4Z6DA

Structure of human dna polymerase beta 279na mutant complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFAKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Insights into the effect of minor groove interactions and metal cofactors on mutagenic replication by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4z6dA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4z6dA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4z6dA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4z6dA03
3UXOA 4M9GA 1UETA 2ZJAA 5DQHA 4I28A 2ZH4A 3M9MB 3GV5B 5KFGA 4I2CA 3C66A 2PFPA 2ZUCA 4RQ7A 3PR5B 3M8SA 1XSPA 4YN4A 3LWMA 3AQLA 3WFSC 2XCAA 4QZFA 2HHUA 5HRDA 4X4SA 2DR5A 5L1JA 4DSKA 5DDYA 1RPLA 4DS4A 3V6HA 3K4GA 3Q8QB 1MSWD 3G6YA 1UA0A 1ZQKA 1X9MA 4PPXA 4B9UA 2BQ3A 1UT8A 2JZBA 4R66A 2P6UA 1D8LA 4J9LA 4MEYA 4IRKA 1VFGA 5J0WA 8ICMA 5HRLA 4PGQA 4M9HA 3QZ7A 1DOQA 4F91B 9ICLA 9ICAA 1FA0A 4C8MA 5KT6A 1X9WA 3C18A 8ICTA 4AT7B 3LK9A 3T3FA 4RPZA 2M2WA 5J2KA 4E7XA 1K1SA 3HJ1A 4R8UB 4QWCA 2NRXA 4F93B 4RQ5A 5KFRA 3JPSA 4DOAA 4MF8A 5CWRA 3TAPA 1ZQDA 4WC0A 7ICOA 4NKUA 4FHXA 4FO6A 4KLGA 4O5KA 4I2JA 1T3NA 4PHDA 1ZQEA 4DQSA 1TK5A 3H3AA 2M9NA 3C1YA 7ICJA 2M2VA 4IRCA 3H8JA 3PX4A 1HUZA 3SV4A 9ICUA 3ETLA 5HNKA 4KTQA 2KP7A 2KFNA 7ICEA 1TV9A 3OSNA 4EBJA 4BXOB 4I2GA 4FHYA 1KFTA 2A1JB 4WBYA 1MC8A 4GXJA 2KTQA 2BHNA 2I1QA 3LWLA 3RJKA 3E2EA 4RNNA 5J0PA 1ZQWA 1N48A 2KZZA 1XSNA 4C8LA 7ICHA 5IIKA 2W9BA 3RAXA 2VA3A 8ICSA 2AGPA 4EYHB 3IHQB 2GWSA 7ICIA 5HRBA 1Y88A 2XY7A 3KHRA 4M04A 4KITB 2VANA 4KLEA 4GXIA 9ICQA 3PNCA 4B9LA 4PHEA 4F4YA 2BCVA 5IIJA 1U48A 2UVWA 2BE3A 3NYBA 5DBAA 5J2CA 4QZBA 5HRFA 5DQIA 1QSYA 3EZ5A 3WFRE 1BGXT 4RQ2A 1NK8A 1KSPA 5IINA 4JWMA 4YMNA 4YVZA 4YMOA 1NK7A 2JEFA 4XUSA 3LQCB 4IG8A 5BPCA 4E0DA 2DVIA 1ZQZA 1ZQIA 2ID1A 4UD5A 3JPRA 4ELTA 4O3OA 5J2DA 4AT8A 3SV3A 1NK4A 1KEJA 4KLFA 2ZTCA 8ICGA 2W9CB 8ICUA 4DWIA 3V72A 5EWEA 9ICKA 4DSLA 4DSIA 5CP2A 2JEGA 3H38A 2LYHA 1S0OA 4DF8A 2ZTDA 1CUKA 4ELUA 4X4QA 1S0VA 5EWFA 4WC6A 1NZPA 4WCWA 4FS2A 2ZH7A 1R8AA 1SL0A 2P66A 4Z6CA 4IRDA 5J2EA 2KFZA 2I9GA 3TFSA 5F2VO 5KFYA 1SKSA 4MFFA 2HHQA 2ALZA 1K1QA 5KFUA 3OGUA 5D49A 2IA6A 1ZETA 1S77D 5HR9A 9ICHA 4RT2A 4NKTA 4XQ8A 4G3IA 4IQVA 4X4RA 1TFYA 4ZH4A 3RB6A 3HT3A 2C28A 3PV8A 1D8YA 4J9SA 2PI5A 1ZYQA 4IR9A 1X2IA 2F1JA 2HHPA 4ED6A 4O3NA 1ZQUA 3C2KA 4C8NA 3C21A 3HP6A 1N56A 5KG4A 4O3PA 4JWNA 3GILA 3RJIA 4B9TA 4EZ9A 3Q8PB 4PHAA 3SYZA 4KLSA 2HHWA 4X5VA 3ZD8A 3PMLA 4J9RA 4DSEA 1L3VA 4M2YA 4DL7A 5KFAA 4YCXA 2IHNA 4AT7A 3ORYA 4RWQA 5KFEA 1UEVA 3RJGA 4O5EA 5J0SA 2JEIA 5HRKA 2V4QA 1RXVA 4FBUA 2XO7A 4R8UA 8ICZA 4DS5A 5HHHA 3UXNA 5EOZA 4F5OA 4JV1A 3JPNA 1NJXA 3MGHA 1D9FA 2ZH9A 5DDMA 3V7KA 1ZQQA 5J2BA 4TUPA 3TQ1A 2J6TA 2AQ4A 4P4PA 4RUAA 4YR0A 2F1HA 5TZVA 3MABA 3RH6A 4F50A 4BXOA 2NRZA 2A1JA 4GC6A 9ICGA 2AQ0A 2ZH1A 3V7LA 3OJSA 2Y1IA 4I27A 2Q0ZX 3RH4A 7ICPA 1TKDA 4CCHA 1VJ7A 4ECRA 4RT3A 2ZH5A 2HHSA 1ZQRA 9ICBA 5CJ7A 1SL2A 4YMMA 4J9OA 5KG5A 5J0YA 3C2LA 1RXWA 2DPJA 1U4BA 3BQ2A 4UB3A 1NKCA 1BPYA 1H38A 2FMQA 3PVXA 3EW9A 3SZ2A 4QWDA 2UVVA 3HWTA 3UPSA 1NK9A 1BPDA 3IM1A 9ICFA 4WC4A 1T4GA 4ED8A 4WC1A 4JV0A 1NK6A 3PW7A 5KFKA 3MFIA 3RTVA 3JZ0A 4WC7A 2ASJA 3H8SA 5KT3A 3V7JA 2PFOA 3PY8A 2KZMA 4ECXA 4YP3A 2PXIA 3Q8LA 1KFSA 2ATLA 4ED2A 2W9CA 1ZQMA 1S97A 9ICPA 5KT4A 5DGBA 1UA1A 3ZDDA 2DR8A 1TAQA 1S10A 8ICXA 3RJFA 5KFIA 4R63A 5DGAA 4RZRA 7ICQA 1NO5A 3HIYA 5J2IA 3LDAA 5DQGA 1ZQNA 5HMLA 2Y1JA 1LB2B 5KFDA 3THVA 2XY6A 3PO5A 1KNYA 1XC9A 4Q43A 4X0BA 3AUOA 2ZJ8A 3H39A 7ICMA 9ICEA 1S0NA 2DFLA 4KLQA 1L3UA 5HRIA 5J2AA 1X9SA 1ZJMA 2BGWA 4RUCA 4YR3A 1L3SA 1ZQOA 4S3NA 2HHXA 3OVBA 3OUYB 4DFKA 1DGSA 4J9NA 1D9DA 3GIIA 1R8CA 1R89A 3BQ0A 2IBKA 4UB5A 2W8LA 3KTQA 3AU6A 1JXEA 1ZQTA 2ZUDA 1ZQPA 4TQRA 5F9LA 5C5JA 4DFJA 8ICKA 3H37A 3TARA 4QW9A 3HW8A 4IQTA 5KFPA 3KHHA 2R8GA 2P6RA 4R65A 1U9LA 4DQIA 1ZQVA 5HC9A 4J9MA 3RJEA 4E8FA 3MR6A 2ASLA 1TFRA 4RQ4A 2NRTA 5KFBA 2VA8A 4M6WB 4ED7A 1QSSA 4NXZA 5DBCA 3MR5A 5J0UA 1RZTA 1BPXA 3RRGA 1MIVA 5D4BA 1MIWA 4RNMA 5DLFA 5DLGA 8ICVA 4UAZA 3OVAA 4F8RA 4UB4A 3MBYA 3ISCA 1SL1A 4WC3A 2C2DA 2F1IA 3KHLA 2RDIA 3AU2A 4FHVA 4KN7A 1JIHA 1NKBA 1NK0A 4QZ9A 3JPTA 4DLGA 5IILA 1JX4A 2NRVA 3L9DA 3T5LA 3ISBA 4FH5A 3B0YA 8ICHA 3C23A 4KLTA 5L1LA 1BNOA 4NLGA 4O0IA 4QZDA 4P2HA 3H40A 4IQUA 3OHAA 1U49A 5CHGA 1RYSA 1MQ2A 1SKWA 5KFSA 4GC7A 3G6VA 1U45A 4YXMA 4J9PA 4Z6FA 3QE9Y 1TK8A 8ICFA 3SI8A 5DEDA 1XO1A 2BPCA 4EBEA 1HUOA 5F9NA 4MFAA 3TFRA 4ECQA 4RNOA 4DSFA 5KG0A 3C1ZA 1NOMA 5HP4A 5J29A 2BDPA 1COOA 4FHWA 1ZQFA 4HYKA 4PGYA 1S0MA 5DG8A 2XC9A 5KTQA 2R8KA 3H4DA 3M8RA 3C2MA 5KFHA 4ED0A 1KLNA 4NM1A 3M9OB 7ICFA 1JXLA 7ICNA 5KG3A 8ICAA 3OSPA 3RB3A 3UQ0A 5IIIA 1NKEA 1KFDA 2RDJA 8ICWA 4TURA 5KFNA 4YR2A 2IHMA 4AT9B 5J2GA 3MR2A 1ZQJA 5DB6A 3TAQA 5HRHA 8ICYA 3JPQA 7ICKA 2MUTB 2BCUA 8ICEA 4EBCA 1ZQBA 3RBEA 1ZQLA 3OJUA 4M9LA 1ZQXA 2FPLA 1Q78A 2ZH6A 3PO4A 4B9VA 2RFFA 1JN3A 1DK2A 3H7IA 3T5JA 7ICSA 4LZDA 1A76A 4M9JA 4WC5A 2HHTA 1Z3EB 2ZUBA 4Z6DA 2M2UA 5HREA 4DLEA 4RQ0A 1S9FA 4KLDA 3OV7A 2XY5A 1QTMA 4X4OA 2B21A 3BQ1A 2PFNA 1HJPA 4MFCA 2M2TA 9ICMA 2XGPA 4KLJA 3N4MB 1BPEA 5L1KA 5CB1A 2HVIA 2V4RA 5KFWA 4DOCA 4WC2A 4F4KA 4DL4A 1U47A 3FDSA 3Q8MA 4DQQA 3PW0A 4M6WA 4DEZA 4M9NA 3Q8KA 2W9AA 4ECSA 3RAQA 4J9KA 4B9NA 1XU4A 4UBCA 3NTUA 5BOLA 1AROP 4UB1A 3UQ2A 1ZQSA 4BWJA 8ICLA 4X0AA 2C2RA 1V4AA 1NK5A 4BGDA 8ICBA 4UBBA 4X4PA 8ICNA 2BCSA 8ICOA 3TI0A 4LVSA 1UEUA 4RWOA 3ZDAA 4IR1A 4O5CA 1ZQCA 5J0QA 1V9PA 3FYHA 4JUZA 5KT7A 4UAWA 4DFPA 4KLUA 3QZ8A 3RB4A 2FPMA 4XRHA 5BOMA 3AQMA 3QEBZ 4EBKA 7ICRA 5KFFA 4R64A 3GV8B 3PW4A 4NLZA 2XGQA 5KFJA 2BQRA 5CA7A 4XQ7A 8ICCA 1A77A 5JUMA 3PR4A 3RBDA 3AQNA 3JPOA 4DO9A 2KZ3A 4QZAA 1ZQGA 4QWEA 2O1PA 4RWPA 4X4NA 4GXKA 4K4HA 5DKWA 8ICJA 3PX0A 4YFKA 1NJYA 2HHVA 1S76D 4BWMA 4RWNA 1JMSA 4Q8FA 2NRWA 4K4GA 3PW2A 1RYRA 1KDHA 2PBEA 2O5AA 5DB8A 2BQUA 3ZDBA 4QZHA 9ICIA 4UQGA 4KLMA 3V6JA 3JYYA 3ZDEA 2WTFA 9ICRA 4QZCA 5J0XA 1BPZA 4MF2A 5J2FA 3PX6A 2V9WA 4QZEA 4JK1A 3Q8RB 3QEAZ 4FBTA 4I2HA 2J6SA 2UVRA 4QWBA 1SZPA 2W8KA 5IIOA 4C8OA 3MR3A 1WOTA 4X4VA 1JQRA 4F92B 5KT2A 5KFMA 4FS1A 3RR8A 5KG7A 1BPBA 4O3QA 4DSJA 4LT6A 2BR0A 4AT9A 2ISPA 3BDPA 9ICOA 4PGXA 4LZGA 4ECVA 3RJJA 3UXPA 4I2IA 4F3OA 2ZH8A 2MUTA 1XS9D 4QWAA 5IIMA 1ZJNA 4RPYA 2DRAA 4ECTA 3TANA 3GV7B 7ICUA 1MIYA 1QLNA 2DR7A 2UVUA 3BQTA 4I2AA 4F5NA 3T5HA 5KFLA 4ATBB 4MEXA 5D46A 1TVAA 4DQPA 4O3SA 3GIJA 3Q8SB 1JAJA 2H5XA 5KFQA 3WFOA 3RRHA 2ASDA 2FLPA 3GQCA 3M9NB 3NGDA 2FMPA 3RR7A 4I2BA 8ICRA 1ZQYA 1IM4A 3C5FA 3HX0A 4DF4A 1T7PA 9ICSA 4KLOA 2ZH2A 2DPIA 3WFQE 5L1IA 4DL3A 3GIKA 1QSLA 4RU9A 1PZNA 5KFCA 5J0OA 3BJYA 1Z00B 2AJQA 1DK3A 4TQSA 4IQWA 2NRKA 4WBZA 2MAXA 4EP7A 4P4MA 4DQRA 4DL6A 4RQ3A 1Q79A 4P4OA 1TK0A 3OHBA 4Q44A 3KHGA 4RQ8A 4DFMA 4UAYA 2OWOA 1R8BA 1IXRA 1KRPA 4FHPA 3MGIA 3H4BA 4F4XA 2BPGA 4NLKA 2ZJ5A 8ICQA 1LV5A 9ICTA 4ECYA 2DR9A 5KT5A 2HW3A 1NJZA 4QZGA 4F5QA 4F4ZA 2R8JA 2ZHBA 2VA2A 4ECZA 1ZQHA 2BCRA 1T8EA 4I2EA 2DRBA 3MFHA 2R8HA 8ICIA 4PHPA 2FMSA 4QZIA 4FH3A 5L9XA 1ZQAA 2JEJA 2JZBB 1NJWA 4TUSA 3H8WA 3V6KA 3JPPA 3RH5A 4F2RA 4RQ1A 1WCNA 4ELVA 7ICLA 1TFWA 4UB2A 3ISDA 5CR0A 9ICJA 4BDPA 4C8KA 3N97B 2BCQA 4EZ6A 3WFPA 2FLNA 4I2DA 4YXJA 1EXNA 4JV2A 4XA5A 4F4WA 3K75D 2IMWP 4NM2A 4M5DA 4B9MA 7ICVA 1B22A 5KG2A 4ECWA 4YD1A 3EPIA 4RQ6A 4M0AA 4DOBA 4Q45A 2FPKA 4NY8A 4RPXA 4KN4A 3MDAA 3RJHA 5HMMA 3ZDCA 1F5AA 4KLHA 1BNPA 1KTQA 1L3TA 4M47A 5DECA 2ZHAA 4QZ8A 3B0XA 2AGQA 3PW5A 3RB0A 3GFKB 4Q8EA 2HVHA 5DG9A 2C22A 2AGOA 3GIMA 4YD2A 4Z6EA 4ECUA 5DB9A 3PMNA 2ISOA 4E80A 1SKRA 4TUQA 1XWLA 3OUYA 5DB7A 1BVSA 4J9QA 5J0TA 3OVSA 3ZD9A 2W9MA 1PX5A 4EYIB 5J2JA 1OU5A 2ZH3A 4DL2A 3MDCA 2C2EA 2W9BB 4YG2A 2FLLA 4ED1A 5KG6A 4F2SA 4I2FA 5J0RA 5J2HA 4GLXA 1CEZA 2Q66A 4YQWA 3EPGA 2ZTEA 4KLLA 7ICTA 5KFZA 2J6UA 2PI4A 4QW8A 4I29A 8ICPA 2BKEA 3G6XA 5KFVA 3EWAA 3GDXA 3EYZA 1WCLA 1TAUA 9ICVA 4B9SA 4ATBA 4KMUA 5HHIA 3T5KA 1UT5A 4DL5A 3C5GA 1C7YA 2BPFA 4F5RA 4KLIA 7ICGA 5HRGA 1B43A 4X4UA 9ICXA 4X4TA 4NLNA 1MQ3A 2AU0A 5DBBA 3AQKA 4UD4A 4O3RA 4EBDA 4PH5A 1XSLA 5DG7A 3HJ4A 2XCPA 5KFXA 5KG1A 3HPOA 5KFTA 2R8IA 4AT8B 2PFQA 1Z00A 4F5PA 3UPQA 9ICWA 4O9MA 2KN7A 5EWGA 9ICNA 1YLQA 9ICCA 4ED3A 4EEYA 5KFOA 1L5UA 4K4IA
chains in the Genus database with same CATH superfamily
