4Z6KA

Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
345
structure length
345
Chain Sequence
b'MKAAVLHEFGQSLQIEEVDIPTPGAGEIVVKMQASGVCHTDLHAVEGDWPVKPSPPFIPGHEGVGLITAVGEGVTHVKEGDRVGVAWLYSACGHCTHCLGGWETLCESQQNSGYSVNGSFAEYVLANANYVGIIPESVDSIEIAPVLCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHMAVQYAIAMGLNVAAVDIDDDKLAFAKKLGAKVTVNAKNTDPAEYLQKEIGGAHGALVTAVSAKAFDQALSMLRRGGTLVCNGLPPGDFPVSIFDTVLNGITIRGSIVGTRLDLQESLDMAAAGKVKATVTAEPLENINDIFERMRQGKIEGRIVIDYTMLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Moraxella sp. (strain tae123)
publication title Structure of alcohol dehydrogenase from the antarctic psychrophile Moraxella sp. TAE123
rcsb
total genus 112
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z6kA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4z6kA01
4NQZA 1TVEA 1LSJA 4AJ1A 1NASA 1GZ4A 4Y9DA 1NHGA 1IB6A 3HNPA 3OQ1A 3FTNA 3OM9A 3LYLA 1JVBA 1KY4A 3QWIA 5JS6A 1T24A 1U5CA 3QE3A 1QRRA 5ILOA 1B26A 2CY0A 4GX2A 4IQGA 1CYDA 1HE5A 5JDCA 2C2XA 1C1DB 1Y8QA 1FK8A 1L1FA 3WFJA 4BNZA 2E82A 1X13A 2O3UA 1GFSA 1OAAA 1ZO8A 4LCJA 3GDGA 2VYVD 5KNLA 1ZSVA 1ZZEA 4XYLA 3I6QA 4AJEA 1V35A 1ISHA 2WJPA 3ETGA 3K8ZA 3CUKA 3JSAA 3RUDA 4F3YA 3RASA 3R6DA 2Y1OA 1ZEMA 1ISMA 4N54A 2EP5A 3BMQB 4QFCA 4J49A 4RO0A 5ER9A 4HNHA 4KUGA 4K1LA 2BI7A 3DDNA 3OJFA 1BW9A 1YB1A 2JCXA 4IJKA 2EP7A 4AJIA 5JMWA 3NTOA 4MVJP 4GMGA 3JQ8A 2WD7B 3QRWA 3DBRA 3GVXA 1JN0A 4WLOA 1ZKMA 1H6BA 4RGBA 1I36A 1MG0A 2HK9A 1VPDA 4AFNA 1N9GA 1DJQA 4J7UA 1UXGA 4O1MA 3MJ4A 1GR0A 5BSHA 4BUCA 2QZ9A 1DFIA 4MVJI 4E5NA 5DP1A 3VPFA 3FNHA 1NPTO 3UF0A 1GUYA 5AXAA 2HKIA 1LUAA 3CMCO 3PEFA 1OBFO 3QW2A 1H6CA 4IPTA 1ZH8A 3JYNA 3H2ZA 1YWGO 1KERA 3E5RA 5IXSA 2IEBA 3GMDA 2BKAA 