  5HR6 A;  1KW4 A;  4MEY A;  7ICE A;  3ORY A;  4P4P A;  2ZH7 A;  4RQ7 A;  4ZOH C;  1U4B A;  3MGI A;  2KMD A;  5HHI A;  1WG8 A;  3C1Z A;  1QLN A;  5D61 A;  3RB6 A;  1S77 D;  4CF4 A;  5D49 A;  2O1P A;  2PFO A;  4RWQ A;  2XC9 A;  3UM9 A;  2EQY A;  1R8A A;  4DLE A;  4KN7 A;  1UPH A;  5EOZ A;  4J9K A;  2DKZ A;  4X5V A;  2ZH5 A;  3ICX A;  2ZIV B;  1BNO A;  4F4X A;  5KFC A;  4DSE A;  3TAC B;  2AU0 A;  1RM6 C;  2W8L A;  4F5Q A;  4E0D A;  4HAI A;  5DBC A;  5KFN A;  4C4S A;  3PHZ A;  4PL2 A;  3C66 A;  4X4S A;  4F5R A;  3BZC A;  3AMZ A;  3UXO A;  1TV9 A;  3FC4 A;  3FDS A;  1HEK A;  1CEZ A;  5DG7 A;  1BGX T;  1PK1 A;  4O3P A;  3IV6 A;  1X66 A;  2ZUC A;  4DSI A;  4AYB C;  1R8C A;  5ALG A;  4AT8 B;  1IXR A;  4DCC A;  1SWV A;  3HRD D;  4R8U A;  2NV3 A;  3LVV A;  2HOQ A;  1DK2 A;  5KG0 A;  2FPK A;  4EZ9 A;  2W54 A;  4B9M A;  1WCN A;  5C0Y A;  2JH7 A;  4Q8E A;  2ZH3 A;  3H8M A;  4TUP A;  3N7S C;  5HRF A;  4QZE A;  3HPO A;  1ZD5 A;  3M6K A;  2I5H A;  3K7D A;  4MHV A;  1Z4O A;  2HN1 A;  4FBT A;  2AH5 A;  3VCB A;  1B43 A;  4FFD A;  1NJY A;  1NK5 A;  3ZD9 A;  4OJ5 A;  5J2A A;  4RT2 A;  4PGX A;  1JN3 A;  5EE3 A;  3LQC B;  1T3N A;  2JR5 A;  2C2D A;  4R66 A;  1XWL A;  2O6K A;  4DSK A;  1PUZ A;  1C20 A;  3RRG A;  3H0R B;  3QU9 A;  5E79 U;  3KHG A;  4GC6 A;  3BS5 A;  5ALI A;  2DR9 A;  3MDA A;  3GV7 B;  2Q4T A;  1N62 A;  1ZQF A;  2HHQ A;  3K75 D;  5KT3 A;  4Y2J A;  1NK0 A;  1Z1B A;  1X6I A;  1SZH A;  3NVY A;  1JI7 A;  5AM1 A;  3K1R B;  4YXJ A;  1Q46 A;  4EBK A;  4F5P A;  4PZO A;  3MGH A;  4GFJ A;  4DFP A;  5CR0 A;  4NV0 A;  1K1S A;  4C4R A;  8ICA A;  9ICI A;  3AQE A;  3JCF A;  4AT9 B;  4K4H A;  3NTU A;  4DL5 A;  3AN1 A;  2V9W A;  4UAZ A;  3MAB A;  4QZI A;  3Q8Q B;  3RB3 A;  3RJJ A;  2ESE A;  4I2H A;  1Z00 A;  4A8E A;  5HHH A;  4R63 A;  2BQ3 A;  2OCE A;  2KSO A;  2O5A A;  4MKP A;  3KZI U;  1TVA A;  2HHT A;  2F44 A;  4FE3 A;  4CE6 A;  4KLS A;  3T5H A;  4JK1 A;  1NK4 A;  3JPT A;  2E1E A;  2Y9U A;  5ALL A;  4AP9 A;  3LWL A;  2JGA A;  2FMS A;  5DGA A;  4EV6 A;  1SKS A;  2IHM A;  9ICX A;  3GII A;  2LYA A;  7ICN A;  4QWC A;  4RQ8 A;  2Y1I A;  1TAM A;  5CHG A;  2Y1J A;  2KHV A;  1LKY A;  2E3T A;  4JLX A;  3L5K A;  4CF5 A;  3SAH A;  2PI4 A;  3IHQ B;  2IHN A;  2EAN A;  2VJ5 A;  2KN7 A;  3KKA C;  1RPL A;  3THV A;  4WBY A;  3OPX A;  1NNL A;  4QWA A;  3AQN A;  1SKR A;  3AUO A;  2DR7 A;  4Y2U A;  5KFI A;  1RQL A;  2ASJ A;  1U47 A;  2PI5 A;  1ZQZ A;  2KEY A;  5AM5 A;  2XID A;  5CHE A;  4Y2Q A;  5A0L A;  3EYZ A;  1CRX A;  2R8G A;  4X0B A;  4YN4 A;  5G5H A;  4IS7 A;  3Q8L A;  8ICC A;  2EZZ A;  2KJ9 A;  1NO5 A;  2VJ4 A;  1Q79 A;  1L3V A;  4M5D A;  1RXW A;  3N28 A;  1MIV A;  3TAR A;  2ATL A;  3C28 A;  2HHU A;  1D8B A;  3HJ1 A;  3PO4 A;  2VA3 A;  3SV4 A;  4B9V A;  2XVT A;  4K8V A;  5T14 A;  1VFG A;  1K1Q A;  5ALN A;  5EWG A;  4YR0 A;  3ED5 A;  4DQS A;  4M9G A;  3HT3 A;  4EBD A;  4NKU A;  5ALD A;  3B0Y A;  2F77 