1UETA 1V85A 4I28A 2ZH4A 5KFGA 2PFPA 3FC4A 1XSPA 3I28A 1PVPA 2DR5A 5AKIA 4DS4A 5TISU 2K4EA 5AIBA 2JZBA 4R66A 4MEYA 1VFGA 8ICMA 1DOQA 2WB1F 4OJPA 1S5LU 2KJ5A 3LK9A 5ALFA 4E7XA 1K1SA 4R8UB 4F93B 1ZQDA 2CXYA 4FO6A 4I2JA 2M9NA 2M2VA 2OYYA 5J8YC 3PX4A 4EBJA 5HNKA 3OSNA 3BZCA 3NASA 4I2GA 1KFTA 2I1QA 2QLTA 1ZQWA 1N48A 4CDGA 2VA3A 3RAXA 1X9XA 4BUGA 3IHQB 4EV6A 3F2DA 3KHRA 4KITB 2PKEA 4B9LA 5CHEA 4PHEA 2UVWA 5IIJA 1U48A 5AKKA 5CFUA 3WKBA 4QZBA 3QX7A 3WFRE 1NK8A 5IINA 4YVZA 4E0DA 2K8AA 1ZQIA 4ELTA 1SXDA 4AT8A 1KQQA 2ZTCA 3V72A 2K8BB 5EWEA 4DSLA 3H38A 2JEGA 4WC6A 4FS2A 2P66A 4Z6CA 4IRDA 1Z1BA 2LMRA 3TFSA 5D61A 3OGUA 4RT2A 1X6JA 2DF4B 1ZQUA 3QU7A 3C21A 2EAPA 4QNLA 4B9TA 1QQ7A 4X5VA 3N7PD 4M2YA 4EENA 4DL7A 4YCXA 2IHNA 3ORYA 3RJGA 2JEIA 2V4QA 1L7OA 4R8UA 1Q3VA 3UXNA 4JV1A 4O69A 3UM9A 1NJXA 5DDMA 4O68A 2WAQF 4RUAA 4YR0A 4DCCA 5AI9A 2ZH1A 2Q0ZX 1TKDA 2GLEA 2F44A 1ED1A 4YMMA 4J9OA 5J0YA 4MKPA 2FDRA 4UB3A 1NKCA 2NO4A 1H38A 1FFVA 3EW9A 4QWDA 1NK9A 4Y2XA 2F8KA 2KD1A 5B3QA 5KFKA 3AN1A 3RTVA 4WC7A 2ASJA 2PFOA 5KT3A 2KZMA 3QUTA 5KT4A 1UA1A 2PMZC 1QQ5A 2RLTA 5KFIA 4R63A 5DGAA 4RZRA 4WJ3B 1ZQNA 2B56A 3H39A 4KX5A 2DFLA 1X9SA 2BGWA 4YR3A 4S3NA 4Y2JA 2G08A 4DFKA 1DGSA 3GIIA 4JMUA 3BQ0A 2IBKA 3KTQA 5AKHA 2ZUDA 4CF5A 5C5JA 4K96A 1N5WA 3TARA 3H0MB 3AQFA 2P6RA 2ASLA 4JLXA 4OAHA 4RQ4A 5CEHA 2KKVA 2NRTA 5KFBA 2O6KA 4ED7A 1MIVA 5DBCA 1BPXA 1N60A 5AKXA 3OVAA 4UAZA 4F8RA 3IRUA 4WC3A 2C2DA 4OJOA 1SIJA 2F1IA 1ECWA 2E3TA 2KNJA 2IUBA 1FEZA 4QZ9A 1JX4A 3L9DA 4FH5A 2NRVA 2KE7A 8ICHA 3C23A 4LEWA 2KOBA 1BNOA 4NLGA 3H40A 1GO3F 3WKCA 5CHGA 5KFSA 4GC7A 3G6VA 1M6YA 2KIVA 1UQVA 3QE9Y 1XO1A 4EBEA 3TFRA 4RNOA 2E8PA 5HP4A 2BDPA 1ZQFA 4HYKA 5ALPA 2R8KA 3H4DA 4ED0A 8ICAA 3D2SA 5KG3A 5C0YA 3UQ0A 1NKEA 1Q46A 3NVZA 8ICWA 3S6JA 3ER9B 5KFNA 1X6IA 7ICKA 2BCUA 2HBLA 3PO4A 4B9VA 2H3FA 2ZIUB 3T5JA 4LZDA 1A76A 4M9JA 2EQYA 2G09A 4UARA 3IV6A 1S9FA 5AM3A 4OO1J 1SB3C 2PFNA 9ICMA 1BPEA 2HVIA 5KFWA 4DOCA 3Q8MA 3KOOA 2HSZA 4Y2SA 4B9NA 4AP9A 2G5HB 4UBCA 1AROP 2F76X 1NK5A 1RM6C 5ALTA 3TI0A 4DFPA 3FYHA 4KLUA 2BDUA 1J97A 5ALIA 1HEKA 3PW4A 5KFJA 4UATA 8ICCA 3PR4A 4DO9A 3SR6A 4RWPA 4RWNA 1L7MA 4Q8FA 4K4GA 1RYRA 1D8BA 5KL8B 2BQUA 3ZDBA 2GH1A 2K4HA 4QZCA 5J0XA 1BPZA 3WK8A 2V9WA 4JK1A 2UVRA 3MR3A 4X4VA 1IG6A 1F0MA 5KT2A 5KG7A 4DSJA 4LT6A 1SV0C 3I76A 4LZGA 1N2XA 1DRGA 2ZH8A 2G07A 1ZJNA 3TANA 1QLNA 2DR7A 2UVUA 5EE9A 4F5NA 2ZIUA 4O3SA 5KFQA 1O08A 5CRXA 3NGDA 4DF4A 3WFQE 2ZH2A 3BJYA 1DK3A 4P4MA 4RQ3A 5EE1A 2E1FA 2Y0SF 2YX8A 3L3FX 4FHPA 1SXEA 4OJLA 2R8JA 1LKYB 3F5AA 1T8EA 2DRBA 2JHDA 5G5GA 3QUBA 4FH3A 2YY6A 5L9XA 3K1RB 3NS1A 3RH5A 4ELVA 7ICLA 1TFWA 3ISDA 5CR0A 4WH5A 4EZ6A 2FLNA 5AI0A 7ICVA 1B22A 1TE2A 4M0AA 3EPIA 3WK7A 2B4VA 2FPKA 5HMMA 1F5AA 1KTQA 4QZ8A 2C22A 3AEVA 1XWLA 2HBMA 5DB7A 5J0TA 4LJXA 2W9BB 5J0RA 2EANA 4KLLA 5KFZA 2PI4A 4QW8A 4I29A 1KKXA 4B9SA 5HHIA 3T5KA 2BPFA 7ICGA 2K60A 4X4UA 2AU0A 4NXUA 2IOHA 4UD4A 4EBDA 4PH5A 4BJQA 5KFXA 4CRXA 3QUQA 2CRXA 3UPQA 4ED3A 4EEYA 4K4IA 3M9MB 4I2CA 4RQ7A 3AQLA 2XCAA 5HRDA 1LKYA 2W3RA 2DKXA 4EEBA 3G6YA 5ALGA 2LYAA 1ZQKA 1RDFA 2ES6A 2N1RA 2BQ3A 1O03A 5ALVA 3QZ7A 1UHUA 4AYBC 9ICAA 5KT6A 3T79A 4RPZA 1KN5A 3KKAC 5J2KA 2M2WA 2B51A 2NRXA 4RQ5A 3AQEA 7ICOA 4NKUA 3WKDA 4KLGA 5AK6A 1SGGA 4O5KA 4PHDA 3C1YA 3K7DA 3ETLA 3HILA 2KFNA 1TV9A 5AI4A 3IDWA 4BXOB 1RG6A 5E79U 2A1JB 4WBYA 5J8YA 1MC8A 4GXJA 5J0PA 1NO5A 4OJ6A 2NO5A 5IIKA 2W9BA 8ICSA 7ICIA 1Y88A 2HOIA 2AHOB 4KLEA 4GXIA 3PNCA 2BCVA 5J2CA 1QSYA 1L8OA 4JWMA 2LKYA 4YMOA 3DDHA 4IG8A 2BZFA 3QU9A 1NK4A 8ICUA 3ETRA 5CP2A 2E8MA 4OCZA 4DF8A 5EWFA 3PHZA 5HR7A 2LBOA 5J2EA 5F2VO 5KFYA 2ALZA 5D49A 2IA6A 5HR9A 9ICHA 3C28A 2L5YA 3F53A 4XQ8A 1TFYA 4UB8U 2PI5A 4J9SA 1C20A 4O3NA 4I0UA 4C8NA 3HP6A 1N56A 4JWNA 3F5EA 2G06A 4OD0A 4PHAA 3SYZA 4KLSA 4NV0A 3SENA 4O5EA 5J0SA 2XO7A 2F77X 1B4FA 5HHHA 4NLCA 2W03A 5EOZA 2ZH9A 4IC9A 3V7KA 3SAHA 4TUPA 3TQ1A 2H3VA 3MABA 2B6GA 3WU2U 4F50A 4BXOA 2F2AB 2A1JA 9ICGA 7ICPA 4ECRA 2ZH5A 2HHSA 1ZQRA 2DPJA 1U4BA 3K1ZA 4NXVA 2FMQA 3PVXA 9ICFA 1ZQ1C 4WC4A 4ED8A 4JV0A 1NK6A 3MCRA 3PY8A 3Q8LA 3A0BU 2ATLA 4ED2A 1S97A 9ICPA 5DGBA 1TAQA 8ICXA 2LPEA 3CNHA 5DQGA 1LB2B 1KNYA 5KFDA 3PO5A 1XC9A 2ZJ8A 4HX0A 4KLQA 5HRIA 4AYBF 5J2AA 1ZJMA 3CP8A 5ALLA 2D3DA 1L3SA 5CFTA 3NVWA 3NVVA 3AU6A 2A19A 2KICA 4DFJA 2MU2A 2XVTA 5AI6A 2HBJA 5GTIU 4QW9A 3CYMA 3HW8A 5KFPA 3KHHA 4R65A 2KKPA 3CK6A 2VA8A 1PK3A 3RRGA 3MR5A 2H3IA 5J0UA 5D4BA 4RNMA 2GAFD 3VC8A 8ICVA 3NKUA 4UB4A 3MBYA 3GU3A 3KHLA 1JI7A 2W11A 2RDIA 2QARB 2JMGA 1JIHA 3JPTA 3SD7A 4KLTA 5L1LA 2JH1A 4O0IA 4QZDA 4EELA 2OM6A 1FO4A 1MQ2A 1SKWA 1PUZA 4J9PA 4Z6FA 8ICFA 3SI8A 2BPCA 1HUOA 4ECQA 4KX3A 5KG0A 3ZI4A 2E8OA 4FHWA 2W7OA 3C2MA 1KLNA 2DWQA 3PSPA 1JXLA 4KB6A 3ONNA 1V38A 4WOYA 2WF9A 1SWVA 4EX6A 5DB6A 1ZQJA 2D6FC 4PZOA 2DBYA 2HCFA 5ALEA 1ZQXA 2FPLA 2RFFA 3GZFA 1URJA 1A6SA 5ALUA 4WC5A 1Z3EB 2YMMA 2M2UA 2YB1A 2XY5A 4X4OA 2M2TA 4CE6A 4WC2A 4DL4A 3FDSA 3PW0A 1QCKA 3QU5A 4J9KA 5AHXA 1ZD2P 1RQNA 2WHEA 3PZPA 2HOQA 5ALWA 2C2RA 4BGDA 1L8LA 3ERCC 4UBBA 2QARA 8ICOA 1UEUA 4NL9A 4XRHA 3QEBZ 5KFFA 2NYVA 3HKZC 2XGQA 4Y2QA 5CA7A 4XQ7A 3RBDA 3AQNA 4KMOB 3WKAA 2O1PA 3I1YA 4XJEA 4K4HA 2HHVA 2DGZA 2W43A 1L7PA 3MGVA 4BX9C 2NRWA 2PBEA 2H3ZA 3PW2A 1KDHA 2QB0B 9ICIA 2WTFA 9ICRA 4MF2A 4I2HA 1WOTA 3ED5A 3RFAA 4C8OA 4U6PA 2AH5A 2ZXHA 2EWRA 4FS1A 2DL0A 1Z19A 4C0ZA 2ISPA 3BDPA 5FP0A 5G5HA 3UXPA 3RJJA 4F3OA 4USAA 1XS9D 5IIMA 1SV0A 2B0CA 7ICUA 2DRAA 1TAMA 2ZIXB 1VJ5A 4Y2TA 3ICXA 3T5HA 4MEXA 5D46A 3RRHA 3GQCA 4I2BA 3IG5A 1ZQYA 2HN2A 1T7PA 9ICSA 4KLOA 5L1IA 4DL3A 2AJQA 5AI8A 2YMQA 4TQSA 2MAXA 4DQRA 4DL6A 2JV3A 1Q79A 1MN8A 3KHGA 3UMCA 4RQ8A 4UAYA 1R8BA 1IXRA 8ICQA 4UW9A 2ZJ5A 1LV5A 2DR9A 4K97A 2HW3A 3PSFA 1UPHA 5KAFU 2BCRA 2R8HA 4QZIA 3DEEA 2JEJA 1NJWA 3JPPA 4F2RA 2GOLA 1OW5A 9ICJA 4BDPA 2E8NA 2W55A 2BCQA 3AL0B 1EXNA 4JV2A 4F4WA 2IMWP 3AMZA 4OJ5A 2EZYA 4NY8A 4FE3A 4RPXA 4KN4A 3BS5B 4KLHA 1L3TA 5DECA 3JCFA 4Q8EA 1PK1B 2WF5A 5KAIU 2QB0A 5D62A 5D63A 4ECUA 2ISOA 2KHQA 2RRDA 1PX5A 4G9BA 3KBBA 5J2JA 2ZH3A 4DL2A 2C2EA 3H8MA 2FLLA 5KG6A 2Q66A 1CEZA 3EPGA 8ICPA 2ZIXA 2DQNB 3EWAA 5KFVA 3GDXA 1TAUA 4KMUA 1C7YA 4X4TA 4NL9C 1MQ3A 5DBBA 3HJ4A 2CN1A 2R8IA 4F5PA 9ICWA 2KN7A 5KFOA 4M9GA 2ZJAA 5DQHA 2YTUA 4CF3A 2ZUCA 3PR5B 3M8SA 3QU2A 3WFSC 4QZFA 5EE3A 5L1JA 5EE0A 4DSKA 1RPLA 2PMZF 3V6HA 3Q8QB 1MSWD 4PPXA 4B9UA 3HKZF 3N28A 2P6UA 4NWIA 3KZIU 1J2NA 4IRKA 5HRLA 4M9HA 9ICLA 4C8MA 3UMBA 4AT7B 3AM9A 3HJ1A 4QWCA 8ICTA 5KFRA 3JPSA 3TAPA 3CRXA 4WC0A 3BS5A 3KKAA 1ZQEA 3H3AA 7ICJA 1PK1A 4IRCA 3H8JA 4NXTA 2KP7A 3R9KA 2MSNA 4FHYA 1WWUA 2BHNA 1A0PA 1NNLA 1ZOLA 3LWLA 3E2EA 4RNNA 7ICHA 5GTHU 1XSNA 1L6NA 2AXTU 2GWSA 5HRBA 2F3NA 2XY7A 4M04A 5AIAA 2ODGA 4KM5A 2BE3A 4F4YA 1X42A 5DBAA 4RQ2A 4LEZA 2JEFA 3LQCB 2DVIA 2E5SA 2A3VA 4UD5A 4O3OA 5J2DA 3SV3A 4KLFA 1QH9A 4DWIA 5ALNA 1S0OA 4X4QA 2ZH7A 1NZPA 4WCWA 1R8AA 4EEKA 3TADC 2KFZA 4J03A 4MFFA 2RHFA 1K1QA 2HHPA 4A8EA 4K8VA 4NKTA 4X4RA 3NRZA 1XNSA 3HT3A 4UASA 1B0XA 5B5EU 1X2IA 4ED6A 1YZ6A 3C2KA 5B66U 4O3PA 3GILA 3RJIA 3OWGA 4DSEA 1L3VA 5KFAA 4AT7A 2K4IA 1UEVA 3U26A 5HRKA 4FBUA 5ALMA 4DS5A 3MGHA 1ZQQA 1RQLA 5J2BA 2J6TA 1N5XA 4P4PA 5TZVA 3RH6A 4C7ZA 4IL6U 2KMDA 2NRZA 4GC6A 1CRXA 2W7PA 3V7LA 4I27A 2Y1IA 3RH4A 4CNQA 4N7RA 3M7DA 1VJ7A 1VLBA 3HJEA 2M0NA 5CJ7A 9ICBA 1SL2A 1RXWA 5KG5A 3BQ2A 1BPYA 1COKA 2EZZA 3HWTA 3UPSA 2F8LA 3C29A 3MFIA 2D8CA 3JZ0A 3H8SA 3V7JA 1Q8KA 4ECXA 3ALRA 1ZQMA 3ZDDA 2KEYA 4UB6U 1S10A 2KHVA 3SQIA 7ICQA 4ZOHC 5F3XB 5J2IA 3LDAA 3M6KA 4OAFA 3THVA 2XY6A 4OAGA 4Q43A 1S0NA 2W3SA 5JTGA 2WB1C 4RUCA 2HHXA 3HRDD 1D9DA 1R89A 4UB5A 2W8LA 1JRPA 3NVOA 1SZHA 8ICKA 4FO1A 3WK9A 1Q3UA 2R8GA 1U9LA 1T94A 1ZQVA 5ALHA 4E8FA 1TFRA 1ZD5A 4FZMA 3QXGA 2DKZA 3L4PA 1QSSA 4RQMA 1RZTA 3F2BA 5DLFA 2VIXA 3ISCA 1SL1A 1WUDA 4JB3A 4FHVA 1X66A 4KN7A 3SMVA 1NKBA 1NK0A 5IILA 3LYSA 3T5LA 3ISBA 3B0YA 1KW4A 4MHVA 1X40A 4P2HA 1VDVA 3OHAA 1U49A 1U45A 4YXMA 3LVWA 2NV3A 5ALQA 1S8OA 5F9NA 5KL1B 4MFAA 2A1AA 3C1ZA 1NOMA 5J29A 1COOA 4Y2VA 3BQ7A 5DG8A 1YT3A 4NM1A 7ICFA 5KFHA 3M9OB 3OSPA 2WFAA 3RB3A 1KFDA 5AM0A 4TURA 3PSIA 4Y2YA 2IHMA 4AT9B 5HRHA 3TAQA 8ICYA 3JPQA 2MUTB 8ICEA 2XIDA 1ZQBA 1FIQA 3OJUA 4M9LA 1Q78A 2ZH6A 2WF6A 4US8A 1DK2A 1KBUA 2LI6A 2HHTA 1GPJA 2Y9TA 4Z6DA 5HREA 3OTQA 4C4TA 4KLDA 1QTMA 4MFCA 2HN1A 2XGPA 4KLJA 1J2MA 3N4MB 5CB1A 2V4RA 1HIWA 4F4KA 2P35A 2HDOA 4DEZA 2ZIWB 1Z1VA 4M9NA 5ALXA 2HBKA 2HMXA 1WYGA 2Z7JA 1Z4OA 2I6XA 1XU4A 3NTUA 2IOFK 4UB1A 8ICLA 1ZQSA 1V4AA 8ICBA 2GA9D 2VJ4A 4X4PA 8ICNA 4PJ0U 4LVSA 4RWOA 1S77D 1V9PA 5KT7A 2FPMA 3AQMA 4EBKA 7ICRA 3GV8B 2FE9A 2BQRA 1A77A 1AQ6A 4O67A 5JTIA 4QZAA 4X4NA 4QWEA 4YFKA 1S76D 1JMSA 2O5AA 5DB8A 4UQGA 2IOFA 5KNIA 3ZDEA 3PX6A 4QZEA 3HIYA 3QEAZ 4QWBA 1SZPA 2W8KA 5IIOA 1JQRA 5CFSA 5KFMA 1BPBA 2KV2A 4AT9A 1LVHA 1ZRNA 9ICOA 4PGXA 2EH9A 5AKJA 4I2IA 2MUTA 4FZNA 4QWAA 2LM1A 5A0LA 4RPYA 1MIYA 3GV7B 3BQTA 5KFLA 4ATBB 5HR6A 1JAJA 3GIJA 2H5XA 3WFOA 2ASDA 2OHFA 3M9NB 5ALYA 3RR7A 1IM4A 3HX0A 3GIKA 4RU9A 1PZNA 1Z00B 2NRKA 4EP7A 4IQWA 4FZLA 2LYBA 4P4OA 2JRZA 2YMPA 3IG8A 3BZKA 2OWOA 2ZIWA 1KRPA 3MGIA 2BPGA 4NLKA 4ECYA 5KT5A 1NJZA 4F4ZA 4F5QA 4UAVA 2YQEA 1ZQHA 2BBJA 2OH2A 8ICIA 2FMSA 4WQKA 5AM4A 4TUSA 4P0PB 3H8WA 4U7CA 1WCNA 4C7YA 4PZNA 3WFPA 4K99A 3KZXA 4I2DA 4YXJA 3K75D 4M5DA 4NM2A 4B9MA 5KG2A 3EF2A 4ECWA 4RQ6A 2IHOA 3D2NA 2K4PA 3MDAA 2MRLA 3QYPA 1MA7A 2AGQA 3PW5A 2RP5A 5AICA 3RB0A 2K8CB 3GIMA 2FJ6A 3NWIA 4NLBA 3J81j 5DB9A 4E80A 2ZXIA 3SAFA 4TUQA 1T3QA 3OVSA 4EYIB 4OAIZ 2H3QA 3MDCA 3B9JA 4I2FA 5J2HA 4GLXA 4YQWA 2ZTEA 7ICTA 2J6UA 2Q4TA 2KK0A 3G6XA 3EYZA 4B6JA 4ATBA 8ICRA 4DL5A 3C5GA 4KLIA 