4Z6KA

Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
345
structure length
345
Chain Sequence
MKAAVLHEFGQSLQIEEVDIPTPGAGEIVVKMQASGVCHTDLHAVEGDWPVKPSPPFIPGHEGVGLITAVGEGVTHVKEGDRVGVAWLYSACGHCTHCLGGWETLCESQQNSGYSVNGSFAEYVLANANYVGIIPESVDSIEIAPVLCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHMAVQYAIAMGLNVAAVDIDDDKLAFAKKLGAKVTVNAKNTDPAEYLQKEIGGAHGALVTAVSAKAFDQALSMLRRGGTLVCNGLPPGDFPVSIFDTVLNGITIRGSIVGTRLDLQESLDMAAAGKVKATVTAEPLENINDIFERMRQGKIEGRIVIDYTMLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title Structure of alcohol dehydrogenase from the antarctic psychrophile Moraxella sp. TAE123
rcsb
source organism Moraxella sp. (strain tae123)
molecule tags Oxidoreductase
total genus 112
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z6kA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4z6kA01
1KBZA 3ZHYA 2WYWA 3TZKA 3H9GA 4IJVA 4J2OA 5FEUA 2GZ1A 3NT4A 4BB6A 2DBZA 3N7UA 3R3JA 3RBVA 4AFNA 6ADHA 2C5EA 2V6GA 2C29D 3IC5A 2AQIA 2EKLA 2Z1MA 4A5OA 1L7DA 4XX0A 3ROPA 4NFHA 1KVRA 2AEFA 2O3TA 3A06A 5JYDA 1JA9A 2C59A 4P4GA 1KEVA 3DBRA 3E48A 3P7MA 1HT0A 4JXKA 4BL5A 3AFNA 2CDBA 3ZN2A 4AJLA 1H6DA 1SMKA 3L6DA 2QRLA 3AW9A 5I8WA 4MIOA 2H1SA 3GHYA 2IZ0A 3AOGA 2AG8A 3GRKA 3DXFA 4XJSA 4BGVA 3TSCA 4Z3KA 5IDWA 2I6TA 4GGPA 4RPJA 3ZWWA 2FPPA 4B3JA 1NFQA 4KTTE 1YL5A 2AQHA 3JQAD 4A7PA 3C7DB 4CLDA 3RUFA 1TEHA 1ZBQA 4J7XA 4DPLA 3WWYA 2DM6A 5H81A 1ZJYA 4X54A 1EQ2A 2DLDA 2YYYA 4GMFA 4R9SA 5JE8A 4I5FA 4Y67A 4U8GA 2FHSA 4CUJA 4HBGA 4B79A 4WLOA 1GAEO 2I9PA 3GNQA 2IYPA 2DPGA 3GMSA 2HK8A 3A9WA 1R4NA 3WGYA 5CDUA 4FFNA 3KETA 4LRSB 3QE3A 3DL2A 4ZICA 4R51A 2VWHA 1JQBA 5L45A 3FHLA 3IP3A 5IJZA 5IN4A 2VT3A 1MFPA 5F21A 1GY8A 5FI3A 4B7CA 4K1LA 4YR9A 1JAYA 4RCVA 4JJGA 1NHGA 2JFHA 3TZ6A 1I3KA 3CSDA 4XR4A 2RHRA 3C1OA 3VH4A 5HS6A 3ZCXA 1NX6A 1PS9A 2OXIA 2CVOA 4YAIA 3ZHXA 2VYVD 3LLSA 1NFFA 1N5DA 1RYEA 3LZ6A 2YV1A 3LF1A 3BMCA 3LVFO 2NTJA 3HG7A 3ASVA 4PFJA 3PLNA 3GLQA 2X9GA 2ZB4A 2YDXA 3EGOA 4AJIA 5ILGA 4BNKA 3BA1A 4RF4A 1IOLA 1GV0A 1KS9A 3ZNOA 3JQ6A 2DBVO 1LC3A 2RH4A 5K9ZA 1E7WA 1LC0A 1WLYA 2GN8A 1VKOA 1ADCA 1PWXA 2IEBA 2NSDA 3D3WB 4I5EA 4L75A 4NBRA 4XGNA 3S2IA 1LDBA 4I1IA 4R1UA 2E49A 3PRJA 3WNQA 2WTBA 5C7OO 4MP6A 3L4BA 4DQVA 4TRJA 2HDHA 1ZZEA 3I9MA 4MVJM 5LDHA 5BSEA 1PR9A 5JC1A 2NU8A 5K1SA 1IUKA 3DFUA 3UCXA 4UEKA 1X14A 3JD2A 2J5RA 1GUYA 3IDSA 2O3UA 2EKPA 1GZ3A 2XAAA 3IKVA 1PJSA 1UAYA 2HJRA 4MIEA 2EXXA 5CHEA 3U4IA 1R4MB 2DUWA 2X8LA 3DAFA 1Y8RB 1B14A 4I9NA 2X5OA 4G5HA 3NTOA 4J3FA 4R3WA 5GY7A 3H8VA 4L8VA 4WLEA 3D4NA 3OA0A 3Q0EA 4B4UA 4N5LA 3FWNA 3CINA 3K6JA 3OIFA 2HLPA 3LK7A 1F14A 3LT1A 1C1DB 4BO6A 3KYCB 5L7YA 1B3BA 4BOYA 3KXDA 3WQSB 1M2WA 4IY1A 5JC8A 4FGWA 2G17A 2OORA 1E6WA 1QYVA 1NVTA 4M8SA 5DOZA 2EHDA 1M67A 4MKRA 2YJZA 5KJ1A 4RPGA 4YJHB 1T4BA 1JKIA 1SOWA 3JQFA 3P2YA 5A1TA 1ISMA 3I83A 1IULA 3KYDB 1Z7BA 3JQGA 1Y5MA 2IYOA 1NPYA 1ZK4A 5G0VA 5JDIC 5K6AA 1ZMOA 3RBZA 5BSHA 2Y0DA 3Q11A 3PVZA 4HFRA 4GKBA 2CF5A 1Q1NA 1DIHA 2VCYA 4E13A 5AXAA 3A28A 1DDOA 1ZSYA 4AJ2A 2Y0EA 1X0VA 2ILTA 4DBVO 4RQUA 1GUZA 2DKNA 4O1MA 2JCYA 4CMHA 1KEPA 3LC7O 1NQ5A 4QFDA 4QEDA 4YQZA 4WOKA 3M2PA 1MXFA 2OO5A 2X0NA 3OMLA 1Q7GA 1M75A 1RYDA 3IIEA 4WASA 4EJMA 6LDHA 5ILOA 5IG2A 1R37A 2VZ9A 4ZQFA 3DO5A 5JW6A 1TXGA 4OIMA 3JYPA 1WDLA 4KQXA 1ISGA 1H2HA 4UVGA 1LRLA 2JCVA 3FBGA 5BSGA 4W7HA 2UDPA 2NLOA 3CPSA 1U1IA 2VNSA 1P1FA 2G1UA 3AUAA 4BO7A 2YQ4A 4MKZA 1GPDG 5ENDA 2VQ3A 2QQ5A 1ZW1A 2O2YA 2W8ZA 4NBUA 3I9LA 3OJLA 3CUKA 1SPXA 1YRLA 3F5SA 3G0OA 3HB4X 3KUXA 4LK3A 4IS2A 1T2FA 2VHYA 3PLRA 3D1LA 4R3NA 2BHLA 1EZ4A 2O48X 3FNHA 4FOSA 4ZU3A 4AJKA 5F5NA 4JLWA 1O9BA 1KIFA 3WSVA 1GYQA 2YHIA 3GC6A 3KZVA 3INTA 5H83A 1E1LA 1ZCJA 2CNBA 2CVQA 2IODA 4E33A 4XDZA 4PG5A 5A05A 2PH3A 3VPXA 1O8CA 3OP4A 3ZDFA 1BVRA 4BKOA 5A4DA 3GFBA 3PPIA 4CLHA 1DHTA 3H9EO 5K6AC 4DIFA 1JN0A 2OP1A 3DQPA 4IZHA 3DHNA 3AI1A 5DN9A 2YY7A 2PNFA 3AUTA 1HYHA 4P4NA 4ZQHA 4JP3A 4HY3A 1WDKA 4ZQEA 3QWFA 1IL0A 3ONFA 3ZW8A 5JPIA 1E5LA 5JAMA 2ZYDA 3L6EA 1HDCA 2BI7A 4CUKA 4ZQBA 5A9TA 1M66A 4ND5A 4B7XA 1YB1A 2WYUA 2GO1A 4YDRA 1SB8A 4LN1A 4PLGA 3WYCA 1P1RA 4Z3DA 3D4PA 5TS3A 3GG9A 1ORRA 3WLEA 3VTZA 2BKAA 1F8FA 3RROA 1HF3A 5I9MA 1N92A 4DLAA 2D2IA 1DC4A 4YBZA 4WCDA 2X1HA 1H9AA 4J90A 4BNIA 1FDUA 1VJTA 3KSZO 4D0SA 4JIGA 3JYLA 1Y1PA 1QYCA 2GRAA 3JQBA 1EBUA 3ZV3A 3ZU3A 4I8XA 3EMKA 4PZEA 1HEUA 3GZNB 3NAQA 4IQ8A 3WNVA 1ENPA 2PGDA 1NWCA 1V3VA 2CZCA 1ZIDA 2LDXA 4ALLA 4DC1A 5CEJA 3EAGA 4MDHA 2CDCA 3T4XA 1W0CA 4KWIA 1EQUA 1C14A 4HFJA 4UVIA 5DP1A 1YH3A 3D5TA 4DBZA 2AW5A 4FCCA 2C5AA 3EVTA 3VDQA 4EJ6A 2JD1A 2Z1NA 4PVDA 1E3WB 3QWBA 1BXKA 4L4RA 4MVJH 1DRUA 2O7QA 2W98A 1R4MA 4LRTB 1Y8RA 3IJRA 1TT5B 2VYVA 3FSRA 1X7HA 2DBRA 4E2YA 4E4YA 4PIVA 4Z0HO 1T25A 1AXGA 4DLBA 3B1FA 1HSOA 3TL3A 1WWKA 4IUYA 4O63O 1V3UA 2WJPA 1D1TA 1T2CA 3E03A 3EHEA 2VT2A 1JDJA 2DTXA 1ENYA 2J3IA 5I7FA 3WXBA 2FOIA 2B36A 1C1DA 4CR7A 3KYCA 4PN3A 1NQOA 2Y1FA 4PLZA 3C1AA 3BAZA 4OKNA 3JV7A 4CM5A 4BV8A 1VI2A 1DFIA 4DQXA 2HK7A 3F4BA 4UEJA 3W8DA 5BR7A 1G0OA 4CQMD 4R41A 4ZGWA 3GEMA 4YJHA 1F17A 4ALNA 4XA8A 4AJPA 1ZXBA 3TQHA 3S8MA 2C54A 4QTZA 3KYDA 1LX6A 2Q49A 