4Z6DA

Structure of human dna polymerase beta 279na mutant complexed with g in the template base paired with incoming non-hydrolyzable ttp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFAKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the effect of minor groove interactions and metal cofactors on mutagenic replication by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4z6dA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4z6dA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4z6dA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4z6dA03
4RQ2A 1MC8A 2W9CA 4O3OA 4RWNA 5HNKA 2NRVA 3JPPA 4DL4A 1ZQDA 5KT5A 2ZJ8A 1BPYA 3Q8SB 4DSEA 1EXNA 3V6KA 1XSNA 4O5EA 4RPYA 1TK5A 4RPZA 4EYIB 2NRWA 3FYHA 5J0PA 5KT7A 1RZTA 2RDJA 3TFRA 5KG5A 1ZQWA 3LQCB 4YD2A 7ICHA 8ICYA 4G3IA 2AQ0A 5IIJA 4WBZA 3UXOA 4F4XA 2XCAA 5HRIA 3PW5A 3JPQA 3ZD8A 1BPDA 4ECTA 3Q8KA 4YXJA 5F9LA 4NY8A 4J9OA 4PHPA 7ICFA 2P6RA 3MFHA 1SKSA 4M9GA 7ICNA 8ICLA 5DGBA 4YG2A 3RB4A 2IBKA 3RJJA 3C1ZA 4I28A 9ICFA 4DO9A 1ZQZA 2MAXA 4IRDA 4I2CA 3L9DA 4DFJA 2J6SA 3V7LA 3RH4A 2J6TA 3PO5A 4ATBA 1V9PA 4RT2A 2JEFA 1OU5A 7ICQA 2NRTA 2W9BB 1NK4A 5HREA 3ZDBA 3TFSA 4X4QA 4MFFA 2ZH1A 2JEGA 2R8IA 2UVUA 2P6UA 4K4IA 5DB6A 3MFIA 3V6HA 4B9LA 4KLFA 8ICEA 2JEIA 2HHUA 2O5AA 5KFEA 5HC9A 5DB7A 3N97B 4DL7A 3ZD9A 3RJIA 8ICJA 3UQ0A 4X0AA 4X5VA 4JWMA 5IILA 2AGOA 4K4GA 3HX0A 1NK8A 2FLNA 2M2TA 4DQPA 4NLGA 4KLJA 4LT6A 3UPSA 1D8YA 4Q8FA 1XWLA 4GXJA 3WFQE 1SL1A 2PI5A 1S76D 5CB1A 4ECWA 4DF4A 8ICPA 2R8HA 5J2DA 4ELTA 1XO1A 5HR9A 3TANA 4UAWA 4QZGA 4DOAA 5C5JA 1X9WA 4WC5A 4FS1A 5HMLA 3M8SA 2XY5A 3QE9Y 2BQRA 3OV7A 5J2JA 2JEJA 1BVSA 5L1KA 4DSFA 3C2LA 2LYHA 4I2IA 1TFYA 4Q45A 3AU6A 8ICXA 5JUMA 3MGIA 8ICCA 4YQWA 2Q66A 2W9BA 3HJ4A 4DQRA 3IHQB 5KG7A 4RNOA 4MFAA 4F5OA 2ZH8A 1JMSA 4KLMA 8ICOA 4FO6A 1TAUA 2Q0ZX 2AGPA 1HUOA 4M9NA 4Z6DA 4F93B 1UA0A 4IG8A 4X4VA 9ICNA 4YMNA 8ICQA 1TAQA 5KG1A 4RUCA 4BWJA 4J9KA 9ICBA 1X2IA 5KFZA 3GIIA 3N4MB 4X4TA 4DL6A 4YR2A 3RB6A 4DOBA 4TQRA 4RQ8A 3OSPA 2FMQA 3AQNA 3UXNA 5KT2A 2XCPA 3PX6A 3LWMA 4EZ6A 7ICPA 5J0RA 1K1SA 1ZQXA 4UAYA 4RWQA 4RQ7A 3PW7A 2W9CB 4RQ1A 1MSWD 5HRDA 4P4MA 2ZH5A 4MEXA 4QZHA 3ISDA 4JV1A 5BOMA 4YCXA 2F1HA 1VFGA 5D4BA 3K75D 4O3RA 3GIMA 2BGWA 1UT5A 3H8SA 4E7XA 3GQCA 4TURA 1KFTA 3QZ7A 2BCSA 4AT9B 9ICAA 4UB1A 3C2KA 4KLDA 4EZ9A 4X4UA 3RAXA 2DR9A 4RQ5A 9ICWA 1U9LA 3GV7B 4O0IA 4J9LA 4BXOA 5F2VO 4E0DA 4KLTA 2XY6A 4JWNA 3KHLA 3T5HA 1ZYQA 4YR3A 2BPGA 5CHGA 1U48A 4YD1A 3E2EA 4QZIA 5HRGA 1SKWA 9ICCA 1MIYA 7ICKA 4KLUA 1ZQPA 2DPIA 4M47A 4F50A 4RPXA 4FHXA 4J9NA 3KTQA 3TAQA 3T5KA 5DGAA 2RFFA 1S9FA 5DKWA 9ICHA 3RJKA 4J9MA 1IM4A 2HHSA 2OWOA 2BKEA 4I2HA 5KFUA 3QZ8A 3OJUA 2DFLA 5IINA 3QEAZ 5HRKA 2PBEA 3H38A 2UVVA 5KFYA 1R8CA 1ZQQA 5D49A 1ZQEA 7ICOA 4QWEA 3MDCA 4QZBA 5KFBA 4K4HA 1IXRA 5HMMA 4Q43A 5KFSA 3M8RA 1JX4A 4KITB 1JIHA 4QW8A 5KG2A 2BQ3A 5J2IA 2WTFA 2ASJA 4X0BA 4C8MA 4F3OA 4MFCA 4YP3A 4ED2A 2ISPA 3SV4A 5IIIA 4F4KA 1ZQLA 3JPNA 5DB8A 3C21A 3EPGA 4JV0A 1PZNA 4ECUA 3RH5A 1U47A 1R89A 3WFPA 4WC4A 4RU9A 1T4GA 4WC2A 4O3QA 3JZ0A 1DOQA 4DOCA 5J2AA 1RYRA 4IRCA 4LVSA 2ISOA 2MUTB 2KFNA 2C22A 5J29A 3MGHA 2AJQA 5EWGA 2BCUA 4KLLA 5J2GA 4R65A 4PGXA 4I2FA 5HRHA 3WFRE 1HJPA 4GC6A 3TARA 1H38A 4I2BA 4F5RA 1UA1A 3H4DA 3V72A 1ZQFA 8ICKA 1ZQYA 1B22A 4EEYA 4GC7A 4KN7A 1D8LA 3OJSA 4QZEA 1Q78A 4JK1A 5EWFA 4DWIA 4KLEA 2I1QA 1QLNA 1JAJA 2J6UA 4EBKA 1RYSA 9ICLA 4Z6FA 4UB3A 5BPCA 1ZQNA 4ECQA 2FLPA 3HT3A 3THVA 9ICXA 2PFPA 3ETLA 1UT8A 1TFRA 1Z00A 3H40A 4DFKA 2H5XA 2PFQA 5KTQA 3M9OB 4MF8A 3RR8A 4FBTA 3PY8A 4AT9A 2VANA 2M9NA 7ICUA 3RR7A 7ICJA 2W8LA 4F92B 1ZQRA 3EZ5A 3KHRA 4F5QA 3JPTA 1NZPA 1YLQA 4AT8A 2ZH9A 3H3AA 1XSLA 4ED6A 1L5UA 2R8GA 3RH6A 3AQMA 3TI0A 4B9NA 4UB4A 1KFDA 4TUQA 3NGDA 2ZHBA 4DQQA 1QSSA 3RBDA 8ICWA 1ZQOA 3KHHA 4FHYA 3PX0A 4NLZA 4EBJA 2BQUA 1T3NA 5KFJA 3T5JA 3PW0A 4I29A 2M2VA 2FLLA 2IHMA 4X4OA 3BQ2A 4ECRA 2FPMA 4FHVA 8ICGA 3IM1A 1QSYA 2I9GA 5IIKA 3G6YA 1ZQJA 4ELVA 3M9NB 2MUTA 4YVZA 2W8KA 5L1IA 4ECXA 5KFOA 3G6XA 1WOTA 1K1QA 3OUYB 3ISCA 3MABA 1NK5A 3ZDAA 1Z00B 4M2YA 8ICNA 1SZPA 5J0QA 1SL2A 5J0TA 3RJHA 4M6WB 2KTQA 2KZMA 3WFOA 2VA8A 1S0OA 1B43A 4PGQA 5F9NA 5KFMA 5KG3A 1TVAA 4J9SA 4PH5A 2C2RA 2R8JA 4Z6CA 4C8NA 4QZ8A 4DQIA 1NO5A 2ZH6A 3JPSA 2C2DA 9ICUA 2DR8A 2ZTCA 2AQ4A 4NLNA 3C5FA 3AQLA 3C1YA 4RNNA 5KFFA 8ICUA 2XC9A 2PI4A 4XRHA 3QEBZ 1TK0A 3UPQA 3KHGA 1NOMA 1TK8A 3RAQA 2ZJAA 3AU2A 4DS5A 3BDPA 4X4RA 4QWBA 4IQUA 4O5CA 3NYBA 3WFSC 2HW3A 5EWEA 3OSNA 2BDPA 1BGXT 4QWDA 8ICFA 2IA6A 4QWCA 5KT6A 4XQ8A 3G6VA 5L9XA 3FDSA 3K4GA 3LDAA 4QWAA 4ECYA 1S10A 2BPFA 1MQ3A 4UBCA 3RJFA 4CCHA 5KFIA 4DSJA 3H8WA 1NK6A 5DBBA 7ICSA 4UD4A 4E80A 4KN4A 1NK7A 4QZCA 4I2EA 2KZZA 4DF8A 1KRPA 3V7KA 5DG9A 4ED8A 1WCLA 3JYYA 5KFVA 4TQSA 4RQ6A 4AT7B 5HP4A 5J2EA 4F2RA 4WC7A 4IQTA 1NJYA 5TZVA 1F5AA 2IMWP 4LZGA 4PHEA 3AUOA 3EWAA 5DDYA 3PR5B 1KLNA 1TKDA 4C8KA 4M9HA 2KP7A 2BE3A 1BPEA 2DPJA 3LK9A 4GXIA 2AU0A 1FA0A 4B9MA 4GLXA 4NKTA 4NXZA 2ZHAA 4ZH4A 1NKEA 2KN7A 1ZQMA 3GV5B 1NJXA 5DQIA 3HWTA 1A77A 1ZQUA 3MBYA 2Y1JA 9ICGA 4WC3A 2HHPA 5IIOA 4RZRA 3Q8RB 4F5NA 1ZJMA 4AT7A 3PV8A 5D46A 5KFNA 3M9MB 3SZ2A 4BDPA 4C8OA 1KTQA 4Z6EA 7ICGA 3UQ2A 1QSLA 4NLKA 2PFNA 5BOLA 2ZUCA 4UB5A 5KFTA 2ASDA 8ICTA 2M2UA 2ATLA 3V7JA 9ICEA 1DK2A 5KFKA 4PPXA 5J0SA 4R8UB 3JPRA 3MDAA 4ED3A 4FHPA 1ZQCA 2V9WA 3HPOA 3MR6A 4RQ3A 4KLSA 7ICTA 1BPBA 5J0UA 2XO7A 9ICTA 1UEVA 3HIYA 3OUYA 2ZJ5A 5HHIA 7ICIA 1KFSA 9ICQA 2DVIA 1NJZA 5KT4A 1R8AA 4QZAA 2PXIA 4ED0A 2VA3A 4KLOA 4KLHA 2HVIA 5KG0A 5KFCA 2V4RA 5J2FA 4DQSA 2XY7A 4IRKA 3ORYA 4BGDA 3V6JA 1XSPA 1QTMA 3OVBA 7ICRA 4RNMA 2XGQA 4EBDA 2BCQA 5DB9A 5KFLA 3C66A 4WC6A 5J2BA 4J9PA 1DK3A 4Q44A 1V4AA 5CR0A 3RRHA 4RWOA 4IR1A 2VA2A 2ZH4A 2HHXA 4UD5A 1ZQTA 2P66A 9ICSA 2AGQA 1D9DA 1JQRA 1D9FA 4KLIA 5CP2A 5KT3A 1MIVA 7ICMA 4M04A 2R8KA 3SYZA 4ECZA 4EP7A 5J0WA 2ID1A 5DG8A 3RRGA 5J0YA 4RUAA 3Q8LA 3Q8MA 4C8LA 4RQ4A 4X4PA 4IQWA 2ZUBA 1AROP 1KDHA 2HHQA 3HP6A 4KLGA 3UXPA 2ZH3A 2BHNA 3JPOA 5L1JA 4ATBB 4AT8B 1ZQGA 4J9RA 4KTQA 1XU4A 4DLEA 4B9TA 4KMUA 2F1JA 4E8FA 4NKUA 1ZQKA 4XUSA 4DFPA 4M9JA 2HHVA 5EOZA 1Y88A 3BQTA 3H7IA 4P4OA 2BCVA 4DSKA 4IR9A 4O3SA 1S77D 4XQ7A 4QZDA 2ALZA 8ICVA 4EBEA 4ECSA 1UEUA 7ICVA 5DBCA 9ICJA 5KFQA 4BWMA 5KFHA 3PW4A 4B9VA 4ECVA 1N56A 4F2SA 3C18A 3EW9A 3H4BA 5DBAA 3C5GA 3PVXA 4WC0A 2KFZA 3HW8A 3HJ1A 3RB3A 4M5DA 1U49A 4F91B 3RTVA 8ICAA 1MQ2A 1L3VA 1ZQSA 5KFXA 4F4YA 1S0NA 3H8JA 1ZJNA 2UVRA 2C2EA 3PMLA 5HRLA 4WCWA 1ZQVA 2B21A 4O3NA 4UBBA 3Q8QB 4YMOA 9ICMA 2UVWA 1DGSA 3T5LA 2FMPA 2BR0A 2W9MA 9ICVA 1T7PA 2M2WA 1T8EA 2O1PA 5KFPA 4R63A 1NKBA 5J0XA 3PMNA 1NKCA 1BPZA 2DRAA 5CJ7A 5DECA 2BCRA 2F1IA 4DLGA 4JUZA 4YN4A 3EYZA 3SV3A 1UETA 3OGUA 4DL5A 4WC1A 1S0MA 1NK0A 2ASLA 3BQ1A 4FH3A 4RWPA 2KZ3A 2V4QA 2C28A 4MEYA 1JXLA 5DDMA 2ZH2A 4DL3A 1LV5A 4B9SA 1HUZA 3OHBA 3PX4A 2JZBB 2HHTA 4R66A 3GIJA 3RBEA 1L3UA 2FPLA 1KEJA 1Z3EB 3BJYA 4FH5A 4QZ9A 2Y1IA 1CUKA 4PGYA 4KLQA 4NM1A 1SKRA 8ICIA 1X9MA 1ZQAA 2HHWA 1S0VA 4TUSA 5DLFA 4RQ0A 7ICLA 3GILA 2NRXA 3PW2A 3MR5A 3B0XA 1VJ7A 1ZETA 3RJGA 3H37A 9ICPA 4NM2A 3ZDDA 2FPKA 3MR2A 4Q8EA 8ICSA 1N48A 4YMMA 4TUPA 3RJEA 1CEZA 4O9MA 1R8BA 4DFMA 4EBCA 2PFOA 4I2GA 4JV2A 9ICIA 3AQKA 9ICRA 4UB2A 4WBYA 1BNPA 1JXEA 4J9QA 1TV9A 4YR0A 1C7YA 3MR3A 1KSPA 2DR7A 1NK9A 4FS2A 4I2DA 3TAPA 4M0AA 3OVSA 2FMSA 3TQ1A 4ED7A 4PHDA 3PO4A 4F8RA 1MIWA 5KFRA 5DEDA 2ZH7A 1S97A 1BPXA 4F4ZA 9ICOA 8ICHA 1BNOA 3PR4A 2IHNA 3LWLA 1NJWA 2A1JA 4O3PA 5HRBA 4X4SA 5KFGA 3C2MA 1XC9A 5J2CA 4ED1A 3RB0A 2XGPA 1XS9D 4LZDA 4IQVA 2RDIA 4R8UA 5DQGA 1JN3A 5IIMA 4GXKA 1RXWA 3NTUA 4R64A 3GV8B 4S3NA 2ZTEA 4PHAA 4DSLA 1L3TA 4RT3A 2DR5A 2HVHA 3GDXA 4M6WA 5HHHA 4FHWA 1A76A 1KNYA 4QZFA 8ICRA 2BPCA 1WCNA 8ICMA 1PX5A 2ZTDA 4DL2A 1U45A 1LB2B 4I2JA 5L1LA 4DEZA 2A1JB 3ISBA 2W9AA 1Q79A 5DQHA 1ZQIA 5CA7A 4F4WA 1SL0A 1L3SA 4UQGA 5KFWA 8ICZA 4EYHB 3OVAA 4P4PA 4M9LA 4I2AA 1TFWA 2GWSA 4MF2A 5DLGA 2DRBA 3PNCA 3C23A 1RXVA 4O5KA 1X9SA 2JZBA 5DG7A 5J0OA 2ZUDA 4P2HA 3GFKB 9ICKA 7ICEA 1ZQBA 5KG6A 3T3FA 1RPLA 2NRZA 3B0YA 1COOA 4YXMA 4FBUA 4DSIA 1ZQHA 4F5PA 4QW9A 4B9UA 4BXOB 3BQ0A 5J2KA 3Q8PB 5HRFA 1U4BA 5KFDA 4DS4A 4X4NA 4HYKA 5J2HA 4XA5A 2NRKA 5KFAA 3OHAA 3GIKA 4YFKA 3H39A 4UAZA 3ZDCA 4I27A 5CWRA 8ICBA 3ZDEA 5KG4A 3EPIA 3SI8A 4ELUA
chains in the Genus database with same CATH superfamily