4F5RA 1B43A 9ICXA 4NLNA 3AQKA 2OCEA 2XCPA 3HPOA 1DXSA 5KG1A 4ICAA 2PFQA 1Z00A 3E0FA 3RR8A 3UXOA 2WF7A 3GV5B 3C66A 3UMGA 4YN4A 3LWMA 2ESEA 2G5IB 2HHUA 4X4SA 5DDYA 3K4GA 1UA0A 1X9MA 2K89A 1SWWA 1UT8A 1L7NA 1D8LA 4J9LA 4P0PA 3CW2C 4QIWC 5J0WA 4PGQA 3SAGA 4DFDA 2JR5A 4F91B 2G0AA 1FA0A 1X9WA 3C18A 3T3FA 3WKEA 1CI4A 4DOAA 4NXWA 4MF8A 5CWRA 4FHXA 4CGZA 1T3NA 4DQSA 1TK5A 1HUZA 3SV4A 9ICUA 4KTQA 2CPRA 2JH7A 7ICEA 3E58A 4O3MA 1QQ6A 2KTQA 1K5OA 4C4RA 3RJKA 2KZZA 4C8LA 2VJ5A 4IS7A 2AGPA 4EYHB 2QKQA 2VANA 9ICQA 3NYBA 5HRFA 5DQIA 3EZ5A 4O6AA 1BGXT 1RYUA 1KSPA 4YMNA 2KVSA 3O0FA 1NK7A 4XUSA 2Y0SC 5BPCA 1ZQZA 2ID1A 3JPRA 8ICGA 1KEJA 2W9CB 4C4SA 9ICKA 4DSIA 2LYHA 2ZTDA 1CUKA 4ELUA 1S0VA 2VKQA 1SL0A 1XO0A 2I9GA 1SKSA 2HHQA 5KFUA 1ZETA 3TADA 4G3IA 4IQVA 4ZH4A 4ACOA 3RB6A 2C28A 1D8YA 3PV8A 1WG8A 1ZYQA 4IR9A 4JLZA 2F1JA 4UAUA 5KG4A 2EAMA 4EZ9A 3Q8PB 2HHWA 1ZXIA 3ZD8A 3PMLA 4J9RA 4RWQA 5KFEA 3N7RC 1RXVA 8ICZA 4F5OA 3JPNA 1D9FA 2AQ4A 2F1HA 2KVCA 2XI9A 1WWVA 5JU5A 3KFUF 2AQ0A 3OJSA 3RF9A 5ALRA 4CCHA 2KJ9A 4RT3A 3C2LA 4F71A 3FM9A 2GO7A 3SZ2A 2UVVA 1BPDA 3IM1A 1T4GA 4WC1A 2BBHA 5T14A 5JRTA 3PW7A 2FCLA 4YP3A 2PXIA 1KFSA 2W9CA 4EX7A 2DR8A 1IIPA 4NXXA 3RJFA 5HMLA 2Y1JA 2RQ5A 4QIWF 4X0BA 3AUOA 7ICMA 9ICEA 1L3UA 4CF4A 1ZQOA 1DGJA 3OVBA 5ALOA 1PVRA 4J9NA 3TACB 1R8CA 2ZG6A 3NVYA 1JXEA 1ZQTA 1JALA 5AKEA 1ZQPA 4TQRA 5F9LA 3QNMA 3H37A 1P7DA 4IQTA 4K98A 4DQIA 3MC1A 4EGWA 5HC9A 4J9MA 3RJEA 3MR6A 1Z4NA 4M6WB 4NXZA 5AM1A 1MIWA 5DLGA 2EDUA 2OEHA 5AKZA 3AU2A 3WK5A 4DLGA 3NRWA 3QUCA 2EAOA 4K9AA 4IQUA 1RYSA 2W04A 5ALKA 2KG5A 3BS7A 1TK8A 5DEDA 3LVVA 1ZD3A 4DSFA 5ALZA 1KL9A 5AI5A 4PGYA 1S0MA 3FAHA 2XC9A 5KTQA 3M8RA 2R18A 7ICNA 3ER8C 5IIIA 4EEDA 2RDJA 1V97A 2YMLA 1YZ7A 4YR2A 5J2GA 3MR2A 2WF8A 3IP4B 4EBCA 3RBEA 1ZQLA 3QU4A 1OXJA 4US9A 5AK5A 5H2FU 1FFUA 3H0LB 3L5KA 1JN3A 3H7IA 7ICSA 3A0HU 2ZUBA 4DLEA 4RQ0A 3OV7A 2B21A 2LHTA 3BQ1A 1HJPA 4QJFB 5L1KA 2KJ8A 1U47A 4DQQA 4M6WA 1N61A 3Q8KA 3H0RB 1N62A 3M1YA 2W9AA 4ECSA 3RAQA 3D2QA 3D6JA 5BOLA 4LEYA 3UQ2A 4BWJA 4X0AA 2KSOB 2BCSA 3PSTA 3TKAA 3ZDAA 4IR1A 1ZQCA 5J0QA 4JUZA 4UAWA 4HAIA 3QZ8A 3RB4A 5B3PA 3KD3A 5BOMA 4R64A 4NLZA 3N7SC 4GFJA 5JUMA 3JPOA 2KZ3A 1ZQGA 4RQNA 1JUDA 4GXKA 5DKWA 8ICJA 3PX0A 1NJYA 4BWMA 5AM2A 2FI1A 4QZHA 4KLMA 3V6JA 3JYYA 1JROA 5J2FA 4FBTA 3OUYB 3Q8RB 4Y2RA 3OPXA 2J6SA 2QB1A 4F92B 1F44A 4O3QA 2BR0A 3WK4A 4ECVA 1PVQA 5K4LA 2XICA 4ECTA 4I2AA 1TVAA 4DQPA 2MA1A 3Q8SB 2JGAA 2FLPA 2FMPA 2ZIVB 3C5FA 2DPIA 5ALJA 1QSLA 5KFCA 5J0OA 4Y2UA 4WBZA 2HI0A 5AK4A 2YB4A 2DUYA 4P0QB 1TK0A 3OHBA 4Q44A 5ALDA 3M6ZA 4DFMA 2LM4A 3VCBA 5AKLA 3H4BA 4F4XA 9ICTA 2I5HA 4QZGA 2ZHBA 3F2CA 2VA2A 4WQLA 4ECZA 4I2EA 2E1EA 3MFHA 4PHPA 4PL2A 2KSOA 4FFDA 1ZQAA 2JZBB 2KIWA 3V6KA 2W54A 4RQ1A 5L1MA 4UB2A 4C8KA 1IV8A 3N97B 2Y9UA 1SV4A 4XA5A 4F72A 5AM5A 4YD1A 4DOBA 4Q45A 2OXOA 3RJHA 3ZDCA 1BNPA 1NZBA 3EUB2 1N63A 4M47A 2ZHAA 4K9BA 3B0XA 3GFKB 2HVHA 5DG9A 2AGOA 5AKGA 4PL1A 4YD2A 2EZXA 5AKYA 3DV9A 4Z6EA 1OUQA 5ALSA 3OUYA 3PMNA 1SKRA 1BVSA 4J9QA 4NJ8A 3ZD9A 2W9MA 1OU5A 4O5CA 4YG2A 2WAQC 4ED1A 4F2SA 5AK3A 4C80A 4GIBA 4Y2PA 3WK6A 2BKEA 9ICVA 2JXJA 1WCLA 2YN4A 1UT5A 5HRGA 2HOFA 2ZIVA 1NI3A 1UCVA 3NUQA 4O3RA 1XSLA 5DG7A 5KFTA 4AT8B 1ZD4A 3SEIA 4O9MA 1F5SA 5EWGA 9ICNA 1YLQA 4LEVA 9ICCA 1ZRMA 4P0QA 1L5UA 3IN5A
chains in the Genus database with same CATH topology
3UXOA 4M9GA 1UETA 2ZJAA 5DQHA 4I28A 2ZH4A 3M9MB 3GV5B 5KFGA 4I2CA 3C66A 2PFPA 2ZUCA 4RQ7A 3PR5B 3M8SA 1XSPA 4YN4A 3LWMA 3AQLA 3WFSC 2XCAA 4QZFA 2HHUA 5HRDA 4X4SA 2DR5A 5L1JA 4DSKA 5DDYA 1RPLA 4DS4A 3V6HA 3K4GA 3Q8QB 1MSWD 3G6YA 1UA0A 1ZQKA 1X9MA 4PPXA 4B9UA 2BQ3A 1UT8A 2JZBA 4R66A 2P6UA 1D8LA 4J9LA 4MEYA 4IRKA 1VFGA 5J0WA 8ICMA 5HRLA 4PGQA 4M9HA 3QZ7A 1DOQA 4F91B 9ICLA 9ICAA 1FA0A 4C8MA 5KT6A 1X9WA 3C18A 8ICTA 4AT7B 3LK9A 3T3FA 4RPZA 2M2WA 5J2KA 4E7XA 1K1SA 3HJ1A 4R8UB 4QWCA 2NRXA 4F93B 4RQ5A 5KFRA 3JPSA 4DOAA 4MF8A 5CWRA 3TAPA 1ZQDA 4WC0A 7ICOA 4NKUA 4FHXA 4FO6A 4KLGA 4O5KA 4I2JA 1T3NA 4PHDA 1ZQEA 4DQSA 1TK5A 3H3AA 2M9NA 3C1YA 7ICJA 2M2VA 4IRCA 3H8JA 3PX4A 1HUZA 3SV4A 9ICUA 3ETLA 5HNKA 4KTQA 2KP7A 2KFNA 7ICEA 1TV9A 3OSNA 4EBJA 4BXOB 4I2GA 4FHYA 1KFTA 2A1JB 4WBYA 1MC8A 4GXJA 2KTQA 2BHNA 2I1QA 3LWLA 3RJKA 3E2EA 4RNNA 5J0PA 1ZQWA 1N48A 2KZZA 1XSNA 4C8LA 7ICHA 5IIKA 2W9BA 3RAXA 2VA3A 8ICSA 2AGPA 4EYHB 3IHQB 2GWSA 7ICIA 5HRBA 1Y88A 2XY7A 3KHRA 4M04A 4KITB 2VANA 4KLEA 4GXIA 9ICQA 3PNCA 4B9LA 4PHEA 4F4YA 2BCVA 5IIJA 1U48A 2UVWA 2BE3A 3NYBA 5DBAA 5J2CA 4QZBA 5HRFA 5DQIA 1QSYA 3EZ5A 3WFRE 1BGXT 4RQ2A 1NK8A 1KSPA 5IINA 4JWMA 4YMNA 4YVZA 4YMOA 1NK7A 2JEFA 4XUSA 3LQCB 4IG8A 5BPCA 4E0DA 2DVIA 1ZQZA 1ZQIA 2ID1A 4UD5A 3JPRA 4ELTA 4O3OA 5J2DA 4AT8A 3SV3A 1NK4A 1KEJA 4KLFA 2ZTCA 8ICGA 2W9CB 8ICUA 4DWIA 3V72A 5EWEA 9ICKA 4DSLA 4DSIA 5CP2A 2JEGA 3H38A 2LYHA 1S0OA 4DF8A 2ZTDA 1CUKA 4ELUA 4X4QA 1S0VA 5EWFA 4WC6A 1NZPA 4WCWA 4FS2A 2ZH7A 1R8AA 1SL0A 2P66A 4Z6CA 4IRDA 5J2EA 2KFZA 2I9GA 3TFSA 5F2VO 5KFYA 1SKSA 4MFFA 2HHQA 2ALZA 1K1QA 5KFUA 3OGUA 5D49A 2IA6A 1ZETA 1S77D 5HR9A 9ICHA 4RT2A 4NKTA 4XQ8A 4G3IA 4IQVA 4X4RA 1TFYA 4ZH4A 3RB6A 3HT3A 2C28A 3PV8A 1D8YA 4J9SA 2PI5A 1ZYQA 4IR9A 1X2IA 2F1JA 2HHPA 4ED6A 4O3NA 1ZQUA 3C2KA 4C8NA 3C21A 3HP6A 1N56A 5KG4A 4O3PA 4JWNA 3GILA 3RJIA 4B9TA 4EZ9A 3Q8PB 4PHAA 3SYZA 4KLSA 2HHWA 4X5VA 3ZD8A 3PMLA 4J9RA 4DSEA 1L3VA 4M2YA 4DL7A 5KFAA 4YCXA 2IHNA 4AT7A 3ORYA 4RWQA 5KFEA 1UEVA 3RJGA 4O5EA 5J0SA 2JEIA 5HRKA 2V4QA 1RXVA 4FBUA 2XO7A 4R8UA 8ICZA 4DS5A 5HHHA 3UXNA 5EOZA 4F5OA 4JV1A 3JPNA 1NJXA 3MGHA 1D9FA 2ZH9A 5DDMA 3V7KA 1ZQQA 5J2BA 4TUPA 3TQ1A 2J6TA 2AQ4A 4P4PA 4RUAA 4YR0A 2F1HA 5TZVA 3MABA 3RH6A 4F50A 4BXOA 2NRZA 2A1JA 4GC6A 9ICGA 2AQ0A 2ZH1A 3V7LA 3OJSA 2Y1IA 4I27A 2Q0ZX 3RH4A 7ICPA 1TKDA 4CCHA 1VJ7A 4ECRA 4RT3A 2ZH5A 2HHSA 1ZQRA 9ICBA 5CJ7A 1SL2A 4YMMA 4J9OA 5KG5A 5J0YA 3C2LA 1RXWA 2DPJA 1U4BA 3BQ2A 4UB3A 1NKCA 1BPYA 1H38A 2FMQA 3PVXA 3EW9A 3SZ2A 4QWDA 2UVVA 3HWTA 3UPSA 1NK9A 1BPDA 3IM1A 9ICFA 4WC4A 1T4GA 4ED8A 4WC1A 4JV0A 1NK6A 3PW7A 5KFKA 3MFIA 3RTVA 3JZ0A 4WC7A 2ASJA 3H8SA 5KT3A 3V7JA 2PFOA 3PY8A 2KZMA 4ECXA 4YP3A 2PXIA 3Q8LA 1KFSA 2ATLA 4ED2A 2W9CA 1ZQMA 1S97A 9ICPA 5KT4A 5DGBA 1UA1A 3ZDDA 2DR8A 1TAQA 1S10A 8ICXA 3RJFA 5KFIA 4R63A 5DGAA 4RZRA 7ICQA 1NO5A 3HIYA 5J2IA 3LDAA 5DQGA 1ZQNA 5HMLA 2Y1JA 1LB2B 5KFDA 3THVA 2XY6A 3PO5A 1KNYA 1XC9A 4Q43A 4X0BA 3AUOA 2ZJ8A 3H39A 7ICMA 9ICEA 1S0NA 2DFLA 4KLQA 1L3UA 5HRIA 5J2AA 1X9SA 1ZJMA 2BGWA 4RUCA 4YR3A 1L3SA 1ZQOA 4S3NA 2HHXA 3OVBA 3OUYB 4DFKA 1DGSA 4J9NA 1D9DA 3GIIA 1R8CA 1R89A 3BQ0A 2IBKA 4UB5A 2W8LA 3KTQA 3AU6A 1JXEA 1ZQTA 2ZUDA 1ZQPA 4TQRA 5F9LA 5C5JA 4DFJA 8ICKA 3H37A 3TARA 4QW9A 3HW8A 4IQTA 5KFPA 3KHHA 2R8GA 2P6RA 4R65A 1U9LA 4DQIA 1ZQVA 5HC9A 4J9MA 3RJEA 4E8FA 3MR6A 2ASLA 1TFRA 4RQ4A 2NRTA 5KFBA 2VA8A 4M6WB 4ED7A 1QSSA 4NXZA 5DBCA 3MR5A 5J0UA 1RZTA 1BPXA 3RRGA 1MIVA 5D4BA 1MIWA 4RNMA 5DLFA 5DLGA 8ICVA 4UAZA 3OVAA 4F8RA 4UB4A 3MBYA 3ISCA 1SL1A 4WC3A 2C2DA 2F1IA 3KHLA 2RDIA 3AU2A 4FHVA 4KN7A 1JIHA 1NKBA 1NK0A 4QZ9A 3JPTA 4DLGA 5IILA 1JX4A 2NRVA 3L9DA 3T5LA 3ISBA 4FH5A 3B0YA 8ICHA 3C23A 4KLTA 5L1LA 1BNOA 4NLGA 4O0IA 4QZDA 4P2HA 3H40A 4IQUA 3OHAA 1U49A 5CHGA 1RYSA 1MQ2A 1SKWA 5KFSA 4GC7A 3G6VA 1U45A 4YXMA 4J9PA 4Z6FA 3QE9Y 1TK8A 8ICFA 3SI8A 5DEDA 1XO1A 2BPCA 4EBEA 1HUOA 5F9NA 4MFAA 3TFRA 4ECQA 4RNOA 4DSFA 5KG0A 3C1ZA 1NOMA 5HP4A 5J29A 2BDPA 1COOA 4FHWA 1ZQFA 4HYKA 4PGYA 1S0MA 5DG8A 2XC9A 5KTQA 2R8KA 3H4DA 3M8RA 3C2MA 5KFHA 4ED0A 1KLNA 4NM1A 3M9OB 7ICFA 1JXLA 7ICNA 5KG3A 8ICAA 3OSPA 3RB3A 3UQ0A 5IIIA 1NKEA 1KFDA 2RDJA 8ICWA 4TURA 5KFNA 4YR2A 2IHMA 4AT9B 5J2GA 3MR2A 1ZQJA 5DB6A 3TAQA 5HRHA 8ICYA 3JPQA 7ICKA 2MUTB 2BCUA 8ICEA 4EBCA 1ZQBA 3RBEA 1ZQLA 3OJUA 4M9LA 1ZQXA 2FPLA 1Q78A 2ZH6A 3PO4A 4B9VA 2RFFA 1JN3A 1DK2A 3H7IA 3T5JA 7ICSA 4LZDA 1A76A 4M9JA 4WC5A 2HHTA 1Z3EB 2ZUBA 4Z6DA 2M2UA 5HREA 4DLEA 4RQ0A 1S9FA 4KLDA 3OV7A 2XY5A 1QTMA 4X4OA 2B21A 3BQ1A 2PFNA 1HJPA 4MFCA 2M2TA 9ICMA 2XGPA 4KLJA 3N4MB 1BPEA 5L1KA 5CB1A 2HVIA 2V4RA 5KFWA 4DOCA 4WC2A 4F4KA 4DL4A 1U47A 3FDSA 3Q8MA 4DQQA 3PW0A 4M6WA 4DEZA 4M9NA 3Q8KA 2W9AA 4ECSA 3RAQA 4J9KA 4B9NA 1XU4A 4UBCA 3NTUA 5BOLA 1AROP 4UB1A 3UQ2A 1ZQSA 4BWJA 8ICLA 4X0AA 2C2RA 1V4AA 1NK5A 4BGDA 8ICBA 4UBBA 4X4PA 8ICNA 2BCSA 8ICOA 3TI0A 4LVSA 1UEUA 4RWOA 3ZDAA 4IR1A 4O5CA 1ZQCA 5J0QA 1V9PA 3FYHA 4JUZA 5KT7A 4UAWA 4DFPA 4KLUA 3QZ8A 3RB4A 2FPMA 4XRHA 5BOMA 3AQMA 3QEBZ 4EBKA 7ICRA 5KFFA 4R64A 3GV8B 3PW4A 4NLZA 2XGQA 5KFJA 2BQRA 5CA7A 4XQ7A 8ICCA 1A77A 5JUMA 3PR4A 3RBDA 3AQNA 3JPOA 4DO9A 2KZ3A 4QZAA 1ZQGA 4QWEA 2O1PA 4RWPA 4X4NA 4GXKA 4K4HA 5DKWA 8ICJA 3PX0A 4YFKA 1NJYA 2HHVA 1S76D 4BWMA 4RWNA 1JMSA 4Q8FA 2NRWA 4K4GA 3PW2A 1RYRA 1KDHA 2PBEA 2O5AA 5DB8A 2BQUA 3ZDBA 4QZHA 9ICIA 4UQGA 4KLMA 3V6JA 3JYYA 3ZDEA 2WTFA 9ICRA 4QZCA 5J0XA 1BPZA 4MF2A 5J2FA 3PX6A 2V9WA 4QZEA 4JK1A 3Q8RB 3QEAZ 4FBTA 4I2HA 2J6SA 2UVRA 4QWBA 1SZPA 2W8KA 5IIOA 4C8OA 3MR3A 1WOTA 4X4VA 1JQRA 4F92B 5KT2A 5KFMA 