4OGWA 2NU7A 4E6PA 1R0SA 4IMPA 3JQBC 4EUFA 4NFSA 1MG0A 1KVUA 2GASA 3E18A 2I99A 3O8QB 5JCXA 3W8EA 4ZJUA 1CQJA 1YGYA 4N54A 1CYDA 1KYQA 3AWDA 3PIIA 1W73A 2UYYA 1ZSNA 2DFDA 2VTEA 2PK3A 3M2TA 3OJEA 4FDAA 4D46A 1ZUD1 1CWUA 1XKQA 4JK3A 2D5CA 1GEEA 2VWQA 4S3MA 3BMOA 3GUCA 1I3NA 1U5CA 4FSHA 4N18A 3JYQA 3FTNA 3K31A 3GK3A 4O5OA 4QXMA 3HQ4O 5KWEA 4CQMB 1K3TA 1DAOA 1HDOA 1ZKMA 3B70A 1DRVA 4XB1A 5F5LA 3SJUA 3EZLA 1S7CA 2UAGA 1XWFA 2WMDA 4L76A 3TRIA 3VDRA 3WGOA 1U8FO 3IQDB 4BIIA 4DXHA 1N2SA 1DXYA 3CEAA 1MA0A 5ES3A 1NR1A 4E0BA 4YCAA 3T7CA 1Y7TA 3D0OA 4J4BA 5FWNA 5BNIA 4CMEC 4UEOA 3AUUA 3PHIA 3EY4A 4F3YA 1VRWA 5U4QA 1BXGA 3MWEB 3H5NA 4CM7A 4R1SA 1DRWA 1NVMB 2X58A 4WGGA 3IMFA 3WMXA 4ESOA 4JROA 3RU7A 4HADA 4B3IA 3WMWA 4D3DA 3V2GA 1HXHA 2A92A 3FRJA 3TZHA 3JYNA 1WNTA 1PJLA 3JQDA 2EP5A 1TT7A 3DB2A 1LU9A 2AE1A 4GWGA 4NPCA 3UF0A 3RUAA 1QLJA 3L77A 4KUHA 1I2BA 1UDAA 3WYEA 1DFGA 3K2EA 1U3TA 2F1KA 1VM6A 4XB2A 2PZKA 4RO0A 2G82A 3ZHBA 2XOXA 2P68A 3GDGA 3D3EA 1HLPA 3DAPA 4RL6A 1TVEA 4I5DA 4CM3A 3K8ZA 1AGNA 3DOCA 4WEOA 4LGVA 3JD3A 4WJZA 3L9WA 5HA5A 3UGKA 1A4IA 2PZLA 4PZCA 2Q1TA 4UVHA 5IAAA 2VUSA 5C7IO 3GH3A 2JHGA 4XYGA 1PGNA 4ZRNA 3WTBA 3BTUA 3SXPA 2AG5A 5JO0A 2AHRA 2J5KA 2XXBA 4MP3A 3PWZA 1YOVA 3NTQA 5JY6A 4XJTA 2ZTVA 3F1LA 4LSMA 5T8KA 1PSDA 3QY9A 3KVOA 2BMAA 3TJRA 3ZGYA 4Y6SA 4CODB 4AJ1A 2GSDA 4BGEA 2HO5A 2JCXA 4FQ8A 3OQ6A 5HM8A 3ZWPA 4BNNA 1PGJA 3PQDA 1IZ0A 2OUIA 2V7PA 3KYBA 4E5YA 5TT1A 4GAEA 1I36A 4KP7A 3ASUA 3ZWVA 4NJOA 1PU2A 4H3VA 1LDEA 1XQ6A 1KVSA 4PZDA 3PQEA 5JBIA 1Z7EA 3IS3A 2Y1DA 4DREA 1DFHA 1YO6A 2ZYGA 2O3QA 3PI7A 3RWBA 1SB9A 4PLVA 3MOIA 4NG5A 1DJNA 1BDMA 5JMWA 4C7JA 1CF2O 3OHSX 3G49A 5A9SA 1PJQA 5AYVA 1QKIA 3H4VA 4OOEA 2ZYAA 1WMAA 1HDRA 1ONNA 1NHWA 4GX5A 4TRRA 4DPMA 5I7SA 1LSJA 2CY0A 1ONPA 1GL3A 4YB8A 4YJGB 1W6UA 1VC2A 4OQYA 3WOHA 4CM8A 1PS0A 1U4OA 2I76A 2JD2A 4LCEA 5ER6A 5K0ZA 1NR7A 3BTSA 1LJ8A 2X5KO 4ND1A 5DULA 1E6EA 5KOIA 1H6AA 1ULUA 4DVJA 5EQFA 3WFJA 1GCUA 1QLHA 3BXXA 4ALMA 2P91A 5KVSA 1I24A 1PGPA 4UUPA 4HNHA 3PWKA 1H2BA 4Y9DA 4OL9A 5HBRA 2YFHA 2A94A 2X5JO 3GHHA 3ADPA 3OJOA 4PLTA 1EVJA 4OSPA 1I30A 4BQRA 2H6EA 1DOHA 1GZ6A 1Y81A 5AOVA 5GMOA 1NYTA 1YL7A 3V8BA 4J1QA 2AXQA 2NVWA 4YAGA 1XHLA 2OZPA 3JCZA 3MJCA 5B4UA 2W2LD 2QYSA 5DOVA 2RCYA 3ZNNA 3QVWA 4D79A 4JCOA 1NPDA 4WLVA 4CL8A 3IUSA 5DNAA 2NUAA 2O3SA 5A3JA 2C20A 2YV2A 1HZZA 1E77A 3FWZA 4RVFA 4YA6A 3M1AA 3TPCA 1R6DA 4XQCA 4R5HA 1KERA 5AQ1A 1CQIA 1OC4A 2OP0A 3Q9UA 4YT5A 4OO3A 3B20A 3WG9A 5TSDA 4NDNE 2WM3A 1ADGA 1ZK1A 4NI5A 1MGOA 4D3SA 4FR5A 1I2CA 1P44A 2DQ4A 1AHIA 3NGLA 5C7LO 1YJQA 2VUTA 3ENNA 2VHXA 5T64A 3VPSA 2Y93A 4WLFA 3DHEA 3AM4A 1GFSA 5AVOA 1BSVA 1T2EA 3DTTA 1V6AA 2H63A 4BV9A 3K9QO 2VNAA 2AQ8A 1B16A 1X1EA 3V2HA 1NP3A 3JD1A 4B8WA 2TMDA 2VHZA 4UUMA 1YONA 1E1MA 4EITA 3LC1O 1J5PA 1E3IA 3GMDA 3M6IA 4CQMA 4WLNA 2J5QA 3W4KA 3FI9A 4IDAA 2DTDA 3DOJA 2SCUA 3D5QA 3GVHA 4XKJA 1X0XA 5TIIA 5CAEA 1P1JA 1JLLA 4UVEA 3UCFA 4TWRA 2O3JA 3PTZA 1QR6A 2IRWA 4RVUA 5DCYA 4CV1A 1IPEA 4DMMA 3WYBA 3PYXA 4Y6RA 5COQA 3RSHA 3ZW9A 3S1LA 4F45A 3RUHA 1ZEMA 1QXSA 3H2SA 1N7HA 4L74A 2PD6A 3PHGA 1PEDA 4KTVE 4WNIA 3U09A 1R0KA 4INAA 2YFQA 4MVJG 4OSOA 5JDCC 5A06A 4G81A 4Q3EA 4OJNA 4CM9D 1V0JA 4FC7A 1F0YA 4R68A 5KIAA 4W99A 1H9BA 5L4LA 1Z6ZA 4URFA 2PD4A 3DZJA 4YJDA 2Q1WA 4ALJA 5L7WA 1RM3A 3BMQB 1C0PA 3E9NA 2HRZA 1LDNA 1E7RA 1I8TA 4AVYA 4G2NA 3JQCA 4BNUA 3ULKA 1Z75A 3Q9NA 5LDGA 1UP7A 2B5WA 2BFMA 2GDZA 1MX3A 2ZQZA 4PG6A 4EZBA 2X9VA 1ZEJA 1LRJA 3GF4A 3I6QA 3ZWXA 3RUCA 5DBGA 3UAGA 5L7TA 4HXYA 4W7IA 5L40A 4PG4A 2FR0A 3RFXA 4CQLA 3RCBA 3BIOA 2GUGA 3QVTA 4GI2A 1BTOA 3PQFA 3LF2A 3U0BA 4CMKA 1LSSA 2Y1CA 2Y68A 2ZTLA 5JDIA 2P5UA 1E7MA 2HSDA 4HFMA 4U0KA 2VYNA 3EW7A 3V5NA 4MVJP 3COSA 3DWFA 2WWRA 4AJ4A 1DSSG 3OSUA 3H9QA 1XEAA 1T24A 4IIVA 4J43A 3TN7A 2JL1A 3GGPA 3GQVA 4TROA 4WOJA 4J0EA 5CPFA 4U6SA 4HWKA 1KETA 3PDJA 2GCGA 1XQ1A 3F9IA 2EG9A 1GPJA 4JNKA 1PWZA 1YQGA 2X22A 3BTVA 5JLAA 4CMAA 2HUNA 2OMEA 1UZMA 3RASA 1T1SA 2D59A 4B4OA 1BXZA 4NIMA 2I3AA 1H0KA 3GFGA 1RWBA 5L95A 1ID1A 2GF2A 2YQ5A 4J1TA 4YRAA 1GUFA 5HTOA 1HE2A 2VZ0A 1PJ2A 4BO4A 5L51A 4NMHA 4BNVA 3V1UA 1P0CA 1D3AA 1F12A 4JP2A 4IS3A 3ANLA 3ADOA 4RPHA 3IKTA 3LU1A 3S2GA 3K2BA 4NK5A 3T4EA 4CV0A 1A9YA 2DC1A 4LVCA 1KVTA 2GYYA 1OZAA 5THKA 3VAZA 2Q45A 3VH2A 2B83A 1WPQA 2NVUB 4MVJE 2HCTA 4E12A 5C37A 3JQ8B 4E2ZA 5TJHA 1AE1A 1NNUA 1LXCA 3KO8A 1P77A 4XYLA 3E9MA 4FW8A 5ENVA 3ZH2A 1PTJA 1PR3A 3HDQA 3JD0A 3TDKA 1J0XO 1JWAB 3DMTA 1T26A 4MJLA 4AJEA 1E6UA 2TMGA 1UJMA 1RM4A 4MPDA 2I65A 1KEWA 2XXJA 1LRKA 4YRDA 4Q3BA 4RVDA 1PGQA 4H15A 3ANMA 3ZWMA 2E6UX 1YBAA 2Q50A 1DJQA 2E4AA 4YVFA 4Q9NA 1RM5A 2YHUA 1QRRA 3K30A 3A4VA 1EMDA 3H5RA 3GDFA 4NU6A 4RF3A 3ZU5A 5HWSA 2DVMA 4WCFB 2QZZA 1MB4A 4Q3AA 5C3MA 2O7SA 1K6JA 3IAHA 1GQ2A 1O5IA 2HMSA 4RQTA 3OETA 2Q1UA 3C7AA 1E1NA 4J6FA 4S1VA 2V6MA 3OBBA 2Q4BA 2FPGA 1HDYA 4J49A 4ILKA 2EP7A 5EERA 3LSYA 4K6CA 1MLDA 1CEQA 3LT2A 1V8BA 3DOOA 4FBGA 2YW9A 3NDIA 1DHRA 3O26A 3EVNA 4B4WA 4O0LA 1XIVA 1C1XB 5T5QA 2W2LA 3G1UA 3FNFA 3I9NA 4E21A 3FTPA 3GVXA 3LQFA 4GL4A 2HMWA 1YKFA 1DC3A 1E92A 3CIFA 4W82A 5JAIA 3TZCA 2DFVA 4B8ZA 1RKXA 