X;  2DWQ A;  3F5E A;  3UMG A;  4J9Q A;  2QLT A;  1TE2 A;  2D6F C;  4GXJ A;  3F2B A;  9ICT A;  4QIW C;  4QZH A;  4I2D A;  2DF4 B;  3BJY A;  1L3T A;  4K98 A;  3HIL A;  4ICA A;  3M9M B;  4WC6 A;  2QB0 A;  2W3R A;  3H3A A;  2MA1 A;  5AI0 A;  2AJQ A;  5AI9 A;  1YLQ A;  4OCZ A;  3IN5 A;  4O3N A;  3DEE A;  3PMN A;  3MFI A;  3G6Y A;  2HVI A;  4EEB A;  8ICW A;  2C22 A;  4DEZ A;  5ALP A;  2DFL A;  4RQ4 A;  4DOA A;  4KLM A;  4RPX A;  4PL1 A;  1KFD A;  2K89 A;  1YZ6 A;  4FHP A;  2ES6 A;  3PVX A;  1QSL A;  4FHV A;  2K60 A;  2V4R A;  2L5Y A;  1PVR A;  3OV7 A;  2VIX A;  2Y0S F;  4M04 A;  2K8C B;  3ETL A;  4Y2X A;  1IM4 A;  1ZQA A;  4WCW A;  3C5G A;  2ODG A;  2YN4 A;  5KFA A;  2FLP A;  4TUQ A;  4O3R A;  3HIY A;  3S6J A;  3ZD8 A;  4GLX A;  2XGP A;  4G3I A;  1NZP A;  4ECT A;  3WU2 U;  2FPL A;  4F91 B;  1A6S A;  2FDR A;  4C8M A;  5CJ7 A;  5JRT A;  4O0I A;  1WWU A;  2LPE A;  2V4Q A;  1XO1 A;  3NRZ A;  4F2R A;  1KLN A;  4UAT A;  1SL2 A;  4KLH A;  4KLE A;  4R64 A;  4UAY A;  2RHF A;  4OAG A;  3GU3 A;  7ICJ A;  1XSP A;  4ATB A;  1Z3E B;  1ZD2 P;  3AQM A;  4LT6 A;  2F8K A;  2OH2 A;  3M1Y A;  1ZJM A;  2ZIU A;  2IA6 A;  3NRW A;  2J6T A;  3RB4 A;  2AXT U;  2A3V A;  2GH1 A;  2W04 A;  4YMO A;  1NJW A;  4G9B A;  2UVW A;  5J2F A;  4ECU A;  1VDV A;  2ZJ5 A;  3E2E A;  5KFK A;  2HCF A;  1ZD3 A;  2M2V A;  3BQ2 A;  1L8O A;  4O68 A;  1ZJN A;  5ALV A;  3HKZ C;  5B3P A;  4ED3 A;  3QXG A;  2BPC A;  4NLB A;  2RQ5 A;  5AM4 A;  3FM9 A;  2XO7 A;  1OXJ A;  4CGZ A;  5DG9 A;  5EE0 A;  3M8R A;  4WC7 A;  3CNH A;  2XIC A;  1QQ7 A;  1JQR A;  2HOI A;  3NGD A;  4F3O A;  1ZYQ A;  3H0M B;  1NZB A;  1TK5 A;  4Y2S A;  2JH1 A;  4XRH A;  1QCK A;  4IQU A;  3QUC A;  3HWT A;  8ICI A;  2DKX A;  5L1M A;  1ZOL A;  3DDH A;  3SAF A;  4I28 A;  3TAD A;  3V6J A;  1X9M A;  4IRC A;  4NXT A;  3H40 A;  1L3S A;  2VA2 A;  1NOM A;  4RZR A;  2ZJA A;  5F9N A;  4PHD A;  1BPX A;  2BCS A;  3RJF A;  4ELT A;  2LKY A;  4ZH4 A;  1Z4N A;  3SMV A;  3ZDB A;  1F44 A;  3TAN A;  3H39 A;  2FE9 A;  5K4L A;  5CFT A;  2DR5 A;  3HX0 A;  1ZXI A;  2KZ3 A;  1C7Y A;  3OWG A;  4OJ6 A;  3MBY A;  2K8A A;  4NLN A;  1Q78 A;  5EE1 A;  3F5A A;  4US8 A;  4WQL A;  3IDW A;  4C8L A;  5H2F U;  3J81 j;  4NLK A;  4RNO A;  4C80 A;  3C18 A;  1URJ A;  9ICS A;  4AT7 B;  2RP5 A;  1ZQC A;  2LM4 A;  2NYV A;  5J0Q A;  5HRK A;  2W7P A;  2G5I B;  4EGW A;  5KFT A;  5GTI U;  8ICS A;  2H3V A;  1RYR A;  1D9D A;  4FHW A;  2ZH6 A;  4J03 A;  3TQ1 A;  1S10 A;  8ICK A;  4S3N A;  3KHL A;  4QWE A;  4MF8 A;  3UXP A;  4UB6 U;  4UD4 A;  4QZ8 A;  4OD0 A;  3VC8 A;  2ZIX B;  3WFO A;  4TQR A;  3MCR A;  4F4W A;  1ZQP A;  3Q8K A;  2ZH9 A;  5IIN A;  2E8M A;  4NWI A;  4NXZ A;  3KOO A;  4P0P B;  2JV3 A;  8ICG A;  5KT6 A;  2EH9 A;  2XGQ A;  2HDO A;  8ICQ A;  4QNL A;  4K9B A;  3T79 A;  3CW2 C;  4X4O A;  3PNC A;  2HHX A;  4I2F A;  1KNY A;  7ICL A;  5L1I A;  1SIJ A;  3V7J A;  3C2K A;  5KFL A;  4DQQ A;  9ICG A;  