4FS1A 3RR8A 5KG7A 1BPBA 4O3QA 4DSJA 4LT6A 2BR0A 4AT9A 2ISPA 3BDPA 9ICOA 4PGXA 4LZGA 4ECVA 3RJJA 3UXPA 4I2IA 4F3OA 2ZH8A 2MUTA 1XS9D 4QWAA 5IIMA 1ZJNA 4RPYA 2DRAA 4ECTA 3TANA 3GV7B 7ICUA 1MIYA 1QLNA 2DR7A 2UVUA 3BQTA 4I2AA 4F5NA 3T5HA 5KFLA 4ATBB 4MEXA 5D46A 1TVAA 4DQPA 4O3SA 3GIJA 3Q8SB 1JAJA 2H5XA 5KFQA 3WFOA 3RRHA 2ASDA 2FLPA 3GQCA 3M9NB 3NGDA 2FMPA 3RR7A 4I2BA 8ICRA 1ZQYA 1IM4A 3C5FA 3HX0A 4DF4A 1T7PA 9ICSA 4KLOA 2ZH2A 2DPIA 3WFQE 5L1IA 4DL3A 3GIKA 1QSLA 4RU9A 1PZNA 5KFCA 5J0OA 3BJYA 1Z00B 2AJQA 1DK3A 4TQSA 4IQWA 2NRKA 4WBZA 2MAXA 4EP7A 4P4MA 4DQRA 4DL6A 4RQ3A 1Q79A 4P4OA 1TK0A 3OHBA 4Q44A 3KHGA 4RQ8A 4DFMA 4UAYA 2OWOA 1R8BA 1IXRA 1KRPA 4FHPA 3MGIA 3H4BA 4F4XA 2BPGA 4NLKA 2ZJ5A 8ICQA 1LV5A 9ICTA 4ECYA 2DR9A 5KT5A 2HW3A 1NJZA 4QZGA 4F5QA 4F4ZA 2R8JA 2ZHBA 2VA2A 4ECZA 1ZQHA 2BCRA 1T8EA 4I2EA 2DRBA 3MFHA 2R8HA 8ICIA 4PHPA 2FMSA 4QZIA 4FH3A 5L9XA 1ZQAA 2JEJA 2JZBB 1NJWA 4TUSA 3H8WA 3V6KA 3JPPA 3RH5A 4F2RA 4RQ1A 1WCNA 4ELVA 7ICLA 1TFWA 4UB2A 3ISDA 5CR0A 9ICJA 4BDPA 4C8KA 3N97B 2BCQA 4EZ6A 3WFPA 2FLNA 4I2DA 4YXJA 1EXNA 4JV2A 4XA5A 4F4WA 3K75D 2IMWP 4NM2A 4M5DA 4B9MA 7ICVA 1B22A 5KG2A 4ECWA 4YD1A 3EPIA 4RQ6A 4M0AA 4DOBA 4Q45A 2FPKA 4NY8A 4RPXA 4KN4A 3MDAA 3RJHA 5HMMA 3ZDCA 1F5AA 4KLHA 1BNPA 1KTQA 1L3TA 4M47A 5DECA 2ZHAA 4QZ8A 3B0XA 2AGQA 3PW5A 3RB0A 3GFKB 4Q8EA 2HVHA 5DG9A 2C22A 2AGOA 3GIMA 4YD2A 4Z6EA 4ECUA 5DB9A 3PMNA 2ISOA 4E80A 1SKRA 4TUQA 1XWLA 3OUYA 5DB7A 1BVSA 4J9QA 5J0TA 3OVSA 3ZD9A 2W9MA 1PX5A 4EYIB 5J2JA 1OU5A 2ZH3A 4DL2A 3MDCA 2C2EA 2W9BB 4YG2A 2FLLA 4ED1A 5KG6A 4F2SA 4I2FA 5J0RA 5J2HA 4GLXA 1CEZA 2Q66A 4YQWA 3EPGA 2ZTEA 4KLLA 7ICTA 5KFZA 2J6UA 2PI4A 4QW8A 4I29A 8ICPA 2BKEA 3G6XA 5KFVA 3EWAA 3GDXA 3EYZA 1WCLA 1TAUA 9ICVA 4B9SA 4ATBA 4KMUA 5HHIA 3T5KA 1UT5A 4DL5A 3C5GA 1C7YA 2BPFA 4F5RA 4KLIA 7ICGA 5HRGA 1B43A 4X4UA 9ICXA 4X4TA 4NLNA 1MQ3A 2AU0A 5DBBA 3AQKA 4UD4A 4O3RA 4EBDA 4PH5A 1XSLA 5DG7A 3HJ4A 2XCPA 5KFXA 5KG1A 3HPOA 5KFTA 2R8IA 4AT8B 2PFQA 1Z00A 4F5PA 3UPQA 9ICWA 4O9MA 2KN7A 5EWGA 9ICNA 1YLQA 9ICCA 4ED3A 4EEYA 5KFOA 1L5UA 4K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UXO A;  4M9G A;  1UET A;  2ZJA A;  5DQH A;  4I28 A;  2ZH4 A;  3M9M B;  3GV5 B;  5KFG A;  4I2C A;  3C66 A;  2PFP A;  2ZUC A;  4RQ7 A;  3PR5 B;  3M8S A;  1XSP A;  4YN4 A;  3LWM A;  3AQL A;  3WFS C;  2XCA A;  4QZF A;  2HHU A;  5HRD A;  4X4S A;  2DR5 A;  5L1J A;  4DSK A;  5DDY A;  1RPL A;  4DS4 A;  3V6H A;  3K4G A;  3Q8Q B;  1MSW D;  3G6Y A;  1UA0 A;  1ZQK A;  1X9M A;  4PPX A;  4B9U A;  2BQ3 A;  1UT8 A;  2JZB A;  4R66 A;  2P6U A;  1D8L A;  4J9L A;  4MEY A;  4IRK A;  1VFG A;  5J0W A;  8ICM A;  5HRL A;  4PGQ A;  4M9H A;  3QZ7 A;  1DOQ A;  4F91 B;  9ICL A;  9ICA A;  1FA0 A;  4C8M A;  5KT6 A;  1X9W A;  3C18 A;  8ICT A;  4AT7 B;  3LK9 A;  3T3F A;  4RPZ A;  2M2W A;  5J2K A;  4E7X A;  1K1S A;  3HJ1 A;  4R8U B;  4QWC A;  2NRX A;  4F93 B;  4RQ5 A;  5KFR A;  3JPS A;  4DOA A;  4MF8 A;  5CWR A;  3TAP A;  1ZQD A;  4WC0 A;  7ICO A;  4NKU A;  4FHX A;  4FO6 A;  4KLG A;  4O5K A;  4I2J A;  1T3N A;  4PHD A;  1ZQE A;  4DQS A;  1TK5 A;  3H3A A;  2M9N A;  3C1Y A;  7ICJ A;  2M2V A;  4IRC A;  3H8J A;  3PX4 A;  1HUZ A;  3SV4 A;  9ICU A;  3ETL A;  5HNK A;  4KTQ A;  2KP7 A;  2KFN A;  7ICE A;  1TV9 A;  3OSN A;  4EBJ A;  4BXO B;  4I2G A;  4FHY A;  1KFT A;  2A1J B;  4WBY A;  1MC8 A;  4GXJ A;  2KTQ A;  2BHN A;  2I1Q A;  3LWL A;  3RJK A;  3E2E A;  4RNN A;  5J0P A;  1ZQW A;  1N48 A;  2KZZ A;  1XSN A;  4C8L A;  7ICH A;  5IIK A;  2W9B A;  3RAX A;  2VA3 A;  8ICS A;  2AGP A;  4EYH B;  3IHQ B;  2GWS A;  7ICI A;  5HRB A;  1Y88 A;  2XY7 A;  3KHR A;  4M04 A;  4KIT B;  2VAN A;  4KLE A;  4GXI A;  9ICQ A;  3PNC A;  4B9L A;  4PHE A;  4F4Y A;  2BCV A;  5IIJ A;  1U48 A;  2UVW A;  2BE3 A;  3NYB A;  5DBA A;  5J2C A;  4QZB A;  5HRF A;  5DQI A;  1QSY A;  3EZ5 A;  3WFR E;  1BGX T;  4RQ2 A;  1NK8 A;  1KSP A;  5IIN A;  4JWM A;  4YMN A;  4YVZ A;  4YMO A;  1NK7 A;  2JEF A;  4XUS A;  3LQC B;  4IG8 A;  5BPC A;  4E0D A;  2DVI A;  1ZQZ A;  1ZQI A;  2ID1 A;  4UD5 A;  3JPR A;  4ELT A;  4O3O A;  5J2D A;  4AT8 A;  3SV3 A;  1NK4 A;  1KEJ A;  4KLF A;  2ZTC A;  8ICG A;  2W9C B;  8ICU A;  4DWI A;  3V72 A;  5EWE A;  9ICK A;  4DSL A;  4DSI A;  5CP2 A;  2JEG A;  3H38 A;  2LYH A;  1S0O A;  4DF8 A;  2ZTD A;  1CUK A;  4ELU A;  4X4Q A;  1S0V A;  5EWF A;  4WC6 A;  1NZP A;  4WCW A;  4FS2 A;  2ZH7 A;  1R8A A;  1SL0 A;  2P66 A;  4Z6C A;  4IRD A;  5J2E A;  2KFZ A;  2I9G A;  3TFS A;  5F2V O;  5KFY A;  1SKS A;  4MFF A;  2HHQ A;  2ALZ A;  1K1Q A;  5KFU A;  3OGU A;  5D49 A;  2IA6 A;  1ZET A;  1S77 D;  5HR9 A;  9ICH A;  4RT2 A;  4NKT A;  4XQ8 A;  4G3I A;  4IQV A;  4X4R A;  1TFY A;  4ZH4 A;  3RB6 A;  3HT3 A;  2C28 A;  3PV8 A;  1D8Y A;  4J9S A;  2PI5 A;  1ZYQ A;  4IR9 A;  1X2I A;  2F1J A;  2HHP A;  4ED6 A;  4O3N A;  1ZQU A;  3C2K A;  4C8N A;  3C21 A;  3HP6 A;  1N56 A;  5KG4 A;  4O3P A;  4JWN A;  3GIL A;  3RJI A;  4B9T A;  4EZ9 A;  3Q8P B;  4PHA A;  3SYZ A;  4KLS A;  2HHW A;  4X5V A;  3ZD8 A;  3PML A;  4J9R A;  4DSE A;  1L3V A;  4M2Y A;  4DL7 A;  5KFA A;  4YCX A;  2IHN A;  4AT7 A;  3ORY A;  4RWQ A;  5KFE A;  1UEV A;  3RJG A;  4O5E A;  5J0S A;  2JEI A;  5HRK A;  2V4Q A;  1RXV A;  4FBU A;  2XO7 A;  4R8U A;  8ICZ A;  4DS5 A;  5HHH A;  3UXN A;  5EOZ A;  4F5O A;  4JV1 A;  3JPN A;  1NJX A;  3MGH A;  1D9F A;  2ZH9 A;  5DDM A;  3V7K A;  1ZQQ A;  5J2B A;  4TUP A;  3TQ1 A;  2J6T A;  2AQ4 A;  4P4P A;  4RUA A;  4YR0 A;  2F1H A;  5TZV A;  3MAB A;  3RH6 A;  4F50 A;  4BXO A;  2NRZ A;  2A1J A;  4GC6 A;  9ICG A;  2AQ0 A;  2ZH1 A;  3V7L A;  3OJS A;  2Y1I A;  4I27 A;  2Q0Z X;  3RH4 A;  7ICP A;  1TKD A;  4CCH A;  1VJ7 A;  4ECR A;  4RT3 A;  2ZH5 A;  2HHS A;  1ZQR A;  9ICB A;  5CJ7 A;  1SL2 A;  4YMM A;  4J9O A;  5KG5 A;  5J0Y A;  3C2L A;  1RXW A;  2DPJ A;  1U4B A;  3BQ2 A;  4UB3 A;  1NKC A;  1BPY A;  1H38 A;  2FMQ A;  3PVX A;  3EW9 A;  3SZ2 A;  4QWD A;  2UVV A;  3HWT A;  3UPS A;  1NK9 A;  1BPD A;  3IM1 A;  9ICF A;  4WC4 A;  1T4G A;  4ED8 A;  4WC1 A;  4JV0 A;  1NK6 A;  3PW7 A;  5KFK A;  3MFI A;  3RTV A;  3JZ0 A;  4WC7 A;  2ASJ A;  3H8S A;  5KT3 A;  3V7J A;  2PFO A;  3PY8 A;  2KZM A;  4ECX A;  4YP3 A;  2PXI A;  3Q8L A;  1KFS A;  2ATL A;  4ED2 A;  2W9C A;  1ZQM A;  1S97 A;  9ICP A;  5KT4 A;  5DGB A;  1UA1 A;  3ZDD A;  2DR8 A;  1TAQ A;  1S10 A;  8ICX A;  3RJF A;  5KFI A;  4R63 A;  5DGA A;  4RZR A;  7ICQ A;  1NO5 A;  3HIY A;  5J2I A;  3LDA A;  5DQG A;  1ZQN A;  5HML A;  2Y1J A;  1LB2 B;  5KFD A;  3THV A;  2XY6 A;  3PO5 A;  1KNY A;  1XC9 A;  4Q43 A;  4X0B A;  3AUO A;  2ZJ8 A;  3H39 A;  7ICM A;  9ICE A;  1S0N A;  2DFL A;  4KLQ A;  1L3U A;  5HRI A;  5J2A A;  1X9S A;  1ZJM A;  2BGW A;  4RUC A;  4YR3 A;  1L3S A;  1ZQO A;  4S3N A;  2HHX A;  3OVB A;  3OUY B;  4DFK A;  1DGS A;  4J9N A;  1D9D A;  3GII A;  1R8C A;  1R89 A;  3BQ0 A;  2IBK A;  4UB5 A;  2W8L A;  3KTQ A;  3AU6 A;  1JXE A;  1ZQT A;  2ZUD A;  1ZQP A;  4TQR A;  5F9L A;  5C5J A;  4DFJ A;  8ICK A;  3H37 A;  3TAR A;  4QW9 A;  3HW8 A;  4IQT A;  5KFP A;  3KHH A;  2R8G A;  2P6R A;  4R65 A;  1U9L A;  4DQI A;  1ZQV A;  5HC9 A;  4J9M A;  3RJE A;  4E8F A;  3MR6 A;  2ASL A;  1TFR A;  4RQ4 A;  2NRT A;  5KFB A;  2VA8 A;  4M6W B;  4ED7 A;  1QSS A;  4NXZ A;  5DBC A;  3MR5 A;  5J0U A;  1RZT A;  1BPX A;  3RRG A;  1MIV A;  5D4B A;  1MIW A;  4RNM A;  5DLF A;  5DLG A;  8ICV A;  4UAZ A;  3OVA A;  4F8R A;  4UB4 A;  3MBY A;  3ISC A;  1SL1 A;  4WC3 A;  2C2D A;  2F1I A;  3KHL A;  2RDI A;  3AU2 A;  4FHV A;  4KN7 A;  1JIH A;  1NKB A;  1NK0 A;  4QZ9 A;  3JPT A;  4DLG A;  5IIL A;  1JX4 A;  2NRV A;  3L9D A;  3T5L A;  3ISB A;  4FH5 A;  3B0Y A;  8ICH A;  3C23 A;  4KLT A;  5L1L A;  1BNO A;  4NLG A;  4O0I A;  4QZD A;  4P2H A;  3H40 A;  4IQU A;  3OHA A;  1U49 A;  5CHG A;  1RYS A;  1MQ2 A;  1SKW A;  5KFS A;  4GC7 A;  3G6V A;  1U45 A;  4YXM A;  4J9P A;  4Z6F A;  3QE9 Y;  1TK8 A;  8ICF A;  3SI8 A;  5DED A;  1XO1 A;  2BPC A;  4EBE A;  1HUO A;  5F9N A;  4MFA A;  3TFR A;  4ECQ A;  4RNO A;  4DSF A;  5KG0 A;  3C1Z A;  1NOM A;  5HP4 A;  5J29 A;  2BDP A;  1COO A;  4FHW A;  1ZQF A;  4HYK A;  4PGY A;  1S0M A;  5DG8 A;  2XC9 A;  5KTQ A;  2R8K A;  3H4D A;  3M8R A;  3C2M A;  5KFH A;  4ED0 A;  1KLN A;  4NM1 A;  3M9O B;  7ICF A;  1JXL A;  7ICN A;  5KG3 A;  8ICA A;  3OSP A;  3RB3 A;  3UQ0 A;  5III A;  1NKE A;  1KFD A;  2RDJ A;  8ICW A;  4TUR A;  5KFN A;  4YR2 A;  2IHM A;  4AT9 B;  5J2G A;  3MR2 A;  1ZQJ A;  5DB6 A;  3TAQ A;  5HRH A;  8ICY A;  3JPQ A;  7ICK A;  2MUT B;  2BCU A;  8ICE A;  4EBC A;  1ZQB A;  3RBE A;  1ZQL A;  3OJU A;  4M9L A;  1ZQX A;  2FPL A;  1Q78 A;  2ZH6 A;  3PO4 A;  4B9V A;  2RFF A;  1JN3 A;  1DK2 A;  3H7I A;  3T5J A;  7ICS A;  4LZD A;  1A76 A;  4M9J A;  4WC5 A;  2HHT A;  1Z3E B;  2ZUB A;  4Z6D A;  2M2U A;  5HRE A;  4DLE A;  4RQ0 A;  1S9F A;  4KLD A;  3OV7 A;  2XY5 A;  1QTM A;  4X4O A;  