4YXFA 2HQ1A 2W2KB 3I9OA 1Y5RA 1HETA 1YB4A 4JGBA 1XSEA 2I66A 3PJDA 5U9CA 5HRUA 2JFGA 3SC6A 4HP8A 1AN9A 4QSMA 3ZWNA 2PKQP 2UUOA 2B4QA 1LDMA 5KVVA 1PZFA 4IDCA 3FNEA 4MO2A 1N1EA 1ZSVA 3ZNQA 2ZTMA 1VKNA 3CZRA 4Z9XA 1FDWA 1YWGO 3DMTC 3HFSA 2NNLD 2AA3A 3OIGA 3GUYA 1YVEI 1VJ0A 1WW8A 2NACA 4J9VA 2D0IA 3PIDA 3PZRA 4F6CA 2X0RA 5TNXA 3TWOA 1HKUA 3CKYA 4FIZA 1PL7A 4L4XA 3RKRA 4A0SA 4A2CA 3SC4A 1HDZA 4N5NA 3U62A 2E37A 4UULA 2VTDA 1YQDA 2CVZA 3BMQA 3WS7A 2Y99A 3WBBA 1IHYA 2W90A 3JQ7B 3AOEA 4BNHA 1K6XA 3RJ5A 4DC0A 4K6FA 4BO1A 2PTGA 3F5QA 5AXCA 4IIUA 3GT0A 5CFZA 1P1HA 5BSFA 1SCUA 4CLOB 5JAZA 4JX8A 5G0WA 4EI2A 3EC7A 3VVCA 5BNTA 4W9NA 1KVQA 4TZTA 4AJOA 3I9KA 1XELA 2NWQA 3T7EA 1B7GO 1NPTO 1WVGA 4OXKA 4XRGA 3PFWO 4AL4A 5I7EA 3L0DA 4ONEA 1QP8A 4YT2A 1QYDA 4Q39A 4GQAA 2OOSA 1P45A 3BMNB 3UKOA 4BHTA 4GX1A 4BMVA 1LA2A 4RVGA 1Q0QA 2C2YA 5L53A 1EK6A 3E5MA 1CRWG 1IY8A 3DZFA 3QSGA 4RPKA 1HZJA 4DQUA 1OBFO 3ENKA 4LVUA 1YBMA 1IYZA 2BRUA 3OQBA 1NVGA 3F4LA 3D3WA 2NVBA 4CM9A 1CERA 2QRKA 2PKQO 5GZ1A 3O9ZA 3WGIA 2FP4A 1T2AA 3Q6IA 3ZV5A 4K9DA 4D41A 3AY3A 4TKMA 3H9JA 1ZK2A 1K2WA 4GPD1 1GV1A 3L4SO 5G0TA 1EE9A 2CDAA 3Q1LA 3QJ5A 1GR0A 1XYGA 3QV1A 3EUWA 1TA4A 3DBLB 1B0AA 3F1KA 1E0DA 3DZGA 3HNPA 1B15A 2HMTA 3NV9A 3GA0A 4RV9A 1PZHA 4TVOA 1J6UA 1NXQA 7MDHA 1QG6A 2B5VA 2VOEA 4C4OA 3WGTA 3AI3A 3TFQA 1I2ZA 4XCVA 2G0TA 4N7RA 3OM9A 4UAGA 4CMEA 3EYWA 2WD7B 3PJGA 1XDWA 4IDFA 4RF5A 5AXDA 1IHXA 3AOEC 3FNGA 4YJFB 2PGLA 1S6YA 1Z73A 4NBVA 1LLDA 4A26A 1OOEA 2Q2VA 2J3JA 3RVDA 3NDRA 4ZRMA 4W9NC 4IGFA 4II3A 5IDQA 4DL9A 1O6ZA 2X4GA 3HHPA 3JQ8A 3UXYA 1A5ZA 2X0JA 3G3EA 4J9UE 2X86A 1MP0A 3DC2A 2DBQA 4DRYA 3HDHA 2X7HA 3AU9A 1UXHA 4YQYA 4LW8A 5GZ3A 1NQTA 2Y66A 3TOZA 2ET6A 1PS8A 2VOJA 4ROSA 3WBFA 1H94A 3ZNPA 4CMJA 2R2GA 5I7VA 4CM4B 2NQTA 1F8GA 2C82A 1DEHA 2Z5LA 4ZVVA 2HU2A 3MTGA 4ND3A 2OHXA 3PZBA 3TOXA 4IXWA 2VRBA 2FRDA 3K5PA 4U6QA 3U5TA 1C0IA 1JKFA 2W4QA 3ICCA 1U28A 4J1SA 3QWAA 3ZHZA 3F47A 3ZWCA 2PV7A 3GVCA 4NH4A 3FF4A 4FJ2A 1OI7A 2Q2WA 3D4OA 3OIDA 4TRMA 5DZSA 2D5AA 4RPLA 4D0RA 1PIWA 1DIRA 4U0JA 3GNSA 4ITUA 5L9AA 2ZB3A 2PR2A 4P8RA 4XEHA 1P9LA 1R15A 3HDYA 3JQ9C 3FR7A 4L9RA 3MTJA 3AU8A 1LLQA 4M86A 1NTOA 4BO0A 1LNQA 3WLFA 3UVEA 4IJUA 2D8AA 3V1YA 1SC6A 2VWGA 3I4FA 1FMCA 3K73O 1U3WA 4HKTA 1MC5A 2ZK7A 3DBRB 4I9UA 2JAHA 4E5KA 3DONA 3PXXA 2FN7A 3Q3CA 4LMPA 1U3VA 4YPOA 1CETA 4B3HA 4RDHA 5DT9A 3MJ4A 4XGIA 4WNCA 3LT0A 3C7CB 2VYND 1T4DA 5G2OA 3WX0A 3UHAA 4BNGA 4D44A 1HYEA 1VSVA 4KUGA 5I9NA 3R6DA 1U3UA 1V3TA 4WUVA 1Y9EA 3FPCA 1LQTA 4GX2A 3BZUA 3E5RA 5CEFA 2P9CA 2CF6A 3RUIA 1NFRA 1J4AA 5JCJD 2QYTA 4HNGA 4IDDA 2AMFA 3AM5A 3JTMA 4IBOA 1N9GB 2O3RA 4R9RA 1LDYA 4UUOA 3UN1A 3I23A 4WEQA 4OYRA 4E5NA 3SJ7A 2EERA 3X2EA 3W6ZA 3RC1A 3C3XA 4PLYA 1NBOA 3NGXA 2Q1SA 4FS3A 2PY6A 2ZTUA 5H82A 2HMUA 4PRLA 3HDJA 1EVIA 1EBFA 1Q0LA 3RJ9A 3QVSA 3G79A 3VPHA 3JQ7A 3ZU4A 5T6BA 4D45A 1T1RA 3I9JA 4RZHA 2NU6A 4BQPA 1R12A 2IEDA 5TX7A 4CLOA 1MG5A 5TLSA 1U2GA 1WP4A 3HE3A 2JFFA 2CD9A 4XZ3A 3QW2A 4BKPA 1JKJA 4M87A 4EYEA 4MIYA 4LMRA 5CP8A 1M6HA 3BMCB 1I01A 4BGIA 5COBA 4XQ9A 2P4QA 3RUDA 2PH5A 4IPTA 1Q7CA 4BO5A 1ENZA 3S2FA 3OQ1A 5KVQA 3BHIA 4XR9A 1N1GA 1J49A 3PFFA 5ICSA 1EFKA 1I0ZA 5CG1A 1L1FA 3GZNA 1ISHA 2WSBA 2ZCVA 3BYZA 3VKUA 2AQKA 2O23A 1B3RA 4H16A 2EEZA 4CMGA 2DTEA 4NK4A 3ROKA 2AEJA 4R69A 3X2FA 1LI4A 5GZ6A 4YAJA 3OEYA 2WYVA 4OXYA 3QVXA 3ST7A 2BLLA 5ITWA 5B37A 3W6UA 3WFIA 3WJ7A 3DBLA 2QHXA 4MVJI 4XGKA 4ALKA 1E3WA 3ONDA 4F46A 4DYVA 3JQEA 1HSZA 1GEGA 3MJVA 4FFOA 4R1NA 3VHRA 4KUEA 3NJ8A 1TT5A 1WZIA 4WECA 4JBGA 1BWSA 5L3ZA 2E82A 1YQXA 3GRPA 4HFNA 2PKRA 3FN4A 3GVIA 4YT8A 4LCJA 1I10A 3PWSA 3RFTA 4ZHSA 3KTDA 3KB6A 1FDTA 4WKGA 3I4CA 5JDCA 3WICA 2EWMA 1P3DA 2QRJA 1PJTA 3UOGA 3DR3A 3IJPA 4I08A 2Q2QA 5IN5A 2GN9A 3WSWA 4BO3A 1NAIA 1EK5A 2B35A 1KEUA 3VZPA 2WE8A 1HTBA 1ZK3A 2RHCA 5IXYA 1M6WA 1ZNQO 3MWDB 5EPOA 2IE0A 3SEFA 1ZFNA 3UFXA 3OECA 3JQGB 1YBVA 1H93A 3NEPX 1Y9AA 1LUAA 1I3LA 1ZVMA 3UW3A 5B12A 2ZIZA 2IXBA 1H5QA 3BHJA 4PGFA 3HN7A 5AXBA 2V6BA 4WPGA 1U2DA 4IJKA 4BS9A 4KWHA 3NUGA 3SLKA 5B1YA 1E3LA 4BNZA 5BQFA 3O8QA 5G4LA 2DUUA 3H3FA 4FFRA 2H9IA 1XA0A 1DPGA 2PZJA 1YB5A 1JVSA 3ITDA 4IDGA 4LISA 1QORA 1ULSA 2X9NA 5F1PA 3PP8A 2ZQYA 3AJRA 3HB5X 3WB9A 2BELA 3DBVO 4E3ZA 3GGGA 2J8ZA 1XG5A 3WIEA 2UUPA 4XQGA 4BNLA 1GTMA 2HRBA 4ND2A 1GQQA 2HK9A 4RLSA 1SEPA 4M49A 5JXWA 2F00A 5IXSA 4FPXA 2B4RO 2GN6A 1BDBA 1P74A 2P9GA 3DZKA 3NT2A 1TLTA 5EINA 4L4SA 3VZQA 1GZ4A 1U4SA 4NHEA 3RIHA 5KTKA 2Y1OA 4W6ZA 1UZLA 4ZD6A 5CG2A 3UH1A 1H6BA 1H6CA 1UDBA 5DCUA 5EJ2A 3FCOA 4YT4A 4MVJD 4Z0PA 3ICPA 3ETDA 4DUPA 3WGZA 1HL3A 3HN2A 1TI7A 2PA3A 2NV6A 4TVBA 5U1PA 1I32A 1YL6A 3ROQA 3RD5A 3R3SA 4GLOA 4ZQGA 2QZ9A 3VC7A 5MGBA 5TRTA 1XLTA 3PJEA 4Q3CA 3GNTA 4BMSA 2GZ3A 4JQCA 2BH9A 1EDZA 2BGLA 3CMCO 5CPBA 3I1JA 2GN4A 4J4HA 4IMRA 3HFGA 4K28A 1E3EA 4XIYA 1LLCA 4EJ0A 2EW8A 4GLLA 1Y8QB 1FF9A 4J91A 3MJSA 4EBFA 1DLJA 2Q99A 3A1NA 1A71A 1XGKA 1I5RA 4QO8A 2YHIB 4FJ1A 1W4ZA 3GEGA 3LT4A 1N9GA 4Q3DA 1YDWA 4JBIA 1YE3A 3UUWA 4R01A 3SX2A 3PGJA 5KJEA 3NKLA 3WWZA 2D4AA 2YUTA 5KJ6A 1PZEA 4E2WA 1HRDA 4TMFA 2E48A 2EV9A 3PDUA 4M1QA 3RC9A 3RI3A 1A4UA 4A73A 