3AQF A;  5AKK A;  1ZQU A;  3AQK A;  2BBJ A;  2WF7 A;  4X4P A;  4F4Y A;  3PV8 A;  2FPM A;  9ICQ A;  3LK9 A;  3SZ2 A;  1ZQK A;  2ZIV A;  4NY8 A;  1SB3 C;  1IIP A;  5IIM A;  3ER8 C;  3ZI4 A;  2UVU A;  1V4A A;  2VAN A;  9ICU A;  1MC8 A;  3RJE A;  1O03 A;  4UAS A;  4MFA A;  4P0Q A;  4YFK A;  2KNJ A;  5KG5 A;  1T94 A;  1BPZ A;  2YX8 A;  2DBY A;  3OSP A;  1L7M A;  2WAQ C;  4DFD A;  1TFW A;  2M9N A;  3NVW A;  4DL6 A;  2KD1 A;  4AT8 A;  1ZQ1 C;  1HJP A;  3OUY B;  9ICR A;  4ED0 A;  1X6J A;  2YMM A;  2KG5 A;  1J2M A;  2VKQ A;  2EWR A;  4K97 A;  3WKD A;  3Q8R B;  2AQ4 A;  1N2X A;  4ED2 A;  4UD5 A;  2W9M A;  2PXI A;  2J6S A;  4EED A;  9ICN A;  5J8Y C;  3KTQ A;  3AU2 A;  2KHQ A;  1X9X A;  3C2L A;  3OSN A;  2WFA A;  9ICL A;  3QEA Z;  2DVI A;  3B0X A;  2DR8 A;  3LDA A;  2F1J A;  2B56 A;  2KVS A;  4BGD A;  4JWN A;  3ZDE A;  2AGO A;  5AM0 A;  4F50 A;  4EEY A;  5D46 A;  4DL4 A;  3QNM A;  4C7Y A;  2PFQ A;  4EEL A;  4I2C A;  3ER9 B;  4ECZ A;  2JEJ A;  4FZN A;  5J0Y A;  4CRX A;  4FBU A;  1F5S A;  1FFU A;  3F2D A;  4RQ1 A;  3SEI A;  1TAU A;  2F2A B;  4IQW A;  4ECQ A;  4Q8F A;  2OYY A;  4I0U A;  4OAI Z;  3Q8P B;  3QZ7 A;  3BDP A;  5ALW A;  2NRW A;  2BKE A;  4OJP A;  1PVP A;  5KFQ A;  1ZQW A;  4PHA A;  5KT2 A;  2ZHA A;  4M6W B;  3MR3 A;  4IRD A;  1U45 A;  2PMZ F;  4K4G A;  3LYS A;  5J29 A;  5AK5 A;  2I1Q A;  4EYH B;  3EZ5 A;  3A0H U;  5GTH U;  4LEV A;  5J2E A;  1UCV A;  4UQG A;  4O5K A;  1LV5 A;  1VJ5 A;  1QSY A;  3LWM A;  1HUO A;  2KFN A;  5HML A;  3V6K A;  3UXN A;  4NL9 C;  2P66 A;  3V72 A;  4DOB A;  3RBD A;  2HMX A;  3RF9 A;  3SI8 A;  4CDG A;  9ICC A;  4I2A A;  2XY6 A;  3D6J A;  3PX6 A;  3GIJ A;  5HR9 A;  1DXS A;  3QU2 A;  1PVQ A;  2AHO B;  3PZP A;  1ZQJ A;  7ICM A;  3G6V A;  3IM1 A;  1IV8 A;  4QZC A;  3RJH A;  5ALJ A;  4XJE A;  5J2K A;  4DSL A;  4YR3 A;  4P4M A;  3JZ0 A;  5AK3 A;  4RUA A;  4MF2 A;  1B4F A;  1WWV A;  3KHR A;  1EXN A;  4X4N A;  2P35 A;  8ICL A;  2RRD A;  3I1Y A;  2Z7J A;  4IRK A;  4NXV A;  4M9H A;  2G06 A;  2VA8 A;  2F76 X;  4UAV A;  1NJX A;  5CA7 A;  2KJ5 A;  2JHD A;  4K9A A;  2YTU A;  4PHP A;  1L6N A;  1ZQV A;  3PW7 A;  2I9G A;  4U6P A;  4FH5 A;  2NRZ A;  1SV0 A;  5DB7 A;  2OHF A;  4RQ0 A;  4RQ2 A;  4F5O A;  5AKE A;  2BBH A;  5KFM A;  3Q8S B;  1NKE A;  2I6X A;  1RQN A;  5JUM A;  3MDC A;  4DL2 A;  2W8K A;  3UPQ A;  1ZQI A;  3PW5 A;  2BCU A;  2WB1 C;  3KBB A;  4XQ8 A;  3UPS A;  3M7D A;  1N5W A;  2OM6 A;  5B3Q A;  4F72 A;  3UQ0 A;  1TFY A;  3CP8 A;  7ICU A;  8ICP A;  5J2I A;  2D8C A;  4NLG A;  1YT3 A;  3AEV A;  3RH4 A;  5AKL A;  1JIH A;  2ID1 A;  2BZF A;  2IOH A;  3NYB A;  9ICA A;  3TAP A;  3QUQ A;  1L7N A;  7ICO A;  3WKC A;  4O5C A;  4E80 A;  4C8K A;  1TKD A;  4JB3 A;  1S0M A;  4B9N A;  4KM5 A;  4DOC A;  3EUB 2;  3ERC C;  4WC0 A;  2NO4 A;  4WC4 A;  3SQI A;  1UA1 A;  2W11 A;  2MUT A;  5IIJ A;  3IP4 B;  2P6U A;  3PW2 A;  4Y2P A;  1MN8 A;  1BVS A;  2BHN A;  5CFS A;  5KFW A;  