4O3OA 4OAIZ 1ZQDA 1EXNA 1XSNA 4RPZA 3UM9A 4I0UA 5KT7A 1RZTA 2RDJA 3LQCB 2OHFA 8ICYA 2VJ4A 5JTIA 2HDOA 2WB1C 8ICOA 3JYYA 3ZD8A 1BPDA 3AQFA 3Q8KA 4YXJA 2KK0A 4J9OA 2P6RA 1SKSA 5DGBA 4USAA 9ICFA 3C1ZA 1UHUA 3NRZA 3V7LA 3RH4A 4RT2A 2JEFA 3L5KA 3ZDBA 3TFSA 4MHVA 2JEGA 2R8IA 2UVUA 4DL7A 3C28A 3ZD9A 8ICJA 1URJA 4X5VA 4JWMA 2AGOA 4K4GA 3HX0A 4KLJA 5AKGA 4LT6A 5ALLA 4O67A 4QIWF 5CB1A 3PSIA 5AKIA 2EZXA 1FFVA 4Y2YA 4CF5A 2K60A 2YTUA 3QUTA 4DOAA 5C5JA 3QUBA 4FS1A 5HMLA 4HX0A 3OV7A 2ESEA 2Q4TA 2LYHA 3TADC 4OAFA 2KNJA 3MGIA 3N7SC 8ICCA 2Q66A 2W9BA 4DQRA 1N5XA 5KG7A 4F5OA 4UAUA 4KLMA 1TAUA 4F93B 4X4VA 9ICNA 1ZD4A 3M7DA 9ICBA 3NS1A 2KIWA 4DL6A 4YR2A 3RB6A 3UMGA 3PX6A 3LWMA 1A0PA 1ZQXA 4UAYA 1N61A 1MSWD 2W9CB 3E58A 4P4MA 2ZH5A 4QZHA 4O3MA 4JV1A 5BOMA 2F1HA 5D4BA 2BGWA 3H8SA 5AK4A 4E7XA 3QZ7A 1DRGA 4UB1A 4X4UA 4K9BA 3GV7B 4J9LA 2DL0A 4KLTA 2XY6A 4JWNA 3HKZC 4YD1A 3CYMA 4M47A 4F50A 4FHXA 4J9NA 3KTQA 3TAQA 3T5KA 2RFFA 2K8AA 4I2HA 2DFLA 3HILA 3SMVA 2UVVA 5KFYA 5D49A 1ZQEA 4QZBA 2H3ZA 2VKQA 4K4HA 5HMMA 5L1MA 2GLEA 1JX4A 3NWIA 1JIHA 5KG2A 2MA1A 2BQ3A 2WTFA 2ASJA 4C8MA 4NLCA 5KAFU 3SV4A 2QLTA 2DUYA 3JPNA 1U47A 1PZNA 3WFPA 1R89A 1ZD5A 1JRPA 2O6KA 2MUTB 1K5OA 5EWGA 3WFRE 4GC6A 3TARA 1H38A 4WC1A 8ICKA 3H4DA 1WWVA 3ER8C 4GC7A 1D8LA 4QZEA 2DKZA 3BZCA 2B56A 3F2DA 3THVA 2KE7A 2PFPA 3H40A 3RR8A 5AM4A 3PY8A 7ICUA 5EE0A 3EZ5A 4UW9A 1YLQA 1L5UA 2R8GA 4NWIA 4UB4A 2JH7A 2ES6A 1QSSA 3KHHA 3PX0A 5ALMA 3PW0A 3T5JA 4X4OA 2M2VA 2IHMA 4ECRA 3T79A 4FHVA 2JR5A 2E8MA 4YVZA 3IG8A 3OUYB 1K1QA 5CFTA 5CFUA 3MABA 2CN1A 5J0QA 4LEZA 2KZMA 2VA8A 4QNLA 1B43A 1S0OA 1QQ7A 1SXEA 2R8JA 2F2AB 9ICUA 2DQNB 2AQ4A 3C1YA 2PI4A 3SEIA 5CEHA 2F8LA 3WFSC 3OSNA 3UMCA 2IA6A 4QWCA 5L9XA 3LDAA 1MQ3A 4UBCA 1NK6A 5G5HA 7ICSA 1NK7A 4QZCA 4I2EA 4DF8A 5AK3A 4NL9A 4Y2SA 5DG9A 3A0BU 2IMWP 4QIWC 1KLNA 4M9HA 2BE3A 1OXJA 3IRUA 3OPXA 2W43A 1NKEA 5KL1B 1NJXA 5DQIA 1ZQUA 2Y9TA 4C7ZA 2HHPA 3MC1A 1Z1VA 1XNSA 4AT7A 3PV8A 2H3IA 4C8OA 3BZKA 5H2FU 5ALWA 1UPHA 3SR6A 3LYSA 2RRDA 3SD7A 3ERCC 4R8UB 3MDAA 3LVVA 2V9WA 2HBKA 1BPBA 9ICTA 4BX9C 5HHIA 5ALDA 2E1EA 4ED0A 1B0XA 2HVIA 1JUDA 2E8OA 4K96A 2V4RA 5J2FA 1XSPA 2XGQA 2BCQA 1DK3A 1V4AA 2KVCA 5CR0A 4IR1A 2VA2A 1QCKA 4Y2JA 2AGQA 5CP2A 5KT3A 1MIVA 4FO1A 4Y2VA 3SYZA 2AH5A 5J0YA 3RRGA 3Q8LA 3Q8MA 5AK5A 4RQ4A 2KSOB 2HHQA 1AROP 3HP6A 2LYBA 4KLGA 2RP5A 2ZH3A 2BHNA 3JPOA 2B51A 1LVHA 4NKUA 2W3RA 4P4OA 4O3SA 3KZIU 4K98A 1TFYA 3PVXA 1X6JA 3H8JA 1F5SA 2G5IB 2ZG6A 1NI3A 1QQ5A 4UBBA 3Q8QB 2FE9A 2WF7A 2Y0SF 4YMOA 2FMPA 1NNLA 1T8EA 1BPZA 5ALIA 5J0XA 3PMNA 2E5SA 1A6SA 2JRZA 5ALHA 4JUZA 4YN4A 3OGUA 3BQ1A 2V4QA 5JRTA 1KKXA 3OHBA 3PX4A 2HHTA 3GIJA 1JROA 1KEJA 4PGYA 2EANA 3PW2A 3WKBA 3RJGA 3H37A 3VC8A 4Q8EA 3AQNA 3IV6A 4AT8B 4O9MA 4EBCA 3AQKA 4EENA 9ICRA 2IOHA 1BNPA 2XICA 1C7YA 1T3QA 2EAPA 4KM5A 4M0AA 1SXDA 3OVSA 4F8RA 1ZD3A 4PHDA 4ED7A 3EF2A 4F4ZA 3PR4A 2LKYA 1LKYA 5AICA 2KEYA 4ED1A 4C7YA 2ZIXA 2XGPA 4LZDA 3QNMA 4IQVA 2RDIA 4R8UA 2ZIUA 1RXWA 3NTUA 2NO5A 4R64A 3GV8B 4PHAA 4DSLA 4RT3A 5GTHU 3IN5A 2HVHA 4M6WA 1KNYA 2OH2A 3NVVA 1PX5A 1HEKA 1L8LA 1LB2B 2A1JB 3ISBA 2HOQA 1ZQIA 5AKEA 5KFWA 4KB6A 5AIBA 5ALEA 3NVOA 5DLGA 3C23A 4O5KA 2IUBA 2IOFK 5AHXA 1ZQBA 1RPLA 3B0YA 4UASA 1COOA 3DV9A 4YXMA 2KHVA 4DSIA 4PZNA 3BQ0A 3ONNA 5E79U 3Q8PB 5HRFA 4X4NA 4DS4A 3NUQA 4HYKA 1UCVA 2NRKA 3OHAA 5AI0A 2EWRA 4EX7A 1S5LU 4RQ2A 4RWNA 1KBUA 1L7NA 5HNKA 2NRVA 1B4FA 2ZJ8A 3Q8SB 4DSEA 3V6KA 4O5EA 1TK5A 2G0AA 4DFDA 3TFRA 4WBZA 3PW5A 4ECTA 4US8A 3MFHA 7ICNA 5ALOA 4YG2A 3RJJA 2MAXA 4IRDA 1N62A 3L9DA 4DFJA 3IP4B 5ALNA 1V9PA 3ER9B 2XVTA 1X9XA 7ICQA 2W9BB 2DKXA 1Z4OA 4MFFA 3D2QA 3PSPA 2P6UA 5DB6A 8ICEA 2KMDA 2ZIWB 2JEIA 2YB4A 1IIPA 1F0MA 5DB7A 5HC9A 1TAMA 3UQ0A 2WFAA 4P0QA 5IILA 3C29A 4DQPA 1XWLA 4HAIA 1N60A 4DF4A 1WWUA 2PMZC 5J2DA 2LHTA 1X66A 3TANA 1GO3F 2HBJA 2XY5A 2E3TA 5AM2A 1C20A 2K8BB 4I2IA 4Y2QA 2JXJA 4Q45A 4G9BA 4LJXA 8ICXA 1X40A 4YQWA 5AKZA 2LYAA 1V85A 4KMOB 8ICQA 1QQ6A 1TAQA 5D63A 3FC4A 4X4TA 3WKEA 2LM1A 4Y2TA 5KT2A 5J0RA 4RWQA 3PW7A 4RQ1A 4AYBC 1VFGA 4O3RA 2QB0A 4TURA 1KFTA 3SENA 2BCSA 3C2KA 4KLDA 4RQ5A 2JH1A 3KKAA 4O0IA 5F2VO 4E0DA 3KHLA 1KW4A 4YR3A 1U48A 4QZIA 1SKWA 3QU9A 2D8CA 2OCEA 2W11A 1S9FA 3RJKA 4F71A 1IM4A 3OJUA 2M0NA 4QWEA 3MDCA 1HIWA 4Q43A 4PZOA 3L3FX 3M8RA 4F3OA 4MFCA 2KSOA 4YP3A 4ED2A 2K4IA 2ISPA 3D2SA 2HI0A 5AKHA 2MSNA 4ECUA 5DB8A 3EPGA 3RH5A 4JV0A 3UMBA 4CGZA 5AKJA 4O3QA 4DOCA 2ISOA 2C22A 4MKPA 4R65A 2G09A 4I2BA 1WOTA 1UA1A 1ZQFA 3HKZF 4EEYA 5B5EU 3OJSA 4JK1A 4EBKA 4OJ5A 4UB3A 4P0QB 4ECQA 3WKCA 1UT8A 3KOOA 4DFKA 2H5XA 5KTQA 2IHOA 4AT9A 2M9NA 3RR7A 3WK8A 1ZQRA 3JPTA 3N7PD 5D61A 3NASA 3AQMA 5ALGA 3TI0A 2ZHBA 4DQQA 3RBDA 5AKXA 8ICWA 4FHYA 4EBJA 1IV8A 4BJQA 1RM6C 2RLTA 3NVZA 3RF9A 8ICGA 3IM1A 2I9GA 4ELVA 3G6YA 1ZQJA 5L1IA 3I28A 2G07A 3ZDAA 4M2YA 8ICNA 1SZPA 5EE1A 5J0TA 2A3VA 3WFOA 5F9NA 5KFMA 2C2RA 4DQIA 4C8NA 4QZ8A 1NO5A 2ZH6A 2E1FA 2D6FC 2C2DA 4NLNA 3C5FA 3QU5A 2BBHA 2XC9A 1L8OA 1JI7A 2R18A 3KHGA 1TK8A 4NXXA 4O6AA 4DS5A 4QWBA 2JMGA 4O5CA 4EEBA 2HW3A 1PK1A 5KT6A 4XQ8A 3G6VA 4QWAA 2BPFA 3RJFA 4CCHA 5KFIA 1WUDA 3H8WA 4DSJA 5DBBA 4UD4A 1PK3A 1KRPA 3V7KA 5ALRA 1WCLA 5KFVA 4TQSA 5HP4A 4UATA 4LEWA 5F3XB 2NO4A 4PHEA 3AUOA 3HRDD 5DDYA 5AI5A 3PR5B 2KICA 1T94A 1BPEA 1FA0A 5GTIU 4GLXA 4NXZA 3GZFA 3GV5B 1A77A 4WC3A 9ICGA 4RZRA 1ZJMA 2YY6A 4UB6U 5D46A 5KFNA 2YMLA 3UQ2A 4NLKA 2G5HB 2YMQA 3N28A 2ZUCA 4KX5A 9ICEA 1DK2A 5KFKA 2MU2A 4PPXA 4FHPA 4KLSA 3HPOA 3MR6A 4RQ3A 2XO7A 4UB8U 2ZJ5A 7ICIA 2DVIA 1O08A 2PXIA 2VA3A 5ALSA 4KLHA 2YMMA 4IRKA 1ED1A 4BGDA 1QTMA 4EBDA 5DB9A 4RWOA 2H3QA 2VIXA 1ZQTA 2P66A 4NV0A 1FIQA 4OJOA 1F44A 7ICMA 4M04A 2HOIA 4EP7A 1PVPA 3IG5A 5DG8A 4C8LA 3KD3A 3BS5B 1KDHA 4C4RA 5ALFA 3UXPA 2FI1A 4Y2PA 4B9TA 2F1JA 1ZQKA 4DFPA 3WK9A 5EOZA 2LPEA 3BQTA 3H7IA 3HJEA 3PSTA 4DSKA 2ALZA 3CRXA 1DGJA 8ICVA 5AM3A 3M1YA 4BWMA 4F2SA 1N56A 3C18A 2GH1A 2ODGA 3RB3A 4CF4A 1U49A 4F91B 3RTVA 8ICAA 1MQ2A 2QB1A 3J81j 1ZJNA 4WCWA 9ICMA 1Z19A 2UVWA 9ICVA 2M2WA 1NKBA 2L5YA 5B66U 2BCRA 3OWGA 3SV3A 2OXOA 4DL5A 1QH9A 1S0MA 2GOLA 2EAMA 4NJ8A 3WKDA 2ZH2A 1LV5A 1HUZA 4BUGA 5A0LA 2JZBB 2AHOB 2OEHA 2FPLA 2ZIWA 4KLQA 1O03A 4NM1A 1SKRA 1VJ5A 4IS7A 8ICIA 2WAQF 4TUSA 3BS5A 4RQ0A 5AKLA 2NRXA 3B0XA 3QU7A 5T14A 4NM2A 2FPKA 5AI9A 1R8BA 1N48A 4YMMA 3RJEA 1SV0C 4DFMA 2PFOA 4JV2A 3O0FA 4UB2A 1JXEA 3QXGA 1NK9A 3M6ZA 2QARB 5DEDA 2ZH7A 3ETRA 4B6JA 5KL8B 1BPXA 8ICHA 2F77X 5HRBA 4EELA 1XC9A 2B0CA 4CF3A 5IIMA 1JN3A 4OJLA 4CDGA 2EZYA 2KG5A 2HOFA 3GDXA 5HHHA 5AKYA 8ICRA 2BPCA 3AQEA 5L1LA 3DDHA 4DEZA 2W9AA 1Q79A 4F4WA 1SL0A 4M9LA 3QUCA 2DRBA 3PNCA 1X9SA 4P2HA 5CHEA 5J0OA 3T3FA 2NRZA 4OJPA 4JLZA 3TKAA 4FBUA 2HBMA 4QW9A 4B9UA 4BXOB 5J2KA 5TISU 1JALA 5KFAA 2QB0B 4YFKA 3ZDCA 5CWRA 8ICBA 3SI8A 2K4PA 3JPPA 4DL4A 5KT5A 3I76A 3RFAA 4RPYA 1OW5A 5J0PA 4EYIB 5KG5A 1ZQWA 4G3IA 3UXOA 3F2BA 4F4XA 4C4TA 2XCAA 4EX6A 4M9GA 4WOYA 3TADA 4DO9A 4Y2XA 4I2CA 4EV6A 2K4HA 2J6TA 4ATBA 1OU5A 2AXTU 2NRTA 3QYPA 4K4IA 2W03A 4B9LA 4KLFA 3N97B 3RJIA 4X0AA 2KKVA 2M2TA 4NLGA 1D8YA 4FFDA 1SL1A 1S76D 3BS7A 8ICPA 2R8HA 1XO1A 5HR9A 3CNHA 4QZGA 1X9WA 3M8SA 2H3VA 3QE9Y 1RDFA 2P35A 1BVSA 4DSFA 3C2LA 1SV4A 5JUMA 2ZH8A 4MFAA 4RNOA 2Y0SC 1JMSA 2AGPA 1HUOA 1YT3A 4Z6DA 4M9NA 1UA0A 3AL0B 4J9KA 4BWJA 3GIIA 4DOBA 4TQRA 1LKYB 2FMQA 4CRXA 1RG6A 2WF6A 2XCPA 4EZ6A 4CNQA 7ICPA 2DF4B 1PUZA 4FE3A 3ISDA 4YCXA 3GQCA 3SAFA 2PMZF 9ICAA 3RAXA 2XIDA 4OO1J 4Y2UA 1ZYQA 5HRGA 9ICCA 7ICKA 3JCFA 4RPXA 3GU3A 5DGAA 3BQ7A 4J9MA 2HHSA 1N2XA 3QEAZ 5HRKA 2PBEA 3H38A 5KFBA 1IXRA 5ALQA 4QW8A 4X0BA 1ZXIA 5IIIA 2DWQA 3C21A 1GPJA 4RU9A 1T4GA 5J2AA 4IRCA 4PJ0U 3MGHA 2AJQA 2BCUA 4KLLA 5J2GA 5HRHA 4WQKA 3F5EA 1HJPA 1L6NA 1ZQYA 5AK6A 5JU5A 1Q78A 2KD1A 4KLEA 1JAJA 2J6UA 3EUB2 1RYSA 4Z6FA 2I6XA 5BPCA 2FLPA 9ICXA 3ETLA 1TFRA 2PFQA 4MF8A 2E8NA 2VANA 4F92B 3WK5A 2G06A 4F5QA 1NZPA 4AT8A 1SB3C 1FEZA 4OAHA 4ED6A 1DXSA 3RH6A 3ED5A 2HSZA 4B9NA 1KFDA 3IDWA 1ZQOA 2BQUA 1T3NA 2B4VA 5K4LA 2W55A 4I29A 2FLLA 3BQ2A 2FPMA 2FCLA 5IIKA 3WK6A 2MUTA 5KFOA 3R9KA 5ALXA 1Z00B 3RJHA 4M6WB 2KTQA 2N1RA 4J9SA 4PH5A 2D3DA 3JPSA 2NYVA 2ZTCA 2DR8A 2F3NA 3KBBA 3AQLA 4RNNA 5KFFA 8ICUA 4K9AA 2PKEA 2LM4A 1TK0A 3UPQA 1NOMA 3RAQA 4P0PA 2F76X 3E0FA 3NYBA 5EWEA 2HN1A 3M6KA 2BDPA 1BGXT 4A8EA 8ICFA 3K4GA 1S10A 5AI4A 1N63A 5EE3A 5ALZA 4ACOA 1Z1BA 4ED8A 4RQ6A 4F2RA 4QJFB 3PZPA 5TZVA 1NJYA 4LZGA 2KFNA 3EWAA 4NXTA 3LK9A 3SAHA 2AU0A 1Q3UA 4NXVA 4ZH4A 2KN7A 3MBYA 2Y1JA 5IIOA 3Q8RB 4F5NA 3M9MB 7ICGA 2QARA 1QSLA 2OM6A 5KFTA 2ASDA 2ATLA 3V7JA 5J0SA 3JPRA 2LBOA 4ED3A 1ZQCA 1KL9A 5J0UA 3OUYA 1ZRNA 9ICQA 4GIBA 1NJZA 1R8AA 2NV3A 2JHDA 4QZAA 5ALUA 5KG0A 5KFCA 2XY7A 5J8YA 2IOFA 3OVBA 7ICRA 4RNMA 5KFLA 3C66A 4Q44A 2HHXA 4UD5A 9ICSA 1D9DA 4KLIA 1TE2A 2R8KA 4ECZA 5J0WA 2ID1A 4US9A 2QKQA 2ZUBA 5L1JA 4ATBB 4J9RA 4KTQA 1XU4A 4DLEA 1X6IA 4KMUA 2HHVA 4XUSA 1J97A 4IR9A 1S77D 2WAQC 4QZDA 3CK6A 4ECSA 5DBCA 9ICJA 2GA9D 5KFQA 3PW4A 4LEVA 3LVWA 2MRLA 4WC0A 3EW9A 3H4BA 5DBAA 2KFZA 3HJ1A 2ZIVB 4M5DA 5AIAA 1J2NA 4F4YA 2UVRA 4XJEA 3PMLA 4OJ6A 1ZQVA 4O3NA 2K4EA 2BR0A 2W9MA 4FHWA 2ZH4A 5KFPA 1PK1B 4R63A 1NKCA 5CJ7A 2F1IA 1AQ6A 1NK0A 4RWPA 5DDMA 4B9SA 2KKPA 3RBEA 1L3UA 4NL9C 3BJYA 4FH5A 3D6JA 1CUKA 1ZQAA 5DLFA 7ICLA 5ALVA 3MR5A 1ZETA 8ICSA 1CEZA 5KAIU 4I2GA 9ICIA 4RQMA 4J9QA 1WG8A 1KSPA 3MR3A 2DR7A 4FS2A 3TAPA 5CRXA 1MA7A 2KV2A 3TQ1A 3PO4A 1MIWA 5KFRA 2A19A 3ZI4A 1YZ7A 9ICOA 1ZRMA 3LWLA 2A1JA 1VDVA 4O3PA 4X4SA 5KFGA 2K8CB 4JB3A 5J2CA 3H0LB 1XS9D 4GXKA 4S3NA 2A1AA 1L3TA 2JGAA 1Z4NA 4DCCA 4QZFA 1SGGA 1RQLA 1IG6A 8ICMA 2EDUA 2ZTDA 1U45A 5CA7A 2KHQA 