3KEQA 2CUKA 4IS2A 2Q99A 1XELA 2C20A 4NHEA 3O03A 5CEEA 2BGMA 3KZVA 4NBVA 1A9ZA 5L51A 1GZ3A 5ENDA 4KTVE 1PZEA 1EVIA 1UXKA 1VE9A 1HDGO 1VLLA 1X1EA 2O48X 3PI7A 3ZNPA 2X58A 5F3RA 1MXHA 4FQ8A 4AJ2A 3OF2A 4BB5A 4E32A 4BNMA 2ZCUA 1XKQA 1ISJA 1EBUA 4ZD6A 3ZHZA 3BIOA 1XR3A 1I3NA 3ANNA 1BXKA 4CQMB 1LDNA 4NBRA 4ZQEA 5GZ3A 1A71A 5TIIA 3WGTA 1BHSA 4CM6A 1Y5RA 2V6BA 1I2CA 1E1KA 1ZK3A 1LDBA 3ZWNA 3ZGYA 2W90A 2PGLA 3BAZA 3KYCA 1PGPA 4NPCA 4JXKA 3HDJA 5IDWA 1XU9A 3I9LA 5B4TA 1YDEA 3L6EA 4XCVA 1KEWA 4CM9A 4DC0A 5JW6A 3DOOA 3WLEA 1VM6A 3CINA 4D3DA 1R4NB 1UZNA 3NEPX 2AHRA 4PZEA 2X5JO 5B4VA 3HN7A 2UAGA 3ADOA 4IJVA 5IZCA 4CQLA 4IM7A 2AMFA 2BH9A 3FWZA 4RPHA 3TQHA 3W8EA 4B7XA 2DFDA 1I3LA 2EJVA 3MTJA 3QSGA 2W2LA 3L4BA 3VDRA 5CG2A 1SBYA 4HXYA 2NU8A 3ROQA 1U8FO 3DBLA 2VQ3A 2X23A 3F3SA 3HB4X 3SVTA 4IQ0A 4NMHA 3LF2A 4DTIA 4LISA 1NAHA 5HBRA 3WGYA 4J1SA 4ZQFA 4DQUA 4JCOA 1LLDA 2IZ0A 3RUEA 3FBGA 4IUYA 3H9JA 4ND3A 4PLPA 5G4KA 3NJ4A 4YAKA 4IMPA 3N7UA 1Q1NA 1T26A 4PLHA 2W4QA 1RKXA 4HP8A 1M76A 2OP0A 5A9SB 1T25A 1HL3A 4KWIA 3DEYX 3GN2A 2EGHA 4INAA 5IDXA 4ALJA 2TMGA 3C1TA 2WEKA 5A3JA 1C14A 1ADGA 1WNTA 4Y98A 4XYEA 3G17A 3C7CB 1VKNA 3CTMA 3KM0A 1X7GA 4W4TA 1IY8A 4XYGA 2VYND 4RPJA 3IMFA 3U49A 4EJ6A 5C5IA 2IEDA 4CV0A 4IQ8A 1KEPA 4ILKA 3HB5X 3OJOA 1YL5A 1WVGA 1G0NA 1I2BA 3U4CA 2D1YA 4DPMA 5COQA 4OH1A 3IP1A 3JQ9A 3U4IA 4D44A 3ZWPA 2C7GA 4ZU3A 5FWNA 4IBOA 5I8ZA 1XDWA 3L4BC 3ROKA 5L95A 1ONNA 2J5KA 4YRDA 1U3WA 1ZMOA 1TLTA 4BV8A 4C4OA 1AE1A 4E0BA 2PZMA 4TZTA 1GL3A 3DMYA 3WS7A 3JQEA 1Z7EA 2OZPA 4BNJA 5IN5A 1P33A 3H7AA 4CM7A 1QLHA 4DLBA 4L9RA 2JHGA 5ADHA 5THKA 2VHZA 5ITWA 4CV2A 3C1AA 4UVIA 4B4OA 4G81A 3GN1A 2IYOA 4OO3A 4QX6A 2I65A 2AG8A 3EZLA 4OIMA 1JW9B 2VOJA 4YRAA 2C59A 