2B21 A;  3BQ1 A;  2PFN A;  1HJP A;  4MFC A;  2M2T A;  9ICM A;  2XGP A;  4KLJ A;  3N4M B;  1BPE A;  5L1K A;  5CB1 A;  2HVI A;  2V4R A;  5KFW A;  4DOC A;  4WC2 A;  4F4K A;  4DL4 A;  1U47 A;  3FDS A;  3Q8M A;  4DQQ A;  3PW0 A;  4M6W A;  4DEZ A;  4M9N A;  3Q8K A;  2W9A A;  4ECS A;  3RAQ A;  4J9K A;  4B9N A;  1XU4 A;  4UBC A;  3NTU A;  5BOL A;  1ARO P;  4UB1 A;  3UQ2 A;  1ZQS A;  4BWJ A;  8ICL A;  4X0A A;  2C2R A;  1V4A A;  1NK5 A;  4BGD A;  8ICB A;  4UBB A;  4X4P A;  8ICN A;  2BCS A;  8ICO A;  3TI0 A;  4LVS A;  1UEU A;  4RWO A;  3ZDA A;  4IR1 A;  4O5C A;  1ZQC A;  5J0Q A;  1V9P A;  3FYH A;  4JUZ A;  5KT7 A;  4UAW A;  4DFP A;  4KLU A;  3QZ8 A;  3RB4 A;  2FPM A;  4XRH A;  5BOM A;  3AQM A;  3QEB Z;  4EBK A;  7ICR A;  5KFF A;  4R64 A;  3GV8 B;  3PW4 A;  4NLZ A;  2XGQ A;  5KFJ A;  2BQR A;  5CA7 A;  4XQ7 A;  8ICC A;  1A77 A;  5JUM A;  3PR4 A;  3RBD A;  3AQN A;  3JPO A;  4DO9 A;  2KZ3 A;  4QZA A;  1ZQG A;  4QWE A;  2O1P A;  4RWP A;  4X4N A;  4GXK A;  4K4H A;  5DKW A;  8ICJ A;  3PX0 A;  4YFK A;  1NJY A;  2HHV A;  1S76 D;  4BWM A;  4RWN A;  1JMS A;  4Q8F A;  2NRW A;  4K4G A;  3PW2 A;  1RYR A;  1KDH A;  2PBE A;  2O5A A;  5DB8 A;  2BQU A;  3ZDB A;  4QZH A;  9ICI A;  4UQG A;  4KLM A;  3V6J A;  3JYY A;  3ZDE A;  2WTF A;  9ICR A;  4QZC A;  5J0X A;  1BPZ A;  4MF2 A;  5J2F A;  3PX6 A;  2V9W A;  4QZE A;  4JK1 A;  3Q8R B;  3QEA Z;  4FBT A;  4I2H A;  2J6S A;  2UVR A;  4QWB A;  1SZP A;  2W8K A;  5IIO A;  4C8O A;  3MR3 A;  1WOT A;  4X4V A;  1JQR A;  4F92 B;  5KT2 A;  5KFM A;  4FS1 A;  3RR8 A;  5KG7 A;  1BPB A;  4O3Q A;  4DSJ A;  4LT6 A;  2BR0 A;  4AT9 A;  2ISP A;  3BDP A;  9ICO A;  4PGX A;  4LZG A;  4ECV A;  3RJJ A;  3UXP A;  4I2I A;  4F3O A;  2ZH8 A;  2MUT A;  1XS9 D;  4QWA A;  5IIM A;  1ZJN A;  4RPY A;  2DRA A;  4ECT A;  3TAN A;  3GV7 B;  7ICU A;  1MIY A;  1QLN A;  2DR7 A;  2UVU A;  3BQT A;  4I2A A;  4F5N A;  3T5H A;  5KFL A;  4ATB B;  4MEX A;  5D46 A;  1TVA A;  4DQP A;  4O3S A;  3GIJ A;  3Q8S B;  1JAJ A;  2H5X A;  5KFQ A;  3WFO A;  3RRH A;  2ASD A;  2FLP A;  3GQC A;  3M9N B;  3NGD A;  2FMP A;  3RR7 A;  4I2B A;  8ICR A;  1ZQY A;  1IM4 A;  3C5F A;  3HX0 A;  4DF4 A;  1T7P A;  9ICS A;  4KLO A;  2ZH2 A;  2DPI A;  3WFQ E;  5L1I A;  4DL3 A;  3GIK A;  1QSL A;  4RU9 A;  1PZN A;  5KFC A;  5J0O A;  3BJY A;  1Z00 B;  2AJQ A;  1DK3 A;  4TQS A;  4IQW A;  2NRK A;  4WBZ A;  2MAX A;  4EP7 A;  4P4M A;  4DQR A;  4DL6 A;  4RQ3 A;  1Q79 A;  4P4O A;  1TK0 A;  3OHB A;  4Q44 A;  3KHG A;  4RQ8 A;  4DFM A;  4UAY A;  2OWO A;  1R8B A;  1IXR A;  1KRP A;  4FHP A;  3MGI A;  3H4B A;  4F4X A;  2BPG A;  4NLK A;  2ZJ5 A;  8ICQ A;  1LV5 A;  9ICT A;  4ECY A;  2DR9 A;  5KT5 A;  2HW3 A;  1NJZ A;  4QZG A;  4F5Q A;  4F4Z A;  2R8J A;  2ZHB A;  2VA2 A;  4ECZ A;  1ZQH A;  2BCR A;  1T8E A;  4I2E A;  2DRB A;  3MFH A;  2R8H A;  8ICI A;  4PHP A;  2FMS A;  4QZI A;  4FH3 A;  5L9X A;  1ZQA A;  2JEJ A;  2JZB B;  1NJW A;  4TUS A;  3H8W A;  3V6K A;  3JPP A;  3RH5 A;  4F2R A;  4RQ1 A;  1WCN A;  4ELV A;  7ICL A;  1TFW A;  4UB2 A;  3ISD A;  5CR0 A;  9ICJ A;  4BDP A;  4C8K A;  3N97 B;  2BCQ A;  4EZ6 A;  3WFP A;  2FLN A;  4I2D A;  4YXJ A;  1EXN A;  4JV2 A;  4XA5 A;  4F4W A;  3K75 D;  2IMW P;  4NM2 A;  4M5D A;  4B9M A;  7ICV A;  1B22 A;  5KG2 A;  4ECW A;  4YD1 A;  3EPI A;  4RQ6 A;  4M0A A;  4DOB A;  4Q45 A;  2FPK A;  4NY8 A;  4RPX A;  4KN4 A;  3MDA A;  3RJH A;  5HMM A;  3ZDC A;  1F5A A;  4KLH A;  1BNP A;  1KTQ A;  1L3T A;  4M47 A;  5DEC A;  2ZHA A;  4QZ8 A;  3B0X A;  2AGQ A;  3PW5 A;  3RB0 A;  3GFK B;  4Q8E A;  2HVH A;  5DG9 A;  2C22 A;  2AGO A;  3GIM A;  4YD2 A;  4Z6E A;  4ECU A;  5DB9 A;  3PMN A;  2ISO A;  4E80 A;  1SKR A;  4TUQ A;  1XWL A;  3OUY A;  5DB7 A;  1BVS A;  4J9Q A;  5J0T A;  3OVS A;  3ZD9 A;  2W9M A;  1PX5 A;  4EYI B;  5J2J A;  1OU5 A;  2ZH3 A;  4DL2 A;  3MDC A;  2C2E A;  2W9B B;  4YG2 A;  2FLL A;  4ED1 A;  5KG6 A;  4F2S A;  4I2F A;  5J0R A;  5J2H A;  4GLX A;  1CEZ A;  2Q66 A;  4YQW A;  3EPG A;  2ZTE A;  4KLL A;  7ICT A;  5KFZ A;  2J6U A;  2PI4 A;  4QW8 A;  4I29 A;  8ICP A;  2BKE A;  3G6X A;  5KFV A;  3EWA A;  3GDX A;  3EYZ A;  1WCL A;  1TAU A;  9ICV A;  4B9S A;  4ATB A;  4KMU A;  5HHI A;  3T5K A;  1UT5 A;  4DL5 A;  3C5G A;  1C7Y A;  2BPF A;  4F5R A;  4KLI A;  7ICG A;  5HRG A;  1B43 A;  4X4U A;  9ICX A;  4X4T A;  4NLN A;  1MQ3 A;  2AU0 A;  5DBB A;  3AQK A;  4UD4 A;  4O3R A;  4EBD A;  4PH5 A;  1XSL A;  5DG7 A;  3HJ4 A;  2XCP A;  5KFX A;  5KG1 A;  3HPO A;  5KFT A;  2R8I A;  4AT8 B;  2PFQ A;  1Z00 A;  4F5P A;  3UPQ A;  9ICW A;  4O9M A;  2KN7 A;  5EWG A;  9ICN A;  1YLQ A;  9ICC A;  4ED3 A;  4EEY A;  5KFO A;  1L5U A;  4K4I A; 
#chains in the Genus database with same CATH topology
 1UET A;  1V85 A;  4I28 A;  2ZH4 A;  5KFG A;  2PFP A;  3FC4 A;  1XSP A;  3I28 A;  1PVP A;  2DR5 A;  5AKI A;  4DS4 A;  5TIS U;  2K4E A;  5AIB A;  2JZB A;  4R66 A;  4MEY A;  1VFG A;  8ICM A;  1DOQ A;  2WB1 F;  4OJP A;  1S5L U;  2KJ5 A;  3LK9 A;  5ALF A;  4E7X A;  1K1S A;  4R8U B;  4F93 B;  1ZQD A;  2CXY A;  4FO6 A;  4I2J A;  2M9N A;  2M2V A;  2OYY A;  5J8Y C;  3PX4 A;  4EBJ A;  5HNK A;  3OSN A;  3BZC A;  3NAS A;  4I2G A;  1KFT A;  2I1Q A;  2QLT A;  1ZQW A;  1N48 A;  4CDG A;  2VA3 A;  3RAX A;  1X9X A;  4BUG A;  3IHQ B;  4EV6 A;  3F2D A;  3KHR A;  4KIT B;  2PKE A;  4B9L A;  5CHE A;  4PHE A;  2UVW A;  5IIJ A;  1U48 A;  5AKK A;  5CFU A;  3WKB A;  4QZB A;  3QX7 A;  3WFR E;  1NK8 A;  5IIN A;  4YVZ A;  4E0D A;  2K8A A;  1ZQI A;  4ELT A;  1SXD A;  4AT8 A;  1KQQ A;  2ZTC A;  3V72 A;  2K8B B;  5EWE A;  4DSL A;  3H38 A;  2JEG A;  4WC6 A;  4FS2 A;  2P66 A;  4Z6C A;  4IRD A;  1Z1B A;  2LMR A;  3TFS A;  5D61 A;  3OGU A;  4RT2 A;  1X6J A;  2DF4 B;  1ZQU A;  3QU7 A;  3C21 A;  2EAP A;  4QNL A;  4B9T A;  1QQ7 A;  4X5V A;  3N7P D;  4M2Y A;  4EEN A;  4DL7 A;  4YCX A;  2IHN A;  3ORY A;  3RJG A;  2JEI A;  2V4Q A;  1L7O A;  4R8U A;  1Q3V A;  3UXN A;  4JV1 A;  4O69 A;  3UM9 A;  1NJX A;  5DDM A;  4O68 A;  2WAQ F;  4RUA A;  4YR0 A;  4DCC A;  5AI9 A;  2ZH1 A;  2Q0Z X;  1TKD A;  2GLE A;  2F44 A;  1ED1 A;  4YMM A;  4J9O A;  5J0Y A;  4MKP A;  2FDR A;  4UB3 A;  1NKC A;  2NO4 A;  1H38 A;  1FFV A;  3EW9 A;  4QWD A;  1NK9 A;  4Y2X A;  2F8K A;  2KD1 A;  5B3Q A;  5KFK A;  3AN1 A;  3RTV A;  4WC7 A;  2ASJ A;  2PFO A;  5KT3 A;  2KZM A;  3QUT A;  5KT4 A;  1UA1 A;  2PMZ C;  1QQ5 A;  2RLT A;  5KFI A;  4R63 A;  5DGA A;  4RZR A;  4WJ3 B;  1ZQN A;  2B56 A;  3H39 A;  4KX5 A;  2DFL A;  1X9S A;  2BGW A;  4YR3 A;  4S3N A;  4Y2J A;  2G08 A;  4DFK A;  1DGS A;  3GII A;  4JMU A;  3BQ0 A;  2IBK A;  3KTQ A;  5AKH A;  2ZUD A;  4CF5 A;  5C5J A;  4K96 A;  1N5W A;  3TAR A;  3H0M B;  3AQF A;  2P6R A;  2ASL A;  4JLX A;  4OAH A;  4RQ4 A;  5CEH A;  2KKV A;  2NRT A;  5KFB A;  2O6K A;  4ED7 A;  1MIV A;  5DBC A;  1BPX A;  1N60 A;  5AKX A;  3OVA A;  4UAZ A;  4F8R A;  3IRU A;  4WC3 A;  2C2D A;  4OJO A;  1SIJ A;  2F1I A;  1ECW A;  2E3T A;  2KNJ A;  2IUB A;  1FEZ A;  4QZ9 A;  1JX4 A;  3L9D A;  4FH5 A;  2NRV A;  2KE7 A;  8ICH A;  3C23 A;  4LEW A;  2KOB A;  1BNO A;  4NLG A;  3H40 A;  1GO3 F;  3WKC A;  5CHG A;  5KFS A;  4GC7 A;  3G6V A;  1M6Y A;  2KIV A;  1UQV A;  3QE9 Y;  1XO1 A;  4EBE A;  3TFR A;  4RNO A;  2E8P A;  5HP4 A;  2BDP A;  1ZQF A;  4HYK A;  5ALP A;  2R8K A;  3H4D A;  4ED0 A;  8ICA A;  3D2S A;  5KG3 A;  5C0Y A;  3UQ0 A;  1NKE A;  1Q46 A;  3NVZ A;  8ICW A;  3S6J A;  3ER9 B;  5KFN A;  1X6I A;  7ICK A;  2BCU A;  2HBL A;  3PO4 A;  4B9V A;  2H3F A;  2ZIU B;  3T5J A;  4LZD A;  1A76 A;  4M9J A;  2EQY A;  2G09 A;  4UAR A;  3IV6 A;  1S9F A;  5AM3 A;  4OO1 J;  1SB3 C;  2PFN A;  9ICM A;  1BPE A;  2HVI A;  5KFW A;  4DOC A;  3Q8M A;  3KOO A;  2HSZ A;  4Y2S A;  4B9N A;  4AP9 A;  2G5H B;  4UBC A;  1ARO P;  2F76 X;  1NK5 A;  1RM6 C;  5ALT A;  3TI0 A;  4DFP A;  3FYH A;  4KLU A;  2BDU A;  1J97 A;  5ALI A;  1HEK A;  3PW4 A;  5KFJ A;  4UAT A;  8ICC A;  3PR4 A;  4DO9 A;  3SR6 A;  4RWP A;  4RWN A;  1L7M A;  4Q8F A;  4K4G A;  1RYR A;  1D8B A;  5KL8 B;  2BQU A;  3ZDB A;  2GH1 A;  2K4H A;  4QZC A;  5J0X A;  1BPZ A;  3WK8 A;  2V9W A;  4JK1 A;  2UVR A;  3MR3 A;  4X4V A;  1IG6 A;  1F0M A;  5KT2 A;  5KG7 A;  4DSJ A;  4LT6 A;  1SV0 C;  3I76 A;  4LZG A;  1N2X A;  1DRG A;  2ZH8 A;  2G07 A;  1ZJN A;  3TAN A;  1QLN A;  2DR7 A;  2UVU A;  5EE9 A;  4F5N A;  2ZIU A;  4O3S A;  5KFQ A;  1O08 A;  5CRX A;  3NGD A;  4DF4 A;  3WFQ E;  2ZH2 A;  3BJY A;  1DK3 A;  4P4M A;  4RQ3 A;  5EE1 A;  2E1F A;  2Y0S F;  2YX8 A;  3L3F X;  4FHP A;  1SXE A;  4OJL A;  2R8J A;  1LKY B;  3F5A A;  1T8E A;  2DRB A;  2JHD A;  5G5G A;  3QUB A;  4FH3 A;  2YY6 A;  5L9X A;  3K1R B;  3NS1 A;  3RH5 A;  4ELV A;  7ICL A;  1TFW A;  3ISD A;  5CR0 A;  4WH5 A;  4EZ6 A;  2FLN A;  5AI0 A;  7ICV A;  1B22 A;  1TE2 A;  4M0A A;  3EPI A;  3WK7 A;  2B4V A;  2FPK A;  5HMM A;  1F5A A;  1KTQ A;  4QZ8 A;  2C22 A;  3AEV A;  