4KLU A;  2HBJ A;  5DB8 A;  5B66 U;  4XA5 A;  5JTG A;  4O3Q A;  4Q44 A;  5AIA A;  3WFQ E;  4JUZ A;  2EDU A;  3EPI A;  1NI3 A;  2W7O A;  4XUS A;  2GA9 D;  4EP7 A;  3ETR A;  4K99 A;  4ECR A;  5DB6 A;  4GXI A;  7ICK A;  8ICX A;  1XS9 D;  1KFS A;  4CCH A;  1RXV A;  4OO1 J;  2YQE A;  3ALR A;  2PKE A;  2ZIW A;  2E1F A;  2GLE A;  2IMW P;  3WFP A;  1ZQO A;  5BOL A;  2QAR A;  3D2N A;  1SV4 A;  2ZJ8 A;  4EBE A;  3WFR E;  4I2E A;  4GXK A;  4EEK A;  1F0M A;  4UW9 A;  4KLO A;  1SL0 A;  4Y2V A;  2KIC A;  4J9O A;  4DL7 A;  3M6Z A;  3OGU A;  2EZY A;  4EX6 A;  1A76 A;  2HBM A;  5C5J A;  4ACO A;  5KG3 A;  4KLQ A;  2GWS A;  3ZDA A;  5HRG A;  3N97 B;  1MIY A;  2KKP A;  3T5L A;  3LVW A;  3IG8 A;  1DK3 A;  4O3S A;  2R8J A;  5L1K A;  1RG6 A;  4LZG A;  2MSN A;  5AIC A;  1L5U A;  4OJO A;  4RT3 A;  2YY6 A;  3M8S A;  1MIW A;  9ICF A;  1DGS A;  2A1J B;  3M9O B;  1ZQL A;  1ZQD A;  5DEC A;  2CN1 A;  4RU9 A;  8ICF A;  4ELV A;  2DGZ A;  5G5G A;  2JEI A;  2BGW A;  4YXM A;  3NUQ A;  3GFK B;  1BPB A;  2F8L A;  4UBB A;  3OHA A;  1RYU A;  1V9P A;  5J0W A;  4KX5 A;  2WTF A;  4ED6 A;  4DS5 A;  4US9 A;  1L7O A;  4UB3 A;  2ISP A;  4HX0 A;  5DQG A;  5J0R A;  1BPE A;  4YD2 A;  5KTQ A;  5F3X B;  3QZ8 A;  3C29 A;  2LBO A;  1UET A;  2XY5 A;  2B0C A;  3MC1 A;  3ISD A;  2QKQ A;  2EZX A;  4FS1 A;  2H3Q A;  3PSF A;  5CEH A;  2RLT A;  3RBE A;  4DQP A;  1ED1 A;  4OAH A;  4B9L A;  1V97 A;  3FYH A;  3NVO A;  4USA A;  4DFJ A;  3CRX A;  3OHB A;  4X4R A;  4O5E A;  5KT4 A;  2DL0 A;  2M2U A;  4X4Q A;  2H3F A;  4QWB A;  4QW9 A;  2Q0Z X;  5ALE A;  5KG4 A;  4WC3 A;  4QWD A;  2JEG A;  5AHX A;  4J9L A;  2OXO A;  4FO1 A;  5AI6 A;  3RJG A;  1WOT A;  3QU5 A;  1KRP A;  1XNS A;  2KK0 A;  1Z19 A;  4P2H A;  3SV3 A;  1COO A;  4QJF B;  3WK8 A;  4O9M A;  3RR7 A;  2CRX A;  3RTV A;  5HRL A;  4AT7 A;  2IBK A;  5DLG A;  4YCX A;  3ZDC A;  4LJX A;  4NJ8 A;  4BWM A;  4B9T A;  3TI0 A;  4LVS A;  4DSJ A;  1BNP A;  5ALM A;  3UMC A;  1TFR A;  1TK8 A;  1UT8 A;  3E58 A;  4KIT B;  3HP6 A;  2A1A A;  3H8W A;  4CF3 A;  2EAM A;  2ZTC A;  4OJL A;  5KAI U;  1ECW A;  3RH6 A;  5J0P A;  5HRE A;  4UB4 A;  3UQ2 A;  3RJK A;  4RQ6 A;  2W55 A;  3SEN A;  2F3N A;  2G09 A;  3UMB A;  4BJQ A;  2HVH A;  1ARO P;  3TFR A;  2JZB A;  1NKB A;  1U49 A;  5KG7 A;  4P0P A;  8ICE A;  4KX3 A;  1DRG A;  3TKA A;  4RNM A;  2ALZ A;  1PZN A;  5DDY A;  1Z1V A;  5KG2 A;  5ALH A;  2FMQ A;  4BXO A;  2K8B B;  2HHV A;  1K5O A;  2HSZ A;  4FZM A;  2XCP A;  8ICB A;  5CWR A;  4HYK A;  4KLG A;  4DLG A;  2M2T A;  3RRH A;  1FIQ A;  1XSN A;  4NLZ A;  4YD1 A;  2MAX A;  2EAP A;  2G5H B;  3KKA A;  5KFP A;  4WC2 A;  3I76 A;  2ZH4 A;  4Y2T A;  4Z6F A;  2E8O A;  5DDM A;  1ZQS A;  4WJ3 B;  4RQN A;  5L1L A;  1S97 A;  5L9X A;  3BQT A;  4KLL A;  4DFM A;  4KLF A;  2H3Z A;  1JXE A;  1Y88 A;  4FH3 A;  4XQ7 A;  3SYZ A;  2YB1 A;  3H4D A;  5D4B A;  2B51 A;  5J0X A;  2WF6 A;  3ZDD A;  1S76 D;  3C21 A;  8ICT A;  2GOL A;  4C4T A;  4X4T A;  1RZT A;  3EW9 A;  1SZP A;  2RDI A;  5FP0 A;  3OUY A;  5KFH A;  5ALK A;  1L8L A;  4F8R A;  3WKA A;  1JRO A;  4RQ3 A;  1QSS A;  1B22 A;  3KFU F;  5DED A;  3PX4 A;  4X0A A;  2KVC A;  5HRB A;  4M9J A;  4KMO B;  5HNK A;  2ZHB A;  4BX9 C;  4M0A A;  5ALO A;  3GIK A;  8ICR A;  4NM1 A;  3AL0 B; 