4EYHB 3OVAA 4P4PA 2DGZA 1TFWA 4MF2A 2KVSA 1RXVA 2O5AA 2JZBA 5DG7A 2ZUDA 3GFKB 4U7CA 5KG6A 4JMUA 3SQIA 2WB1F 4IC9A 1X42A 4O68A 4XA5A 5C0YA 3MGVA 3H39A 5KG4A 4ELUA 3PSFA 1MC8A 2W9CA 3KKAC 4P0PB 1BPYA 3U26A 5ALPA 1FFUA 2I5HA 2NRWA 3FYHA 2CRXA 4YD2A 7ICHA 2AQ0A 5IIJA 5HRIA 3JPQA 5F9LA 4PL2A 4NY8A 7ICFA 4PHPA 4WC6A 4K99A 8ICLA 3S6JA 3RB4A 2IBKA 4I28A 4FZLA 1ZQZA 3ALRA 3PHZA 3K7DA 2J6SA 2WF5A 3PO5A 3SAGA 2Z7JA 1NK4A 5HREA 3CW2C 2ZH1A 1SWVA 3F53A 4FZNA 3MFIA 3V6HA 2HHUA 1N5WA 5KFEA 4N7RA 5CFSA 4NLBA 1NK8A 2FLNA 4U6PA 3UPSA 4Q8FA 4GXJA 3WFQE 2PI5A 4ECWA 3QX7A 4ELTA 4UAWA 5AI8A 2HBLA 4WC5A 1ECWA 2BQRA 5J2JA 2JEJA 5L1KA 3FAHA 3H0MB 3AU6A 1V38A 2HCFA 1FO4A 1V97A 2BDUA 3HJ4A 3IHQB 1MN8A 4FO6A 2Q0ZX 4IG8A 4UARA 4OD0A 4YMNA 5KG1A 4RUCA 3WK4A 1X2IA 5KFZA 3N4MB 2BZFA 3B9JA 4RQ8A 3OSPA 3UXNA 1K1SA 5AKKA 4EEKA 4RQ7A 5HRDA 4MEXA 3K75D 3GIMA 1YZ6A 1UT5A 1ZQ1C 2KJ8A 2CPRA 4OAGA 2ZIUB 4AT9B 2GAFD 4EZ9A 2F44A 4F72A 2DR9A 9ICWA 1U9LA 1Q8KA 4BXOA 1L7MA 3T5HA 2BPGA 3E2EA 5CHGA 4AP9A 2CXYA 2W04A 2ZIVA 1MIYA 4KLUA 1ZQPA 2DPIA 2FJ6A 5ALJA 5DKWA 9ICHA 5G5GA 2HMXA 1OUQA 2OWOA 2BKEA 4GFJA 5KFUA 3QZ8A 5IINA 5JTGA 2W7PA 1R8CA 1ZQQA 7ICOA 1COKA 5KFSA 3OTQA 4KITB 5J2IA 1XO0A 2OYYA 4F4KA 1ZQLA 1M6YA 1S8OA 4OCZA 4WC4A 4EEDA 2W7OA 4WC2A 3JZ0A 1DOQA 1RYRA 3KFUF 3FM9A 2KIVA 4LVSA 5J29A 3NKUA 3WK7A 4PGXA 4I2FA 1B22A 2KJ9A 4F5RA 3V72A 4KN7A 4DWIA 5EWFA 2I1QA 1QLNA 1NZBA 9ICLA 1ZQNA 5B3QA 3HT3A 1Z00A 3M9OB 4FBTA 5AM1A 7ICJA 2W8LA 4WH5A 2Y9UA 3KHRA 4Y2RA 3AEVA 2ZH9A 3H3AA 1XSLA 4TUQA 3NGDA 4IL6U 2E8PA 4NLZA 5KFJA 2B6GA 4C0ZA 1QSYA 3AM9A 3M9NB 4ECXA 2W8KA 5B3PA 3G6XA 3ISCA 1RQNA 1NK5A 1L7PA 4FZMA 1SL2A 3ICXA 4PGQA 5KG3A 1TVAA 4Z6CA 4PL1A 3KZXA 3VCBA 5HR6A 1SIJA 4XRHA 3QEBZ 2ZJAA 3AU2A 3BDPA 4X4RA 4IQUA 1ZOLA 2W54A 4QWDA 4ECYA 3F5AA 3FDSA 4O69A 4E80A 4KN4A 3DEEA 2F8KA 2KZZA 5AM0A 1PVQA 2JV3A 3AMZA 4AT7B 4JLXA 5J2EA 5D62A 4WC7A 3I1YA 2RQ5A 3QUQA 4IQTA 1F5AA 2FDRA 2VJ5A 5ALKA 4C8KA 2KP7A 1TKDA 2DPJA 4C4SA 4GXIA 5KNIA 4B9MA 4NKTA 1RYUA 4EGWA 2ZHAA 4WQLA 1ZQMA 3HWTA 2BBJA 5AM5A 1Q46A 2EH9A 3SZ2A 4BDPA 1KTQA 3AN1A 4Z6EA 2KOBA 4K97A 2PFNA 5BOLA 2H3FA 4UB5A 8ICTA 2K89A 2M2UA 5ALYA 2LI6A 1SV0A 7ICTA 3H0RB 3NVWA 1UEVA 3HIYA 1ZD2P 4C80A 1KFSA 3K1RB 2YB1A 5KT4A 2EZZA 4KLOA 3WKAA 4DQSA 1CRXA 2HN2A 3ORYA 2ZXHA 3V6JA 1L7OA 4RQNA 5J8YC 1CI4A 4AYBF 1SZHA 5J2BA 4J9PA 3RRHA 3CP8A 1JQRA 1D9FA 2YQEA 4KX3A 3NVYA 2WF8A 4RUAA 4X4PA 4IQWA 3K1ZA 1WYGA 2ZIXB 4NXWA 1ZQGA 1Q3VA 1D8BA 4E8FA 4M9JA 1Y88A 2BCVA 4XQ7A 4EBEA 1UEUA 7ICVA 4B9VA 5KFHA 1KN5A 4ECVA 3C5GA 4NXUA 2XI9A 3HW8A 1KQQA 1L3VA 2YMPA 1ZQSA 5KFXA 3A0HU 1S0NA 2C2EA 5HRLA 2B21A 1P7DA 2KJ5A 1DGSA 3T5LA 2G08A 2O1PA 5AI6A 1T7PA 4X4QA 2DRAA 5DECA 2EAOA 4DLGA 3EYZA 1UETA 2EQYA 3D2NA 2ASLA 4FH3A 3QU4A 2KZ3A 2C28A 1JXLA 4MEYA 4DL3A 3H8MA 4R66A 1Z3EB 4QZ9A 5ALTA 2Y1IA 2WHEA 1X9MA 2HHWA 1S0VA 4J03A 2GO7A 3GILA 1VJ7A 3TACB 9ICPA 3ZDDA 5FP0A 2YN4A 3MR2A 4TUPA 3QU2A 2YX8A 4WBYA 1TV9A 4YR0A 4I2DA 3F2CA 2FMSA 2W3SA 4ZOHC 2DBYA 1BNOA 1S97A 1J2MA 1SWWA 2IHNA 1NJWA 3MCRA 3N7RC 3C2MA 3RB0A 5DQGA 2ZTEA 4UAVA 2DR5A 3WU2U 1A76A 3L4PA 4K8VA 2LMRA 1WCNA 4DL2A 4I2JA 2ZXIA 5DQHA 1VLBA 1L3SA 4UQGA 8ICZA 4I2AA 2GWSA 5EE9A 1UQVA 9ICKA 7ICEA 3NRWA 4ICAA 5HR7A 1ZQHA 4F5PA 1U4BA 5KFDA 5J2HA 1PVRA 4CE6A 2WF9A 3GIKA 4LEYA 4UAZA 4I27A 3ZDEA 4WJ3B 3EPIA 2RHFA
chains in the Genus database with same CATH topology
4RQ2A 1MC8A 2W9CA 4O3OA 4RWNA 5HNKA 2NRVA 3JPPA 4DL4A 1ZQDA 5KT5A 2ZJ8A 1BPYA 3Q8SB 4DSEA 1EXNA 3V6KA 1XSNA 4O5EA 4RPYA 1TK5A 4RPZA 4EYIB 2NRWA 3FYHA 5J0PA 5KT7A 1RZTA 2RDJA 3TFRA 5KG5A 1ZQWA 3LQCB 4YD2A 7ICHA 8ICYA 4G3IA 2AQ0A 5IIJA 4WBZA 3UXOA 4F4XA 2XCAA 5HRIA 3PW5A 3JPQA 3ZD8A 1BPDA 4ECTA 3Q8KA 4YXJA 5F9LA 4NY8A 4J9OA 4PHPA 7ICFA 2P6RA 3MFHA 1SKSA 4M9GA 7ICNA 8ICLA 5DGBA 4YG2A 3RB4A 2IBKA 3RJJA 3C1ZA 4I28A 9ICFA 4DO9A 1ZQZA 2MAXA 4IRDA 4I2CA 3L9DA 4DFJA 2J6SA 3V7LA 3RH4A 2J6TA 3PO5A 4ATBA 1V9PA 4RT2A 2JEFA 1OU5A 7ICQA 2NRTA 2W9BB 1NK4A 5HREA 3ZDBA 3TFSA 4X4QA 4MFFA 2ZH1A 2JEGA 2R8IA 2UVUA 2P6UA 4K4IA 5DB6A 3MFIA 3V6HA 4B9LA 4KLFA 8ICEA 2JEIA 2HHUA 2O5AA 5KFEA 5HC9A 5DB7A 3N97B 4DL7A 3ZD9A 3RJIA 8ICJA 3UQ0A 4X0AA 4X5VA 4JWMA 5IILA 2AGOA 4K4GA 3HX0A 1NK8A 2FLNA 2M2TA 4DQPA 4NLGA 4KLJA 4LT6A 3UPSA 1D8YA 4Q8FA 1XWLA 4GXJA 3WFQE 1SL1A 2PI5A 1S76D 5CB1A 4ECWA 4DF4A 8ICPA 2R8HA 5J2DA 4ELTA 1XO1A 5HR9A 3TANA 4UAWA 4QZGA 4DOAA 5C5JA 1X9WA 4WC5A 4FS1A 5HMLA 3M8SA 2XY5A 3QE9Y 2BQRA 3OV7A 5J2JA 2JEJA 1BVSA 5L1KA 4DSFA 3C2LA 2LYHA 4I2IA 1TFYA 4Q45A 3AU6A 8ICXA 5JUMA 3MGIA 8ICCA 4YQWA 2Q66A 2W9BA 3HJ4A 4DQRA 3IHQB 5KG7A 4RNOA 4MFAA 4F5OA 2ZH8A 1JMSA 4KLMA 8ICOA 4FO6A 1TAUA 2Q0ZX 2AGPA 1HUOA 4M9NA 4Z6DA 4F93B 1UA0A 4IG8A 4X4VA 9ICNA 4YMNA 8ICQA 1TAQA 5KG1A 4RUCA 4BWJA 4J9KA 9ICBA 1X2IA 5KFZA 3GIIA 3N4MB 4X4TA 4DL6A 4YR2A 3RB6A 4DOBA 4TQRA 4RQ8A 3OSPA 2FMQA 3AQNA 3UXNA 5KT2A 2XCPA 3PX6A 3LWMA 4EZ6A 7ICPA 5J0RA 1K1SA 1ZQXA 4UAYA 4RWQA 4RQ7A 3PW7A 2W9CB 4RQ1A 1MSWD 5HRDA 4P4MA 2ZH5A 4MEXA 4QZHA 3ISDA 4JV1A 5BOMA 4YCXA 2F1HA 1VFGA 5D4BA 3K75D 4O3RA 3GIMA 2BGWA 1UT5A 3H8SA 4E7XA 3GQCA 4TURA 1KFTA 3QZ7A 2BCSA 4AT9B 9ICAA 4UB1A 3C2KA 4KLDA 4EZ9A 4X4UA 3RAXA 2DR9A 4RQ5A 9ICWA 1U9LA 3GV7B 4O0IA 4J9LA 4BXOA 5F2VO 4E0DA 4KLTA 2XY6A 4JWNA 3KHLA 3T5HA 1ZYQA 4YR3A 2BPGA 5CHGA 1U48A 4YD1A 3E2EA 4QZIA 5HRGA 1SKWA 9ICCA 1MIYA 7ICKA 4KLUA 1ZQPA 2DPIA 4M47A 4F50A 4RPXA 4FHXA 4J9NA 3KTQA 3TAQA 3T5KA 5DGAA 2RFFA 1S9FA 5DKWA 9ICHA 3RJKA 4J9MA 1IM4A 2HHSA 2OWOA 2BKEA 4I2HA 5KFUA 3QZ8A 3OJUA 2DFLA 5IINA 3QEAZ 5HRKA 2PBEA 3H38A 2UVVA 5KFYA 1R8CA 1ZQQA 5D49A 1ZQEA 7ICOA 4QWEA 3MDCA 4QZBA 5KFBA 4K4HA 1IXRA 5HMMA 4Q43A 5KFSA 3M8RA 1JX4A 4KITB 1JIHA 4QW8A 5KG2A 2BQ3A 5J2IA 2WTFA 2ASJA 4X0BA 4C8MA 4F3OA 4MFCA 4YP3A 4ED2A 2ISPA 3SV4A 5IIIA 4F4KA 1ZQLA 3JPNA 5DB8A 3C21A 3EPGA 4JV0A 1PZNA 4ECUA 3RH5A 1U47A 1R89A 3WFPA 4WC4A 4RU9A 1T4GA 4WC2A 4O3QA 3JZ0A 1DOQA 4DOCA 5J2AA 1RYRA 4IRCA 4LVSA 2ISOA 2MUTB 2KFNA 2C22A 5J29A 3MGHA 2AJQA 5EWGA 2BCUA 4KLLA 5J2GA 4R65A 4PGXA 4I2FA 5HRHA 3WFRE 1HJPA 4GC6A 3TARA 1H38A 4I2BA 4F5RA 1UA1A 3H4DA 3V72A 1ZQFA 8ICKA 1ZQYA 1B22A 4EEYA 4GC7A 4KN7A 1D8LA 3OJSA 4QZEA 1Q78A 4JK1A 5EWFA 4DWIA 4KLEA 2I1QA 1QLNA 1JAJA 2J6UA 4EBKA 1RYSA 9ICLA 4Z6FA 4UB3A 5BPCA 1ZQNA 4ECQA 2FLPA 3HT3A 3THVA 9ICXA 2PFPA 3ETLA 1UT8A 1TFRA 1Z00A 3H40A 4DFKA 2H5XA 2PFQA 5KTQA 3M9OB 4MF8A 3RR8A 4FBTA 3PY8A 4AT9A 2VANA 2M9NA 7ICUA 3RR7A 7ICJA 2W8LA 4F92B 1ZQRA 3EZ5A 3KHRA 4F5QA 3JPTA 1NZPA 1YLQA 4AT8A 2ZH9A 3H3AA 1XSLA 4ED6A 1L5UA 2R8GA 3RH6A 3AQMA 3TI0A 4B9NA 4UB4A 1KFDA 4TUQA 3NGDA 2ZHBA 4DQQA 1QSSA 3RBDA 8ICWA 1ZQOA 3KHHA 4FHYA 3PX0A 4NLZA 4EBJA 2BQUA 1T3NA 5KFJA 3T5JA 3PW0A 4I29A 2M2VA 2FLLA 2IHMA 4X4OA 3BQ2A 4ECRA 2FPMA 4FHVA 8ICGA 3IM1A 1QSYA 2I9GA 5IIKA 3G6YA 1ZQJA 4ELVA 3M9NB 2MUTA 4YVZA 2W8KA 5L1IA 4ECXA 5KFOA 3G6XA 1WOTA 1K1QA 3OUYB 3ISCA 3MABA 1NK5A 3ZDAA 1Z00B 4M2YA 8ICNA 1SZPA 5J0QA 1SL2A 5J0TA 3RJHA 4M6WB 2KTQA 2KZMA 3WFOA 2VA8A 1S0OA 1B43A 4PGQA 5F9NA 5KFMA 5KG3A 1TVAA 4J9SA 4PH5A 2C2RA 2R8JA 4Z6CA 4C8NA 4QZ8A 4DQIA 1NO5A 2ZH6A 3JPSA 2C2DA 9ICUA 2DR8A 2ZTCA 2AQ4A 4NLNA 3C5FA 3AQLA 3C1YA 4RNNA 5KFFA 8ICUA 2XC9A 2PI4A 4XRHA 3QEBZ 1TK0A 3UPQA 3KHGA 1NOMA 1TK8A 3RAQA 2ZJAA 3AU2A 4DS5A 3BDPA 4X4RA 4QWBA 4IQUA 4O5CA 3NYBA 3WFSC 2HW3A 5EWEA 3OSNA 2BDPA 1BGXT 4QWDA 8ICFA 2IA6A 4QWCA 5KT6A 4XQ8A 3G6VA 5L9XA 3FDSA 3K4GA 3LDAA 4QWAA 4ECYA 1S10A 2BPFA 1MQ3A 4UBCA 3RJFA 4CCHA 5KFIA 4DSJA 3H8WA 1NK6A 5DBBA 7ICSA 4UD4A 4E80A 4KN4A 1NK7A 4QZCA 4I2EA 2KZZA 4DF8A 1KRPA 3V7KA 5DG9A 4ED8A 1WCLA 3JYYA 5KFVA 4TQSA 4RQ6A 4AT7B 5HP4A 5J2EA 4F2RA 4WC7A 4IQTA 1NJYA 5TZVA 1F5AA 2IMWP 4LZGA 4PHEA 3AUOA 3EWAA 5DDYA 3PR5B 1KLNA 1TKDA 4C8KA 4M9HA 2KP7A 2BE3A 1BPEA 2DPJA 3LK9A 4GXIA 2AU0A 1FA0A 4B9MA 4GLXA 4NKTA 4NXZA 2ZHAA 4ZH4A 1NKEA 2KN7A 1ZQMA 3GV5B 1NJXA 5DQIA 3HWTA 1A77A 1ZQUA 3MBYA 2Y1JA 9ICGA 4WC3A 2HHPA 5IIOA 4RZRA 3Q8RB 4F5NA 1ZJMA 4AT7A 3PV8A 5D46A 5KFNA 3M9MB 3SZ2A 4BDPA 4C8OA 1KTQA 4Z6EA 7ICGA 3UQ2A 1QSLA 4NLKA 2PFNA 5BOLA 2ZUCA 4UB5A 5KFTA 2ASDA 8ICTA 2M2UA 2ATLA 3V7JA 9ICEA 1DK2A 5KFKA 4PPXA 5J0SA 4R8UB 3JPRA 3MDAA 4ED3A 4FHPA 1ZQCA 2V9WA 3HPOA 3MR6A 4RQ3A 4KLSA 7ICTA 1BPBA 5J0UA 2XO7A 9ICTA 1UEVA 3HIYA 3OUYA 2ZJ5A 5HHIA 7ICIA 1KFSA 9ICQA 2DVIA 1NJZA 5KT4A 1R8AA 4QZAA 2PXIA 4ED0A 2VA3A 4KLOA 4KLHA 2HVIA 5KG0A 5KFCA 2V4RA 5J2FA 4DQSA 2XY7A 4IRKA 3ORYA 4BGDA 3V6JA 1XSPA 1QTMA 3OVBA 7ICRA 4RNMA 2XGQA 4EBDA 2BCQA 5DB9A 5KFLA 3C66A 4WC6A 5J2BA 4J9PA 1DK3A 4Q44A 1V4AA 5CR0A 3RRHA 4RWOA 4IR1A 2VA2A 2ZH4A 2HHXA 4UD5A 1ZQTA 2P66A 9ICSA 2AGQA 1D9DA 1JQRA 1D9FA 4KLIA 5CP2A 5KT3A 1MIVA 7ICMA 4M04A 2R8KA 3SYZA 4ECZA 4EP7A 5J0WA 2ID1A 5DG8A 3RRGA 5J0YA 4RUAA 3Q8LA 3Q8MA 4C8LA 4RQ4A 4X4PA 4IQWA 2ZUBA 1AROP 1KDHA 2HHQA 3HP6A 4KLGA 3UXPA 2ZH3A 2BHNA 3JPOA 5L1JA 4ATBB 4AT8B 1ZQGA 4J9RA 4KTQA 1XU4A 4DLEA 4B9TA 4KMUA 2F1JA 4E8FA 4NKUA 1ZQKA 4XUSA 4DFPA 4M9JA 2HHVA 5EOZA 1Y88A 3BQTA 3H7IA 