1ENOA 1QV6A 4YAEA 4M55A 1Z82A 4GWKA 4OH1A 4CPDA 1DC6A 2RAFA 1BRMA 4NFYA 1OFGA 5JSFA 3U4DA 1NWHA 5KKCA 4GKVA 5IZ4A 2JJYA 2EJWA 1LSOA 4Y8VA 5A3VA 4QO7A 2B4TO 4QUKA 2GLXA 3L6OO 3ON5A 1WMBA 9LDBA 5KNLA 1UXKA 4MP8A 2GD1O 1LQUA 5CEEA 1L7EA 3C1TA 5DP2A 3M1LA 2G76A 1DIBA 1BGVA 1WDMA 3JQAB 1CJCA 3CH6A 3ETGA 4NQZA 4R5MA 1LSUA 3BHMA 5JCJA 5JY1A 1N8KA 2RBEA 1RJWA 3ZU2A 1X1TA 3MOGA 2C0CA 4DGSA 5ADHA 1YS4A 1EUCA 2C2XA 2QX7A 1EFLA 3U4HA 1O0SA 5FFFA 3MZ0A 4J7CA 3CZMA 1DBVO 3RBXA 1GU7A 3KLPX 3PGXA 3U3XA 3GY0A 4BUCA 1ADBA 2Q46A 4BMNA 1AHHA 4XWYA 1C0KA 3A14A 5T67A 3WIDA 3CE6A 4R1TA 3FBTA 5LC1A 2AEMA 1B8UA 1IB6A 3Q2KA 4YJGA 4CR8A 3CTMA 1FJHA 5KVCA 1G6KA 5TC4A 4CMBA 1VL6A 1GQYA 4R4JA 1UUFA 1LLUA 3DBHB 3N74A 3R0IA 4IDEA 3DZIA 4JBHA 5LCXA 1HE5A 2NU9A 3L07A 1HYGA 4KDFA 5TF4A 3LLVA 4RDIA 4CM6A 5JNLA 1P0FA 3GOHA 3ZWOA 5A02A 3EK2A 5A5EA 2ZB8A 4Z0TA 4I5GA 3GZ4A 2R6JA 3I6IA 2ZJ1A 3B1JA 1I33A 1EUZA 4KMSA 2VHWA 3OEWA 4XDYA 5CDGA 2QG4A 1P1KA 3NTRA 5COAA 2QW8A 2DPHA 4LSWA 3C85A 4FFPA 4XYEA 2D3TA 1RPNA 2C7VA 1KY5A 2PFGA 3KHUA 2IZZA 4WK6A 1KC1A 2A4KA 1GYPA 5EQDA 4C7KA 3DEYX 3G1TA 1F06A 4NJMB 3H7AA 4IQ0A 3C24A 4XD2A 3U4CA 1B8VA 4IQGA 3DAGA 5IF3A 4CMIB 3OJFA 1EDOA 1E7QA 2FY8A 3KRTA 5EMHA 3WDSA 4BNWA 1A72A 3WGHA 1YDEA 1P33A 4FB5A 3RC7A 1HDXA 4CL3A 3ABIA 1P1IA 2B37A 3OH8A 2XPCA 1PZGA 3GPDG 2ZCUA 3G17A 4RLHA 1OAAA 3GR6A 4KDEA 3VPFA 3KV3O 1UDCA 3AFMA 3GN1A 3TL2A 3HWRA 3L4BC 4D42A 1GYRA 1SEVA 1NASA 1K0UA 1VE9A 4CJXA 4D7AA 1SNYA 1DC5A 4GMGA 2OGUA 1CDOA 5KCZA 1MUUA 3BMOB 3DDNA 3LDHA 1A27A 4QQRA 3GPIA 3KOUA 1JAXA 1KC3A 1G0NA 4W4TA 5ER9A 1SAYA 1PQPA 2JHFA 3GAFA 2P2SA 1GCOA 3LC2O 3S55A 5I8ZA 1V9LA 3SLGA 1EEHA 3DTYA 1ZO8A 2B69A 1HE4A 1NQAO 2EIHA 5TGDA 1U9JA 3IL2A 1B2LA 4XYBA 4AICA 1JTVA 4Z6KA 1UP6A 3ORFA 1WAMA 4K26A 4NR0A 2A9FA 4FJ0A 1K89A 1E7YA 5ITVA 1UXGA 2LDBA 5TQVA 2YZ7A 2BFOA 3WGGA 2O2SA 4PG8A 4KQWA 4EGFA 1BXGB 2VZ8A 5JYEA 1WXDA 1ZXLA 4FFLA 1O89A 4OKIA 2J6IA 2FPIA 3N58A 4BKRA 4BNMA 1UZNA 3VPGA 1AUPA 3I52A 3AUSA 2IXAA 4XQEA 4TZKA 5CDSA 4RVSA 4FN4A 3HSKA 1PJCA 4GX0A 4EDFA 1Y8QA 3KM0A 4PLFA 4B4VA 3ZWBA 1YXMA 5JS6A 2R00A 4EEXA 3JQFC 4M54A 5F1OA 3VTFA 3WR5A 3KSDO 3VZSA 3PHHA 1K5HA 4DA9A 1B8PA 5DBFA 4IINA 2EKQA 1QYXA 5G4KB 3KSUA 3V1TC 3VZRA 1SBYA 2BF7A 4XYMA 3OJ0A 3DFZA 2DT5A 1HDGO 3GG2A 2VRCD 2PLAA 3PYLA 2VN8A 2EW2A 4D43A 4FOOA 5DCWA 4DIOA 3ETEA 3B1KA 3H2ZA 3ONEA 4FD3A 4CV2A 1BMDA 4CLRB 1YJ8A 2B0JA 1HE3A 1NAHA 3FR8A 3QIVA 4GSKA 4MVJA 4OMUA 3E1KA 3PJFA 4JJFA 3QRWA 3E82A 5C5IA 4QECA 5G0SA 4HV4A 2GNAA 4A27A 8ADHA 1BW9B 2OBNA 3EZYA 5B4VA 4CM1A 4AG3A 3P5SA 1PJ4A 4YTEA 4IDBA 1PJ3A 1HWYA 4U7WA 1FK8A 1YOVB 3QHAA 2V6FA 3R1IA 4NNJA 2PD3A 4O6VA 3EDMA 2WEKA 4TQGA 2CFCA 3GVPA 1ZJZA 3D64A 3WGQA 2GPTA 2PGJA 2OFPA 5A04A 2HAEA 5HS4A 1Z74A 3ROMA 4GVLA 3JQAA 1CIVA 1Q2XA 4O59O 5FI5A 5I9LA 1E3SA 7ADHA 2J3KA 1ISFA 4G65A 3TF5A 1X7DA 1DIGA 3I5MA 3NX4A 3MEQA 4CLXA 4NBTA 4BO9A 2Y67A 3O03A 1D7OA 3VKVA 4BNFA 4UVDA 3F3SA 1U8XX 3WTCA 1U7HA 2ZKLA 3O4RA 4J2HA 4J4TA 2Y0CA 3JQ9A 5JMPA 3GEDA 1VJ1A 2GZ2A 1OMOA 2O50A 4DWVA 2ZATA 4OAQA 3NT5A 3OFSA 4EUHA 2Y1EA 3TZQA 5F1KA 3U9LA 4NZ9A 5A9SB 1DO8A 4PVCA 1R66A 3VH3A 3RU9A 4NBWA 5KJFA 1PX0A 1UAGA 4RZIA 4BNJA 2R00C 5A9RA 1R0LA 2V65A 4BB5A 1PL6A 1UH5A 2CMDA 2IDZA 2WE7A 4QT0A 3IP1A 2I3GA 4CM8B 3VOSA 4E2XA 1E7SA 1VL8A 4N5MA 1KOLA 5KKAA 3B6ZA 4JN6B 5CDTA 1PQWA 2BGKA 3DBHA 2QIOA 3INGA 4RVHA 2HMVA 3UICA 4GBJA 4KOAA 5IDXA 2OL4A 2IZ1A 2UV8A 1C3VA 4TKLA 1JVBA 3AY6A 3GDOA 2NVUA 3H6KA 1XU7A 1BG6A 1KY4A 5CDYA 5F3RA 4QX6A 1X13A 1LBEA 4EUEA 4ZN6A 3QLJA 3MCVA 3PYMA 5EESA 4CMCA 4WLUA 3AK4A 1P31A 2BD0A 4Q3NA 1LEHA 3DZBA 3AI2A 4I9HA 2BFAA 2FMUA 2NADA 1O95A 4YRBA 5FYDA 2WD8A 3K92A 4UUNA 3CMMA 1E5QA 2X23A 2X0IA 2PWZA 4AJJA 2Q3EA 2HJSA 5KJCA 3CXRA 3OICA 4DTIA 3NDJA 4XIJA 4CV3A 2CUKA 3AM3A 4NJMA 4GH5A 2BFPA 3U49A 3QWIA 1W8DA 3QQPA 1HLDA 3NYWA 4CMIA 4OOFA 4RF2A 3JYOA 3W4IA 4BNTA 1OC2A 5BNFA 2ZJ0A 4PRKA 5A03A 2GGSA 5T57A 1A9ZA 4GSLA 4J0FA 4IJWA 1X15A 4WCFA 3HUDA 3RUEA 4E32A 2GERA 1FXSA 1Q0HA 3LYLA 3ITKA 3BTOA 4AJNA 2JKVA 1D1SA 3L9XA 3H65A 4BKQA 4FGSA 3Q2IA 2FSVA 1LTHR 4BGUA 2UVDA 1V35A 3HZZA 1GADO 2NTVA 3RC2A 2Y05A 4H7PA 4PLHA 4MVJF 1GD1O 3QP9A 2NQ8A 4E5MA 4WE3A 1N7GA 2VWPA 4BNYA 1K6IA 3O38A 1Z45A 2O4UX 2P5YA 3ZV6A 3OF2A 2JD0A 1G1AA 4PG7A 4Z9FA 1C1XA 1U7TA 2C07A 2NTNA 4OQZA 1QV7A 4R54A 3H9UA 4GVXA 2DAPA 4OXNA 4NU5A 4BO2A 4F6LA 4J1NA 2X6TA 4FFMA 4IZIA 5JFOA 3ZI0A 2W2KA 3KBOA 1QYWA 2CSUA 4YACA 5DDIP 2EJVA 4MINA 2XF8A 1XCBA 1ZK0A 3WQRA 2A35A 4E30A 1NM5A 4BO8A 1QMGA 1ZH8A 4P38A 1XU9A 4P22A 1MFZA 4PCVA 4R16A 3QWHA 1EUDA 1MC4A 3ZWYA 1VSUA 1EVZA 1R4NB 3ANNA 3F6YA 3AY7A 3K96A 4ZA2A 3MJEA 2BGMA 2GR9A 4PLCA 5FF9A 3SBOA 3PHLA 2C7GA 1MXHA 4L73A 3FPLA 4OM8A 1ONOA 4YEDA 5G0UA 4BVAA 3H3JA 4B7UA 5IZCA 5G4KA 4BKUA 2ZB7A 4Z9YA 1E3JA 3I3OA 1M76A 3QA9A 1FDSA 3E8XA 4HX5A 4M89A 1IE3A 2NM0A 2G5CA 5EIOA 4ND4A 4WCFC 1SO8A 5TJ9A 3KLMX 5JO9A 4UREA 3RFVA 4IGEA 1Q7BA 2P9EA 4RGBA 1PJBA 3C8MA 1ISIA 4CLRA 3PHJA 4AJHA 4CUZA 1ARZA 2EGHA 3W1VA 3TNLA 3STHA 1DAPA 3BMNA 3ZZNA 4EW6A 4YAKA 2FWMX 3DMYA 4CQLB 4CLEA 1D8AA 2FR8A 1BW9A 1FDVA 1A7KA 1RM0A 4IXTA 1ADFA 