1XWL A;  2HBM A;  5DB7 A;  5J0T A;  4LJX A;  2W9B B;  5J0R A;  2EAN A;  4KLL A;  5KFZ A;  2PI4 A;  4QW8 A;  4I29 A;  1KKX A;  4B9S A;  5HHI A;  3T5K A;  2BPF A;  7ICG A;  2K60 A;  4X4U A;  2AU0 A;  4NXU A;  2IOH A;  4UD4 A;  4EBD A;  4PH5 A;  4BJQ A;  5KFX A;  4CRX A;  3QUQ A;  2CRX A;  3UPQ A;  4ED3 A;  4EEY A;  4K4I A;  3M9M B;  4I2C A;  4RQ7 A;  3AQL A;  2XCA A;  5HRD A;  1LKY A;  2W3R A;  2DKX A;  4EEB A;  3G6Y A;  5ALG A;  2LYA A;  1ZQK A;  1RDF A;  2ES6 A;  2N1R A;  2BQ3 A;  1O03 A;  5ALV A;  3QZ7 A;  1UHU A;  4AYB C;  9ICA A;  5KT6 A;  3T79 A;  4RPZ A;  1KN5 A;  3KKA C;  5J2K A;  2M2W A;  2B51 A;  2NRX A;  4RQ5 A;  3AQE A;  7ICO A;  4NKU A;  3WKD A;  4KLG A;  5AK6 A;  1SGG A;  4O5K A;  4PHD A;  3C1Y A;  3K7D A;  3ETL A;  3HIL A;  2KFN A;  1TV9 A;  5AI4 A;  3IDW A;  4BXO B;  1RG6 A;  5E79 U;  2A1J B;  4WBY A;  5J8Y A;  1MC8 A;  4GXJ A;  5J0P A;  1NO5 A;  4OJ6 A;  2NO5 A;  5IIK A;  2W9B A;  8ICS A;  7ICI A;  1Y88 A;  2HOI A;  2AHO B;  4KLE A;  4GXI A;  3PNC A;  2BCV A;  5J2C A;  1QSY A;  1L8O A;  4JWM A;  2LKY A;  4YMO A;  3DDH A;  4IG8 A;  2BZF A;  3QU9 A;  1NK4 A;  8ICU A;  3ETR A;  5CP2 A;  2E8M A;  4OCZ A;  4DF8 A;  5EWF A;  3PHZ A;  5HR7 A;  2LBO A;  5J2E A;  5F2V O;  5KFY A;  2ALZ A;  5D49 A;  2IA6 A;  5HR9 A;  9ICH A;  3C28 A;  2L5Y A;  3F53 A;  4XQ8 A;  1TFY A;  4UB8 U;  2PI5 A;  4J9S A;  1C20 A;  4O3N A;  4I0U A;  4C8N A;  3HP6 A;  1N56 A;  4JWN A;  3F5E A;  2G06 A;  4OD0 A;  4PHA A;  3SYZ A;  4KLS A;  4NV0 A;  3SEN A;  4O5E A;  5J0S A;  2XO7 A;  2F77 X;  1B4F A;  5HHH A;  4NLC A;  2W03 A;  5EOZ A;  2ZH9 A;  4IC9 A;  3V7K A;  3SAH A;  4TUP A;  3TQ1 A;  2H3V A;  3MAB A;  2B6G A;  3WU2 U;  4F50 A;  4BXO A;  2F2A B;  2A1J A;  9ICG A;  7ICP A;  4ECR A;  2ZH5 A;  2HHS A;  1ZQR A;  2DPJ A;  1U4B A;  3K1Z A;  4NXV A;  2FMQ A;  3PVX A;  9ICF A;  1ZQ1 C;  4WC4 A;  4ED8 A;  4JV0 A;  1NK6 A;  3MCR A;  3PY8 A;  3Q8L A;  3A0B U;  2ATL A;  4ED2 A;  1S97 A;  9ICP A;  5DGB A;  1TAQ A;  8ICX A;  2LPE A;  3CNH A;  5DQG A;  1LB2 B;  1KNY A;  5KFD A;  3PO5 A;  1XC9 A;  2ZJ8 A;  4HX0 A;  4KLQ A;  5HRI A;  4AYB F;  5J2A A;  1ZJM A;  3CP8 A;  5ALL A;  2D3D A;  1L3S A;  5CFT A;  3NVW A;  3NVV A;  3AU6 A;  2A19 A;  2KIC A;  4DFJ A;  2MU2 A;  2XVT A;  5AI6 A;  2HBJ A;  5GTI U;  4QW9 A;  3CYM A;  3HW8 A;  5KFP A;  3KHH A;  4R65 A;  2KKP A;  3CK6 A;  2VA8 A;  1PK3 A;  3RRG A;  3MR5 A;  2H3I A;  5J0U A;  5D4B A;  4RNM A;  2GAF D;  3VC8 A;  8ICV A;  3NKU A;  4UB4 A;  3MBY A;  3GU3 A;  3KHL A;  1JI7 A;  2W11 A;  2RDI A;  2QAR B;  2JMG A;  1JIH A;  3JPT A;  3SD7 A;  4KLT A;  5L1L A;  2JH1 A;  4O0I A;  4QZD A;  4EEL A;  2OM6 A;  1FO4 A;  1MQ2 A;  1SKW A;  1PUZ A;  4J9P A;  4Z6F A;  8ICF A;  3SI8 A;  2BPC A;  1HUO A;  4ECQ A;  4KX3 A;  5KG0 A;  3ZI4 A;  2E8O A;  4FHW A;  2W7O A;  3C2M A;  1KLN A;  2DWQ A;  3PSP A;  1JXL A;  4KB6 A;  3ONN A;  1V38 A;  4WOY A;  2WF9 A;  1SWV A;  4EX6 A;  5DB6 A;  1ZQJ A;  2D6F C;  4PZO A;  2DBY A;  2HCF A;  5ALE A;  1ZQX A;  2FPL A;  2RFF A;  3GZF A;  1URJ A;  1A6S A;  5ALU A;  4WC5 A;  1Z3E B;  2YMM A;  2M2U A;  2YB1 A;  2XY5 A;  4X4O A;  2M2T A;  4CE6 A;  4WC2 A;  4DL4 A;  3FDS A;  3PW0 A;  1QCK A;  3QU5 A;  4J9K A;  5AHX A;  1ZD2 P;  1RQN A;  2WHE A;  3PZP A;  2HOQ A;  5ALW A;  2C2R A;  4BGD A;  1L8L A;  3ERC C;  4UBB A;  2QAR A;  8ICO A;  1UEU A;  4NL9 A;  4XRH A;  3QEB Z;  5KFF A;  2NYV A;  3HKZ C;  2XGQ A;  4Y2Q A;  5CA7 A;  4XQ7 A;  3RBD A;  3AQN A;  4KMO B;  3WKA A;  2O1P A;  3I1Y A;  4XJE A;  4K4H A;  2HHV A;  2DGZ A;  2W43 A;  1L7P A;  3MGV A;  4BX9 C;  2NRW A;  2PBE A;  2H3Z A;  3PW2 A;  1KDH A;  2QB0 B;  9ICI A;  2WTF A;  9ICR A;  4MF2 A;  4I2H A;  1WOT A;  3ED5 A;  3RFA A;  4C8O A;  4U6P A;  2AH5 A;  2ZXH A;  2EWR A;  4FS1 A;  2DL0 A;  1Z19 A;  4C0Z A;  2ISP A;  3BDP A;  5FP0 A;  5G5H A;  3UXP A;  3RJJ A;  4F3O A;  4USA A;  1XS9 D;  5IIM A;  1SV0 A;  2B0C A;  7ICU A;  2DRA A;  1TAM A;  2ZIX B;  1VJ5 A;  4Y2T A;  3ICX A;  3T5H A;  4MEX A;  5D46 A;  3RRH A;  3GQC A;  4I2B A;  3IG5 A;  1ZQY A;  2HN2 A;  1T7P A;  9ICS A;  4KLO A;  5L1I A;  4DL3 A;  2AJQ A;  5AI8 A;  2YMQ A;  4TQS A;  2MAX A;  4DQR A;  4DL6 A;  2JV3 A;  1Q79 A;  1MN8 A;  3KHG A;  3UMC A;  4RQ8 A;  4UAY A;  1R8B A;  1IXR A;  8ICQ A;  4UW9 A;  2ZJ5 A;  1LV5 A;  2DR9 A;  4K97 A;  2HW3 A;  3PSF A;  1UPH A;  5KAF U;  2BCR A;  2R8H A;  4QZI A;  3DEE A;  2JEJ A;  1NJW A;  3JPP A;  4F2R A;  2GOL A;  1OW5 A;  9ICJ A;  4BDP A;  2E8N A;  2W55 A;  2BCQ A;  3AL0 B;  1EXN A;  4JV2 A;  4F4W A;  2IMW P;  3AMZ A;  4OJ5 A;  2EZY A;  4NY8 A;  4FE3 A;  4RPX A;  4KN4 A;  3BS5 B;  4KLH A;  1L3T A;  5DEC A;  3JCF A;  4Q8E A;  1PK1 B;  2WF5 A;  5KAI U;  2QB0 A;  5D62 A;  5D63 A;  4ECU A;  2ISO A;  2KHQ A;  2RRD A;  1PX5 A;  4G9B A;  3KBB A;  5J2J A;  2ZH3 A;  4DL2 A;  2C2E A;  3H8M A;  2FLL A;  5KG6 A;  2Q66 A;  1CEZ A;  3EPG A;  8ICP A;  2ZIX A;  2DQN B;  3EWA A;  5KFV A;  3GDX A;  1TAU A;  4KMU A;  1C7Y A;  4X4T A;  4NL9 C;  1MQ3 A;  5DBB A;  3HJ4 A;  2CN1 A;  2R8I A;  4F5P A;  9ICW A;  2KN7 A;  5KFO A;  4M9G A;  2ZJA A;  5DQH A;  2YTU A;  4CF3 A;  2ZUC A;  3PR5 B;  3M8S A;  3QU2 A;  3WFS C;  4QZF A;  5EE3 A;  5L1J A;  5EE0 A;  4DSK A;  1RPL A;  2PMZ F;  3V6H A;  3Q8Q B;  1MSW D;  4PPX A;  4B9U A;  3HKZ F;  3N28 A;  2P6U A;  4NWI A;  3KZI U;  1J2N A;  4IRK A;  5HRL A;  4M9H A;  9ICL A;  4C8M A;  3UMB A;  4AT7 B;  3AM9 A;  3HJ1 A;  4QWC A;  8ICT A;  5KFR A;  3JPS A;  3TAP A;  3CRX A;  4WC0 A;  3BS5 A;  3KKA A;  1ZQE A;  3H3A A;  7ICJ A;  1PK1 A;  4IRC A;  3H8J A;  4NXT A;  2KP7 A;  3R9K A;  2MSN A;  4FHY A;  1WWU A;  2BHN A;  1A0P A;  1NNL A;  1ZOL A;  3LWL A;  3E2E A;  4RNN A;  7ICH A;  5GTH U;  1XSN A;  1L6N A;  2AXT U;  2GWS A;  5HRB A;  2F3N A;  2XY7 A;  4M04 A;  5AIA A;  2ODG A;  4KM5 A;  2BE3 A;  4F4Y A;  1X42 A;  5DBA A;  4RQ2 A;  4LEZ A;  2JEF A;  3LQC B;  2DVI A;  2E5S A;  2A3V A;  4UD5 A;  4O3O A;  5J2D A;  3SV3 A;  4KLF A;  1QH9 A;  4DWI A;  5ALN A;  1S0O A;  4X4Q A;  2ZH7 A;  1NZP A;  4WCW A;  1R8A A;  4EEK A;  3TAD C;  2KFZ A;  4J03 A;  4MFF A;  2RHF A;  1K1Q A;  2HHP A;  4A8E A;  4K8V A;  4NKT A;  4X4R A;  3NRZ A;  1XNS A;  3HT3 A;  4UAS A;  1B0X A;  5B5E U;  1X2I A;  4ED6 A;  1YZ6 A;  3C2K A;  5B66 U;  4O3P A;  3GIL A;  3RJI A;  3OWG A;  4DSE A;  1L3V A;  5KFA A;  4AT7 A;  2K4I A;  1UEV A;  3U26 A;  5HRK A;  4FBU A;  5ALM A;  4DS5 A;  3MGH A;  1ZQQ A;  1RQL A;  5J2B A;  2J6T A;  1N5X A;  4P4P A;  5TZV A;  3RH6 A;  4C7Z A;  4IL6 U;  2KMD A;  2NRZ A;  4GC6 A;  1CRX A;  2W7P A;  3V7L A;  4I27 A;  2Y1I A;  3RH4 A;  4CNQ A;  4N7R A;  3M7D A;  1VJ7 A;  1VLB A;  3HJE A;  2M0N A;  5CJ7 A;  9ICB A;  1SL2 A;  1RXW A;  5KG5 A;  3BQ2 A;  1BPY A;  1COK A;  2EZZ A;  3HWT A;  3UPS A;  2F8L A;  3C29 A;  3MFI A;  2D8C A;  3JZ0 A;  3H8S A;  3V7J A;  1Q8K A;  4ECX A;  3ALR A;  1ZQM A;  3ZDD A;  2KEY A;  4UB6 U;  1S10 A;  2KHV A;  3SQI A;  7ICQ A;  4ZOH C;  5F3X B;  5J2I A;  3LDA A;  3M6K A;  4OAF A;  3THV A;  2XY6 A;  4OAG A;  4Q43 A;  1S0N A;  2W3S A;  5JTG A;  2WB1 C;  4RUC A;  2HHX A;  3HRD D;  1D9D A;  1R89 A;  4UB5 A;  2W8L A;  1JRP A;  3NVO A;  1SZH A;  8ICK A;  4FO1 A;  3WK9 A;  1Q3U A;  2R8G A;  1U9L A;  1T94 A;  1ZQV A;  5ALH A;  4E8F A;  1TFR A;  1ZD5 A;  4FZM A;  3QXG A;  2DKZ A;  3L4P A;  1QSS A;  4RQM A;  1RZT A;  3F2B A;  5DLF A;  2VIX A;  3ISC A;  1SL1 A;  1WUD A;  4JB3 A;  4FHV A;  1X66 A;  4KN7 A;  3SMV A;  1NKB A;  1NK0 A;  5IIL A;  3LYS A;  3T5L A;  3ISB A;  3B0Y A;  1KW4 A;  4MHV A;  1X40 A;  4P2H A;  1VDV A;  3OHA A;  1U49 A;  1U45 A;  4YXM A;  3LVW A;  2NV3 A;  5ALQ A;  1S8O A;  5F9N A;  5KL1 B;  4MFA A;  2A1A A;  3C1Z A;  1NOM A;  5J29 A;  1COO A;  4Y2V A;  3BQ7 A;  5DG8 A;  1YT3 A;  4NM1 A;  7ICF A;  5KFH A;  3M9O B;  3OSP A;  2WFA A;  3RB3 A;  1KFD A;  5AM0 A;  4TUR A;  3PSI A;  4Y2Y A;  2IHM A;  4AT9 B;  5HRH A;  3TAQ A;  8ICY A;  3JPQ A;  2MUT B;  8ICE A;  2XID A;  1ZQB A;  1FIQ A;  3OJU A;  4M9L A;  1Q78 A;  2ZH6 A;  2WF6 A;  4US8 A;  1DK2 A;  1KBU A;  2LI6 A;  2HHT A;  1GPJ A;  2Y9T A;  4Z6D A;  5HRE A;  3OTQ A;  4C4T A;  4KLD A;  1QTM A;  4MFC A;  2HN1 A;  2XGP A;  4KLJ A;  1J2M A;  3N4M B;  5CB1 A;  2V4R A;  1HIW A;  4F4K A;  2P35 A;  2HDO A;  4DEZ A;  2ZIW B;  1Z1V A;  4M9N A;  5ALX A;  2HBK A;  2HMX A;  1WYG A;  2Z7J A;  1Z4O A;  2I6X A;  1XU4 A;  3NTU A;  2IOF K;  4UB1 A;  8ICL A;  1ZQS A;  1V4A A;  8ICB A;  2GA9 D;  2VJ4 A;  4X4P A;  8ICN A;  4PJ0 U;  4LVS A;  4RWO A;  1S77 D;  1V9P A;  5KT7 A;  2FPM A;  3AQM A;  4EBK A;  7ICR A;  3GV8 B;  2FE9 A;  2BQR A;  1A77 A;  1AQ6 A;  4O67 A;  5JTI A;  4QZA A;  4X4N A;  4QWE A;  4YFK A;  1S76 D;  1JMS A;  2O5A A;  5DB8 A;  4UQG A;  2IOF A;  5KNI A;  3ZDE A;  3PX6 A;  4QZE A;  3HIY A;  3QEA Z;  4QWB A;  1SZP A;  2W8K A;  5IIO A;  1JQR A;  