4P4OA 2BCVA 4DSKA 4IR9A 4O3SA 1S77D 4XQ7A 4QZDA 2ALZA 8ICVA 4EBEA 4ECSA 1UEUA 7ICVA 5DBCA 9ICJA 5KFQA 4BWMA 5KFHA 3PW4A 4B9VA 4ECVA 1N56A 4F2SA 3C18A 3EW9A 3H4BA 5DBAA 3C5GA 3PVXA 4WC0A 2KFZA 3HW8A 3HJ1A 3RB3A 4M5DA 1U49A 4F91B 3RTVA 8ICAA 1MQ2A 1L3VA 1ZQSA 5KFXA 4F4YA 1S0NA 3H8JA 1ZJNA 2UVRA 2C2EA 3PMLA 5HRLA 4WCWA 1ZQVA 2B21A 4O3NA 4UBBA 3Q8QB 4YMOA 9ICMA 2UVWA 1DGSA 3T5LA 2FMPA 2BR0A 2W9MA 9ICVA 1T7PA 2M2WA 1T8EA 2O1PA 5KFPA 4R63A 1NKBA 5J0XA 3PMNA 1NKCA 1BPZA 2DRAA 5CJ7A 5DECA 2BCRA 2F1IA 4DLGA 4JUZA 4YN4A 3EYZA 3SV3A 1UETA 3OGUA 4DL5A 4WC1A 1S0MA 1NK0A 2ASLA 3BQ1A 4FH3A 4RWPA 2KZ3A 2V4QA 2C28A 4MEYA 1JXLA 5DDMA 2ZH2A 4DL3A 1LV5A 4B9SA 1HUZA 3OHBA 3PX4A 2JZBB 2HHTA 4R66A 3GIJA 3RBEA 1L3UA 2FPLA 1KEJA 1Z3EB 3BJYA 4FH5A 4QZ9A 2Y1IA 1CUKA 4PGYA 4KLQA 4NM1A 1SKRA 8ICIA 1X9MA 1ZQAA 2HHWA 1S0VA 4TUSA 5DLFA 4RQ0A 7ICLA 3GILA 2NRXA 3PW2A 3MR5A 3B0XA 1VJ7A 1ZETA 3RJGA 3H37A 9ICPA 4NM2A 3ZDDA 2FPKA 3MR2A 4Q8EA 8ICSA 1N48A 4YMMA 4TUPA 3RJEA 1CEZA 4O9MA 1R8BA 4DFMA 4EBCA 2PFOA 4I2GA 4JV2A 9ICIA 3AQKA 9ICRA 4UB2A 4WBYA 1BNPA 1JXEA 4J9QA 1TV9A 4YR0A 1C7YA 3MR3A 1KSPA 2DR7A 1NK9A 4FS2A 4I2DA 3TAPA 4M0AA 3OVSA 2FMSA 3TQ1A 4ED7A 4PHDA 3PO4A 4F8RA 1MIWA 5KFRA 5DEDA 2ZH7A 1S97A 1BPXA 4F4ZA 9ICOA 8ICHA 1BNOA 3PR4A 2IHNA 3LWLA 1NJWA 2A1JA 4O3PA 5HRBA 4X4SA 5KFGA 3C2MA 1XC9A 5J2CA 4ED1A 3RB0A 2XGPA 1XS9D 4LZDA 4IQVA 2RDIA 4R8UA 5DQGA 1JN3A 5IIMA 4GXKA 1RXWA 3NTUA 4R64A 3GV8B 4S3NA 2ZTEA 4PHAA 4DSLA 1L3TA 4RT3A 2DR5A 2HVHA 3GDXA 4M6WA 5HHHA 4FHWA 1A76A 1KNYA 4QZFA 8ICRA 2BPCA 1WCNA 8ICMA 1PX5A 2ZTDA 4DL2A 1U45A 1LB2B 4I2JA 5L1LA 4DEZA 2A1JB 3ISBA 2W9AA 1Q79A 5DQHA 1ZQIA 5CA7A 4F4WA 1SL0A 1L3SA 4UQGA 5KFWA 8ICZA 4EYHB 3OVAA 4P4PA 4M9LA 4I2AA 1TFWA 2GWSA 4MF2A 5DLGA 2DRBA 3PNCA 3C23A 1RXVA 4O5KA 1X9SA 2JZBA 5DG7A 5J0OA 2ZUDA 4P2HA 3GFKB 9ICKA 7ICEA 1ZQBA 5KG6A 3T3FA 1RPLA 2NRZA 3B0YA 1COOA 4YXMA 4FBUA 4DSIA 1ZQHA 4F5PA 4QW9A 4B9UA 4BXOB 3BQ0A 5J2KA 3Q8PB 5HRFA 1U4BA 5KFDA 4DS4A 4X4NA 4HYKA 5J2HA 4XA5A 2NRKA 5KFAA 3OHAA 3GIKA 4YFKA 3H39A 4UAZA 3ZDCA 4I27A 5CWRA 8ICBA 3ZDEA 5KG4A 3EPIA 3SI8A 4ELUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ2 A;  1MC8 A;  2W9C A;  4O3O A;  4RWN A;  5HNK A;  2NRV A;  3JPP A;  4DL4 A;  1ZQD A;  5KT5 A;  2ZJ8 A;  1BPY A;  3Q8S B;  4DSE A;  1EXN A;  3V6K A;  1XSN A;  4O5E A;  4RPY A;  1TK5 A;  4RPZ A;  4EYI B;  2NRW A;  3FYH A;  5J0P A;  5KT7 A;  1RZT A;  2RDJ A;  3TFR A;  5KG5 A;  1ZQW A;  3LQC B;  4YD2 A;  7ICH A;  8ICY A;  4G3I A;  2AQ0 A;  5IIJ A;  4WBZ A;  3UXO A;  4F4X A;  2XCA A;  5HRI A;  3PW5 A;  3JPQ A;  3ZD8 A;  1BPD A;  4ECT A;  3Q8K A;  4YXJ A;  5F9L A;  4NY8 A;  4J9O A;  4PHP A;  7ICF A;  2P6R A;  3MFH A;  1SKS A;  4M9G A;  7ICN A;  8ICL A;  5DGB A;  4YG2 A;  3RB4 A;  2IBK A;  3RJJ A;  3C1Z A;  4I28 A;  9ICF A;  4DO9 A;  1ZQZ A;  2MAX A;  4IRD A;  4I2C A;  3L9D A;  4DFJ A;  2J6S A;  3V7L A;  3RH4 A;  2J6T A;  3PO5 A;  4ATB A;  1V9P A;  4RT2 A;  2JEF A;  1OU5 A;  7ICQ A;  2NRT A;  2W9B B;  1NK4 A;  5HRE A;  3ZDB A;  3TFS A;  4X4Q A;  4MFF A;  2ZH1 A;  2JEG A;  2R8I A;  2UVU A;  2P6U A;  4K4I A;  5DB6 A;  3MFI A;  3V6H A;  4B9L A;  4KLF A;  8ICE A;  2JEI A;  2HHU A;  2O5A A;  5KFE A;  5HC9 A;  5DB7 A;  3N97 B;  4DL7 A;  3ZD9 A;  3RJI A;  8ICJ A;  3UQ0 A;  4X0A A;  4X5V A;  4JWM A;  5IIL A;  2AGO A;  4K4G A;  3HX0 A;  1NK8 A;  2FLN A;  2M2T A;  4DQP A;  4NLG A;  4KLJ A;  4LT6 A;  3UPS A;  1D8Y A;  4Q8F A;  1XWL A;  4GXJ A;  3WFQ E;  1SL1 A;  2PI5 A;  1S76 D;  5CB1 A;  4ECW A;  4DF4 A;  8ICP A;  2R8H A;  5J2D A;  4ELT A;  1XO1 A;  5HR9 A;  3TAN A;  4UAW A;  4QZG A;  4DOA A;  5C5J A;  1X9W A;  4WC5 A;  4FS1 A;  5HML A;  3M8S A;  2XY5 A;  3QE9 Y;  2BQR A;  3OV7 A;  5J2J A;  2JEJ A;  1BVS A;  5L1K A;  4DSF A;  3C2L A;  2LYH A;  4I2I A;  1TFY A;  4Q45 A;  3AU6 A;  8ICX A;  5JUM A;  3MGI A;  8ICC A;  4YQW A;  2Q66 A;  2W9B A;  3HJ4 A;  4DQR A;  3IHQ B;  5KG7 A;  4RNO A;  4MFA A;  4F5O A;  2ZH8 A;  1JMS A;  4KLM A;  8ICO A;  4FO6 A;  1TAU A;  2Q0Z X;  2AGP A;  1HUO A;  4M9N A;  4Z6D A;  4F93 B;  1UA0 A;  4IG8 A;  4X4V A;  9ICN A;  4YMN A;  8ICQ A;  1TAQ A;  5KG1 A;  4RUC A;  4BWJ A;  4J9K A;  9ICB A;  1X2I A;  5KFZ A;  3GII A;  3N4M B;  4X4T A;  4DL6 A;  4YR2 A;  3RB6 A;  4DOB A;  4TQR A;  4RQ8 A;  3OSP A;  2FMQ A;  3AQN A;  3UXN A;  5KT2 A;  2XCP A;  3PX6 A;  3LWM A;  4EZ6 A;  7ICP A;  5J0R A;  1K1S A;  1ZQX A;  4UAY A;  4RWQ A;  4RQ7 A;  3PW7 A;  2W9C B;  4RQ1 A;  1MSW D;  5HRD A;  4P4M A;  2ZH5 A;  4MEX A;  4QZH A;  3ISD A;  4JV1 A;  5BOM A;  4YCX A;  2F1H A;  1VFG A;  5D4B A;  3K75 D;  4O3R A;  3GIM A;  2BGW A;  1UT5 A;  3H8S A;  4E7X A;  3GQC A;  4TUR A;  1KFT A;  3QZ7 A;  2BCS A;  4AT9 B;  9ICA A;  4UB1 A;  3C2K A;  4KLD A;  4EZ9 A;  4X4U A;  3RAX A;  2DR9 A;  4RQ5 A;  9ICW A;  1U9L A;  3GV7 B;  4O0I A;  4J9L A;  4BXO A;  5F2V O;  4E0D A;  4KLT A;  2XY6 A;  4JWN A;  3KHL A;  3T5H A;  1ZYQ A;  4YR3 A;  2BPG A;  5CHG A;  1U48 A;  4YD1 A;  3E2E A;  4QZI A;  5HRG A;  1SKW A;  9ICC A;  1MIY A;  7ICK A;  4KLU A;  1ZQP A;  2DPI A;  4M47 A;  4F50 A;  4RPX A;  4FHX A;  4J9N A;  3KTQ A;  3TAQ A;  3T5K A;  5DGA A;  2RFF A;  1S9F A;  5DKW A;  9ICH A;  3RJK A;  4J9M A;  1IM4 A;  2HHS A;  2OWO A;  2BKE A;  4I2H A;  5KFU A;  3QZ8 A;  3OJU A;  2DFL A;  5IIN A;  3QEA Z;  5HRK A;  2PBE A;  3H38 A;  2UVV A;  5KFY A;  1R8C A;  1ZQQ A;  5D49 A;  1ZQE A;  7ICO A;  4QWE A;  3MDC A;  4QZB A;  5KFB A;  4K4H A;  1IXR A;  5HMM A;  4Q43 A;  5KFS A;  3M8R A;  1JX4 A;  4KIT B;  1JIH A;  4QW8 A;  5KG2 A;  2BQ3 A;  5J2I A;  2WTF A;  2ASJ A;  4X0B A;  4C8M A;  4F3O A;  4MFC A;  4YP3 A;  4ED2 A;  2ISP A;  3SV4 A;  5III A;  4F4K A;  1ZQL A;  3JPN A;  5DB8 A;  3C21 A;  3EPG A;  4JV0 A;  1PZN A;  4ECU A;  3RH5 A;  1U47 A;  1R89 A;  3WFP A;  4WC4 A;  4RU9 A;  1T4G A;  4WC2 A;  4O3Q A;  3JZ0 A;  1DOQ A;  4DOC A;  5J2A A;  1RYR A;  4IRC A;  4LVS A;  2ISO A;  2MUT B;  2KFN A;  2C22 A;  5J29 A;  3MGH A;  2AJQ A;  5EWG A;  2BCU A;  4KLL A;  5J2G A;  4R65 A;  4PGX A;  4I2F A;  5HRH A;  3WFR E;  1HJP A;  4GC6 A;  3TAR A;  1H38 A;  4I2B A;  4F5R A;  1UA1 A;  3H4D A;  3V72 A;  1ZQF A;  8ICK A;  1ZQY A;  1B22 A;  4EEY A;  4GC7 A;  4KN7 A;  1D8L A;  3OJS A;  4QZE A;  1Q78 A;  4JK1 A;  5EWF A;  4DWI A;  4KLE A;  2I1Q A;  1QLN A;  1JAJ A;  2J6U A;  4EBK A;  1RYS A;  9ICL A;  4Z6F A;  4UB3 A;  5BPC A;  1ZQN A;  4ECQ A;  2FLP A;  3HT3 A;  3THV A;  9ICX A;  2PFP A;  3ETL A;  1UT8 A;  1TFR A;  1Z00 A;  3H40 A;  4DFK A;  2H5X A;  2PFQ A;  5KTQ A;  3M9O B;  4MF8 A;  3RR8 A;  4FBT A;  3PY8 A;  4AT9 A;  2VAN A;  2M9N A;  7ICU A;  3RR7 A;  7ICJ A;  2W8L A;  4F92 B;  1ZQR A;  3EZ5 A;  3KHR A;  4F5Q A;  3JPT A;  1NZP A;  1YLQ A;  4AT8 A;  2ZH9 A;  3H3A A;  1XSL A;  4ED6 A;  1L5U A;  2R8G A;  3RH6 A;  3AQM A;  3TI0 A;  4B9N A;  4UB4 A;  1KFD A;  4TUQ A;  3NGD A;  2ZHB A;  4DQQ A;  1QSS A;  3RBD A;  8ICW A;  1ZQO A;  3KHH A;  4FHY A;  3PX0 A;  4NLZ A;  4EBJ A;  2BQU A;  1T3N A;  5KFJ A;  3T5J A;  3PW0 A;  4I29 A;  2M2V A;  2FLL A;  2IHM A;  4X4O A;  3BQ2 A;  4ECR A;  2FPM A;  4FHV A;  8ICG A;  3IM1 A;  1QSY A;  2I9G A;  5IIK A;  3G6Y A;  1ZQJ A;  4ELV A;  3M9N B;  2MUT A;  4YVZ A;  2W8K A;  5L1I A;  4ECX A;  5KFO A;  3G6X A;  1WOT A;  1K1Q A;  3OUY B;  3ISC A;  3MAB A;  1NK5 A;  3ZDA A;  1Z00 B;  4M2Y A;  8ICN A;  1SZP A;  5J0Q A;  1SL2 A;  5J0T A;  3RJH A;  4M6W B;  2KTQ A;  2KZM A;  3WFO A;  2VA8 A;  1S0O A;  1B43 A;  4PGQ A;  5F9N A;  5KFM A;  5KG3 A;  1TVA A;  4J9S A;  4PH5 A;  2C2R A;  2R8J A;  4Z6C A;  4C8N A;  4QZ8 A;  4DQI A;  1NO5 A;  2ZH6 A;  3JPS A;  2C2D A;  9ICU A;  2DR8 A;  2ZTC A;  2AQ4 A;  4NLN A;  3C5F A;  3AQL A;  3C1Y A;  4RNN A;  5KFF A;  8ICU A;  2XC9 A;  2PI4 A;  4XRH A;  3QEB Z;  1TK0 A;  3UPQ A;  3KHG A;  1NOM A;  1TK8 A;  3RAQ A;  2ZJA A;  3AU2 A;  4DS5 A;  3BDP A;  4X4R A;  4QWB A;  4IQU A;  4O5C A;  3NYB A;  3WFS C;  2HW3 A;  5EWE A;  3OSN A;  2BDP A;  1BGX T;  4QWD A;  8ICF A;  2IA6 A;  4QWC A;  5KT6 A;  4XQ8 A;  3G6V A;  5L9X A;  3FDS A;  3K4G A;  3LDA A;  4QWA A;  4ECY A;  1S10 A;  2BPF A;  1MQ3 A;  4UBC A;  3RJF A;  4CCH A;  5KFI A;  4DSJ A;  3H8W A;  1NK6 A;  5DBB A;  7ICS A;  4UD4 A;  4E80 A;  4KN4 A;  1NK7 A;  4QZC A;  4I2E A;  2KZZ A;  4DF8 A;  1KRP A;  3V7K A;  5DG9 A;  4ED8 A;  1WCL A;  3JYY A;  5KFV A;  4TQS A;  4RQ6 A;  4AT7 B;  5HP4 A;  5J2E A;  4F2R A;  4WC7 A;  4IQT A;  1NJY A;  5TZV A;  1F5A A;  2IMW P;  4LZG A;  4PHE A;  3AUO A;  3EWA A;  5DDY A;  3PR5 B;  1KLN A;  1TKD A;  4C8K A;  4M9H A;  2KP7 A;  2BE3 A;  1BPE A;  2DPJ A;  3LK9 A;  4GXI A;  2AU0 A;  1FA0 A;  4B9M A;  4GLX A;  4NKT A;  4NXZ A;  2ZHA A;  4ZH4 A;  1NKE A;  2KN7 A;  1ZQM A;  3GV5 B;  1NJX A;  5DQI A;  3HWT A;  1A77 A;  1ZQU A;  3MBY A;  2Y1J A;  9ICG A;  4WC3 A;  2HHP A;  5IIO A;  4RZR A;  3Q8R B;  4F5N A;  