4J7UA 3V2UA 4DIBA 5MDHA 3JSAA 4YYZA 1BVUA 4MOWA 8LDHA 1X7GA 4J16A 4DYDA 5J23A 2VHVA 2D1YA 4DLLA 1A7AA 2Q4EA 3D7LA 1LDGA 1ML3A 3KEQA 4U5QA 3GGOA 4KZPA 3ZWAA 1QSGA 5IFLA 4E5PA 5EL0A 5TT0A 2RH8A 3FD8A 4Y98A 3RKUA 1SZJG 4QFCA 5A5FA 3TFOA 4IM7A 3NRCA 1WZEA 2FSSA 1UXJA 3HJAA 4CR6A 9LDTA 1DB3A 1B26A 3E6AA 1D4FA 4TSKA 4YWJA 2JAPA 2I67A 2VRCA 3NJ4A 3INRA 1IZ9A 2Y1GA 3W4JA 3UCEA 3VVBA 4BNXA 1JW9B 1IPFA 3SVTA 4D3FA 4RORA 4A03A 3P19A 1VL0A 1UXIA 4E31A 4ALIA 1PL8A 1DLIA 3E9QA 5JAQA 3P2OA 1EE2A 2FZWA 3WJAA 1DIAA 2PZMA 1T2DA 3GN2A 3IOYA 1EVYA 2AE2A 4JJIA 1O94A 2WD7A 1MV8A 5IZCC 3PK0A 4YJFA 4PLWA 2FR1A 1JU9A 1VPDA 3HADA 4L0QA 3KEOA 3VH1A 3QVOA 2I5PO 4TRNA 4EEZA 1XR3A 2RIRA 1PGOA 3F46A 3JD4A 3RQSA 4FC6A 3GAZA 1SOVA 4A10A 2EGGA 3DHYA 5IDYA 4GGOA 1TB4A 1ZMTA 3H5AA 2P4HX 3DZHA 5ICMA 2WDZA 5THQA 1ISJA 1JWBB 2EF1A 4P4LA 4Y6PA 1GDHA 5EN4A 2OBYA 3OA2A 4DMLA 5BT9A 1VLLA 2J3HA 4HUJA 4CM4A 4XRRA 2O4CA 4II2A 3ZV4A 3WQQA 3W8FA 3IUPA 2YV3A 2DU8A 4ID9A 3MJTA 5T8KC 1PQUA 1BHSA 4OHUA 2POQX 1UR5A 5DF1A 3S2EA 5L4SA 5L4NA 2HKIA 5B4TA 1AXEA 3PEFA 1I3MA 3RAJA 5DBIA 1Y6JA 2BI8A 4DPKA 2YDYA 1R16A 2H5LA 2VUUA 1E1KA 1UP4A 1C0LA 2FZEA 2Z95A 4MKXA 4RJTA 1U5AA 4PLPA
chains in the Genus database with same CATH superfamily
1Z5GA 3ZHYA 3H9GA 3U9SA 5FEUA 3C4QA 2DBZA 1A2BA 2ATVA 2GK7A 3IOBA 4AFNA 3AUXA 4K8OA 4YDQA 3K71B 1QPZA 5BNZA 2G0NA 5LP1A 1J8VA 3AF2A 1ETUA 3PUXA 4KVZA 4M9UA 2XWJI 3WC4A 3IVMA 3RNLA 1M0WA 3I2GA 5ITZA 2A7XA 2YRXA 4XX0A 5TE9A 3OQOA 4G5YA 2HNBA 1H5UA 3GW8A 2O2GA 1KVRA 3L1UA 1W52X 4IG9A 2C59A 3OT1A 3W2GA 4LYJA 3GFQA 3OUTA 4DILA 3P7MA 4IP0A 1P0PA 3AFNA 2COKA 2CDBA 3L1KA 3NRJA 1Y4AE 4OUDA 2ZLBA 4TTIA 4Y0VA 3UYLA 3ZN2A 3T1OA 1JDVA 2GVZC 1A4XA 4HZIA 4NYIQ 1QZXA 4JYCA 4R2JA 3AW9A 1BEZA 1VZ3A 3TLGB 3R7WA 3O74A 4MIOA 4FWIB 5CLIA 5LYYA 2IZ0A 3N2NA 3GRKA 3UJ7A 2YWJA 3IELA 3LWBA 3UY4A 1USIA 2DOKA 2PPVA 2Y1LA 4FLMA 3BS4A 4IYJA 4Z3KA 5IDWA 4MQBA 3DKPA 1K8RA 3QPVA 5ALHA 4D9KA 1AKTA 4HQFA 4MGKR 1QPBA 1F7UA 3RDPA 1RXIA 3ZG6A 1DQNA 4J7XA 1M83A 4QHSA 2AFIE 1A8UA 1OXVA 2QB5A 1Q19A 3F2IA 4B6JA 2QRNA 2QTAA 1EQ2A 2GRJA 3MXOA 4R9SA 5JE8A 3RYHA 2VDPB 4OHYA 4U8GA 1VB5A 1XWWA 3AT1A 2FN9A 4RNCA 4CUJA 2B92A 1GAEO 2I9PA 421PA 1EA5A 3ZBUA 3JTEA 5CDUA 1R6VA 4FFNA 5AKKA 4X5OA 5CB0A 2GPYA 4R51A 4RHUA 1YC2A 2VWHA 3L0BA 1JQBA 5BQOA 2HA0A 5IN4A 1BEUB 1GPMA 3P2KA 4BJHB 1KMQA 1Z2OX 3AW8A 3OP1A 2V7VA 1NOIA 1ETHA 1NMQA 2EL7A 2JJ8A 3ED5A 2NUPB 1RCTE 2XNSA 4WN3A 3SFZA 3ABRB 4YR9A 4JYPA 5BRAA 4RCVA 2Y0BA 2HRRA 4U39A 4NU0A 4BTEA 1LK7A 4O2AB 1IBSA 1GVHA 1K08A 2VHUA 4JB0A 3Q9SA 3F49S 1X8XA 3TZ6A 3WHIA 4IO1A 2RHRA 3B38A 3C1OA 4KXUA 4MULA 4XR4A 5HS6A 3K9GA 2WMNB 3T3HA 4AKHA 5T3UA 2OXIA 3ILXA 3A1DA 3MRSA 3ZHXA 1PYOA 3LPMA 4DR4B 1GQFA 4B47A 2V8OA 2HQBA 2Q2OA 2UYOA 3OC6A 4W5JA 5FLXA 3TE7A 2NTJA 3HG7A 2FSFA 1SC4A 3ASVA 2GFIA 4CIAA 2Z6AA 1NL3A 3GLFB 2EDAA 2OESA 1SD1A 2PZFA 3BAFA 3OI7A 3T7DA 1KP9A 2QMQA 5AVSA 4Y1RA 2A86A 1S3GA 2H4JA 4DR3B 1R5OA 3EGEA 4KLNA 1IONA 3R8CA 3COJA 5LJIA 1OX5A 1GV0A 4URHA 4YAFA 5FUQA 4GOND 1WLYA 5CB4B 1KZGB 4I5EA 5KNDH 1CRPA 3RNOA 1PNTA 3RFUA 1CUBA 2DSNA 4I1IA 1LZLA 1P5FA 1U2QA 1T3ZA 2ZJAA 1BH6A 2WTBA 4MLPA 1PEYA 2CGEA 2H1WA 1QP4A 3UMJA 4L5CA 4L02A 2RHDA 3KWFA 5K1SA 4E03A 5BSEA 2NU8A 1UQRA 2B61A 4URYR 1IUKA 1NXSA 2G63A 2I2CA 3VSBA 3SQXA 2XVYA 1RPAA 3JD2A 3DZCA 3IDSA 1PVDA 2O3UA 3ADCA 1GZ3A 2XAAA 3LPDA 1U2TA 2XKBA 3IKVA 2IU3A 1UAYA 2HJRA 1RBYA 3RSFA 3BFVA 2QN8A 3IMKA 4GVPA 3EYAA 2X8LA 1B14A 4I9NA 5G1OA 3HFJA 3ZCUA 3DCJA 4G5HA 3DJYA 4XGQA 5T4HA 4F4JA 2DQYA 4TMVA 3H8VA 1YCFA 4M9CA 3IQXA 1HDIA 3G2HA 3LIPA 1YR7A 4M0CA 3OA0A 3IB6A 3TTSA 5CVVA 3STWA 3H19A 3TQTA 1NP6A 4B4UA 4N5LA 5JRDS 2F1JA 3LGXA 5KO2A 3FUWA 2C1XA 2IWRA 3GA7A 2F1OA 3K6JA 1O87A 2OXCA 5DIZA 3AL2A 3IALA 2OV8A 4X1YA 2EBUA 1VCIA 1C1DB 4H6XA 1YK0A 1S2OA 4QULA 1RYNA 1PX2A 1B3BA 2ZWVA 3RS7A 2WFMA 4NSNA 1G9TA 3OZVA 4WI1A 3KXDA 5TF0A 4M53A 4IY1A 2B2XA 3KTAB 1PFWA 3TLYA 3ZXIA 3GA5A 4MAMA 3K15A 2OGWA 3MTEA 4ZOAA 4B6EA 1AKWA 5DOZA 3EWIA 2F43A 3O21A 4QWMA 4U9IS 4MKRA 4RFLA 4FZ3A 3QE4A 4DR6B 1H4SA 2HHJA 4YJHB 1HORA 3NAZA 1SOWA 3JQFA 2MMCA 1GTG1 2P62A 5A1TA 1AMOA 1TJ3A 2CLKB 3KLBA 3TLZA 4QGHA 3KYDB 2WAYA 2IU6A 3P2EA 4EYOA 1Z7BA 2C5SA 3JQGA 2O0JA 1AKMA 4J76A 2B3DA 3WWPA 3IFSA 2OQRA 4M83A 4AUMA 1PD1A 1Q91A 5K6AA 3L4JA 5KNDD 3WLHA 1P62B 3QUTA 2RGWA 5ANRB 2BGNA 4RZ3A 2V59A 1N3LA 2H4ZA 3CLVA 2G71A 4KBFA 5AW4A 1IK6A 1S3SA 3FWHA 1QIEA 3QXGA 1J25A 4O3FA 5FADA 1JFRA 1Z5NA 2EL9A 1T0JB 2VCYA 3EC2A 3FTEA 4JSRA 5AXAA 1Z6QA 3KPWA 1DDOA 5BYJA 2WYHA 4KWEA 4PC3A 3BXGA 3TLJA 5GONF 2B78A 1F3OA 1HTWA 2ILTA 2Y0EA 4RQUA 2YN4A 3M5WA 5EP1A 1FNSA 2OCYC 4R2XA 2DKNA 4V0NA 2ZTSA 5HG0A 2RB4A 2A9OA 3CONA 3BL8A 1KEPA 4OJKA 4WINA 4YFYA 1RZRD 5E6RA 5AKYA 3OTGA 2XXAA 3CH5A 1ESMA 4QFDA 2F67A 2X76A 4G01B 2FSPA 5EKTA 2IVFA 4A16A 4WOKA 2OO5A 3J81k 4WASA 1TAUA 3SDBA 2OLJA 1P6XA 3RAEC 4A4DA 2BKVA 3HRIA 2OZEA 1R37A 3AIMA 3FTFA 3AF3A 1NXOA 1ZGJA 3W7BA 4MV5A 4WBXC 4LOIA 5SYNA 2OZVA 1PUXA 4NBKA 4UU0A 1ISGA 1H2HA 1GPBA 1WSAA 3C3DA 1G21A 1LRLA 3I8SA 3IRVA 4EG0A 5BSGA 4ZVMA 2NLOA 1Y4DE 2O0HA 4LJKA 3DOUA 4Q6BA 2RAUA 4LZNA 