5CFS A;  5KFM A;  1BPB A;  2KV2 A;  4AT9 A;  1LVH A;  1ZRN A;  9ICO A;  4PGX A;  2EH9 A;  5AKJ A;  4I2I A;  2MUT A;  4FZN A;  4QWA A;  2LM1 A;  5A0L A;  4RPY A;  1MIY A;  3GV7 B;  3BQT A;  5KFL A;  4ATB B;  5HR6 A;  1JAJ A;  3GIJ A;  2H5X A;  3WFO A;  2ASD A;  2OHF A;  3M9N B;  5ALY A;  3RR7 A;  1IM4 A;  3HX0 A;  3GIK A;  4RU9 A;  1PZN A;  1Z00 B;  2NRK A;  4EP7 A;  4IQW A;  4FZL A;  2LYB A;  4P4O A;  2JRZ A;  2YMP A;  3IG8 A;  3BZK A;  2OWO A;  2ZIW A;  1KRP A;  3MGI A;  2BPG A;  4NLK A;  4ECY A;  5KT5 A;  1NJZ A;  4F4Z A;  4F5Q A;  4UAV A;  2YQE A;  1ZQH A;  2BBJ A;  2OH2 A;  8ICI A;  2FMS A;  4WQK A;  5AM4 A;  4TUS A;  4P0P B;  3H8W A;  4U7C A;  1WCN A;  4C7Y A;  4PZN A;  3WFP A;  4K99 A;  3KZX A;  4I2D A;  4YXJ A;  3K75 D;  4M5D A;  4NM2 A;  4B9M A;  5KG2 A;  3EF2 A;  4ECW A;  4RQ6 A;  2IHO A;  3D2N A;  2K4P A;  3MDA A;  2MRL A;  3QYP A;  1MA7 A;  2AGQ A;  3PW5 A;  2RP5 A;  5AIC A;  3RB0 A;  2K8C B;  3GIM A;  2FJ6 A;  3NWI A;  4NLB A;  3J81 j;  5DB9 A;  4E80 A;  2ZXI A;  3SAF A;  4TUQ A;  1T3Q A;  3OVS A;  4EYI B;  4OAI Z;  2H3Q A;  3MDC A;  3B9J A;  4I2F A;  5J2H A;  4GLX A;  4YQW A;  2ZTE A;  7ICT A;  2J6U A;  2Q4T A;  2KK0 A;  3G6X A;  3EYZ A;  4B6J A;  4ATB A;  8ICR A;  4DL5 A;  3C5G A;  4KLI A;  4F5R A;  1B43 A;  9ICX A;  4NLN A;  3AQK A;  2OCE A;  2XCP A;  3HPO A;  1DXS A;  5KG1 A;  4ICA A;  2PFQ A;  1Z00 A;  3E0F A;  3RR8 A;  3UXO A;  2WF7 A;  3GV5 B;  3C66 A;  3UMG A;  4YN4 A;  3LWM A;  2ESE A;  2G5I B;  2HHU A;  4X4S A;  5DDY A;  3K4G A;  1UA0 A;  1X9M A;  2K89 A;  1SWW A;  1UT8 A;  1L7N A;  1D8L A;  4J9L A;  4P0P A;  3CW2 C;  4QIW C;  5J0W A;  4PGQ A;  3SAG A;  4DFD A;  2JR5 A;  4F91 B;  2G0A A;  1FA0 A;  1X9W A;  3C18 A;  3T3F A;  3WKE A;  1CI4 A;  4DOA A;  4NXW A;  4MF8 A;  5CWR A;  4FHX A;  4CGZ A;  1T3N A;  4DQS A;  1TK5 A;  1HUZ A;  3SV4 A;  9ICU A;  4KTQ A;  2CPR A;  2JH7 A;  7ICE A;  3E58 A;  4O3M A;  1QQ6 A;  2KTQ A;  1K5O A;  4C4R A;  3RJK A;  2KZZ A;  4C8L A;  2VJ5 A;  4IS7 A;  2AGP A;  4EYH B;  2QKQ A;  2VAN A;  9ICQ A;  3NYB A;  5HRF A;  5DQI A;  3EZ5 A;  4O6A A;  1BGX T;  1RYU A;  1KSP A;  4YMN A;  2KVS A;  3O0F A;  1NK7 A;  4XUS A;  2Y0S C;  5BPC A;  1ZQZ A;  2ID1 A;  3JPR A;  8ICG A;  1KEJ A;  2W9C B;  4C4S A;  9ICK A;  4DSI A;  2LYH A;  2ZTD A;  1CUK A;  4ELU A;  1S0V A;  2VKQ A;  1SL0 A;  1XO0 A;  2I9G A;  1SKS A;  2HHQ A;  5KFU A;  1ZET A;  3TAD A;  4G3I A;  4IQV A;  4ZH4 A;  4ACO A;  3RB6 A;  2C28 A;  1D8Y A;  3PV8 A;  1WG8 A;  1ZYQ A;  4IR9 A;  4JLZ A;  2F1J A;  4UAU A;  5KG4 A;  2EAM A;  4EZ9 A;  3Q8P B;  2HHW A;  1ZXI A;  3ZD8 A;  3PML A;  4J9R A;  4RWQ A;  5KFE A;  3N7R C;  1RXV A;  8ICZ A;  4F5O A;  3JPN A;  1D9F A;  2AQ4 A;  2F1H A;  2KVC A;  2XI9 A;  1WWV A;  5JU5 A;  3KFU F;  2AQ0 A;  3OJS A;  3RF9 A;  5ALR A;  4CCH A;  2KJ9 A;  4RT3 A;  3C2L A;  4F71 A;  3FM9 A;  2GO7 A;  3SZ2 A;  2UVV A;  1BPD A;  3IM1 A;  1T4G A;  4WC1 A;  2BBH A;  5T14 A;  5JRT A;  3PW7 A;  2FCL A;  4YP3 A;  2PXI A;  1KFS A;  2W9C A;  4EX7 A;  2DR8 A;  1IIP A;  4NXX A;  3RJF A;  5HML A;  2Y1J A;  2RQ5 A;  4QIW F;  4X0B A;  3AUO A;  7ICM A;  9ICE A;  1L3U A;  4CF4 A;  1ZQO A;  1DGJ A;  3OVB A;  5ALO A;  1PVR A;  4J9N A;  3TAC B;  1R8C A;  2ZG6 A;  3NVY A;  1JXE A;  1ZQT A;  1JAL A;  5AKE A;  1ZQP A;  4TQR A;  5F9L A;  3QNM A;  3H37 A;  1P7D A;  4IQT A;  4K98 A;  4DQI A;  3MC1 A;  4EGW A;  5HC9 A;  4J9M A;  3RJE A;  3MR6 A;  1Z4N A;  4M6W B;  4NXZ A;  5AM1 A;  1MIW A;  5DLG A;  2EDU A;  2OEH A;  5AKZ A;  3AU2 A;  3WK5 A;  4DLG A;  3NRW A;  3QUC A;  2EAO A;  4K9A A;  4IQU A;  1RYS A;  2W04 A;  5ALK A;  2KG5 A;  3BS7 A;  1TK8 A;  5DED A;  3LVV A;  1ZD3 A;  4DSF A;  5ALZ A;  1KL9 A;  5AI5 A;  4PGY A;  1S0M A;  3FAH A;  2XC9 A;  5KTQ A;  3M8R A;  2R18 A;  7ICN A;  3ER8 C;  5III A;  4EED A;  2RDJ A;  1V97 A;  2YML A;  1YZ7 A;  4YR2 A;  5J2G A;  3MR2 A;  2WF8 A;  3IP4 B;  4EBC A;  3RBE A;  1ZQL A;  3QU4 A;  1OXJ A;  4US9 A;  5AK5 A;  5H2F U;  1FFU A;  3H0L B;  3L5K A;  1JN3 A;  3H7I A;  7ICS A;  3A0H U;  2ZUB A;  4DLE A;  4RQ0 A;  3OV7 A;  2B21 A;  2LHT A;  3BQ1 A;  1HJP A;  4QJF B;  5L1K A;  2KJ8 A;  1U47 A;  4DQQ A;  4M6W A;  1N61 A;  3Q8K A;  3H0R B;  1N62 A;  3M1Y A;  2W9A A;  4ECS A;  3RAQ A;  3D2Q A;  3D6J A;  5BOL A;  4LEY A;  3UQ2 A;  4BWJ A;  4X0A A;  2KSO B;  2BCS A;  3PST A;  3TKA A;  3ZDA A;  4IR1 A;  1ZQC A;  5J0Q A;  4JUZ A;  4UAW A;  4HAI A;  3QZ8 A;  3RB4 A;  5B3P A;  3KD3 A;  5BOM A;  4R64 A;  4NLZ A;  3N7S C;  4GFJ A;  5JUM A;  3JPO A;  2KZ3 A;  1ZQG A;  4RQN A;  1JUD A;  4GXK A;  5DKW A;  8ICJ A;  3PX0 A;  1NJY A;  4BWM A;  5AM2 A;  2FI1 A;  4QZH A;  4KLM A;  3V6J A;  3JYY A;  1JRO A;  5J2F A;  4FBT A;  3OUY B;  3Q8R B;  4Y2R A;  3OPX A;  2J6S A;  2QB1 A;  4F92 B;  1F44 A;  4O3Q A;  2BR0 A;  3WK4 A;  4ECV A;  1PVQ A;  5K4L A;  2XIC A;  4ECT A;  4I2A A;  1TVA A;  4DQP A;  2MA1 A;  3Q8S B;  2JGA A;  2FLP A;  2FMP A;  2ZIV B;  3C5F A;  2DPI A;  5ALJ A;  1QSL A;  5KFC A;  5J0O A;  4Y2U A;  4WBZ A;  2HI0 A;  5AK4 A;  2YB4 A;  2DUY A;  4P0Q B;  1TK0 A;  3OHB A;  4Q44 A;  5ALD A;  3M6Z A;  4DFM A;  2LM4 A;  3VCB A;  5AKL A;  3H4B A;  4F4X A;  9ICT A;  2I5H A;  4QZG A;  2ZHB A;  3F2C A;  2VA2 A;  4WQL A;  4ECZ A;  4I2E A;  2E1E A;  3MFH A;  4PHP A;  4PL2 A;  2KSO A;  4FFD A;  1ZQA A;  2JZB B;  2KIW A;  3V6K A;  2W54 A;  4RQ1 A;  5L1M A;  4UB2 A;  4C8K A;  1IV8 A;  3N97 B;  2Y9U A;  1SV4 A;  4XA5 A;  4F72 A;  5AM5 A;  4YD1 A;  4DOB A;  4Q45 A;  2OXO A;  3RJH A;  3ZDC A;  1BNP A;  1NZB A;  3EUB 2;  1N63 A;  4M47 A;  2ZHA A;  4K9B A;  3B0X A;  3GFK B;  2HVH A;  5DG9 A;  2AGO A;  5AKG A;  4PL1 A;  4YD2 A;  2EZX A;  5AKY A;  3DV9 A;  4Z6E A;  1OUQ A;  5ALS A;  3OUY A;  3PMN A;  1SKR A;  1BVS A;  4J9Q A;  4NJ8 A;  3ZD9 A;  2W9M A;  1OU5 A;  4O5C A;  4YG2 A;  2WAQ C;  4ED1 A;  4F2S A;  5AK3 A;  4C80 A;  4GIB A;  4Y2P A;  3WK6 A;  2BKE A;  9ICV A;  2JXJ A;  1WCL A;  2YN4 A;  1UT5 A;  5HRG A;  2HOF A;  2ZIV A;  1NI3 A;  1UCV A;  3NUQ A;  4O3R A;  1XSL A;  5DG7 A;  5KFT A;  4AT8 B;  1ZD4 A;  3SEI A;  4O9M A;  1F5S A;  5EWG A;  9ICN A;  1YLQ A;  4LEV A;  9ICC A;  1ZRM A;  4P0Q A;  1L5U A;  3IN5 A; 
#chains in the Genus database with same CATH homology
 3UXO A;  4M9G A;  1UET A;  2ZJA A;  5DQH A;  4I28 A;  2ZH4 A;  3M9M B;  3GV5 B;  5KFG A;  4I2C A;  3C66 A;  2PFP A;  2ZUC A;  4RQ7 A;  3PR5 B;  3M8S A;  1XSP A;  4YN4 A;  3LWM A;  3AQL A;  3WFS C;  2XCA A;  4QZF A;  2HHU A;  5HRD A;  4X4S A;  2DR5 A;  5L1J A;  4DSK A;  5DDY A;  1RPL A;  4DS4 A;  3V6H A;  3K4G A;  3Q8Q B;  1MSW D;  3G6Y A;  1UA0 A;  1ZQK A;  1X9M A;  4PPX A;  4B9U A;  2BQ3 A;  1UT8 A;  2JZB A;  4R66 A;  2P6U A;  1D8L A;  4J9L A;  4MEY A;  4IRK A;  1VFG A;  5J0W A;  8ICM A;  5HRL A;  4PGQ A;  4M9H A;  3QZ7 A;  1DOQ A;  4F91 B;  9ICL A;  9ICA A;  1FA0 A;  4C8M A;  5KT6 A;  1X9W A;  3C18 A;  8ICT A;  4AT7 B;  3LK9 A;  3T3F A;  4RPZ A;  2M2W A;  5J2K A;  4E7X A;  1K1S A;  3HJ1 A;  4R8U B;  4QWC A;  2NRX A;  4F93 B;  4RQ5 A;  5KFR A;  3JPS A;  4DOA A;  4MF8 A;  5CWR A;  3TAP A;  1ZQD A;  4WC0 A;  7ICO A;  4NKU A;  4FHX A;  4FO6 A;  4KLG A;  4O5K A;  4I2J A;  1T3N A;  4PHD A;  1ZQE A;  4DQS A;  1TK5 A;  3H3A A;  2M9N A;  3C1Y A;  7ICJ A;  2M2V A;  4IRC A;  3H8J A;  3PX4 A;  1HUZ A;  3SV4 A;  9ICU A;  3ETL A;  5HNK A;  4KTQ A;  2KP7 A;  2KFN A;  7ICE A;  1TV9 A;  3OSN A;  4EBJ A;  4BXO B;  4I2G A;  4FHY A;  1KFT A;  2A1J B;  4WBY A;  1MC8 A;  4GXJ A;  2KTQ A;  2BHN A;  2I1Q A;  3LWL A;  3RJK A;  3E2E A;  4RNN A;  5J0P A;  1ZQW A;  1N48 A;  2KZZ A;  1XSN A;  4C8L A;  7ICH A;  5IIK A;  2W9B A;  3RAX A;  2VA3 A;  8ICS A;  2AGP A;  4EYH B;  3IHQ B;  2GWS A;  7ICI A;  5HRB A;  1Y88 A;  2XY7 A;  3KHR A;  4M04 A;  4KIT B;  2VAN A;  4KLE A;  4GXI A;  9ICQ A;  3PNC A;  4B9L A;  4PHE A;  4F4Y A;  2BCV A;  5IIJ A;  1U48 A;  2UVW A;  2BE3 A;  3NYB A;  5DBA A;  5J2C A;  4QZB A;  5HRF A;  5DQI A;  1QSY A;  3EZ5 A;  3WFR E;  1BGX T;  4RQ2 A;  1NK8 A;  1KSP A;  5IIN A;  4JWM A;  4YMN A;  4YVZ A;  4YMO A;  1NK7 A;  2JEF A;  4XUS A;  3LQC B;  4IG8 A;  5BPC A;  4E0D A;  2DVI A;  1ZQZ A;  1ZQI A;  2ID1 A;  4UD5 A;  3JPR A;  4ELT A;  4O3O A;  5J2D A;  4AT8 A;  3SV3 A;  1NK4 A;  1KEJ A;  4KLF A;  2ZTC A;  8ICG A;  2W9C B;  8ICU A;  4DWI A;  3V72 A;  5EWE A;  9ICK A;  4DSL A;  4DSI A;  5CP2 A;  2JEG A;  3H38 A;  2LYH A;  1S0O A;  4DF8 A;  2ZTD A;  1CUK A;  4ELU A;  4X4Q A;  1S0V A;  5EWF A;  4WC6 A;  1NZP A;  4WCW A;  4FS2 A;  2ZH7 A;  1R8A A;  1SL0 A;  2P66 A;  4Z6C A;  4IRD A;  5J2E A;  2KFZ A;  2I9G A;  3TFS A;  5F2V O;  5KFY A;  1SKS A;  4MFF A;  2HHQ A;  2ALZ A;  1K1Q A;  5KFU A;  3OGU A;  5D49 A;  2IA6 A;  1ZET A;  1S77 D;  5HR9 A;  9ICH A;  4RT2 A;  4NKT A;  4XQ8 A;  4G3I A;  4IQV A;  4X4R A;  1TFY A;  4ZH4 A;  3RB6 A;  3HT3 