1ZJM A;  4AT7 A;  3PV8 A;  5D46 A;  5KFN A;  3M9M B;  3SZ2 A;  4BDP A;  4C8O A;  1KTQ A;  4Z6E A;  7ICG A;  3UQ2 A;  1QSL A;  4NLK A;  2PFN A;  5BOL A;  2ZUC A;  4UB5 A;  5KFT A;  2ASD A;  8ICT A;  2M2U A;  2ATL A;  3V7J A;  9ICE A;  1DK2 A;  5KFK A;  4PPX A;  5J0S A;  4R8U B;  3JPR A;  3MDA A;  4ED3 A;  4FHP A;  1ZQC A;  2V9W A;  3HPO A;  3MR6 A;  4RQ3 A;  4KLS A;  7ICT A;  1BPB A;  5J0U A;  2XO7 A;  9ICT A;  1UEV A;  3HIY A;  3OUY A;  2ZJ5 A;  5HHI A;  7ICI A;  1KFS A;  9ICQ A;  2DVI A;  1NJZ A;  5KT4 A;  1R8A A;  4QZA A;  2PXI A;  4ED0 A;  2VA3 A;  4KLO A;  4KLH A;  2HVI A;  5KG0 A;  5KFC A;  2V4R A;  5J2F A;  4DQS A;  2XY7 A;  4IRK A;  3ORY A;  4BGD A;  3V6J A;  1XSP A;  1QTM A;  3OVB A;  7ICR A;  4RNM A;  2XGQ A;  4EBD A;  2BCQ A;  5DB9 A;  5KFL A;  3C66 A;  4WC6 A;  5J2B A;  4J9P A;  1DK3 A;  4Q44 A;  1V4A A;  5CR0 A;  3RRH A;  4RWO A;  4IR1 A;  2VA2 A;  2ZH4 A;  2HHX A;  4UD5 A;  1ZQT A;  2P66 A;  9ICS A;  2AGQ A;  1D9D A;  1JQR A;  1D9F A;  4KLI A;  5CP2 A;  5KT3 A;  1MIV A;  7ICM A;  4M04 A;  2R8K A;  3SYZ A;  4ECZ A;  4EP7 A;  5J0W A;  2ID1 A;  5DG8 A;  3RRG A;  5J0Y A;  4RUA A;  3Q8L A;  3Q8M A;  4C8L A;  4RQ4 A;  4X4P A;  4IQW A;  2ZUB A;  1ARO P;  1KDH A;  2HHQ A;  3HP6 A;  4KLG A;  3UXP A;  2ZH3 A;  2BHN A;  3JPO A;  5L1J A;  4ATB B;  4AT8 B;  1ZQG A;  4J9R A;  4KTQ A;  1XU4 A;  4DLE A;  4B9T A;  4KMU A;  2F1J A;  4E8F A;  4NKU A;  1ZQK A;  4XUS A;  4DFP A;  4M9J A;  2HHV A;  5EOZ A;  1Y88 A;  3BQT A;  3H7I A;  4P4O A;  2BCV A;  4DSK A;  4IR9 A;  4O3S A;  1S77 D;  4XQ7 A;  4QZD A;  2ALZ A;  8ICV A;  4EBE A;  4ECS A;  1UEU A;  7ICV A;  5DBC A;  9ICJ A;  5KFQ A;  4BWM A;  5KFH A;  3PW4 A;  4B9V A;  4ECV A;  1N56 A;  4F2S A;  3C18 A;  3EW9 A;  3H4B A;  5DBA A;  3C5G A;  3PVX A;  4WC0 A;  2KFZ A;  3HW8 A;  3HJ1 A;  3RB3 A;  4M5D A;  1U49 A;  4F91 B;  3RTV A;  8ICA A;  1MQ2 A;  1L3V A;  1ZQS A;  5KFX A;  4F4Y A;  1S0N A;  3H8J A;  1ZJN A;  2UVR A;  2C2E A;  3PML A;  5HRL A;  4WCW A;  1ZQV A;  2B21 A;  4O3N A;  4UBB A;  3Q8Q B;  4YMO A;  9ICM A;  2UVW A;  1DGS A;  3T5L A;  2FMP A;  2BR0 A;  2W9M A;  9ICV A;  1T7P A;  2M2W A;  1T8E A;  2O1P A;  5KFP A;  4R63 A;  1NKB A;  5J0X A;  3PMN A;  1NKC A;  1BPZ A;  2DRA A;  5CJ7 A;  5DEC A;  2BCR A;  2F1I A;  4DLG A;  4JUZ A;  4YN4 A;  3EYZ A;  3SV3 A;  1UET A;  3OGU A;  4DL5 A;  4WC1 A;  1S0M A;  1NK0 A;  2ASL A;  3BQ1 A;  4FH3 A;  4RWP A;  2KZ3 A;  2V4Q A;  2C28 A;  4MEY A;  1JXL A;  5DDM A;  2ZH2 A;  4DL3 A;  1LV5 A;  4B9S A;  1HUZ A;  3OHB A;  3PX4 A;  2JZB B;  2HHT A;  4R66 A;  3GIJ A;  3RBE A;  1L3U A;  2FPL A;  1KEJ A;  1Z3E B;  3BJY A;  4FH5 A;  4QZ9 A;  2Y1I A;  1CUK A;  4PGY A;  4KLQ A;  4NM1 A;  1SKR A;  8ICI A;  1X9M A;  1ZQA A;  2HHW A;  1S0V A;  4TUS A;  5DLF A;  4RQ0 A;  7ICL A;  3GIL A;  2NRX A;  3PW2 A;  3MR5 A;  3B0X A;  1VJ7 A;  1ZET A;  3RJG A;  3H37 A;  9ICP A;  4NM2 A;  3ZDD A;  2FPK A;  3MR2 A;  4Q8E A;  8ICS A;  1N48 A;  4YMM A;  4TUP A;  3RJE A;  1CEZ A;  4O9M A;  1R8B A;  4DFM A;  4EBC A;  2PFO A;  4I2G A;  4JV2 A;  9ICI A;  3AQK A;  9ICR A;  4UB2 A;  4WBY A;  1BNP A;  1JXE A;  4J9Q A;  1TV9 A;  4YR0 A;  1C7Y A;  3MR3 A;  1KSP A;  2DR7 A;  1NK9 A;  4FS2 A;  4I2D A;  3TAP A;  4M0A A;  3OVS A;  2FMS A;  3TQ1 A;  4ED7 A;  4PHD A;  3PO4 A;  4F8R A;  1MIW A;  5KFR A;  5DED A;  2ZH7 A;  1S97 A;  1BPX A;  4F4Z A;  9ICO A;  8ICH A;  1BNO A;  3PR4 A;  2IHN A;  3LWL A;  1NJW A;  2A1J A;  4O3P A;  5HRB A;  4X4S A;  5KFG A;  3C2M A;  1XC9 A;  5J2C A;  4ED1 A;  3RB0 A;  2XGP A;  1XS9 D;  4LZD A;  4IQV A;  2RDI A;  4R8U A;  5DQG A;  1JN3 A;  5IIM A;  4GXK A;  1RXW A;  3NTU A;  4R64 A;  3GV8 B;  4S3N A;  2ZTE A;  4PHA A;  4DSL A;  1L3T A;  4RT3 A;  2DR5 A;  2HVH A;  3GDX A;  4M6W A;  5HHH A;  4FHW A;  1A76 A;  1KNY A;  4QZF A;  8ICR A;  2BPC A;  1WCN A;  8ICM A;  1PX5 A;  2ZTD A;  4DL2 A;  1U45 A;  1LB2 B;  4I2J A;  5L1L A;  4DEZ A;  2A1J B;  3ISB A;  2W9A A;  1Q79 A;  5DQH A;  1ZQI A;  5CA7 A;  4F4W A;  1SL0 A;  1L3S A;  4UQG A;  5KFW A;  8ICZ A;  4EYH B;  3OVA A;  4P4P A;  4M9L A;  4I2A A;  1TFW A;  2GWS A;  4MF2 A;  5DLG A;  2DRB A;  3PNC A;  3C23 A;  1RXV A;  4O5K A;  1X9S A;  2JZB A;  5DG7 A;  5J0O A;  2ZUD A;  4P2H A;  3GFK B;  9ICK A;  7ICE A;  1ZQB A;  5KG6 A;  3T3F A;  1RPL A;  2NRZ A;  3B0Y A;  1COO A;  4YXM A;  4FBU A;  4DSI A;  1ZQH A;  4F5P A;  4QW9 A;  4B9U A;  4BXO B;  3BQ0 A;  5J2K A;  3Q8P B;  5HRF A;  1U4B A;  5KFD A;  4DS4 A;  4X4N A;  4HYK A;  5J2H A;  4XA5 A;  2NRK A;  5KFA A;  3OHA A;  3GIK A;  4YFK A;  3H39 A;  4UAZ A;  3ZDC A;  4I27 A;  5CWR A;  8ICB A;  3ZDE A;  5KG4 A;  3EPI A;  3SI8 A;  4ELU A; 
#chains in the Genus database with same CATH topology
 4O3O A;  4OAI Z;  1ZQD A;  1EXN A;  1XSN A;  4RPZ A;  3UM9 A;  4I0U A;  5KT7 A;  1RZT A;  2RDJ A;  3LQC B;  2OHF A;  8ICY A;  2VJ4 A;  5JTI A;  2HDO A;  2WB1 C;  8ICO A;  3JYY A;  3ZD8 A;  1BPD A;  3AQF A;  3Q8K A;  4YXJ A;  2KK0 A;  4J9O A;  2P6R A;  1SKS A;  5DGB A;  4USA A;  9ICF A;  3C1Z A;  1UHU A;  3NRZ A;  3V7L A;  3RH4 A;  4RT2 A;  2JEF A;  3L5K A;  3ZDB A;  3TFS A;  4MHV A;  2JEG A;  2R8I A;  2UVU A;  4DL7 A;  3C28 A;  3ZD9 A;  8ICJ A;  1URJ A;  4X5V A;  4JWM A;  2AGO A;  4K4G A;  3HX0 A;  4KLJ A;  5AKG A;  4LT6 A;  5ALL A;  4O67 A;  4QIW F;  5CB1 A;  3PSI A;  5AKI A;  2EZX A;  1FFV A;  4Y2Y A;  4CF5 A;  2K60 A;  2YTU A;  3QUT A;  4DOA A;  5C5J A;  3QUB A;  4FS1 A;  5HML A;  4HX0 A;  3OV7 A;  2ESE A;  2Q4T A;  2LYH A;  3TAD C;  4OAF A;  2KNJ A;  3MGI A;  3N7S C;  8ICC A;  2Q66 A;  2W9B A;  4DQR A;  1N5X A;  5KG7 A;  4F5O A;  4UAU A;  4KLM A;  1TAU A;  4F93 B;  4X4V A;  9ICN A;  1ZD4 A;  3M7D A;  9ICB A;  3NS1 A;  2KIW A;  4DL6 A;  4YR2 A;  3RB6 A;  3UMG A;  3PX6 A;  3LWM A;  1A0P A;  1ZQX A;  4UAY A;  1N61 A;  1MSW D;  2W9C B;  3E58 A;  4P4M A;  2ZH5 A;  4QZH A;  4O3M A;  4JV1 A;  5BOM A;  2F1H A;  5D4B A;  2BGW A;  3H8S A;  5AK4 A;  4E7X A;  3QZ7 A;  1DRG A;  4UB1 A;  4X4U A;  4K9B A;  3GV7 B;  4J9L A;  2DL0 A;  4KLT A;  2XY6 A;  4JWN A;  3HKZ C;  4YD1 A;  3CYM A;  4M47 A;  4F50 A;  4FHX A;  4J9N A;  3KTQ A;  3TAQ A;  3T5K A;  2RFF A;  2K8A A;  4I2H A;  2DFL A;  3HIL A;  3SMV A;  2UVV A;  5KFY A;  5D49 A;  1ZQE A;  4QZB A;  2H3Z A;  2VKQ A;  4K4H A;  5HMM A;  5L1M A;  2GLE A;  1JX4 A;  3NWI A;  1JIH A;  5KG2 A;  2MA1 A;  2BQ3 A;  2WTF A;  2ASJ A;  4C8M A;  4NLC A;  5KAF U;  3SV4 A;  2QLT A;  2DUY A;  3JPN A;  1U47 A;  1PZN A;  3WFP A;  1R89 A;  1ZD5 A;  1JRP A;  2O6K A;  2MUT B;  1K5O A;  5EWG A;  3WFR E;  4GC6 A;  3TAR A;  1H38 A;  4WC1 A;  8ICK A;  3H4D A;  1WWV A;  3ER8 C;  4GC7 A;  1D8L A;  4QZE A;  2DKZ A;  3BZC A;  2B56 A;  3F2D A;  3THV A;  2KE7 A;  2PFP A;  3H40 A;  3RR8 A;  5AM4 A;  3PY8 A;  7ICU A;  5EE0 A;  3EZ5 A;  4UW9 A;  1YLQ A;  1L5U A;  2R8G A;  4NWI A;  4UB4 A;  2JH7 A;  2ES6 A;  1QSS A;  3KHH A;  3PX0 A;  5ALM A;  3PW0 A;  3T5J A;  4X4O A;  2M2V A;  2IHM A;  4ECR A;  3T79 A;  4FHV A;  2JR5 A;  2E8M A;  4YVZ A;  3IG8 A;  3OUY B;  1K1Q A;  5CFT A;  5CFU A;  3MAB A;  2CN1 A;  5J0Q A;  4LEZ A;  2KZM A;  2VA8 A;  4QNL A;  1B43 A;  1S0O A;  1QQ7 A;  1SXE A;  2R8J A;  2F2A B;  9ICU A;  2DQN B;  2AQ4 A;  3C1Y A;  2PI4 A;  3SEI A;  5CEH A;  2F8L A;  3WFS C;  3OSN A;  3UMC A;  2IA6 A;  4QWC A;  5L9X A;  3LDA A;  1MQ3 A;  4UBC A;  1NK6 A;  5G5H A;  7ICS A;  1NK7 A;  4QZC A;  4I2E A;  4DF8 A;  5AK3 A;  4NL9 A;  4Y2S A;  5DG9 A;  3A0B U;  2IMW P;  4QIW C;  1KLN A;  4M9H A;  2BE3 A;  1OXJ A;  3IRU A;  3OPX A;  2W43 A;  1NKE A;  5KL1 B;  1NJX A;  5DQI A;  1ZQU A;  2Y9T A;  4C7Z A;  2HHP A;  3MC1 A;  1Z1V A;  1XNS A;  4AT7 A;  3PV8 A;  2H3I A;  4C8O A;  3BZK A;  5H2F U;  5ALW A;  1UPH A;  3SR6 A;  3LYS A;  2RRD A;  3SD7 A;  3ERC C;  4R8U B;  3MDA A;  3LVV A;  2V9W A;  2HBK A;  1BPB A;  9ICT A;  4BX9 C;  5HHI A;  5ALD A;  2E1E A;  4ED0 A;  1B0X A;  2HVI A;  1JUD A;  2E8O A;  4K96 A;  2V4R A;  5J2F A;  1XSP A;  2XGQ A;  2BCQ A;  1DK3 A;  1V4A A;  2KVC A;  5CR0 A;  4IR1 A;  2VA2 A;  1QCK A;  4Y2J A;  2AGQ A;  5CP2 A;  5KT3 A;  1MIV A;  4FO1 A;  4Y2V A;  3SYZ A;  2AH5 A;  5J0Y A;  3RRG A;  3Q8L A;  3Q8M A;  5AK5 A;  4RQ4 A;  2KSO B;  2HHQ A;  1ARO P;  3HP6 A;  2LYB A;  4KLG A;  2RP5 A;  2ZH3 A;  2BHN A;  3JPO A;  2B51 A;  1LVH A;  4NKU A;  2W3R A;  4P4O A;  4O3S A;  3KZI U;  4K98 A;  1TFY A;  3PVX A;  1X6J A;  3H8J A;  1F5S A;  2G5I B;  2ZG6 A;  1NI3 A;  1QQ5 A;  4UBB A;  3Q8Q B;  2FE9 A;  2WF7 A;  2Y0S F;  4YMO A;  2FMP A;  1NNL A;  1T8E A;  1BPZ A;  5ALI A;  5J0X A;  3PMN A;  2E5S A;  1A6S A;  2JRZ A;  5ALH A;  4JUZ A;  4YN4 A;  3OGU A;  3BQ1 A;  2V4Q A;  5JRT A;  1KKX A;  3OHB A;  3PX4 A;  2HHT A;  3GIJ A;  1JRO A;  1KEJ A;  4PGY A;  2EAN A;  3PW2 A;  3WKB A;  3RJG A;  3H37 A;  3VC8 A;  4Q8E A;  3AQN A;  3IV6 A;  4AT8 B;  4O9M A;  4EBC