3ELDA 3D43A 4MW5A 3UUEA 2CJWB 4MKZA 5TMPA 1GPDG 2I4NA 5AI4A 1HBJA 1ZW1A 2EYQA 3IE2A 4RMNA 4ZHQA 4LOJA 3THXB 1H8HD 4MWEA 4Y3UA 3WIVA 4BPRA 4KBYA 4NBUA 2W8ZA 5C5DA 3OJLA 3KUXA 4LK3A 3HB4X 4N9WA 3VI4B 2DYKA 4MW2A 1HLFA 2VHYA 3FAZA 4DZTA 1D2RA 1JB9A 1CUGA 3D1LA 3EXIA 2QD3A 1KJIA 1AUQA 2GB4A 1KSFX 1GT6A 5B3LA 5IASA 4AJKA 2WZQA 4JLWA 5F5NA 3DDHA 3UPDA 1NQVA 5L3SB 1YJXA 5F52A 2R8YA 4K9OA 1U7WA 1Y9JA 3WSVA 2WK1A 4FDLA 3INTA 1ZYUA 3OAAA 2X19A 3ZUPA 2LRHA 1J2RA 4E33A 3INYA 3TO5A 4WVLA 3KYJB 1T2VA 4PG5A 4XDZA 1OZ0A 3UNXA 3W05A 1GPUA 2Z6QA 4TTAA 5CDFA 4BKOA 1JJBA 1BVRA 5A4DA 3FNQA 2YS6A 4IMJB 2H1CA 1T9ZA 2ZIXA 2C84A 4I36A 3OZFA 3A6ZA 4KE8A 4RFSB 4LF9B 4G6ZA 4C5AA 1CD5A 3SZMA 4UTVA 5DN9A 5HSGA 2QVBA 1VLZA 1HYHA 2QU7A 4ZQHA 1VIMA 2Q8NA 1WDKA 4ZQEA 3QWFA 1TD1A 3KOZA 6CHYA 2G70A 3PD1A 5JPIA 4CG2A 3ABOB 2WSYB 4DY4A 5ESWA 5JAMA 1CLEA 1HDCA 2VEDA 5FNVA 3PD0A 1W2HA 4CUKA 4LJ4A 2FWAA 3IBFA 4COOA 4PX3A 4HSGA 1YB1A 2RI1A 1R8YA 2WYUA 3PUHA 1NLZA 2V7BA 3HYRA 4YDRA 5I01A 2AG6A 2BF4A 3KSMA 3ROTA 5HJ7A 4WZBB 2CLHB 3L01A 1EJ0A 4Q24A 5TS3A 3RYTC 3G85A 3NHBA 2MSCB 3FPHA 1FX0A 2WPDA 2J33A 4YRTA 1CR0A 2XCOA 3TW6A 2D3WA 4Q37A 1QG2A 3VTZA 5H70A 4JI4B 3OF3A 1F8FA 4QU9A 3AP1A 1PE0A 3PUYA 5EJ6A 5FOXA 4IFIA 3LS2A 1BIFA 3LK6A 3N5KA 2X2OA 1DC4A 3VDMA 2H29A 3AIIA 1H9AA 4XB6B 1FDUA 1KDOA 5FLKA 4JODA 3SMVA 2ONCA 4TV8B 2PQ2A 4JIGA 4D0SA 3KKPA 5EHZA 1H1TA 2GRAA 3LBAA 2QYOA 4TMWA 3IPCA 1O1YA 4HEHA 5EI5A 2KHZA 1A88A 3WDKA 4QPCA 4C0QC 4I8XA 5DHSA 1E20A 1DV1A 4GZ5A 1WHSB 1XCOA 1NWCA 2PGDA 1V3VA 2QQEA 1SZDA 2ODQA 2LDXA 3F5MA 5H02A 4ALLA 3LPNA 4OMFG 3EMBA 1U98A 5FA8A 1P4SA 3EAGA 2K2WA 2VNHA 2WYIA 3E22B 1OA0A 3OUUA 3D7SA 1R88A 3E0XA 4EKGA 1NVDA 2AOVA 5AHWA 3FDXA 4KFRA 3V4OA 5K0CA 5JZOA 3IOCA 2QPLA 3CNHA 2J6CA 2GESA 1YH3A 2LUOA 3D5TA 3UHOA 4QTXA 2C5AA 2LXNA 3VDQA 3AVPA 1NF3A 1P2TA 2IBMA 3ESAA 2IUYA 4L4RA 1X42A 3WLTA 3ZJ4A 4MIKA 4W1RA 3CO0S 1DRUA 1RAAA 2O7QA 3KWMA 4TL6A 5BY2A 3T61A 4HGPA 2W43A 4REMA 1Y8RA 3A05A 1OAOA 4RTQA 1RBQA 1JE0A 1GG9A 1X7HA 4E2YA 1W96A 2R7MA 4PIVA 4Q6WA 5KWVA 1FIUA 3HBNA 3MN1A 2GM9A 2C3UA 2YMQA 3R9XA 1P2BA 3S5UA 4M7PA 4IUYA 5EZ6B 2OG1A 5EUMA 4F1JA 1X1CA 2H59A 2QLLA 4FVTA 4B3XA 2WJ4A 3TD6A 3X2SA 4EK9A 5AHRA 3ORQA 1P4JA 2EW1A 3AFHA 3U9TA 3QF7A 1JQEA 3CCBA 3D8NA 2QE7A 2R3SA 3R0JA 4DCPA 1JJ7A 3TR5A 2Y1FA 1RCFA 4WZBE 4LYFA 5HDQA 5KX5B 5KMGA 3HM9A 4OPMA 1IDN1 3H0KA 3JV7A 4RA6A 2HPZA 1VI2A 3HU5A 4UQPA 4BV8A 3DP9A 4DQXA 2HK7A 5BR7A 3HCFA 2VDMB 1G0OA 4CQMD 5A4FS 1YCGA 3BXPA 3PHCA 4Z99A 3GELA 3VR2D 1XJCA 3GEMA 2CFIA 4LX0A 2AZ4A 1N6PA 1ZUIA 3TPFA 4ALNA 4AJPA 3T3NA 2DHCA 2I6XA 3D02A 3Q3HA 5AI6A 5CXXA 1XRSB 5DYNA 4F91B 4N41A 4JUFA 1XA4A 4X93A 1OU4A 1NNI1 3PWTA 2H8GA 1M2EA 2ECKA 2FF7A 5D01A 3UOWA 4KXMA 4RKQA 2HJGA 4LE1A 1UAAA 3JQBC 1BJTA 1RQNA 2V5AA 1XPOA 1YRYE 2FSHA 1MG0A 2ZSIA 2ETVA 1DKNA 1KVUA 1P7CA 1BS2A 1CDZA 5LA6F 3E18A 2AF3C 4ZJUA 4BXOA 4B3TB 1CYDA 1RWKA 1QDLB 3AWDA 1YAJA 3NYRA 4G1CA 1AN0A 4TS9A 1ZSNA 3BWCA 3N7TA 2WIKA 3CISA 3RABA 1JHDA 1REQA 1NVWQ 3UJAA 4V3CA 2H5IA 1CWUA 5KKNB 3BGWA 2BCEA 2W6ZA 4D9NA 5B7GA 3AYZB 2XMSA 3DAHA 4S3MA 4F2HA 2VDVE 4MR7B 3GUCA 1Z3IX 3HBAA 4C89A 1TM2A 3LMKA 1J9EA 5JHHB 1R18A 2P2LA 2W5UA 1S4MA 1G291 1Y4SA 3IQIX 4K40A 3D54D 4EYQA 3GB9A 1Z5PA 4QXMA 2JCSA 5GAJA 2QNRA 4TL9A 4BDTA 3G5UA 4CQMB 5KWEA 1NN1A 2BTQB 1Q0RA 3B70A 1DRVA 3H0EA 1T4CA 3UYKA 4BZWA 3WGOA 5LP6A 1XWFA 2F9LA 4TTRA 3CNOA 4F5ZA 3RQIA 1A2OA 1N5MA 3BZWA 5JATA 1MA0A 4FW9A 4BZXA 3FFBA 5EZYB 4E0BA 7REQA 2GFQA 1EZ1A 3ZDDA 5GINE 1PYDA 4ZOBA 1K0FA 3PHIA 1PFQA 4EFKA 5U4QA 5I7HA 1HMYA 1WW2A 1YI8A 2P5TB 4W1QA 3VDNB 2GEDA 1NVMB 3EZXA 1FNBA 2F2TA 3IMFA 4I2NA 5KOYA 4EHAA 4DRXA 2W42A 4ACAA 4J94A 4J0CA 3UAVA 1HXHA 5KHLB 2IBTA 3P9SA 4JJAA 2M32A 2JAXA 2N42A 1SVSA 1LU9A 2AE1A 2P65A 2N1BA 4PHCA 1AKUA 3C74A 3RUAA 3UF0A 3L77A 3KELA 4U9HS 1ZM9A 2YXLA 1AZLA 2G09A 2OECA 3P94A 1P0IA 4C0LA 3LFTA 2P9HA 1DFGA 5CA0B 1G9XA 1QOZA 2ZVPX 4C0SA 1U3TA 1ZICA 2A9KA 1CUXA 5L3VA 4DJAA 3ZHBA 1E5TA 2XOXA 1VPWA 1JQAA 4JDUA 1CBUA 2AW3A 1K8XB 2JFNA 1OFVA 4EVRA 3ZXSA 4A8JA 1QQ5A 3FHTA 3PRHA 2X5NA 1IUOA 2I54A 3IUBA 1Y6FA 3EGXB 3IXQA 4PR3A 3S44A 1GFWA 3KZMA 1AGNA 1LW7A 1T9GR 1AJEA 3G0CA 4WEOA 4RS4A 4TKZA 3QKWA 5HA5A 5A3QA 1AKQA 4EBBA 1DTWA 1Z8FA 3AY0A 3D3JA 4TWBA 5K1ZA 2LWIA 2YMMA 2Q1TA 5E4TA 2O6LA 1AQNA 3OY7A 4ENTA 3ZLBA 1S8NA 4D6YA 3GH3A 4KITB 4XYGA 1Z3CA 3BTUA 1Z2NX 3GLIB 1A98A 4LF5B 2AHRA 3D7MA 4MP3A 1ZCFA 1E4VA 1UANA 2JNWA 3I58A 1YOVA 2Q5OA 1SVWA 5AK6A 4NE9A 4CW7A 2VDWA 2ZTVA 4LSMA 4DKXA 3AJAA 1GCIA 1Z36A 2O2ZA 1HGXA 3Q6NA 3QY9A 4XM0A 1YA8A 5DM2A 3TJRA 2DHQA 3HS3A 3BKXA 3MBKA 5LBIA 2SECE 4CEIB 4G9GA 2YWRA 1X7XB 1AQYA 2X1MA 3DL4A 1SKYB 3OPMA 5C3UA 5HM8A 4JIMA 1COZA 1PGJA 1G7TA 1P2VA 3A1UA 1YNSA 3KYBA 1QRAA 1C9EA 4R98A 2ZWMA 3CVOA 4MWOA 4H3SA 5D6NA 3R5KA 1WUYA 1YTLA 1LDEA 1XQ6A 3BRQA 3CPJB 1RJDA 3IXMA 4PZDA 3PQEA 3IAS1 1Z7EA 4DREA 4H7DA 4RYLA 2ZYGA 3EPJA 3PI7A 1VXRA 3VR4A 1GOTA 2RI6A 2UYGA 3GIDA 4IHQA 4RHTA 5JMWA 1ZX1A 5HQTA 3G49A 5A9SA 1H4QA 1S2DA 1AA9A 2JIMA 4NHOA 1XD2A 4LPKA 3QU4A 1FFCA 4OOEA 4FMPA 1WMAA 3L02A 4D99A 2R8ZA 2CFRA 1ONNA 5ARBA 2ZXUA 3E9RA 