#chains in the Genus database with same CATH homology
 4UB2 A;  5KFI A;  9ICV A;  2ASJ A;  2NRT A;  2I1Q A;  5CP2 A;  5KFZ A;  1U47 A;  5KFU A;  2PI5 A;  2BE3 A;  2ZH8 A;  4RWN A;  1ZQZ A;  2W9B B;  4JV0 A;  3G6X A;  4DFK A;  2B21 A;  4IQV A;  3EZ5 A;  4EYH B;  1ZQN A;  3EYZ A;  2BQR A;  1X2I A;  5J2E A;  1ZQQ A;  4WBY A;  4UQG A;  1N56 A;  1MSW D;  2R8G A;  4O5K A;  1VJ7 A;  1LV5 A;  4RNN A;  1QSY A;  4X0B A;  5CB1 A;  4YN4 A;  3LWM A;  1HUO A;  4I29 A;  5IIO A;  4KLT A;  1NK6 A;  2KFN A;  3JYY A;  4KN4 A;  5HML A;  3Q8L A;  8ICC A;  7ICP A;  3V6K A;  2XCA A;  4KLJ A;  3UXN A;  2XY7 A;  7ICR A;  3WFS C;  1XC9 A;  1NO5 A;  9ICH A;  2P66 A;  2ZUB A;  4IQT A;  1Q79 A;  3V72 A;  4DOB A;  4TQS A;  3RBD A;  1L3V A;  3SI8 A;  4M5D A;  1RXW A;  9ICC A;  4I2A A;  2XY6 A;  1BPY A;  3PX6 A;  3GIJ A;  2C28 A;  1SKW A;  7ICF A;  5HR9 A;  1KDH A;  3TAR A;  1MIV A;  3ISC A;  2ATL A;  4KLI A;  2F1H A;  1ZQJ A;  5KT7 A;  7ICM A;  1U48 A;  3G6V A;  1NK7 A;  2HHU A;  3IM1 A;  2R8I A;  4R65 A;  4QZC A;  3HJ1 A;  3RJH A;  3PO4 A;  2R8H A;  3SV4 A;  5J2K A;  2VA3 A;  4B9V A;  8ICV A;  5HC9 A;  1VFG A;  4YQW A;  1K1Q A;  4I2I A;  4DSL A;  4YR3 A;  5EWG A;  4P4M A;  4RUA A;  4DSF A;  4MF2 A;  4YR0 A;  3N4M B;  4Z6C A;  2P6R A;  4WC5 A;  3MR5 A;  4J9S A;  3KHR A;  1EXN A;  4DQS A;  4M9G A;  5KFS A;  5KG1 A;  4Q43 A;  4PGQ A;  3HT3 A;  4EBD A;  4X4N A;  4IR1 A;  1KSP A;  4MFC A;  8ICL A;  4NKU A;  3K4G A;  4QZB A;  4M6W A;  1JX4 A;  4IRK A;  3PX0 A;  4M9H A;  3B0Y A;  2KTQ A;  2ASD A;  5DKW A;  8ICZ A;  5J2J A;  5J2B A;  4J9Q A;  2H5X A;  2C2E A;  2PFP A;  1R89 A;  2VA8 A;  5KFD A;  3C23 A;  4ECS A;  4GXJ A;  3RAQ A;  1NJX A;  9ICT A;  5CA7 A;  4QZH A;  4I2D A;  2JEF A;  4EBC A;  2F1I A;  4PHP A;  4YP3 A;  2HHW A;  1NK9 A;  2W9B A;  3BJY A;  1ZQV A;  3PW7 A;  1L3T A;  1S9F A;  2I9G A;  4ATB B;  1ZQX A;  3M9M B;  4FH5 A;  4WC6 A;  9ICK A;  2NRZ A;  5DB7 A;  5DB9 A;  3V7L A;  4RQ0 A;  4RQ2 A;  4F5O A;  1T7P A;  4ELU A;  3HW8 A;  3H3A A;  2AJQ A;  3V6H A;  5KFM A;  3Q8S B;  2ISO A;  4I2G A;  1YLQ A;  1NKE A;  4O3N A;  5JUM A;  3PMN A;  3MFI A;  3MDC A;  3G6Y A;  2HVI A;  4DL2 A;  2W8K A;  3UPQ A;  1ZQI A;  1XSL A;  3PW5 A;  2ZTE A;  3PML A;  8ICU A;  7ICS A;  4IR9 A;  8ICW A;  2C22 A;  4DEZ A;  8ICJ A;  2BCU A;  5KFR A;  4XQ8 A;  4QZD A;  5TZV A;  3UPS A;  2DFL A;  1ZET A;  4RQ4 A;  9ICE A;  2BCV A;  4I2J A;  4DOA A;  3UQ0 A;  2DPJ A;  4KLM A;  1BPD A;  4RPX A;  5HRI A;  1TFY A;  5J0S A;  3OJU A;  1KFD A;  8ICY A;  7ICU A;  5J2G A;  1NK8 A;  2FLN A;  5J2I A;  8ICP A;  3H8J A;  4FHP A;  2OWO