3SLGA 1NXQA 1SEVA 4BQRA 3IKVA 1HE4A 4GX1A 1FMCA 2BFPA 4K26A 1Y8QB 3RCBA 5CHEA 2EXXA 1HWYA 2IDZA 5DBGA 5ITVA 1U2DA 3OFSA 1DXYA 1GZ6A 2ZQYA 3I3OA 2DPGA 2QRKA 3H65A 3X2EA 1XGKA 5AXBA 2VYVA 1BXZA 1ISFA 3M1LA 3PK0A 4CM4B 4JROA 4MPDA 1PJSA 4A2CA 4WKGA 4BO1A 4F6LA 4HUJA 4DQVA 2AEJA 3A1NA 1B8PA 1Y6JA 3PHIA 4CUZA 4GQAA 2HK8A 3ZNOA 2VWGA 2VZ9A 4AL4A 4DPKA 2DLDA 4FJ2A 5TRTA 4DIFA 3I9JA 2UV8A 3DBRB 3UCEA 4YT5A 1I24A 3H9EO 4OXYA 2FWMX 3ZWOA 4E5KA 4B3HA 1YBVA 1N7HA 4ALMA 4YYZA 5JCXA 4LSMA 4DLAA 4ND2A 1UZMA 2CD9A 3B1KA 4DWVA 3ZWMA 5G0VA 1PTJA 1ADFA 1P31A 3DAFA 5F5NA 5BNFA 1GYRA 2BFMA 3RJ5A 4JIGA 3S2IA 4E21A 1EEHA 5F1OA 4Q3EA 1BVUA 2B83A 3Q9NA 2FZEA 1ARZA 5HA5A 1OC2A 3U3XA 4DBVO 3F4BA 2IXBA 2EG9A 4E31A 1B2LA 5DOVA 2NLOA 2V7PA 1T2AA 3H9GA 4ZQGA 4B3IA 2CDCA 3IP3A 4L4XA 1HDRA 1QV6A 4H15A 5DZSA 3PRJA 3AFNA 4FPXA 4OXKA 4X54A 1ZK2A 4QTZA 1NWHA 2GZ3A 5AQ1A 1W73A 1DHTA 1TB4A 2ZYDA 1MFPA 3WYEA 2DUUA 2OFPA 2DPHA 4NU6A 3D3WA 3WBFA 2I66A 4Z6KA 3DB2A 3RJ9A 1DRVA 1M6HA 1KC1A 5DF1A 1GQQA 1WZEA 1PGJA 4OQZA 1ZBQA 5C37A 2C5EA 1JA9A 5AOVA 3TZ6A 5DCUA 3PLNA 3FI9A 3AJRA 3L9WA 2PR2A 2X9GA 2A4KA 2O2SA 3PYMA 4MVJM 3JTMA 3BA1A 3QWHA 3RUAA 2X5KO 4I5FA 5DCYA 3MZ0A 3OP4A 4NK4A 3V8BA 2VZ0A 5B1YA 1HT0A 3RC7A 1DB3A 3LDHA 2VRBA 3S2FA 1YE3A 4CLXA 1LX6A 5TC4A 4BGEA 1NVMB 1FDUA 1DLIA 1XSEA 5K1SA 2Y68A 1TA4A 2JKVA 1UJMA 3GOHA 4YCAA 3OQBA 3GDFA 5I9MA 2E48A 3F4LA 1KC3A 4CMGA 1E3WB 4BNUA 1E77A 2GGSA 2ZKLA 1GADO 2RHCA 2V6MA 4L4RA 4NFSA 4J9UE 4W7IA 3RAJA 1GU7A 1R6DA 1RYEA 2CVOA 2QYTA 2D0IA 2FN7A 2WTBA 4KQXA 2PA3A 5L40A 3VZSA 3CE6A 4R1NA 1SCUA 5EJ2A 2R2GA 3R0IA 1NNUA 4FFNA 3CXRA 1OC4A 4FFMA 4YQZA 4R9RA 2YDYA 5IAAA 4OJNA 3E18A 1JDJA 3LVFO 5JXWA 5JBIA 3KEOA 2VNSA 3GR6A 1YOVB 2HU2A 