4QATA 4EA8A 1VOTA 4XH9B 3WXMA 3BIWA 3IH5A 4UE3S 1LSJA 1OGIA 1COWD 3RR2A 4Z4IA 4YCLA 4GKJB 4MGIR 4YJGB 1UL1X 3HJRA 3C4VA 3TR0A 4J7AA 5FXMA 1PR1A 2XT6A 4LV5B 4ZT5A 1U4OA 4FUTA 2H51A 4JWKA 2I76A 4AI6A 2BFNA 2JD2A 4LCEA 3X0DA 4YRNA 1NR7A 1TZCA 2AWNA 2NYRA 2OTCA 2XYRA 1Y33E 2GARA 1L5RA 3VKGA 1Y7IA 4KQCA 2ZRBA 4DVJA 3KQKA 4MZXA 1SVMA 1GCUA 1LX7A 3Q72A 3GXOA 4OGFA 1XEWY 1GA1A 2P91A 3TEJA 1BAPA 5KVSA 3K6SB 3ZDQA 3V8QA 2P2DA 3MW8A 3DTVB 2XUKA 3PWKA 2R8EA 1PFKA 4MQ4A 1Q57A 4N1AA 2A94A 2WWYA 2C4HA 1XPUA 1TZMA 3VZCA 3FDIA 1OLSB 3GLIE 2H6EA 4JJ8A 3BIXA 3G8BA 1Y98A 2C00A 3G2LA 5GMOA 1U0NA 3T4PA 2H4XA 3ZHSA 1G3MA 1XHLA 3JZMA 2BP7B 3HKEA 4MW9A 3RIEA 5BWLA 3S4YA 1CZUA 2C7PA 4LJ8A 4B3MB 2BTEA 1GSHA 2X8AA 1ISPA 1OFUA 3GBPA 4KGZA 2YJGA 2NTEA 3QW4B 4ZVLA 1SKYE 3IUSA 1J1ZA 4LYHA 5EKUA 1USWA 4AKEA 4BTVA 5BUSA 4MKHA 3QG5A 1RWNA 2FW0A 3P52A 3Q8WA 2O2HA 3CV3A 2C20A 2HFJA 3AVUA 2C9MA 2IP2A 3ZZTA 4V3BA 1JEJA 1KE2A 3G6WA 3ZQJA 4QA9A 2VPIA 4F5WA 5EHGA 5AKJA 3QMWA 3VR3A 4R5HA 3VA7A 1XKXA 3VOAA 4R84A 1TFRA 3ICVA 5CFOA 3LLCA 4YNBA 1CQIA 3RVPA 1U4NA 1U65A 1M10A 2OP0A 2JHAA 4IIFA 4OO3A 4YT5A 3UWPA 1JR2A 3SDSA 4ZTBA 1Z0UA 2QR3A 3A4IA 4H1HA 4QOSA 3QZUA 5TSDA 1C8KA 16PKA 2QM0A 2R6GA 2ENUA 1GL9B 3AIOA 3GJZA 2SHKA 5FUXA 4WBNA 2FVXA 1OHHD 1XL1A 2ZYHA 3SJAA 1X7YA 4G84A 4ER0A 4D3SA 5HHTA 1L4YA 4BVKA 5LMNB 5F4BA 1AU9A 1XROA 3LQ1A 5TQ0B 2C7BA 2QMEA 4ZDKA 1H0SA 2ZUBA 3BMXA 1WMEA 4WLFA 3ES9A 2DSTA 1M6VA 4HWTA 3VR6H 1MB9A 3TLAA 1BX3A 1W0KD 5FBRB 2G6BA 1B8OA 1RJGA 3QIAA 5A4MS 5D5HA 2XB4A 1GU1A 2JH9A 2DUJA 2ZITA 3AB7A 3RRJA 3LVRE 1ES9A 1L7NA 3JD1A 3V8VA 5KYGA 3UWOA 4B8WA 4EATA 3B3GA 3E81A 3EASA 2HX1A 4GLBA 3CJTA 4EITA 5JH7F 4OFXA 2FDCA 3LC1O 4RK7A 1Z62A 1NE2A 4WLNA 2J5QA 4A1FA 2HV9A 3JAKB 2DTDA 2IH2A 1YR2A 3RUPA 4ZO6A 4XKJA 5CT6A 5TIIA 4YPVA 2XWSA 3EJ6A 1JLLA 4ZKDA 1FFHA 3EVGA 1Q11A 3ZUGA 1I1OA 5DCYA 1E6CA 2PQMA 5EYPB 1PKEA 4UDNA 4Y6RA 1V5IA 1QV9A 2I8LA 2PUWA 2UZ1A 3GCXA 3NV7A 1WBBA 3OZXA 2AWOA 3QBJA 5CCDA 1F2TB 4AS3A 4BQIA 2A0YA 3NJRA 3AWIA 1QXSA 5D2CA 2BBOA 4L74A 3IAS6 2PD6A 1L5WA 1LWNA 1L7AA 1PEDA 4PPNA 4OCZA 4INAA 3U09A 1ICEA 1Z4OA 4RWEA 4EABA 3UTDA 1B1CA 1J1UA 4G4IA 3RS2A 4AXBA 5GADl 1JFTA 3ZQKA 1JAZA 3TD2A 1F0YA 2ZBUA 3PC8C 4GZ6A 5ELLA 1ZD8A 4MW4A 1QUEA 5LNK6 3IVAA 2XMBA 4URFA 1M2GA 1ZDMA 3DZJA 1IK4A 1T9GS 2WWHA 3DV9A 1U81A 1CR2A 4M0UA 1RM3A 3E9NA 4B73A 2EFHB 2LPMA 1BU8A 2R8PA 4KACA 1RYBA 1YJ5A 5IJ9A 2P9YA 4MQLA 3NHRA 1ZL0A 2BFCA 3L8EA 2CCGA 4V24A 2XMGA 4A0RA 3L79A 2P30A 1TZBA 4ENRA 1F4VA 1SUSA 2L42A 5H68A 1TLLA 1ZEJA 3HA2A 3C6ZA 1LRJA 1Z8NA 4K9SA 3GF4A 4U63A 3IULA 1HOTA 2XV1A 3I6QA 4URVR 5CXQA 3ZWXA 3RUCA 1USKA 3AILA 4WBSA 3UAGA 5AVXA 3PGA1 3GU3A 1GNQA 3VFDA 4HXYA 5L7TA 4W7IA 5IYZB 4PG4A 4CKEB 5C51B 2W2OA 1O8BA 5C5EA 4CQLA 2I7DA 5FOVA 3RAFC 1OAKA 3OFJA 2Z2KA 4ZZ0A 4MWCA 4ZXFA 3PQFA 1P72A 4CMKA 1THTA 3IAM1 1JBQA 5KAPA 2OQ2A 5J9FA 3EW7A 1GTJ1 5DM4A 3KEGA 5JNRA 5TMDA 5K6AC 1BRTA 3OSUA 4O2BF 4OBXA 3V8NA 4B71A 5KYWA 1RLJA 5AHOA 1HFWA 5BT8A 4UXIA 4GQBA 3DC7A 2JL1A 3M4NA 2VHQA 2XD4A 4J0EA 3DKIA 1OLXB 1UT5A 4U6SA 4QYWA 3WYCA 1SQGA 1GN8A 2O2JA 3SSNA 2GCGA 4ZYLA 1M2OB 4KZKA 3ERCA 1XQ1A 1U7DA 3HPQA 1P73A 2NZVG 4JX9A 5IKEA 4FDVA 3I04A 3FVVA 3QTBA 3W5BA 1IN8A 4U2GA 4HQNA 3G9TA 4JVNA 4JNKA 1PWZA 2X22A 2W6OA 5JLAA 1OSNA 4EA9A 2OMEA 4F9EA 3RASA 1L4MA 3R24A 3L18A 4GPIB 2WJ3A 3B7WA 2DPMA 3MGGA 4QUAA 3ROGA 4B4OA 4XUDA 3KC2A 1UFOA 3E9YA 3B9RA 4EVQA 1RWBA 2RJNA 3HZHA 4YRRA 5L95A 2YQ5A 3OQPA 4J1TA 4X6XA 2ZETA 4LY6A 2FMIA 5HIKA 1SUDA 4MKIA 2XUFA 2HNAA 4BO4A 8MHTA 2QRVB 4JC0A 3LYHA 3FNIA 4TXHA 3ZE6A 2VT7A 1DXQA 5FO1A 3ADOA 1RMYA 2HTFA 4XVRA 1NURA 4IIXA 3KT3A 3FYTA 3HB1A 5GTDA 5IABA 1P3Y1 3O9VA 1EK0A 3BJRA 1XQVA 3K2BA 1RFLA 3M6AA 1YFKA 1A9YA 1SOAA 2DC1A 2GPBA 2QDKA 2W93A 1J33A 4LVCA 1JFSA 4PXYA 4Y2VA 2ZS7A 2QD2A 3TKLA 3VH2A 1WPQA 2NUTB 3EJWA 3PUJA 1EPUA 4MVJE 1O7JA 3F6RA 1KH3A 3ZVKA 1FJGB 4MYDA 4YMHA 2WABA 1J39A 1G5QA 1IAQA 3P9QA 1AE1A 3I8OA 1NNUA 3DB1A 3EBLA 3QKRB 4S0XA 5FBKA 2AJLI 4Y0NA 2FSUA 4XYLA 3I5YA 4G1MB 4JKYA 5BN5A 1Z34A 3HY3A 2YCBA 1ODLA 3I73A 4PWZA 3VC1A 3G2NA 3MWFA 4ZGBA 1J0XO 3JVUA 4LHYA 1L2TA 4C0AC 1RM4A 4QU8A 1AKNA 4M36A 2VAPA 1WTAA 4AZSA 5JQWA 1E0AA 4ZEMA 1KO1A 3YASA 2J87A 1JUDA 1TJ5A 3NR2A 2CE7A 2ADMA 5J4VA 4MW0A 3ZWMA 1YBAA 1FQWA 1ZA2A 2X41A 2XOEA 1L5SA 1U94A 1TQ8A 2Q5EA 4NKRA 3PSHA 3KT8A 3OE7D 2WHPB 4QOEA 2G9NA 2BFBA 4E7OA 3L7AA 2JLZA 3A4VA 1VE3A 3VC3A 3O93A 4CKZA 4DEYA 4MPRA 2Q4TA 4XSHA 4Q3AA 4NRDA 1A9RA 2O7SA 1K6JA 3IAHA 1O5IA 2E21A 4GF5A 5D7BA 2PJDA 3FNRA 4F1KA 1Q1EA 2NT3A 1OH7A 4X61A 1JIVA 4KPFC 3PFIA 1BKSB 3ODGA 4IOJA 3EEOA 2Q4BA 4YC7A 1IRIA 2PXCA 3B3JA 1HDYA 5FTMA 2C5FA 2ONJA 3U3MA 3VHXB 4K6CA 3QYFA 5IX8A 4J0JA 1CY4A 4E4RA 3SYMA 1ZWKA 5KYUA 1GT91 5G02A 3ZDCA 5HUHA 2H5JA 3EVNA 2CB9A 1YR9A 2GSWA 4ZWNA 1ABBA 5EWMB 3NIWA 1C1XB 1DEXA 4Z4HA 5T5QA 3LOUA 4XVQA 3G1UA 2WNSA 3BBPA 3IAM6 3CZCA 1UOPA 2XZDA 4MQ6A 1T5IA 2ZB2A 3FTPA 3GVXA 1IY1A 3GGJA 1UKYA 1Z7WA 3H2KA 3T1TA 4K1XA 2DFVA 5KSOA 1NJ2A 2VCHA 5KYXB 3LWZA 3I9OA 1EHIA 1Y5RA 1YB4A 2H7XA 3PDIA 4JGBA 1XSEA 2I66A 5AKXA 4B2YA 4D3XA 2W2VA 5U9CA 5HRUA 1U1EA 2ZJFA 