A;  4IG8 A;  1ZQT A;  3PVX A;  1QSL A;  9ICB A;  4DF8 A;  4FHV A;  4F4K A;  4NLG A;  2V4R A;  4KLD A;  4DQR A;  3OV7 A;  1OU5 A;  3RH4 A;  4QZG A;  4M04 A;  3ETL A;  1JIH A;  2ID1 A;  4M9L A;  2BCQ A;  4UB1 A;  5J0T A;  3EPG A;  1IM4 A;  4F5N A;  1JXL A;  1ZQA A;  4WCW A;  3NYB A;  4UBC A;  3C5G A;  9ICA A;  8ICH A;  3TAP A;  5KG6 A;  4DS4 A;  3T5K A;  5KFA A;  2FLP A;  4TUQ A;  7ICO A;  2RDJ A;  4O3R A;  3HIY A;  3ZD8 A;  4O5C A;  4UAW A;  4GLX A;  5IIK A;  2XGP A;  3AU6 A;  4G3I A;  4FHX A;  4I27 A;  4E80 A;  4ECT A;  1NZP A;  4ED1 A;  4C8K A;  1TKD A;  4M2Y A;  2FPL A;  4F91 B;  1S0M A;  2KZZ A;  4DL3 A;  4B9N A;  4E8F A;  4DOC A;  4TUR A;  1NKC A;  4C8M A;  5CJ7 A;  2V4Q A;  5EWE A;  4O0I A;  5DLF A;  4WC0 A;  1XO1 A;  5III A;  5DBA A;  2W9C B;  5L1J A;  3RAX A;  1ZQE A;  4PH5 A;  4F2R A;  1KLN A;  4WC4 A;  8ICM A;  1UA1 A;  3GIL A;  9ICW A;  3MR2 A;  1SL2 A;  4KLH A;  7ICH A;  4KLE A;  4R64 A;  4UAY A;  3PR5 B;  2MUT A;  5IIJ A;  4PPX A;  3V7K A;  2P6U A;  3PW2 A;  1UT5 A;  3C1Y A;  1ZQH A;  7ICJ A;  1XSP A;  4ATB A;  3PW4 A;  1S0N A;  9ICJ A;  4WC1 A;  1Z3E B;  1BVS A;  2BHN A;  1PX5 A;  5DQH A;  3AQM A;  4LT6 A;  2JZB B;  5KFW A;  4KLU A;  5DB8 A;  3GV5 B;  3JPP A;  4XA5 A;  4EZ6 A;  1ZJM A;  2IA6 A;  4DWI A;  3JPN A;  5J2H A;  4J9N A;  1X9W A;  2J6T A;  4O3Q A;  4Q44 A;  4AT9 A;  9ICP A;  2KZM A;  4JUZ A;  3RB4 A;  3WFQ E;  2DRA A;  3EPI A;  4JV1 A;  4F92 B;  4XUS A;  3BQ1 A;  4EP7 A;  2M2W A;  4BXO B;  4YMO A;  3H7I A;  1NJW A;  2UVW A;  3HJ4 A;  4RUC A;  3TFS A;  5KFF A;  4ECR A;  1U9L A;  5KT5 A;  5J2F A;  4ECU A;  4X4U A;  4M9N A;  2ZJ5 A;  5DB6 A;  4GXI A;  3E2E A;  7ICK A;  8ICX A;  1XS9 D;  1ZQB A;  1JAJ A;  2PBE A;  5KFK A;  1KFS A;  2FLL A;  4CCH A;  4QW8 A;  2M2V A;  4WBZ A;  3BQ2 A;  1RXV A;  4E7X A;  1ZJN A;  3M9N B;  4BDP A;  5KFJ A;  4ED3 A;  2BPC A;  1WCL A;  2XO7 A;  2C2R A;  2ZH1 A;  2IMW P;  4YMN A;  5DG9 A;  3M8R A;  1SL1 A;  3WFP A;  1ZQO A;  5BOL A;  4WC7 A;  3PW0 A;  4KMU A;  5HRD A;  2ZJ8 A;  4RPY A;  2AGQ A;  4EBE A;  1CUK A;  3WFR E;  1JQR A;  3GIM A;  4DQI A;  3NGD A;  4F3O A;  4TUS A;  4FHY A;  1LB2 B;  4FO6 A;  3RR8 A;  4I2E A;  1ZYQ A;  3AQL A;  4GXK A;  1S0O A;  5KFB A;  4X4V A;  3RH5 A;  1TK5 A;  2UVR A;  1S0V A;  4KLO A;  7ICQ A;  1SL0 A;  4XRH A;  2HHQ A;  2W9C A;  2UVV A;  4IQU A;  3HWT A;  4J9O A;  4DL7 A;  3JPR A;  8ICI A;  3OGU A;  2Q66 A;  1ZQM A;  5IIL A;  1A77 A;  4M47 A;  1R8B A;  1A76 A;  4YG2 A;  5C5J A;  4I28 A;  5KFX A;  3JPS A;  7ICG A;  3V6J A;  9ICO A;  4RWP A;  4I2B A;  4ED7 A;  5KG3 A;  1X9M A;  4KLQ A;  2GWS A;  5KFO A;  4IRC A;  3ZDA A;  5HRG A;  2ZTD A;  3H40 A;  2NRX A;  3N97 B;  1L3S A;  2R8K A;  4JV2 A;  1MIY A;  3T5J A;  3T5L A;  1NOM A;  2VA2 A;  4RZR A;  2ZJA A;  4LZD A;  5F9N A;  4PHD A;  3H8S A;  1BPX A;  3PR4 A;  2AQ0 A;  3Q8M A;  1D9F A;  4C8N A;  3RJF A;  4ZH4 A;  5KFE A;  4ECW A;  3RB0 A;  