3Q9UA 5HWSA 2GDZA 2R00C 3ENNA 4IDCA 5DOZA 4P4NA 3VVCA 4GLLA 5EERA 1R0SA 3HSKA 2ZJ0A 2OP1A 1JTVA 2VHVA 5T5QA 2X86A 4BNGA 4YA6A 2EEZA 4XQEA 4OMUA 4NI5A 1MV8A 1YJ8A 2ZTLA 4NJMB 4YAGA 1QYVA 4BNYA 4GPD1 2WWRA 3UVEA 5A3VA 1WWKA 3DAPA 3HADA 4MVJF 1P77A 4BKPA 2Y67A 4FJ0A 3WSWA 4HY3A 2X9NA 4II2A 3PHLA 4ZRMA 3QVOA 1IYZA 1UAGA 4UVDA 5ILGA 4CM5A 1P1JA 3HFSA 3ZV5A 1R0KA 4EJMA 5A4DA 5FI5A 3VC7A 3VHRA 4LW8A 1K6JA 2X0JA 4O59O 2FPPA 1DJNA 3RROA 3LT0A 4LCEA 3AUAA 4IMRA 5KJCA 5L9AA 4BMVA 5KVCA 3GPIA 1L7EA 2UVDA 2YDXA 2CZCA 4L4SA 5AYVA 4A0SA 3AI3A 1KVSA 4M87A 3FPCA 1DC6A 4NG5A 2HCTA 4UVHA 2ZQZA 4MP6A 3TDKA 2P4QA 3ZWXA 3H3JA 3SBOA 3VOSA 3EUWA 3R1IA 4AJHA 3OQ6A 1CJCA 2W2LD 2ZB8A 4BNWA 5K6AC 2SCUA 4BGUA 4LSWA 2JD0A 4Q3CA 4W99A 5BNIA 3F5SA 5JYEA 2HJRA 1HZZA 5A06A 2VWPA 3AM4A 1PS9A 1IZ9A 4CODB 1U3TA 1P3DA 2RH4A 4CV3A 3GDOA 3MTGA 4CJXA 2C07A 4XGNA 3W4KA 4YJHB 4YRBA 1UZLA 1SO8A 1UP7A 4J3FA 2FPIA 4K28A 3JQ7B 3IJRA 1R15A 1EFKA 5T67A 4QECA 3MOIA 3WWYA 2WE7A 4OKIA 4E5YA 4A5OA 5EL0A 1LNQA 2YUTA 1C0KA 2A9FA 3NUGA 2I5PO 3JQBC 1HDYA 3DFUA 1RM4A 4YB8A 2O7QA 1E7QA 4DIBA 4GX0A 3LT2A 2I3AA 3MJVA 3Q2KA 3GVCA 3KTDA 1PQPA 4JBHA 4BKOA 4RV9A 3T7CA 3I6IA 5B4UA 2FRDA 1J4AA 1B0AA 4FGWA 1V3UA 1H6AA 5KJEA 1ZXBA 1QV7A 5CDGA 4WNCA 3GUYA 3OICA 1JKIA 4RF5A 4RORA 3RFXA 1EBFA 3KYBA 2GO1A 4OOEA 3UCFA 1KY5A 1CF2O 3EHEA 1NQ5A 1GEEA 5T6BA 2OXIA 2YFQA 4LRTB 2HDHA 3FBTA 2YV1A 3I4CA 3KSDO 4P4LA 1HDOA 1GQ2A 1TEHA 2B4TO 4XGKA 4R41A 1HE3A 2PD3A 3TL3A 1TT5A 2PWZA 2YV3A 4HFRA 3D3WB 1HYGA 3AWDA 5IZCC 1P74A 3NDRA 3S1LA 3SJUA 3VKVA 4HFJA 4CMEC 1DRUA 3OIDA 2NACA 5HM8A 5I8WA 1GV1A 1V0JA 4J6FA 4W7HA 1PGQA 4P38A 1DAOA 3VVBA 1PU2A 4E30A 1WDMA 3E8XA 2PZLA 2FOIA 4WLVA 7ADHA 2I3GA 2X0RA 3H5RA 