3WLPA 4F4CA 1N8TA 1I2AA 1AN9A 1KBQA 1C30B 2JFXA 2PKQP 2B4QA 2UUOA 2YN0A 4FLFA 2FTKE 3SHOA 1U3DA 2JFWA 3MIZA 3FNEA 1PTJC 1N1EA 1ZSVA 2X1VA 5DNVA 5AM2A 3T7JA 1B23P 4XDGA 1VKNA 1MPXA 5D3MA 3TSAA 5DGXA 1TC2A 1XNJA 3DMTC 2JJ1D 3JAMA 2QT0A 2AA3A 2EFGA 2RG7A 4O08A 4BDSA 4DMRA 2QK4A 4GMXA 5CTAA 2XMZA 1EUDB 2X0RA 4ARAA 5EXEA 4LJSA 3TWOA 3UJNA 4FIZA 4G0XA 4DB2A 3MFQA 4JLKA 4C4TA 2FW1A 4L4XA 4PYJA 1GNVA 1MU0A 3PXUA 2PMKA 4Y30A 4CN9A 1NI4B 2I91A 3UHJA 4WW0A 4Y9UA 3TIIA 1IHYA 1JHQA 4JT2A 1S1MA 3H9CA 1YB2A 3IT2A 4IDNA 4LOHA 1A2KC 2O52A 3SNHA 1JG3A 1PR5A 3DD1A 3F5QA 3G89A 2BFFB 4IIUA 4MUXA 4O4IA 4PICA 5AXCA 4JHLA 2IUUA 4DLNA 1SCUA 4JOSA 5B3JC 4EI2A 1FYDA 2FI1A 3VVCA 2MYPA 3DE5X 1TCCA 3QPCA 1WRBA 5ALRA 4ESEA 2IOFA 4TZTA 3I9KA 1C8LA 1R8SA 1P6QA 1XELA 1RADA 2IPAB 1B7GO 2UXDB 2I1VB 3Q7EA 1K9VF 2EZUA 2XVXA 3L0IB 1O54A 3CLSC 4Q39A 1CY7A 4GQAA 4GZMA 1P45A 4HQRA 3BMNB 5EXSA 3KQUA 2CLMB 2JI9A 3DZDA 4MQFB 4ETIA 1I5OA 3WE7A 4D8TA 4EX7A 2WJ6A 1CRWG 1Z5OA 3QSGA 3SI7A 3I05A 4LC9A 4XWOA 1DZ3A 1TOAA 3SR0A 5F77A 5J4YA 1IYZA 2BRUA 3OQBA 1DAEA 1ZY2A 1FNMA 1Y7HA 1H4TA 1ZISA 3BWDD 4HZGA 3CG0A 3ZCQA 2FWPA 2I22A 2I4LA 2QRKA 3A6GA 3L0PA 4O4JB 5JSZA 1EXMA 2QE6A 5GZ1A 4DCMA 3ZV5A 3B2EA 1M5TA 3SLRA 1LNSA 3HCWA 2C2MA 4OB7A 3LKDA 1GV1A 5G0TA 2CDAA 4QRIA 5CGZA 1MC8A 3RSCA 1GR0A 4WNAB 5DM1A 1I9CA 2ODWA 3EUWA 3P9ZA 1B0AA 2IPOA 4NG4A 4WOCA 3ZEAA 3F1KA 4EY8A 4MCAA 2H57A 2ZEJA 1NVBA 2JKZA 3MAJA 1MB2A 3BILA 1B15A 3RWMB 2R8OA 3OOWA 1KAMA 1LI7A 1RBZA 1LF5A 4RV9A 4ZREA 1ECFA 1J6UA 4C20A 3HMKA 1U90A 2V4UA 3QFCA 4Y2PA 2VAMA 3JZDA 3PQ6A 2Q6IA 3UOAB 3ZGNA 5BSVA 4NL4H 4KN5A 3PGKA 4MV1A 3TFQA 1MJHA 1CP2A 3LPCA 1YF3A 4AWAA 2HPHA 2FW9A 1I2ZA 1M2VA 2XE4A 4JD5A 1EFCA 3E5HA 1KDVA 4N7RA 3SQMA 2B8NA 3H2JA 4UAGA 4CMEA 4GUAA 1KEEB 1YVDA 1A1SA 2F1HA 3E61A 3AVTA 1JLRA 3R7FA 2GK4A 3ZGZA 1Z73A 2XTAA 4NBVA 4D9FA 2F8LA 3RSSA 4E5DA 2FKAA 4LXGA 5KYKA 3MSXA 4DLRA 2J0UA 3RVDA 3Q7PA 1KYZA 1U3CA 2EDCA 4OHXA 3V4RA 1WU7A 1NBHA 1C3XA 1P4RA 2UVPB 5DM60 4PIMA 4W9NC 4IIDA 5DX1A 4NTZA 3A0RB 5J43A 5JBQA 3IVGA 1O6ZA 3HHPA 1O08A 1WMSA 4DL9A 4YRLA 4QRHA 3L1HA 3G3EA 1ORVA 1D03A 3BXOA 3C98A 4GZ3A 4WVFA 4WZZA 4ARBA 1KDTA 3HDHA 3R0QA 4JJ7A 1RPTA 1L7PA 1TJNA 3B3AA 2ZOSA 4YQYA 3K4QA 1VJGA 1MJFA 1NQTA 3K3PA 3MM4A 5WRFA 4YP6A 3TOZA 4ZYXA 2BUBA 1NYRA 2X7JA 3WBFA 4BMXA 3NBKA 2AVDA 2NQTA 1TEZA 2C82A 2DETA 3H5OA 2JLYA 1GNSA 5IAOA 1YI1A 4H2DA 1D4OA 2HSGA 2J85A 4ZVVA 2EARA 1GZ7A 4FFSA 4ND3A 4MRAA 5REQB 1J00A 4LF8B 2DF8A 1W29A 3K5PA 3R7BA 2JDIA 3Q8KA 3U5TA 1NIJA 1V96A 1ZIXA 1IRXA 4JLOA 4N5HX 2WY2D 2W4QA 4EYSA 2J0QA 2WG0A 1NRIA 4OI4A 3TKYA 2PV7A 1SGWA 3P2MA 5E7JA 4DT1B 4BY9E 5H80A 1CY6A 2DCUA 2G67A 2A0FA 4K7JA 4LXXA 3CJRA 3FFTA 4TVKA 1DIRA 3DFFA 3K9HA 2ZULA 1TCUA 3AXSA 4GMHA 4RU1A 2WIFA 5L9AA 1RLUA 3AP2A 2P1ZA 3LL4A 2BZ0A 3N75A 4P8RA 3C3CA 5HUQA 4M0PA 3DEHA 1FDIA 4UTNA 5FWYA 2XCTB 3FR7A 1LY1A 4L9RA 4S12A 3H2YA 2UXBB 1TMKA 4UU7A 3TNDA 2FLWA 3MTJA 2KI5A 1N33B 4M86A 1VDMA 4XGRA 1AD2A 2R7KA 3UVEA 2B6HA 4EHHA 4EJ2A 4IJUA 4XX0B 4DRZA 2VNKA 4DLKA 2XEXA 1KPHA 2D8AA 1EP2B 4QUEA 4LPSA 3I4FA 4EFDA 4JLNA 3N07A 1A9SA 1CVIA 4I9UA 2JAHA 5JCZA 3DO8A 3BRWD 4OUDB 4YPOA 1JG2A 4NABA 3DOEA 4YMSA 1IUPA 2R2AA 5DT9A 2JK0A 1T36A 1Z2AA 4JA0A 3R7WB 5KNCH 5G2OA 3WX0A 3UHAA 5CB4F 2ZZNA 3SE7A 5CB6A 1GPWB 4KUGA 5E7MA 1A04A 2H2DA 3KZOA 1U3UA 4WUVA 3W2EA 4DE5A 1LQTA 1JPVA 2G07A 3D2BA 2QX6A 3OLYA 4UC0A 1NFRA 1J4AA 1L5KA 2QYTA 1RI3A 5TQ2B 3V8PA 1QVZA 1KXZA 5EA2A 1M33A 3TM5A 1Y3CE 2XB8A 3NNSA 2AMFA 4O29A 3FVWA 1LDYA 3K0BA 1ZBDA 3UA4A 1Y3HA 1RE0A 1P9OA 1WXEA 4UHFA 1DBQA 1T9CA 5K3SA 3RYHB 4G8CA 3UB3A 4YLYA 4RTSA 2FQXA 3RAPR 2PX4A 1N9ZA 1VGQA 4ED9A 1DQPA 3AHFA 4FE7A 4FP9A 2QMOA 1ZQ1A 3RC1A 5IT0A 1NBOA 4L8WB 3T41A 3NOVA 2Q1SA 5F2KA 4N03A 2ZTUA 4L72A 1W46A 4M46A 3SXUA 3M83A 3QXXA 4Z7JA 3RJ9A 1UADA 4PC1A 4EY3A 4OP2A 2WJYA 5DN6D 5J2TA 2GZHA 2A0UA 2FWJA 2MSLA 1RLIA 4DV4B 2ZXEA 3LFHA 2IWHA 3T7RA 1VZ2A 1T1RA 5B64A 2H48A 3JALA 2IUTA 1DEOA 3G5LA 5E4YA 5IPFA 3ESYA 1TEXA 1EI9A 1PTKA 2A1UA 2IEDA 2XQFA 4CLOA 3C48A 3T3OA 1K88A 4K9RA 1WP4A 3PNKA 3HE3A 2E5LB 3RG2A 5DV9A 4MDYA 2GCNA 2IPNA 4MAFA 3O2JA 3OPQA 3QW2A 1S02A 4BKPA 1E0KA 5BMVA 4MIYA 4CKBA 5EKXA 4Y6GB 3ICQB 3GLGE 2D06A 3AG5A 2FSVC 1L5YA 1M6HA 1WUIS 2J0EA 2Z57A 5HCNA 1I01A 3PQ5A 5CURA 4IHAA 5COBA 1C4KA 4BGIA 5BW4A 2P4QA 1GGFA 4UATA 1K3UB 5G1PA 4IPTA 2WF6A 4YROA 3PUIA 1ZWLA 3FLEA 3S2FA 2VDJA 3VKWA 5C4MA 2D7JA 4Y1RB 1ODFA 3DV2A 5TV2A 2WJVA 1J70A 5KVQA 3FCSB 3UMFA 3BHIA 3M9XA 4HAUA 4RTMA 1U02A 2YR0A 1L1FA 1VJRA 1PHRA 1SXIA 2PLRA 3EG5A 3GGDA 3K9NA 3MUNA 4KXXA 5FB3A 1E9VA 2AQKA 3FVQA 5F9MA 2J3QA 3TRHA 2DTEA 2G1PA 3F6SA 1X19A 1QQ6A 4WT7A 5FH9A 2AEJA 1SIUA 3M6LA 4UHHA 3O8CA 3D0KA 1LI4A 2MSKA 3R3HA 1L5MA 2ZRLA 4P3PA 5GZ6A 1PT5A 1G3UA 5HE9A 4D2IA 3OEYA 1UF9A 2HPVA 4QM7A 3C6MA 3ST7A 2BLLA 1J0BA 1EXNA 2DQZA 2V7GA 1PJAA 2JH8A 3DNFA 3NHSA 1P4AA 3I1YA 4G0QA 4XD7D 1V25A 2NU8B 3SS9X 3COWA 3MELA 3PNYA 3CZ5A 4Z1MA 1AS2A 5EFOA 3T6KA 2QHXA 4ZVRA 1NN5A 4UMFA 4JYMA 4KGVA 2QRPA 4D8WA 3Q0TA 5AUPB 2IKSA 3PX3A 2ZKIA 1GEGA 4FFOA 5AR1A 2H65A 3VHRA 4C4AA 3NJ8A 3ADKA 5FAXA 4PPQA 1V8ZA 5J63A </