4J9M A;  2R8J A;  3ZDB A;  4O3S A;  1DK3 A;  2HHP A;  5L1K A;  3TAN A;  3H39 A;  4LZG A;  4RQ5 A;  4RPZ A;  3ISB A;  2DR5 A;  1UA0 A;  3HX0 A;  8ICN A;  1L5U A;  4MEY A;  2KZ3 A;  1C7Y A;  7ICE A;  3ORY A;  4RT3 A;  4P4P A;  4R8U B;  3M8S A;  2ZH7 A;  4RQ7 A;  1MIW A;  9ICF A;  3MBY A;  1U4B A;  1DGS A;  2A1J B;  3M9O B;  3MGI A;  1ZQL A;  1ZQD A;  4NLN A;  1Q78 A;  4K4I A;  5HHI A;  5DEC A;  3C1Z A;  1QLN A;  3RB6 A;  2BDP A;  4RU9 A;  1S77 D;  8ICF A;  4QZA A;  5J0U A;  2HW3 A;  5F2V O;  4ELV A;  4C8L A;  5D49 A;  1D8Y A;  2JEI A;  2BGW A;  4YXM A;  4MEX A;  4B9S A;  4NLK A;  1H38 A;  2O1P A;  4RNO A;  5HMM A;  3C18 A;  2PFO A;  3GFK B;  9ICS A;  1BPB A;  7ICI A;  4RWQ A;  4UBB A;  3OHA A;  2XC9 A;  5J0W A;  1V9P A;  2WTF A;  4DS5 A;  4ED6 A;  1ZQC A;  4AT7 B;  2ISP A;  4UB3 A;  5BPC A;  3TAQ A;  5F9L A;  2BPF A;  3QE9 Y;  5J0Q A;  5DQG A;  5HRK A;  1R8A A;  4DLE A;  5J0R A;  4KN7 A;  5EOZ A;  4Z6D A;  1BPE A;  4YD2 A;  5KFT A;  4J9K A;  2DPI A;  5J2C A;  2KP7 A;  2ZH5 A;  4X5V A;  5KTQ A;  8ICS A;  3QZ8 A;  1BNO A;  4F4X A;  1UET A;  5KFC A;  3GQC A;  4DSE A;  2XY5 A;  1RYR A;  1D9D A;  4FHW A;  2AU0 A;  3ISD A;  1KFT A;  4F5Q A;  2W8L A;  4FS1 A;  4E0D A;  3TQ1 A;  2ZH6 A;  3RBE A;  4DQP A;  1S10 A;  8ICK A;  5DBC A;  4S3N A;  3KHL A;  5DQI A;  4O3O A;  4QWE A;  2AGP A;  5KFN A;  1ZQG A;  4MF8 A;  5KFY A;  4PHE A;  3UXP A;  3C66 A;  4B9L A;  4UD4 A;  3H37 A;  4QZ8 A;  4X4S A;  4F5R A;  3FYH A;  3WFO A;  3UXO A;  1TV9 A;  4ECX A;  4DFJ A;  4TQR A;  3T3F A;  1N48 A;  2FMP A;  3OHB A;  3FDS A;  4X4R A;  4F4W A;  4O5E A;  1CEZ A;  2ZUD A;  4GC7 A;  5DG7 A;  1BGX T;  5KT4 A;  3Q8K A;  1ZQP A;  3PO5 A;  9ICM A;  2M2U A;  1UEU A;  2ZH9 A;  4O3P A;  3JPQ A;  4X4Q A;  5IIN A;  4QWB A;  3MR6 A;  4QW9 A;  2Q0Z X;  2ZUC A;  5KG4 A;  1RYS A;  4WC3 A;  4NXZ A;  4QWD A;  4DSI A;  2JEG A;  1R8C A;  4J9L A;  8ICG A;  4AT8 B;  1IXR A;  5KT6 A;  2XGQ A;  5DBB A;  4ECY A;  4R8U A;  8ICQ A;  1ZQY A;  3OJS A;  2A1J A;  3RJG A;  1WOT A;  1DK2 A;  4X4O A;  5KG0 A;  2FPK A;  3PNC A;  1ZQR A;  2HHX A;  4I2F A;  4EZ9 A;  5DGB A;  7ICT A;  7ICL A;  1KNY A;  1KRP A;  5L1I A;  4B9M A;  1WCN A;  1KEJ A;  4P2H A;  3SV3 A;  1COO A;  3V7J A;  4Q8E A;  3C2K A;  5KFL A;  3QEB Z;  4O9M A;  4DQQ A;  2ZH3 A;  3RR7 A;  4B9U A;  9ICG A;  4TUP A;  1KTQ A;  3RTV A;  1ZQU A;  5HRL A;  3AQK A;  4NKT A;  4AT7 A;  5HRF A;  4QZE A;  5BOM A;  2IBK A;  5DLG A;  3HPO A;  5KFV A;  4NM2 A;  4YCX A;  4ECV A;  2NRV A;  4X4P A;  3ZDC A;  4F4Y A;  4BWM A;  3PV8 A;  4B9T A;  4DF4 A;  2FPM A;  5J2D A;  3TI0 A;  3OVS A;  4FBT A;  4LVS A;  3JZ0 A;  4DSJ A;  9ICQ A;  4YR2 A;  3LK9 A;  3SZ2 A;  1B43 A;  1BNP A;  1TK0 A;  1NJY A;  3KHH A;  1ZQK A;  1NK5 A;  4NY8 A;  1TFR A;  3ZD9 A;  1TK8 A;  1UT8 A;  3EWA A;  5IIM A;  2NRK A;  4KIT B;  3HP6 A;  3RJI A;  3H8W A;  5J2A A;  2UVU A;  1V4A A;  4RT2 A;  1Z00 B;  4PGX A;  1JN3 A;  