3PWZA 4GAEA 1J49A 3QV1A 1A4IA 3TNLA 5TQVA 1B14A 1VL0A 2YY7A 3DOCA 3GZ4A 4IIVA 4J7XA 1ONOA 1DC4A 3RUIA 3VKUA 3WB9A 4BGVA 4GL4A 3EVNA 4CV1A 1YO6A 5KVVA 2JJYA 2DC1A 2AQHA 4IGFA 5C7OO 2CF6A 3VDQA 3L77A 2XAAA 1E3IA 1ADCA 1Y8RB 1E3WA 2CFCA 3FNEA 3JQAD 1BVRA 5JO0A 3IL2A 2GZ1A 3VPGA 3PDUA 4EYEA 3KYDB 3PFWO 2P68A 4B3JA 3QLJA 4M8SA 4NK5A 3QVXA 3RI3A 4N5NA 3AUUA 2G82A 4PLTA 5H82A 3O9ZA 2VNAA 3V2GA 2WE8A 4R9SA 1SPXA 3NGXA 3AU8A 1NR7A 3PHHA 4ALKA 4CLDA 2GSDA 1E3LA 3MWEB 4IDBA 1DFGA 1E1LA 4M1QA 3F9IA 1T1RA 2AQ8A 4EUHA 3U62A 5A9TA 4OKNA 1YOVA 3A4VA 2PZKA 3K96A 3JQFA 3GNTA 4Y67A 4FCCA 3D4NA 3FHLA 2XXJA 3UCXA 5AXDA 2OMEA 4UUMA 5F1PA 3K73O 3QQPA 3NTQA 4MO2A 1PIWA 1K89A 4R68A 3ZCXA 4PN3A 4A27A 4QXMA 4BIIA 3GPDG 1C1XA 1GCUA 4ZQHA 4DIOA 1B8VA 2CNBA 2P9GA 4TVOA 2PTGA 1R4MA 4Z3DA 3D0OA 3JQCA 3JQAB 3TZQA 1ENZA 3RC9A 3HUDA 3P7MA 1EE9A 1SNYA 5DDIP 3C7DB 3ZU4A 3BMCB 2UYYA 3GFGA 3TOXA 4ZN6A 3ZNQA 2IE0A 4QSMA 1GAEO 4K6CA 1N8KA 2DAPA 4FN4A 4E2XA 2VRCD 2AQKA 1M67A 3OA2A 4TROA 4FDAA 4MDHA 4MKZA 1Z7BA 3LSYA 1GV0A 3TPCA 1ZXLA 1YBMA 1JQBA 4J1QA 5BSFA 5J23A 1ISGA 3QVWA 1V3TA 5JDCC 1OFGA 2NNLD 2Z1MA 1FXSA 3MJCA 3BTOA 4BHTA 2Y99A 1AXEA 1H0KA 1WMBA 4XDYA 2Q46A 3ASVA 1X7HA 4J0FA 4YR9A 1XCBA 4EEXA 3OEYA 4BO6A 4AJJA 1PL8A 3IDSA 3W6UA 1ZIDA 2GYYA 5TF4A 2OBNA 1PZHA 1VL6A 3DAGA 3E03A 1LRJA 2WYVA 1NQAO 1B7GO 1UR5A 1V9LA 4U0KA 3ZWAA 1P0CA 2O23A 2ZYGA 4IXTA 3QVSA 4RZIA 1H93A 4KMSA 5L7WA 2QIOA 4NJOA 2GLXA 3SJ7A 3DZIA 1I10A 3DZFA 3CMMA 4RF2A 1PJQA 2EF1A 3NAQA 2D4AA 3BMOB 3DTYA 3GZNB 4TZKA 5IN4A 5JCJD 1LSOA 4N5LA 4BMSA 5A05A 2GZ2A 3D4PA 3GC6A 4ROSA 1T2DA 3GFBA 5JDIC 4Z9FA 4L76A 1W6UA 2O7SA 3NDIA 3UGKA 4CMAA 4R3WA 2P9CA 1HYHA 2IYPA 1A72A 2WD7A 4BNXA 5BQFA 1HLDA 1FDWA 3KV3O 