A;  2C28 A;  3PV8 A;  1D8Y A;  4J9S A;  2PI5 A;  1ZYQ A;  4IR9 A;  1X2I A;  2F1J A;  2HHP A;  4ED6 A;  4O3N A;  1ZQU A;  3C2K A;  4C8N A;  3C21 A;  3HP6 A;  1N56 A;  5KG4 A;  4O3P A;  4JWN A;  3GIL A;  3RJI A;  4B9T A;  4EZ9 A;  3Q8P B;  4PHA A;  3SYZ A;  4KLS A;  2HHW A;  4X5V A;  3ZD8 A;  3PML A;  4J9R A;  4DSE A;  1L3V A;  4M2Y A;  4DL7 A;  5KFA A;  4YCX A;  2IHN A;  4AT7 A;  3ORY A;  4RWQ A;  5KFE A;  1UEV A;  3RJG A;  4O5E A;  5J0S A;  2JEI A;  5HRK A;  2V4Q A;  1RXV A;  4FBU A;  2XO7 A;  4R8U A;  8ICZ A;  4DS5 A;  5HHH A;  3UXN A;  5EOZ A;  4F5O A;  4JV1 A;  3JPN A;  1NJX A;  3MGH A;  1D9F A;  2ZH9 A;  5DDM A;  3V7K A;  1ZQQ A;  5J2B A;  4TUP A;  3TQ1 A;  2J6T A;  2AQ4 A;  4P4P A;  4RUA A;  4YR0 A;  2F1H A;  5TZV A;  3MAB A;  3RH6 A;  4F50 A;  4BXO A;  2NRZ A;  2A1J A;  4GC6 A;  9ICG A;  2AQ0 A;  2ZH1 A;  3V7L A;  3OJS A;  2Y1I A;  4I27 A;  2Q0Z X;  3RH4 A;  7ICP A;  1TKD A;  4CCH A;  1VJ7 A;  4ECR A;  4RT3 A;  2ZH5 A;  2HHS A;  1ZQR A;  9ICB A;  5CJ7 A;  1SL2 A;  4YMM A;  4J9O A;  5KG5 A;  5J0Y A;  3C2L A;  1RXW A;  2DPJ A;  1U4B A;  3BQ2 A;  4UB3 A;  1NKC A;  1BPY A;  1H38 A;  2FMQ A;  3PVX A;  3EW9 A;  3SZ2 A;  4QWD A;  2UVV A;  3HWT A;  3UPS A;  1NK9 A;  1BPD A;  3IM1 A;  9ICF A;  4WC4 A;  1T4G A;  4ED8 A;  4WC1 A;  4JV0 A;  1NK6 A;  3PW7 A;  5KFK A;  3MFI A;  3RTV A;  3JZ0 A;  4WC7 A;  2ASJ A;  3H8S A;  5KT3 A;  3V7J A;  2PFO A;  3PY8 A;  2KZM A;  4ECX A;  4YP3 A;  2PXI A;  3Q8L A;  1KFS A;  2ATL A;  4ED2 A;  2W9C A;  1ZQM A;  1S97 A;  9ICP A;  5KT4 A;  5DGB A;  1UA1 A;  3ZDD A;  2DR8 A;  1TAQ A;  1S10 A;  8ICX A;  3RJF A;  5KFI A;  4R63 A;  5DGA A;  4RZR A;  7ICQ A;  1NO5 A;  3HIY A;  5J2I A;  3LDA A;  5DQG A;  1ZQN A;  5HML A;  2Y1J A;  1LB2 B;  5KFD A;  3THV A;  2XY6 A;  3PO5 A;  1KNY A;  1XC9 A;  4Q43 A;  4X0B A;  3AUO A;  2ZJ8 A;  3H39 A;  7ICM A;  9ICE A;  1S0N A;  2DFL A;  4KLQ A;  1L3U A;  5HRI A;  5J2A A;  1X9S A;  1ZJM A;  2BGW A;  4RUC A;  4YR3 A;  1L3S A;  1ZQO A;  4S3N A;  2HHX A;  3OVB A;  3OUY B;  4DFK A;  1DGS A;  4J9N A;  1D9D A;  3GII A;  1R8C A;  1R89 A;  3BQ0 A;  2IBK A;  4UB5 A;  2W8L A;  3KTQ A;  3AU6 A;  1JXE A;  1ZQT A;  2ZUD A;  1ZQP A;  4TQR A;  5F9L A;  5C5J A;  4DFJ A;  8ICK A;  3H37 A;  3TAR A;  4QW9 A;  3HW8 A;  4IQT A;  5KFP A;  3KHH A;  2R8G A;  2P6R A;  4R65 A;  1U9L A;  4DQI A;  1ZQV A;  5HC9 A;  4J9M A;  3RJE A;  4E8F A;  3MR6 A;  2ASL A;  1TFR A;  4RQ4 A;  2NRT A;  5KFB A;  2VA8 A;  4M6W B;  4ED7 A;  1QSS A;  4NXZ A;  5DBC A;  3MR5 A;  5J0U A;  1RZT A;  1BPX A;  3RRG A;  1MIV A;  5D4B A;  1MIW A;  4RNM A;  5DLF A;  5DLG A;  8ICV A;  4UAZ A;  3OVA A;  4F8R A;  4UB4 A;  3MBY A;  3ISC A;  1SL1 A;  4WC3 A;  2C2D A;  2F1I A;  3KHL A;  2RDI A;  3AU2 A;  4FHV A;  4KN7 A;  1JIH A;  1NKB A;  1NK0 A;  4QZ9 A;  3JPT A;  4DLG A;  5IIL A;  1JX4 A;  2NRV A;  3L9D A;  3T5L A;  3ISB A;  4FH5 A;  3B0Y A;  8ICH A;  3C23 A;  4KLT A;  5L1L A;  1BNO A;  4NLG A;  4O0I A;  4QZD A;  4P2H A;  3H40 A;  4IQU A;  3OHA A;  1U49 A;  5CHG A;  1RYS A;  1MQ2 A;  1SKW A;  5KFS A;  4GC7 A;  3G6V A;  1U45 A;  4YXM A;  4J9P A;  4Z6F A;  3QE9 Y;  1TK8 A;  8ICF A;  3SI8 A;  5DED A;  1XO1 A;  2BPC A;  4EBE A;  1HUO A;  5F9N A;  4MFA A;  3TFR A;  4ECQ A;  4RNO A;  4DSF A;  5KG0 A;  3C1Z A;  1NOM A;  5HP4 A;  5J29 A;  2BDP A;  1COO A;  4FHW A;  1ZQF A;  4HYK A;  4PGY A;  1S0M A;  5DG8 A;  2XC9 A;  5KTQ A;  2R8K A;  3H4D A;  3M8R A;  3C2M A;  5KFH A;  4ED0 A;  1KLN A;  4NM1 A;  3M9O B;  7ICF A;  1JXL A;  7ICN A;  5KG3 A;  8ICA A;  3OSP A;  3RB3 A;  3UQ0 A;  5III A;  1NKE A;  1KFD A;  2RDJ A;  8ICW A;  4TUR A;  5KFN A;  4YR2 A;  2IHM A;  4AT9 B;  5J2G A;  3MR2 A;  1ZQJ A;  5DB6 A;  3TAQ A;  5HRH A;  8ICY A;  3JPQ A;  7ICK A;  2MUT B;  2BCU A;  8ICE A;  4EBC A;  1ZQB A;  3RBE A;  1ZQL A;  3OJU A;  4M9L A;  1ZQX A;  2FPL A;  1Q78 A;  2ZH6 A;  3PO4 A;  4B9V A;  2RFF A;  1JN3 A;  1DK2 A;  3H7I A;  3T5J A;  7ICS A;  4LZD A;  1A76 A;  4M9J A;  4WC5 A;  2HHT A;  1Z3E B;  2ZUB A;  4Z6D A;  2M2U A;  5HRE A;  4DLE A;  4RQ0 A;  1S9F A;  4KLD A;  3OV7 A;  2XY5 A;  1QTM A;  4X4O A;  2B21 A;  3BQ1 A;  2PFN A;  1HJP A;  4MFC A;  2M2T A;  9ICM A;  2XGP A;  4KLJ A;  3N4M B;  1BPE A;  5L1K A;  5CB1 A;  2HVI A;  2V4R A;  5KFW A;  4DOC A;  4WC2 A;  4F4K A;  4DL4 A;  1U47 A;  3FDS A;  3Q8M A;  4DQQ A;  3PW0 A;  4M6W A;  4DEZ A;  4M9N A;  3Q8K A;  2W9A A;  4ECS A;  3RAQ A;  4J9K A;  4B9N A;  1XU4 A;  4UBC A;  3NTU A;  5BOL A;  1ARO P;  4UB1 A;  3UQ2 A;  1ZQS A;  4BWJ A;  8ICL A;  4X0A A;  2C2R A;  1V4A A;  1NK5 A;  4BGD A;  8ICB A;  4UBB A;  4X4P A;  8ICN A;  2BCS A;  8ICO A;  3TI0 A;  4LVS A;  1UEU A;  4RWO A;  3ZDA A;  4IR1 A;  4O5C A;  1ZQC A;  5J0Q A;  1V9P A;  3FYH A;  4JUZ A;  5KT7 A;  4UAW A;  4DFP A;  4KLU A;  3QZ8 A;  3RB4 A;  2FPM A;  4XRH A;  5BOM A;  3AQM A;  3QEB Z;  4EBK A;  7ICR A;  5KFF A;  4R64 A;  3GV8 B;  3PW4 A;  4NLZ A;  2XGQ A;  5KFJ A;  2BQR A;  5CA7 A;  4XQ7 A;  8ICC A;  1A77 A;  5JUM A;  3PR4 A;  3RBD A;  3AQN A;  3JPO A;  4DO9 A;  2KZ3 A;  4QZA A;  1ZQG A;  4QWE A;  2O1P A;  4RWP A;  4X4N A;  4GXK A;  4K4H A;  5DKW A;  8ICJ A;  3PX0 A;  4YFK A;  1NJY A;  2HHV A;  1S76 D;  4BWM A;  4RWN A;  1JMS A;  4Q8F A;  2NRW A;  4K4G A;  3PW2 A;  1RYR A;  1KDH A;  2PBE A;  2O5A A;  5DB8 A;  2BQU A;  3ZDB A;  4QZH A;  9ICI A;  4UQG A;  4KLM A;  3V6J A;  3JYY A;  3ZDE A;  2WTF A;  9ICR A;  4QZC A;  5J0X A;  1BPZ A;  4MF2 A;  5J2F A;  3PX6 A;  2V9W A;  4QZE A;  4JK1 A;  3Q8R B;  3QEA Z;  4FBT A;  4I2H A;  2J6S A;  2UVR A;  4QWB A;  1SZP A;  2W8K A;  5IIO A;  4C8O A;  3MR3 A;  1WOT A;  4X4V A;  1JQR A;  4F92 B;  5KT2 A;  5KFM A;  4FS1 A;  3RR8 A;  5KG7 A;  1BPB A;  4O3Q A;  4DSJ A;  4LT6 A;  2BR0 A;  4AT9 A;  2ISP A;  3BDP A;  9ICO A;  4PGX A;  4LZG A;  4ECV A;  3RJJ A;  3UXP A;  4I2I A;  4F3O A;  2ZH8 A;  2MUT A;  1XS9 D;  4QWA A;  5IIM A;  1ZJN A;  4RPY A;  2DRA A;  4ECT A;  3TAN A;  3GV7 B;  7ICU A;  1MIY A;  1QLN A;  2DR7 A;  2UVU A;  3BQT A;  4I2A A;  4F5N A;  3T5H A;  5KFL A;  4ATB B;  4MEX A;  5D46 A;  1TVA A;  4DQP A;  4O3S A;  3GIJ A;  3Q8S B;  1JAJ A;  2H5X A;  5KFQ A;  3WFO A;  3RRH A;  2ASD A;  2FLP A;  3GQC A;  3M9N B;  3NGD A;  2FMP A;  3RR7 A;  4I2B A;  8ICR A;  1ZQY A;  1IM4 A;  3C5F A;  3HX0 A;  4DF4 A;  1T7P A;  9ICS A;  4KLO A;  2ZH2 A;  2DPI A;  3WFQ E;  5L1I A;  4DL3 A;  3GIK A;  1QSL A;  4RU9 A;  1PZN A;  5KFC A;  5J0O A;  3BJY A;  1Z00 B;  2AJQ A;  1DK3 A;  4TQS A;  4IQW A;  2NRK A;  4WBZ A;  2MAX A;  4EP7 A;  4P4M A;  4DQR A;  4DL6 A;  4RQ3 A;  1Q79 A;  4P4O A;  1TK0 A;  3OHB A;  4Q44 A;  3KHG A;  4RQ8 A;  4DFM A;  4UAY A;  2OWO A;  1R8B A;  1IXR A;  1KRP A;  4FHP A;  3MGI A;  3H4B A;  4F4X A;  2BPG A;  4NLK A;  2ZJ5 A;  8ICQ A;  1LV5 A;  9ICT A;  4ECY A;  2DR9 A;  5KT5 A;  2HW3 A;  1NJZ A;  4QZG A;  4F5Q A;  4F4Z A;  2R8J A;  2ZHB A;  2VA2 A;  4ECZ A;  1ZQH A;  2BCR A;  1T8E A;  4I2E A;  2DRB A;  3MFH A;  2R8H A;  8ICI A;  4PHP A;  2FMS A;  4QZI A;  4FH3 A;  5L9X A;  1ZQA A;  2JEJ A;  2JZB B;  1NJW A;  4TUS A;  3H8W A;  3V6K A;  3JPP A;  3RH5 A;  4F2R A;  4RQ1 A;  1WCN A;  4ELV A;  7ICL A;  1TFW A;  4UB2 A;  3ISD A;  5CR0 A;  9ICJ A;  4BDP A;  4C8K A;  3N97 B;  2BCQ A;  4EZ6 A;  3WFP A;  2FLN A;  4I2D A;  4YXJ A;  1EXN A;  4JV2 A;  4XA5 A;  4F4W A;  3K75 D;  2IMW P;  4NM2 A;  4M5D A;  4B9M A;  7ICV A;  1B22 A;  5KG2 A;  4ECW A;  4YD1 A;  3EPI A;  4RQ6 A;  4M0A A;  4DOB A;  4Q45 A;  2FPK A;  4NY8 A;  4RPX A;  4KN4 A;  3MDA A;  3RJH A;  5HMM A;  3ZDC A;  1F5A A;  4KLH A;  1BNP A;  1KTQ A;  1L3T A;  4M47 A;  5DEC A;  2ZHA A;  4QZ8 A;  3B0X A;  2AGQ A;  3PW5 A;  3RB0 A;  3GFK B;  4Q8E A;  2HVH A;  5DG9 A;  2C22 A;  2AGO A;  3GIM A;  4YD2 A;  4Z6E A;  4ECU A;  5DB9 A;  3PMN A;  2ISO A;  4E80 A;  1SKR A;  4TUQ A;  1XWL A;  3OUY A;  5DB7 A;  1BVS A;  4J9Q A;  5J0T A;  3OVS A;  3ZD9 A;  2W9M A;  1PX5 A;  4EYI B;  5J2J A;  1OU5 A;  2ZH3 A;  4DL2 A;  3MDC A;  2C2E A;  2W9B B;  4YG2 A;  2FLL A;  4ED1 A;  5KG6 A;  4F2S A;  4I2F A;  5J0R A;  5J2H A;  4GLX A;  1CEZ A;  2Q66 A;  4YQW A;  3EPG A;  2ZTE A;  4KLL A;  7ICT A;  5KFZ A;  2J6U A;  2PI4 A;  4QW8 A;  4I29 A;  8ICP A;  2BKE A;  3G6X A;  5KFV A;  3EWA A;  3GDX A;  3EYZ A;  1WCL A;  1TAU A;  9ICV A;  4B9S A;  4ATB A;  4KMU A;  5HHI A;  3T5K A;  1UT5 A;  4DL5 A;  3C5G A;  1C7Y A;  2BPF A;  4F5R A;  4KLI A;  7ICG A;  5HRG A;  1B43 A;  4X4U A;  9ICX A;  4X4T A;  4NLN A;  1MQ3 A;  2AU0 A;  5DBB A;  3AQK A;  4UD4 A;  4O3R A;  4EBD A;  4PH5 A;  1XSL A;  5DG7 A;  3HJ4 A;  2XCP A;  5KFX A;  5KG1 A;  3HPO A;  5KFT A;  2R8I A;  4AT8 B;  2PFQ A;  1Z00 A;  4F5P A;  3UPQ A;  9ICW A;  4O9M A;  2KN7 A;  5EWG A;  9ICN A;  1YLQ A;  9ICC A;  4ED3 A;  4EEY A;  5KFO A;  1L5U A;  4K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...