2W9A A;  2BQU A;  2ZTC A;  1T3N A;  3LQC B;  2VAN A;  2C2D A;  4R66 A;  4KTQ A;  1XWL A;  2LYH A;  9ICU A;  1MC8 A;  3RH6 A;  3RJE A;  5J0P A;  4DSK A;  1D8L A;  4UB4 A;  4MFA A;  3UQ2 A;  4YFK A;  2KFZ A;  5HRE A;  5HRH A;  3RRG A;  5KG5 A;  3RJK A;  4RQ6 A;  3PY8 A;  3KHG A;  1BPZ A;  4J9R A;  4GC6 A;  3OSP A;  3H38 A;  2HVH A;  4C8O A;  1ARO P;  3TFR A;  2DR9 A;  2JZB A;  3JPO A;  1NKB A;  3MDA A;  4FS2 A;  2BR0 A;  1TFW A;  2M9N A;  1U49 A;  3GV7 B;  5KG7 A;  4YMM A;  4DL6 A;  8ICE A;  1FA0 A;  4UB5 A;  1ZQF A;  4RNM A;  1L3U A;  2ALZ A;  1PZN A;  5DDY A;  3K75 D;  5KG2 A;  5KT3 A;  2FMQ A;  1HJP A;  4AT8 A;  3OUY B;  7ICN A;  4ED8 A;  9ICR A;  1NK0 A;  4BXO A;  4ED0 A;  4JWM A;  2HHV A;  3OVB A;  1MQ2 A;  4DO9 A;  3BQ0 A;  3L9D A;  2AQ4 A;  3Q8R B;  2ZH2 A;  4YXJ A;  4ED2 A;  5J0O A;  4UD5 A;  4YVZ A;  4EBJ A;  4F5P A;  4EBK A;  2MUT B;  3MGH A;  2W9M A;  2XCP A;  2PXI A;  8ICB A;  5CWR A;  4HYK A;  3C5F A;  4DFP A;  2J6S A;  4KLG A;  5CR0 A;  4DLG A;  2M2T A;  5HP4 A;  3RRH A;  9ICN A;  1K1S A;  3KTQ A;  1XSN A;  4NLZ A;  8ICO A;  4YD1 A;  8ICA A;  2MAX A;  3AU2 A;  9ICI A;  4MFF A;  5DG8 A;  3C2L A;  3OSN A;  5KFP A;  4WC2 A;  9ICL A;  4AT9 B;  3QEA Z;  4K4H A;  3B0X A;  2DR8 A;  5KFG A;  3NTU A;  2DVI A;  3LDA A;  2F1J A;  4DL5 A;  2ASL A;  2V9W A;  2ZH4 A;  4UAZ A;  4Z6F A;  3GDX A;  3MAB A;  4QZI A;  3Q8Q B;  3RB3 A;  1MQ3 A;  1HUZ A;  3RJJ A;  5DDM A;  4BGD A;  1ZQS A;  4I2H A;  4JWN A;  3OVA A;  3ZDE A;  2AGO A;  1Z00 A;  5HHH A;  4R63 A;  2BQ3 A;  4RWO A;  1T4G A;  4Z6E A;  3H4B A;  5L1L A;  4F2S A;  2O5A A;  1S97 A;  5L9X A;  3BQT A;  1TVA A;  4KLL A;  1TAQ A;  2HHT A;  4BWJ A;  4DFM A;  4KLF A;  4F50 A;  4EEY A;  1JXE A;  5D46 A;  4DL4 A;  4EYI B;  1Y88 A;  1QTM A;  2PFQ A;  4I2C A;  4FH3 A;  4ECZ A;  1JMS A;  4XQ7 A;  2JEJ A;  4F4Z A;  4J9P A;  5J0Y A;  3H4D A;  3SYZ A;  5D4B A;  4FBU A;  4KLS A;  3T5H A;  4JK1 A;  1F5A A;  1NK4 A;  5J0X A;  4RQ1 A;  3JPT A;  3ZDD A;  1TAU A;  5EWF A;  3LWL A;  1NJZ A;  1S76 D;  2FMS A;  4IQW A;  2HHS A;  3C21 A;  5DGA A;  2BPG A;  4ECQ A;  4Q8F A;  1SKS A;  4P4O A;  1DOQ A;  4QZ9 A;  1UEV A;  8ICT A;  2IHM A;  9ICX A;  3GII A;  4Q45 A;  4X4T A;  1XU4 A;  1RZT A;  1T8E A;  3Q8P B;  3EW9 A;  4QWC A;  3QZ7 A;  1SZP A;  2RDI A;  4RQ8 A;  3BDP A;  2NRW A;  2BKE A;  3OUY A;  5KFH A;  3GV8 B;  2Y1I A;  2BCR A;  4F8R A;  4RQ3 A;  5KFQ A;  1QSS A;  1B22 A;  5CHG A;  2Y1J A;  2BCS A;  4ELT A;  2PFN A;  1ZQW A;  4QZF A;  3PX4 A;  2J6U A;  5DED A;  4PHA A;  2PI4 A;  5KT2 A;  4X0A A;  3IHQ B;  2IHN A;  2ZHA A;  4F93 B;  4M6W B;  2DRB A;  4PGY A;  2RFF A;  3MR3 A;  4IRD A;  1U45 A;  5HRB A;  2KN7 A;  4M9J A;  1X9S A;  1RPL A;  3THV A;  5HNK A;  2ZHB A;  7ICV A;  4K4G A;  4QWA A;  3GIK A;  3C2M A;  4M0A A;  8ICR A;  3MFH A;  3AQN A;  5J29 A;  4NM1 A;  1SKR A;  3AUO A;  2DR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...