A;  3AQK A;  4EEN A;  9ICR A;  2IOH A;  1BNP A;  2XIC A;  1C7Y A;  1T3Q A;  2EAP A;  4KM5 A;  4M0A A;  1SXD A;  3OVS A;  4F8R A;  1ZD3 A;  4PHD A;  4ED7 A;  3EF2 A;  4F4Z A;  3PR4 A;  2LKY A;  1LKY A;  5AIC A;  2KEY A;  4ED1 A;  4C7Y A;  2ZIX A;  2XGP A;  4LZD A;  3QNM A;  4IQV A;  2RDI A;  4R8U A;  2ZIU A;  1RXW A;  3NTU A;  2NO5 A;  4R64 A;  3GV8 B;  4PHA A;  4DSL A;  4RT3 A;  5GTH U;  3IN5 A;  2HVH A;  4M6W A;  1KNY A;  2OH2 A;  3NVV A;  1PX5 A;  1HEK A;  1L8L A;  1LB2 B;  2A1J B;  3ISB A;  2HOQ A;  1ZQI A;  5AKE A;  5KFW A;  4KB6 A;  5AIB A;  5ALE A;  3NVO A;  5DLG A;  3C23 A;  4O5K A;  2IUB A;  2IOF K;  5AHX A;  1ZQB A;  1RPL A;  3B0Y A;  4UAS A;  1COO A;  3DV9 A;  4YXM A;  2KHV A;  4DSI A;  4PZN A;  3BQ0 A;  3ONN A;  5E79 U;  3Q8P B;  5HRF A;  4X4N A;  4DS4 A;  3NUQ A;  4HYK A;  1UCV A;  2NRK A;  3OHA A;  5AI0 A;  2EWR A;  4EX7 A;  1S5L U;  4RQ2 A;  4RWN A;  1KBU A;  1L7N A;  5HNK A;  2NRV A;  1B4F A;  2ZJ8 A;  3Q8S B;  4DSE A;  3V6K A;  4O5E A;  1TK5 A;  2G0A A;  4DFD A;  3TFR A;  4WBZ A;  3PW5 A;  4ECT A;  4US8 A;  3MFH A;  7ICN A;  5ALO A;  4YG2 A;  3RJJ A;  2MAX A;  4IRD A;  1N62 A;  3L9D A;  4DFJ A;  3IP4 B;  5ALN A;  1V9P A;  3ER9 B;  2XVT A;  1X9X A;  7ICQ A;  2W9B B;  2DKX A;  1Z4O A;  4MFF A;  3D2Q A;  3PSP A;  2P6U A;  5DB6 A;  8ICE A;  2KMD A;  2ZIW B;  2JEI A;  2YB4 A;  1IIP A;  1F0M A;  5DB7 A;  5HC9 A;  1TAM A;  3UQ0 A;  2WFA A;  4P0Q A;  5IIL A;  3C29 A;  4DQP A;  1XWL A;  4HAI A;  1N60 A;  4DF4 A;  1WWU A;  2PMZ C;  5J2D A;  2LHT A;  1X66 A;  3TAN A;  1GO3 F;  2HBJ A;  2XY5 A;  2E3T A;  5AM2 A;  1C20 A;  2K8B B;  4I2I A;  4Y2Q A;  2JXJ A;  4Q45 A;  4G9B A;  4LJX A;  8ICX A;  1X40 A;  4YQW A;  5AKZ A;  2LYA A;  1V85 A;  4KMO B;  8ICQ A;  1QQ6 A;  1TAQ A;  5D63 A;  3FC4 A;  4X4T A;  3WKE A;  2LM1 A;  4Y2T A;  5KT2 A;  5J0R A;  4RWQ A;  3PW7 A;  4RQ1 A;  4AYB C;  1VFG A;  4O3R A;  2QB0 A;  4TUR A;  1KFT A;  3SEN A;  2BCS A;  3C2K A;  4KLD A;  4RQ5 A;  2JH1 A;  3KKA A;  4O0I A;  5F2V O;  4E0D A;  3KHL A;  1KW4 A;  4YR3 A;  1U48 A;  4QZI A;  1SKW A;  3QU9 A;  2D8C A;  2OCE A;  2W11 A;  1S9F A;  3RJK A;  4F71 A;  1IM4 A;  3OJU A;  2M0N A;  4QWE A;  3MDC A;  1HIW A;  4Q43 A;  4PZO A;  3L3F X;  3M8R A;  4F3O A;  4MFC A;  2KSO A;  4YP3 A;  4ED2 A;  2K4I A;  2ISP A;  3D2S A;  2HI0 A;  5AKH A;  2MSN A;  4ECU A;  5DB8 A;  3EPG A;  3RH5 A;  4JV0 A;  3UMB A;  4CGZ A;  5AKJ A;  4O3Q A;  4DOC A;  2ISO A;  2C22 A;  4MKP A;  4R65 A;  2G09 A;  4I2B A;  1WOT A;  1UA1 A;  1ZQF A;  3HKZ F;  4EEY A;  5B5E U;  3OJS A;  4JK1 A;  4EBK A;  4OJ5 A;  4UB3 A;  4P0Q B;  4ECQ A;  3WKC A;  1UT8 A;  3KOO A;  4DFK A;  2H5X A;  5KTQ A;  2IHO A;  4AT9 A;  2M9N A;  3RR7 A;  3WK8 A;  1ZQR A;  3JPT A;  3N7P D;  5D61 A;  3NAS A;  3AQM A;  5ALG A;  3TI0 A;  2ZHB A;  4DQQ A;  3RBD A;  5AKX A;  8ICW A;  4FHY A;  4EBJ A;  1IV8 A;  4BJQ A;  1RM6 C;  2RLT A;  3NVZ A;  3RF9 A;  8ICG A;  3IM1 A;  2I9G A;  4ELV A;  3G6Y A;  1ZQJ A;  5L1I A;  3I28 A;  2G07 A;  3ZDA A;  4M2Y A;  8ICN A;  1SZP A;  5EE1 A;  5J0T A;  2A3V A;  3WFO A;  5F9N A;  5KFM A;  2C2R A;  4DQI A;  4C8N A;  4QZ8 A;  1NO5 A;  2ZH6 A;  2E1F A;  2D6F C;  2C2D A;  4NLN A;  3C5F A;  3QU5 A;  2BBH A;  2XC9 A;  1L8O A;  1JI7 A;  2R18 A;  3KHG A;  1TK8 A;  4NXX A;  4O6A A;  4DS5 A;  4QWB A;  2JMG A;  4O5C A;  4EEB A;  2HW3 A;  1PK1 A;  5KT6 A;  4XQ8 A;  3G6V A;  4QWA A;  2BPF A;  3RJF A;  4CCH A;  5KFI A;  1WUD A;  3H8W A;  4DSJ A;  5DBB A;  4UD4 A;  1PK3 A;  1KRP A;  3V7K A;  5ALR A;  1WCL A;  5KFV A;  4TQS A;  5HP4 A;  4UAT A;  4LEW A;  5F3X B;  2NO4 A;  4PHE A;  3AUO A;  3HRD D;  5DDY A;  5AI5 A;  3PR5 B;  2KIC A;  1T94 A;  1BPE A;  1FA0 A;  5GTI U;  4GLX A;  4NXZ A;  3GZF A;  3GV5 B;  1A77 A;  4WC3 A;  9ICG A;  4RZR A;  1ZJM A;  2YY6 A;  4UB6 U;  5D46 A;  5KFN A;  2YML A;  3UQ2 A;  4NLK A;  2G5H B;  2YMQ A;  3N28 A;  2ZUC A;  4KX5 A;  9ICE A;  1DK2 A;  5KFK A;  2MU2 A;  4PPX A;  4FHP A;  4KLS A;  3HPO A;  3MR6 A;  4RQ3 A;  2XO7 A;  4UB8 U;  2ZJ5 A;  7ICI A;  2DVI A;  1O08 A;  2PXI A;  2VA3 A;  5ALS A;  4KLH A;  2YMM A;  4IRK A;  1ED1 A;  4BGD A;  1QTM A;  4EBD A;  5DB9 A;  4RWO A;  2H3Q A;  2VIX A;  1ZQT A;  2P66 A;  4NV0 A;  1FIQ A;  4OJO A;  1F44 A;  7ICM A;  4M04 A;  2HOI A;  4EP7 A;  1PVP A;  3IG5 A;  5DG8 A;  4C8L A;  3KD3 A;  3BS5 B;  1KDH A;  4C4R A;  5ALF A;  3UXP A;  2FI1 A;  4Y2P A;  4B9T A;  2F1J A;  1ZQK A;  4DFP A;  3WK9 A;  5EOZ A;  2LPE A;  3BQT A;  3H7I A;  3HJE A;  3PST A;  4DSK A;  2ALZ A;  3CRX A;  1DGJ A;  8ICV A;  5AM3 A;  3M1Y A;  4BWM A;  4F2S A;  1N56 A;  3C18 A;  2GH1 A;  2ODG A;  3RB3 A;  4CF4 A;  1U49 A;  4F91 B;  3RTV A;  8ICA A;  1MQ2 A;  2QB1 A;  3J81 j;  1ZJN A;  4WCW A;  9ICM A;  1Z19 A;  2UVW A;  9ICV A;  2M2W A;  1NKB A;  2L5Y A;  5B66 U;  2BCR A;  3OWG A;  3SV3 A;  2OXO A;  4DL5 A;  1QH9 A;  1S0M A;  2GOL A;  2EAM A;  4NJ8 A;  3WKD A;  2ZH2 A;  1LV5 A;  1HUZ A;  4BUG A;  5A0L A;  2JZB B;  2AHO B;  2OEH A;  2FPL A;  2ZIW A;  4KLQ A;  1O03 A;  4NM1 A;  1SKR A;  1VJ5 A;  4IS7 A;  8ICI A;  2WAQ F;  4TUS A;  3BS5 A;  4RQ0 A;  5AKL A;  2NRX A;  3B0X A;  3QU7 A;  5T14 A;  4NM2 A;  2FPK A;  5AI9 A;  1R8B A;  1N48 A;  4YMM A;  3RJE A;  1SV0 C;  4DFM A;  2PFO A;  4JV2 A;  3O0F A;  4UB2 A;  1JXE A;  3QXG A;  1NK9 A;  3M6Z A;  2QAR B;  5DED A;  2ZH7 A;  3ETR A;  4B6J A;  5KL8 B;  1BPX A;  8ICH A;  2F77 X;  5HRB A;  4EEL A;  1XC9 A;  2B0C A;  4CF3 A;  5IIM A;  1JN3 A;  4OJL A;  4CDG A;  2EZY A;  2KG5 A;  2HOF A;  3GDX A;  5HHH A;  5AKY A;  8ICR A;  2BPC A;  3AQE A;  5L1L A;  3DDH A;  4DEZ A;  2W9A A;  1Q79 A;  4F4W A;  1SL0 A;  4M9L A;  3QUC A;  2DRB A;  3PNC A;  1X9S A;  4P2H A;  5CHE A;  5J0O A;  3T3F A;  2NRZ A;  4OJP A;  4JLZ A;  3TKA A;  4FBU A;  2HBM A;  4QW9 A;  4B9U A;  4BXO B;  5J2K A;  5TIS U;  1JAL A;  5KFA A;  2QB0 B;  4YFK A;  3ZDC A;  5CWR A;  8ICB A;  3SI8 A;  2K4P A;  3JPP A;  4DL4 A;  5KT5 A;  3I76 A;  3RFA A;  4RPY A;  1OW5 A;  5J0P A;  4EYI B;  5KG5 A;  1ZQW A;  4G3I A;  3UXO A;  3F2B A;  4F4X A;  4C4T A;  2XCA A;  4EX6 A;  4M9G A;  4WOY A;  3TAD A;  4DO9 A;  4Y2X A;  4I2C A;  4EV6 A;  2K4H A;  2J6T A;  4ATB A;  1OU5 A;  2AXT U;  2NRT A;  3QYP A;  4K4I A;  2W03 A;  4B9L A;  4KLF A;  3N97 B;  3RJI A;  4X0A A;  2KKV A;  2M2T A;  4NLG A;  1D8Y A;  4FFD A;  1SL1 A;  1S76 D;  3BS7 A;  8ICP A;  2R8H A;  1XO1 A;  5HR9 A;  3CNH A;  4QZG A;  1X9W A;  3M8S A;  2H3V A;  3QE9 Y;  1RDF A;  2P35 A;  1BVS A;  4DSF A;  3C2L A;  1SV4 A;  5JUM A;  2ZH8 A;  4MFA A;  4RNO A;  2Y0S C;  1JMS A;  2AGP A;  1HUO A;  1YT3 A;  4Z6D A;  4M9N A;  1UA0 A;  3AL0 B;  4J9K A;  4BWJ A;  3GII A;  4DOB A;  4TQR A;  1LKY B;  2FMQ A;  4CRX A;  1RG6 A;  2WF6 A;  2XCP A;  4EZ6 A;  4CNQ A;  7ICP A;  2DF4 B;  1PUZ A;  4FE3 A;  3ISD A;  4YCX A;  3GQC A;  3SAF A;  2PMZ F;  9ICA A;  3RAX A;  2XID A;  4OO1 J;  4Y2U A;  1ZYQ A;  5HRG A;  9ICC A;  7ICK A;  3JCF A;  4RPX A;  3GU3 A;  5DGA A;  3BQ7 A;  4J9M A;  2HHS A;  1N2X A;  3QEA Z;  5HRK A;  2PBE A;  3H38 A;  5KFB A;  1IXR A;  5ALQ A;  4QW8 A;  4X0B A;  1ZXI A;  5III A;  2DWQ A;  3C21 A;  1GPJ A;  4RU9 A;  1T4G A;  5J2A A;  4IRC A;  4PJ0 U;  3MGH A;  2AJQ A;  2BCU A;  4KLL A;  5J2G A;  5HRH A;  4WQK A;  3F5E A;  1HJP A;  1L6N A;  1ZQY A;  5AK6 A;  5JU5 A;  1Q78 A;  2KD1 A;  4KLE A;  1JAJ A;  2J6U A;  3EUB 2;  1RYS A;  4Z6F A;  2I6X A;  5BPC A;  2FLP A;  9ICX A;  3ETL A;  1TFR A;  2PFQ A;  4MF8 A;  2E8N A;  2VAN A;  4F92 B;  3WK5 A;  2G06 A;  4F5Q A;  1NZP A;  4AT8 A;  1SB3 C;  1FEZ A;  4OAH A;  4ED6 A;  1DXS A;  3RH6 A;  3ED5 A;  2HSZ A;  4B9N A;  1KFD A;  3IDW A;  1ZQO A;  2BQU A;  1T3N A;  2B4V A;  5K4L A;  2W55 A;  4I29 A;  2FLL A;  3BQ2 A;  2FPM A;  2FCL A;  5IIK A;  3WK6 A;  2MUT A;  5KFO A;  3R9K A;  5ALX A;  1Z00 B;  3RJH A;  4M6W B;  2KTQ A;  2N1R A;  4J9S A;  4PH5 A;  2D3D A;  3JPS A;  2NYV A;  2ZTC A;  2DR8 A;  2F3N A;  3KBB A;  3AQL A;  4RNN A;  5KFF A;  8ICU A;  4K9A A;  2PKE A;  2LM4 A;  1TK0 A;  3UPQ A;  1NOM A;  3RAQ A;  4P0P A;  2F76 X;  3E0F A;  3NYB A;  5EWE A;  2HN1 A;  3M6K A;  2BDP A;  1BGX T;  4A8E A;  8ICF A;  3K4G A;  1S10 A;  5AI4 A;  1N63 A;  5EE3 A;  5ALZ A;  4ACO A;  1Z1B A;  4ED8 A;  4RQ6 A;  4F2R A;  4QJF B;  3PZP A;  5TZV A;  1NJY A;  4LZG A;  2KFN A;  3EWA A;  4NXT A;  3LK9 A;  3SAH A;  2AU0 A;  1Q3U A;  4NXV A;  4ZH4 A;  2KN7 A;  3MBY A;  2Y1J A;  5IIO A;  3Q8R B;  4F5N A;  3M9M B;  7ICG A;  2QAR A;  1QSL A;  2OM6 A;  5KFT A;  2ASD A;  2ATL A;  3V7J A;  5J0S A;  3JPR A;  2LBO A;  4ED3 A;  1ZQC A;  1KL9 A;  5J0U A;  3OUY A;  1ZRN A;  9ICQ A;  4GIB A;  1NJZ A;  1R8A A;  2NV3 A;  2JHD A;  4QZA A;  5ALU A;  5KG0 A;  5KFC A;  2XY7 A;  5J8Y A;  2IOF A;  3OVB A;  7ICR A;  4RNM A;  5KFL A;  3C66 A;  4Q44 A;  2HHX A;  4UD5 A;  9ICS A;  1D9D A;  4KLI A;  1TE2 A;  2R8K A;  4ECZ A;  5J0W A;  2ID1 A;  4US9 A;  2QKQ A;  2ZUB A;  5L1J A;  4ATB B;  4J9R A;  4KTQ A;  1XU4 A;  4DLE A;  1X6I A;  4KMU A;  2HHV A;  4XUS A;  1J97 A;  4IR9 A;  1S77 D;  2WAQ C;  4QZD A;  3CK6 A;  4ECS A;  5DBC A;  9ICJ A;  2GA9 D;  5KFQ A;  3PW4 A;  4LEV A;  3LVW A;  2MRL A;  4WC0 A;  3EW9 A;  3H4B A;  5DBA A;  2KFZ A;  3HJ1 A;  2ZIV B;  4M5D A;  5AIA A;  1J2N A;  4F4Y A;  2UVR A;  4XJE A;  3PML A;  4OJ6 A;  1ZQV A;  4O3N A;  2K4E A;  2BR0 A;  2W9M A;  4FHW A;  2ZH4 A;  5KFP A;  1PK1 B;  4R63 A;  1NKC A;  5CJ7 A;  2F1I A;  1AQ6 A;  1NK0 A;  4RWP A;  5DDM A;  4B9S A;  2KKP A;  3RBE A;  1L3U A;  4NL9 C;  3BJY A;  4FH5 A;  3D6J A;  1CUK A;  1ZQA A;  5DLF A;  7ICL A;  5ALV A;  3MR5 A;  1ZET A;  8ICS A;  1CEZ A;  5KAI U;  4I2G A;  9ICI A;  4RQM A;  4J9Q A;  1WG8 A;  1KSP A;  3MR3 A;  2DR7 A;  4FS2 A;  3TAP A;  5CRX A;  1MA7 A;  2KV2 A;  3TQ1 A;  3PO4 A;  1MIW A;  5KFR A;  2A19 A;  3ZI4 A;  1YZ7 A;  9ICO A;  1ZRM A;  3LWL A;  2A1J A;  1VDV A;  4O3P A;  4X4S A;  5KFG A;  2K8C B;  4JB3 A;  5J2C A;  3H0L B;  1XS9 D;  4GXK A;  4S3N A;  2A1A A;  1L3T A;  2JGA A;  1Z4N A;  4DCC A;  4QZF A;  1SGG A;  1RQL A;  1IG6 A;  8ICM A;  2EDU A;  2ZTD A;  1U45 A;  5CA7 A;  2KHQ A;  4EYH B;  3OVA A;  4P4P A;  2DGZ A;  1TFW A;  4MF2 A;  2KVS A;  1RXV A;  2O5A A;  2JZB A;  5DG7 A;  2ZUD A;  3GFK B;  4U7C A;  5KG6 A;  4JMU A;  3SQI A;  2WB1 F;  4IC9 A;  1X42 A;  4O68 A;  4XA5 A;  5C0Y A;  3MGV A;  3H39 A;  5KG4 A;  4ELU A;  3PSF A;  1MC8 A;  2W9C A;  3KKA C;  4P0P B;  1BPY A;  3U26 A;  5ALP A;  1FFU A;  2I5H A;  2NRW A;  3FYH A;  2CRX A;  4YD2 A;  7ICH A;  2AQ0 A;  5IIJ A;  5HRI A;  3JPQ A;  5F9L A;  4PL2 A;  4NY8 A;  7ICF A;  4PHP A;  4WC6 A;  4K99 A;  8ICL A;  3S6J A;  3RB4 A;  2IBK A;  4I28 A;  4FZL A;  1ZQZ A;  3ALR A;  3PHZ A;  3K7D A;  2J6S A;  2WF5 A;  3PO5 A;  3SAG A;  2Z7J A;  1NK4 A;  5HRE A;  3CW2 C;  2ZH1 A;  1SWV A;  3F53 A;  4FZN A;  3MFI A;  3V6H A;  2HHU A;  1N5W A;  5KFE A;  4N7R A;  5CFS A;  4NLB A;  1NK8 A;  2FLN A;  4U6P A;  3UPS A;  4Q8F A;  4GXJ A;  3WFQ E;  2PI5 A;  4ECW A;  3QX7 A;  4ELT A;  4UAW A;  5AI8 A;  2HBL A;  4WC5 A;  1ECW A;  2BQR A;  5J2J A;  2JEJ A;  5L1K A;  3FAH A;  3H0M B;  3AU6 A;  1V38 A;  2HCF A;  1FO4 A;  1V97 A;  2BDU A;  3HJ4 A;  3IHQ B;  1MN8 A;  4FO6 A;  2Q0Z X;  4IG8 A;  4UAR A;  4OD0 A;  4YMN A;  5KG1 A;  4RUC A;  3WK4 A;  1X2I A;  5KFZ A;  3N4M B;  2BZF A;  3B9J A;  4RQ8 A;  3OSP A;  3UXN A;  1K1S A;  5AKK A;  4EEK A;  4RQ7 A;  5HRD A;  4MEX A;  3K75 D;  3GIM A;  1YZ6 A;  1UT5 A;  1ZQ1 C;  2KJ8 A;  2CPR A;  4OAG A;  2ZIU B;  4AT9 B;  2GAF D;  4EZ9 A;  2F44 A;  4F72 A;  2DR9 A;  9ICW A;  1U9L A;  1Q8K A;  4BXO A;  1L7M A;  3T5H A;  2BPG A;  3E2E A;  5CHG A;  4AP9 A;  2CXY A;  2W04 A;  2ZIV A;  1MIY A;  4KLU A;  1ZQP A;  2DPI A;  2FJ6 A;  5ALJ A;  5DKW A;  9ICH A;  5G5G A;  2HMX A;  1OUQ A;  2OWO A;  2BKE A;  4GFJ A;  5KFU A;  3QZ8 A;  5IIN A;  5JTG A;  2W7P A;  1R8C A;  1ZQQ A;  7ICO A;  1COK A;  5KFS A;  3OTQ A;  4KIT B;  5J2I A;  1XO0 A;  2OYY A;  4F4K A;  1ZQL A;  1M6Y A;  1S8O A;  4OCZ A;  4WC4 A;  4EED A;  2W7O A;  4WC2 A;  3JZ0 A;  1DOQ A;  1RYR A;  3KFU F;  3FM9 A;  2KIV A;  4LVS A;  5J29 A;  3NKU A;  3WK7 A;  4PGX A;  4I2F A;  1B22 A;  2KJ9 A;  4F5R A;  3V72 A;  4KN7 A;  4DWI A;  5EWF A;  2I1Q A;  1QLN A;  1NZB A;  9ICL A;  1ZQN A;  5B3Q A;  3HT3 A;  1Z00 A;  3M9O B;  4FBT A;  5AM1 A;  7ICJ A;  2W8L A;  4WH5 A;  2Y9U A;  3KHR A;  4Y2R A;  3AEV A;  2ZH9 A;  3H3A A;  1XSL A;  4TUQ A;  3NGD A;  4IL6 U;  2E8P A;  4NLZ A;  5KFJ A;  2B6G A;  4C0Z A;  1QSY A;  3AM9 A;  3M9N B;  4ECX A;  2W8K A;  5B3P A;  3G6X A;  3ISC A;  1RQN A;  1NK5 A;  1L7P A;  4FZM A;  1SL2 A;  3ICX A;  4PGQ A;  5KG3 A;  1TVA A;  4Z6C A;  4PL1 A;  3KZX A;  3VCB A;  5HR6 A;  1SIJ A;  4XRH A;  3QEB Z;  2ZJA A;  3AU2 A;  3BDP A;  4X4R A;  4IQU A;  1ZOL A;  2W54 A;  4QWD A;  4ECY A;  3F5A A;  3FDS A;  4O69 A;  4E80 A;  4KN4 A;  3DEE A;  2F8K A;  2KZZ A;  5AM0 A;  1PVQ A;  2JV3 A;  3AMZ A;  4AT7 B;  4JLX A;  5J2E A;  5D62 A;  4WC7 A;  3I1Y A;  2RQ5 A;  3QUQ A;  4IQT A;  1F5A A;  2FDR A;  2VJ5 A;  5ALK A;  4C8K A;  2KP7 A;  1TKD A;  2DPJ A;  4C4S A;  4GXI A;  5KNI A;  4B9M A;  4NKT A;  1RYU A;  4EGW A;  2ZHA A;  4WQL A;  1ZQM A;  3HWT A;  2BBJ A;  5AM5 A;  1Q46 A;  2EH9 A;  3SZ2 A;  4BDP A;  1KTQ A;  3AN1 A;  4Z6E A;  2KOB A;  4K97 A;  2PFN A;  5BOL A;  2H3F A;  4UB5 A;  8ICT A;  2K89 A;  2M2U A;  5ALY A;  2LI6 A;  1SV0 A;  7ICT A;  3H0R B;  3NVW A;  1UEV A;  3HIY A;  1ZD2 P;  4C80 A;  1KFS A;  3K1R B;  2YB1 A;  5KT4 A;  2EZZ A;  4KLO A;  3WKA A;  4DQS A;  1CRX A;  2HN2 A;  3ORY A;  2ZXH A;  3V6J A;  1L7O A;  4RQN A;  5J8Y C;  1CI4 A;  4AYB F;  1SZH A;  5J2B A;  4J9P A;  3RRH A;  3CP8 A;  1JQR A;  1D9F A;  2YQE A;  4KX3 A;  3NVY A;  2WF8 A;  4RUA A;  4X4P A;  4IQW A;  3K1Z A;  1WYG A;  2ZIX B;  4NXW A;  1ZQG A;  1Q3V A;  1D8B A;  4E8F A;  4M9J A;  1Y88 A;  2BCV A;  4XQ7 A;  4EBE A;  1UEU A;  7ICV A;  4B9V A;  5KFH A;  1KN5 A;  4ECV A;  3C5G A;  4NXU A;  2XI9 A;  3HW8 A;  1KQQ A;  1L3V A;  2YMP A;  1ZQS A;  5KFX A;  3A0H U;  1S0N A;  2C2E A;  5HRL A;  2B21 A;  1P7D A;  2KJ5 A;  1DGS A;  3T5L A;  2G08 A;  2O1P A;  5AI6 A;  1T7P A;  4X4Q A;  2DRA A;  5DEC A;  2EAO A;  4DLG A;  3EYZ A;  1UET A;  2EQY A;  3D2N A;  2ASL A;  4FH3 A;  3QU4 A;  2KZ3 A;  2C28 A;  1JXL A;  4MEY A;  4DL3 A;  3H8M A;  4R66 A;  1Z3E B;  4QZ9 A;  5ALT A;  2Y1I A;  2WHE A;  1X9M A;  2HHW A;  1S0V A;  4J03 A;  2GO7 A;  3GIL A;  1VJ7 A;  3TAC B;  9ICP A;  3ZDD A;  5FP0 A;  2YN4 A;  3MR2 A;  4TUP A;  3QU2 A;  2YX8 A;  4WBY A;  1TV9 A;  4YR0 A;  4I2D A;  3F2C A;  2FMS A;  2W3S A;  4ZOH C;  2DBY A;  1BNO A;  1S97 A;  1J2M A;  1SWW A;  2IHN A;  1NJW A;  3MCR A;  3N7R C;  3C2M A;  3RB0 A;  5DQG A;  2ZTE A;  4UAV A;  2DR5 A;  3WU2 U;  1A76 A;  3L4P A;  4K8V A;  2LMR A;  1WCN A;  4DL2 A;  4I2J A;  2ZXI A;  5DQH A;  1VLB A;  1L3S A;  4UQG A;  8ICZ A;  4I2A A;  2GWS A;  5EE9 A;  1UQV A;  9ICK A;  7ICE A;  3NRW A;  4ICA A;  5HR7 A;  1ZQH A;  4F5P A;  1U4B A;  5KFD A;  5J2H A;  1PVR A;  4CE6 A;  2WF9 A;  3GIK A;  4LEY A;  4UAZ A;  4I27 A;  3ZDE A;  4WJ3 B;  3EPI A;  2RHF A; 
#chains in the Genus database with same CATH homology
 4RQ2 A;  1MC8 A;  2W9C A;  4O3O A;  4RWN A;  5HNK A;  2NRV A;  3JPP A;  4DL4 A;  1ZQD A;  5KT5 A;  2ZJ8 A;  1BPY A;  3Q8S B;  4DSE A;  1EXN A;  3V6K A;  1XSN A;  4O5E A;  4RPY A;  1TK5 A;  4RPZ A;  4EYI B;  2NRW A;  3FYH A;  5J0P A;  5KT7 A;  1RZT A;  2RDJ A;  3TFR A;  5KG5 A;  1ZQW A;  3LQC B;  4YD2 A;  7ICH A;  8ICY A;  4G3I A;  2AQ0 A;  5IIJ A;  4WBZ A;  3UXO A;  4F4X A;  2XCA A;  5HRI A;  3PW5 A;  3JPQ A;  3ZD8 A;  1BPD A;  4ECT A;  3Q8K A;  4YXJ A;  5F9L A;  4NY8 A;  4J9O A;  4PHP A;  7ICF A;  2P6R A;  3MFH A;  1SKS A;  4M9G A;  7ICN A;  8ICL A;  5DGB A;  4YG2 A;  3RB4 A;  2IBK A;  3RJJ A;  3C1Z A;  4I28 A;  9ICF A;  4DO9 A;  1ZQZ A;  2MAX A;  4IRD A;  4I2C A;  3L9D A;  4DFJ A;  2J6S A;  3V7L A;  3RH4 A;  2J6T A;  3PO5 A;  4ATB A;  1V9P A;  4RT2 A;  2JEF A;  1OU5 A;  7ICQ A;  2NRT A;  2W9B B;  1NK4 A;  5HRE A;  3ZDB A;  3TFS A;  4X4Q A;  4MFF A;  2ZH1 A;  2JEG A;  2R8I A;  2UVU A;  2P6U A;  4K4I A;  5DB6 A;  3MFI A;  3V6H A;  4B9L A;  4KLF A;  8ICE A;  2JEI A;  2HHU A;  2O5A A;  5KFE A;  5HC9 A;  5DB7 A;  3N97 B;  4DL7 A;  3ZD9 A;  3RJI A;  8ICJ A;  3UQ0 A;  4X0A A;  4X5V A;  4JWM A;  5IIL A;  2AGO A;  4K4G A;  3HX0 A;  1NK8 A;  2FLN A;  2M2T A;  4DQP A;  4NLG A;  4KLJ A;  4LT6 A;  3UPS A;  1D8Y A;  4Q8F A;  1XWL A;  4GXJ A;  3WFQ E;  1SL1 A;  2PI5 A;  1S76 D;  5CB1 A;  4ECW A;  4DF4 A;  8ICP A;  2R8H A;  5J2D A;  4ELT A;  1XO1 A;  5HR9 A;  3TAN A;  4UAW A;  4QZG A;  4DOA A;  5C5J A;  1X9W A;  4WC5 A;  4FS1 A;  5HML A;  3M8S A;  2XY5 A;  3QE9 Y;  2BQR A;  3OV7 A;  5J2J A;  2JEJ A;  1BVS A;  5L1K A;  4DSF A;  3C2L A;  2LYH A;  4I2I A;  1TFY A;  4Q45 A;  3AU6 A;  8ICX A;  5JUM A;  3MGI A;  8ICC A;  4YQW A;  2Q66 A;  2W9B A;  3HJ4 A;  4DQR A;  3IHQ B;  5KG7 A;  4RNO A;  4MFA A;  4F5O A;  2ZH8 A;  1JMS A;  4KLM A;  8ICO A;  4FO6 A;  1TAU A;  2Q0Z X;  2AGP A;  1HUO A;  4M9N A;  4Z6D A;  4F93 B;  1UA0 A;  4IG8 A;  4X4V A;  9ICN A;  4YMN A;  8ICQ A;  1TAQ A;  5KG1 A;  4RUC A;  4BWJ A;  4J9K A;  9ICB A;  1X2I A;  5KFZ A;  3GII A;  3N4M B;  4X4T A;  4DL6 A;  4YR2 A;  3RB6 A;  4DOB A;  4TQR A;  4RQ8 A;  3OSP A;  2FMQ A;  3AQN A;  3UXN A;  5KT2 A;  2XCP A;  3PX6 A;  3LWM A;  4EZ6 A;  7ICP A;  5J0R A;  1K1S A;  1ZQX A;  4UAY A;  4RWQ A;  4RQ7 A;  3PW7 A;  2W9C B;  4RQ1 A;  1MSW D;  5HRD A;  4P4M A;  2ZH5 A;  4MEX A;  4QZH A;  3ISD A;  4JV1 A;  5BOM A;  4YCX A;  2F1H A;  1VFG A;  5D4B A;  3K75 D;  4O3R A;  3GIM A;  2BGW A;  1UT5 A;  3H8S A;  4E7X A;  3GQC A;  4TUR A;  1KFT A;  3QZ7 A;  2BCS A;  4AT9 B;  9ICA A;  4UB1 A;  3C2K A;  4KLD A;  4EZ9 A;  4X4U A;  3RAX A;  2DR9 A;  4RQ5 A;  9ICW A;  1U9L A;  3GV7 B;  4O0I A;  4J9L A;  4BXO A;  5F2V O;  4E0D A;  4KLT A;  2XY6 A;  4JWN A;  3KHL A;  3T5H A;  1ZYQ A;  4YR3 A;  2BPG A;  5CHG A;  1U48 A;  4YD1 A;  3E2E A;  4QZI A;  5HRG A;  1SKW A;  9ICC A;  1MIY A;  7ICK A;  4KLU A;  1ZQP A;  2DPI A;  4M47 A;  4F50 A;  4RPX A;  4FHX A;  4J9N A;  3KTQ A;  3TAQ A;  3T5K A;  5DGA A;  2RFF A;  1S9F A;  5DKW A;  9ICH A;  3RJK A;  4J9M A;  1IM4 A;  2HHS A;  2OWO A;  2BKE A;  4I2H A;  5KFU A;  3QZ8 A;  3OJU A;  2DFL A;  5IIN A;  3QEA Z;  5HRK A;  2PBE A;  3H38 A;  2UVV A;  5KFY A;  1R8C A;  1ZQQ A;  5D49 A;  1ZQE A;  7ICO A;  4QWE A;  3MDC A;  4QZB A;  5KFB A;  4K4H A;  1IXR A;  5HMM A;  4Q43 A;  5KFS A;  3M8R A;  1JX4 A;  4KIT B;  1JIH A;  4QW8 A;  5KG2 A;  2BQ3 A;  5J2I A;  2WTF A;  2ASJ A;  4X0B A;  4C8M A;  4F3O A;  4MFC A;  4YP3 A;  4ED2 A;  2ISP A;  3SV4 A;  5III A;  4F4K A;  1ZQL A;  3JPN A;  5DB8 A;  3C21 A;  3EPG A;  4JV0 A;  1PZN A;  4ECU A;  3RH5 A;  1U47 A;  1R89 A;  3WFP A;  4WC4 A;  4RU9 A;  1T4G A;  4WC2 A;  4O3Q A;  3JZ0 A;  1DOQ A;  4DOC A;  5J2A A;  1RYR A;  4IRC A;  4LVS A;  2ISO A;  2MUT B;  2KFN A;  2C22 A;  5J29 A;  3MGH A;  2AJQ A;  5EWG A;  2BCU A;  4KLL A;  5J2G A;  4R65 A;  4PGX A;  4I2F A;  5HRH A;  3WFR E;  1HJP A;  4GC6 A;  3TAR A;  1H38 A;  4I2B A;  4F5R A;  1UA1 A;  3H4D A;  3V72 A;  1ZQF A;  8ICK A;  1ZQY A;  1B22 A;  4EEY A;  4GC7 A;  4KN7 A;  1D8L A;  3OJS A;  4QZE A;  1Q78 A;  4JK1 A;  5EWF A;  4DWI A;  4KLE A;  2I1Q A;  1QLN A;  1JAJ A;  2J6U A;  4EBK A;  1RYS A;  9ICL A;  4Z6F A;  4UB3 A;  5BPC A;  1ZQN A;  4ECQ A;  2FLP A;  3HT3 A;  3THV A;  9ICX A;  2PFP A;  3ETL A;  1UT8 A;  1TFR A;  1Z00 A;  3H40 A;  4DFK A;  2H5X A;  2PFQ A;  5KTQ A;  3M9O B;  4MF8 A;  3RR8 A;  4FBT A;  3PY8 A;  4AT9 A;  2VAN A;  2M9N A;  7ICU A;  3RR7 A;  7ICJ A;  2W8L A;  4F92 B;  1ZQR A;  3EZ5 A;  3KHR A;  4F5Q A;  3JPT A;  1NZP A;  1YLQ A;  4AT8 A;  2ZH9 A;  3H3A A;  1XSL A;  4ED6 A;  1L5U A;  2R8G A;  3RH6 A;  3AQM A;  3TI0 A;  4B9N A;  4UB4 A;  1KFD A;  4TUQ A;  3NGD A;  2ZHB A;  4DQQ A;  1QSS A;  3RBD A;  8ICW A;  1ZQO A;  3KHH A;  4FHY A;  3PX0 A;  4NLZ A;  4EBJ A;  2BQU A;  1T3N A;  5KFJ A;  3T5J A;  3PW0 A;  4I29 A;  2M2V A;  2FLL A;  2IHM A;  4X4O A;  3BQ2 A;  4ECR A;  2FPM A;  4FHV A;  8ICG A;  3IM1 A;  1QSY A;  2I9G A;  5IIK A;  3G6Y A;  1ZQJ A;  4ELV A;  3M9N B;  2MUT A;  4YVZ A;  2W8K A;  5L1I A;  4ECX A;  5KFO A;  3G6X A;  1WOT A;  1K1Q A;  3OUY B;  3ISC A;  3MAB A;  1NK5 A;  3ZDA A;  1Z00 B;  4M2Y A;  8ICN A;  1SZP A;  5J0Q A;  1SL2 A;  5J0T A;  3RJH A;  4M6W B;  2KTQ A;  2KZM A;  3WFO A;  2VA8 A;  1S0O A;  1B43 A;  4PGQ A;  5F9N A;  5KFM A;  5KG3 A;  1TVA A;  4J9S A;  4PH5 A;  2C2R A;  2R8J A;  4Z6C A;  4C8N A;  4QZ8 A;  4DQI A;  1NO5 A;  2ZH6 A;  3JPS A;  2C2D A;  9ICU A;  2DR8 A;  2ZTC A;  2AQ4 A;  4NLN A;  3C5F A;  3AQL A;  3C1Y A;  4RNN A;  5KFF A;  8ICU A;  2XC9 A;  2PI4 A;  4XRH A;  3QEB Z;  1TK0 A;  3UPQ A;  3KHG A;  1NOM A;  1TK8 A;  3RAQ A;  2ZJA A;  3AU2 A;  4DS5 A;  3BDP A;  4X4R A;  4QWB A;  4IQU A;  4O5C A;  3NYB A;  3WFS C;  2HW3 A;  5EWE A;  3OSN A;  2BDP A;  1BGX T;  4QWD A;  8ICF A;  2IA6 A;  4QWC A;  5KT6 A;  4XQ8 A;  3G6V A;  5L9X A;  3FDS A;  3K4G A;  3LDA A;  4QWA A;  4ECY A;  1S10 A;  2BPF A;  1MQ3 A;  4UBC A;  3RJF A;  4CCH A;  5KFI A;  4DSJ A;  3H8W A;  1NK6 A;  5DBB A;  7ICS A;  4UD4 A;  4E80 A;  4KN4 A;  1NK7 A;  4QZC A;  4I2E A;  2KZZ A;  4DF8 A;  1KRP A;  3V7K A;  5DG9 A;  4ED8 A;  1WCL A;  3JYY A;  5KFV A;  4TQS A;  4RQ6 A;  4AT7 B;  5HP4 A;  5J2E A;  4F2R A;  4WC7 A;  4IQT A;  1NJY A;  5TZV A;  1F5A A;  2IMW P;  4LZG A;  4PHE A;  3AUO A;  3EWA A;  5DDY A;  3PR5 B;  1KLN A;  1TKD A;  4C8K A;  4M9H A;  2KP7 A;  2BE3 A;  1BPE A;  2DPJ A;  3LK9 A;  4GXI A;  2AU0 A;  1FA0 A;  4B9M A;  4GLX A;  4NKT A;  4NXZ A;  2ZHA A;  4ZH4 A;  1NKE A;  2KN7 A;  1ZQM A;  3GV5 B;  1NJX A;  5DQI A;  3HWT A;  1A77 A;  1ZQU A;  3MBY A;  2Y1J A;  9ICG A;  4WC3 A;  2HHP A;  5IIO A;  4RZR A;  3Q8R B;  4F5N A;  1ZJM A;  4AT7 A;  3PV8 A;  5D46 A;  5KFN A;  3M9M B;  3SZ2 A;  4BDP A;  4C8O A;  1KTQ A;  4Z6E A;  7ICG A;  3UQ2 A;  1QSL A;  4NLK A;  2PFN A;  5BOL A;  2ZUC A;  4UB5 A;  5KFT A;  2ASD A;  8ICT A;  2M2U A;  2ATL A;  3V7J A;  9ICE A;  1DK2 A;  5KFK A;  4PPX A;  5J0S A;  4R8U B;  3JPR A;  3MDA A;  4ED3 A;  4FHP A;  1ZQC A;  2V9W A;  3HPO A;  3MR6 A;  4RQ3 A;  4KLS A;  7ICT A;  1BPB A;  5J0U A;  2XO7 A;  9ICT A;  1UEV A;  3HIY A;  3OUY A;  2ZJ5 A;  5HHI A;  7ICI A;  1KFS A;  9ICQ A;  2DVI A;  1NJZ A;  5KT4 A;  1R8A A;  4QZA A;  2PXI A;  4ED0 A;  2VA3 A;  4KLO A;  4KLH A;  2HVI A;  5KG0 A;  5KFC A;  2V4R A;  5J2F A;  4DQS A;  2XY7 A;  4IRK A;  3ORY A;  4BGD A;  3V6J A;  1XSP A;  1QTM A;  3OVB A;  7ICR A;  4RNM A;  2XGQ A;  4EBD A;  2BCQ A;  5DB9 A;  5KFL A;  3C66 A;  4WC6 A;  5J2B A;  4J9P A;  1DK3 A;  4Q44 A;  1V4A A;  5CR0 A;  3RRH A;  4RWO A;  4IR1 A;  2VA2 A;  2ZH4 A;  2HHX A;  4UD5 A;  1ZQT A;  2P66 A;  9ICS A;  2AGQ A;  1D9D A;  1JQR A;  1D9F A;  4KLI A;  5CP2 A;  5KT3 A;  1MIV A;  7ICM A;  4M04 A;  2R8K A;  3SYZ A;  4ECZ A;  4EP7 A;  5J0W A;  2ID1 A;  5DG8 A;  3RRG A;  5J0Y A;  4RUA A;  3Q8L A;  3Q8M A;  4C8L A;  4RQ4 A;  4X4P A;  4IQW A;  2ZUB A;  1ARO P;  1KDH A;  2HHQ A;  3HP6 A;  4KLG A;  3UXP A;  2ZH3 A;  2BHN A;  3JPO A;  5L1J A;  4ATB B;  4AT8 B;  1ZQG A;  4J9R A;  4KTQ A;  1XU4 A;  4DLE A;  4B9T A;  4KMU A;  2F1J A;  4E8F A;  4NKU A;  1ZQK A;  4XUS A;  4DFP A;  4M9J A;  2HHV A;  5EOZ A;  1Y88 A;  3BQT A;  3H7I A;  4P4O A;  2BCV A;  4DSK A;  4IR9 A;  4O3S A;  1S77 D;  4XQ7 A;  4QZD A;  2ALZ A;  8ICV A;  4EBE A;  4ECS A;  1UEU A;  7ICV A;  5DBC A;  9ICJ A;  5KFQ A;  4BWM A;  5KFH A;  3PW4 A;  4B9V A;  4ECV A;  1N56 A;  4F2S A;  3C18 A;  3EW9 A;  3H4B A;  5DBA A;  3C5G A;  3PVX A;  4WC0 A;  2KFZ A;  3HW8 A;  3HJ1 A;  3RB3 A;  4M5D A;  1U49 A;  4F91 B;  3RTV A;  8ICA A;  1MQ2 A;  1L3V A;  1ZQS A;  5KFX A;  4F4Y A;  1S0N A;  3H8J A;  1ZJN A;  2UVR A;  2C2E A;  3PML A;  5HRL A;  4WCW A;  1ZQV A;  2B21 A;  4O3N A;  4UBB A;  3Q8Q B;  4YMO A;  9ICM A;  2UVW A;  1DGS A;  3T5L A;  2FMP A;  2BR0 A;  2W9M A;  9ICV A;  1T7P A;  2M2W A;  1T8E A;  2O1P A;  5KFP A;  4R63 A;  1NKB A;  5J0X A;  3PMN A;  1NKC A;  1BPZ A;  2DRA A;  5CJ7 A;  5DEC A;  2BCR A;  2F1I A;  4DLG A;  4JUZ A;  4YN4 A;  3EYZ A;  3SV3 A;  1UET A;  3OGU A;  4DL5 A;  4WC1 A;  1S0M A;  1NK0 A;  2ASL A;  3BQ1 A;  4FH3 A;  4RWP A;  2KZ3 A;  2V4Q A;  2C28 A;  4MEY A;  1JXL A;  5DDM A;  2ZH2 A;  4DL3 A;  1LV5 A;  4B9S A;  1HUZ A;  3OHB A;  3PX4 A;  2JZB B;  2HHT A;  4R66 A;  3GIJ A;  3RBE A;  1L3U A;  2FPL A;  1KEJ A;  1Z3E B;  3BJY A;  4FH5 A;  4QZ9 A;  2Y1I A;  1CUK A;  4PGY A;  4KLQ A;  4NM1 A;  1SKR A;  8ICI A;  1X9M A;  1ZQA A;  2HHW A;  1S0V A;  4TUS A;  5DLF A;  4RQ0 A;  7ICL A;  3GIL A;  2NRX A;  3PW2 A;  3MR5 A;  3B0X A;  1VJ7 A;  1ZET A;  3RJG A;  3H37 A;  9ICP A;  4NM2 A;  3ZDD A;  2FPK A;  3MR2 A;  4Q8E A;  8ICS A;  1N48 A;  4YMM A;  4TUP A;  3RJE A;  1CEZ A;  4O9M A;  1R8B A;  4DFM A;  4EBC A;  2PFO A;  4I2G A;  4JV2 A;  9ICI A;  3AQK A;  9ICR A;  4UB2 A;  4WBY A;  1BNP A;  1JXE A;  4J9Q A;  1TV9 A;  4YR0 A;  1C7Y A;  3MR3 A;  1KSP A;  2DR7 A;  1NK9 A;  4FS2 A;  4I2D A;  3TAP A;  4M0A A;  3OVS A;  2FMS A;  3TQ1 A;  4ED7 A;  4PHD A;  3PO4 A;  4F8R A;  1MIW A;  5KFR A;  5DED A;  2ZH7 A;  1S97 A;  1BPX A;  4F4Z A;  9ICO A;  8ICH A;  1BNO A;  3PR4 A;  2IHN A;  3LWL A;  1NJW A;  2A1J A;  4O3P A;  5HRB A;  4X4S A;  5KFG A;  3C2M A;  1XC9 A;  5J2C A;  4ED1 A;  3RB0 A;  2XGP A;  1XS9 D;  4LZD A;  4IQV A;  2RDI A;  4R8U A;  5DQG A;  1JN3 A;  5IIM A;  4GXK A;  1RXW A;  3NTU A;  4R64 A;  3GV8 B;  4S3N A;  2ZTE A;  4PHA A;  4DSL A;  1L3T A;  4RT3 A;  2DR5 A;  2HVH A;  3GDX A;  4M6W A;  5HHH A;  4FHW A;  1A76 A;  1KNY A;  4QZF A;  8ICR A;  2BPC A;  1WCN A;  8ICM A;  1PX5 A;  2ZTD A;  4DL2 A;  1U45 A;  1LB2 B;  4I2J A;  5L1L A;  4DEZ A;  2A1J B;  3ISB A;  2W9A A;  1Q79 A;  5DQH A;  1ZQI A;  5CA7 A;  4F4W A;  1SL0 A;  1L3S A;  4UQG A;  5KFW A;  8ICZ A;  4EYH B;  3OVA A;  4P4P A;  4M9L A;  4I2A A;  1TFW A;  2GWS A;  4MF2 A;  5DLG A;  2DRB A;  3PNC A;  3C23 A;  1RXV A;  4O5K A;  1X9S A;  2JZB A;  5DG7 A;  5J0O A;  2ZUD A;  4P2H A;  3GFK B;  9ICK A;  7ICE A;  1ZQB A;  5KG6 A;  3T3F A;  1RPL A;  2NRZ A;  3B0Y A;  1COO A;  4YXM A;  4FBU A;  4DSI A;  1ZQH A;  4F5P A;  4QW9 A;  4B9U A;  4BXO B;  3BQ0 A;  5J2K A;  3Q8P B;  5HRF A;  1U4B A;  5KFD A;  4DS4 A;  4X4N A;  4HYK A;  5J2H A;  4XA5 A;  2NRK A;  5KFA A;  3OHA A;  3GIK A;  4YFK A;  3H39 A;  4UAZ A;  3ZDC A;  4I27 A;  5CWR A;  8ICB A;  3ZDE A;  5KG4 A;  3EPI A;  3SI8 A;  4ELU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...