4IDAA 4CL3A 4CMIB 2E4AA 2NVBA 3RC1A 1LEHA 4CM1A 1GDHA 1PJ4A 2Y1EA 3E9NA 2W98A 4E4YA 3GNQA 3IUSA 5JDIA 4DL9A 1EDZA 1MA0A 4YJFB 2PY6A 1NHWA 2Q50A 5DBFA 5EINA 4P8RA 3PDJA 4NH4A 3NV9A 1U28A 2Z95A 1KS9A 3G79A 4XQCA 3CEAA 3IS3A 1DHRA 1HLPA 3JQ9C 2JAPA 2RBEA 3DBHB 5KJ6A 1PJBA 3PP8A 1O6ZA 1LRLA 1QYXA 4XEHA 1MC4A 5TJ9A 1PL7A 3H9QA 3GQVA 1PQUA 3O4RA 4JGBA 4Q3AA 4RCVA 4RPKA 5DBIA 4BNTA 4E2WA 3IJPA 5KKCA 4CUJA 1F12A 3TFOA 3PGXA 3OH8A 3RUFA 3RBXA 1LU9A 5KOIA 1WDKA 4J9VA 3RUCA 4R01A 4Z9XA 1GYQA 3K2BA 1I3KA 1GUFA 2GASA 3ZW9A 3N58A 1RWBA 4A10A 1K6XA 3QVTA 3K31A 3UOGA 4CQMD 3A9WA 4A73A 1HZJA 3AW9A 1KOLA 2OGUA 5IFLA 3WXBA 3S8MA 3BYZA 3T4EA 4ZGWA 3PZBA 2W8ZA 2QX7A 4AJKA 3E9MA 4GGPA 1IUKA 2HAEA 1H2BA 3GG9A 4CR6A 3E5MA 3G3EA 1PZGA 1F06A 5KJ1A 4PLGA 2YV2A 2VT2A 1JAXA 1SMKA 2NQTA 4F46A 4TRRA 4O0LA 3A06A 3KVOA 2Q1UA 3W8DA 1PWZA 3PJFA 3AY6A 5CEJA 4J1NA 3AU9A 4WPGA 5HRUA 2AEMA 2RAFA 2VUUA 4R4JA 1WMAA 4DPLA 3KB6A 5I9LA 4BNFA 2EW2A 3L6DA 2DKNA 3ORFA 1ULSA 4LN1A 4JLWA 3LT1A 2PNFA 1NQTA 5JO9A 1BSVA 3CPSA 4RVFA 1DDOA 4IS3A 1XWFA 3KYDA 9LDBA 4ITUA 2YW9A 1PJTA 1UDAA 2HQ1A 4YJGB 1UDCA 3BHIA 2EJWA 2NWQA 2YYYA 2PD6A 4U5QA 1GEGA 2UDPA 4UVEA 1PJ2A 3AY3A 4U7WA 1D3AA 2I9PA 4PGFA 4WECA 1Y1PA 5KVSA 3H2SA 1N7GA 2EGGA 4S3MA 3I23A 3TL2A 2PH3A 5ICSA 3RSHA 5COBA 2Q49A 4AJLA 5A5FA 2AE2A 4KDEA 3ZZNA 4XJSA 4IGEA 3VH2A 1MP0A 2CF5A 5A9SA 4RJTA 4Z0PA 4FC6A 5CEFA 4IIUA 2DBQA 2HRBA 1JAYA 3IOYA 4I9HA 2NTJA 3BZUA 4OHUA 1Y9AA 4Q9NA 5KTKA 1RM0A 4Z0HO 1EZ4A 1YB4A 4BO7A 4BVAA 1GYPA 1X1TA 4GLOA 1R4MB 3NT2A 4LMPA 1IZ0A 1MGOA 1YJQA 4EW6A 3W4JA 1EK6A 3JQAA 2WMDA 4L8VA 1BXGA 4C7KA 4RVGA 1EQ2A 5L7YA 2QHXA 3EY4A 4BNVA 2PGJA 3KSZO 3IC5A 2JD1A 4I9UA 4YACA 3H8VA 3OJEA 3ON5A 3BMCA 1ZW1A 1P1RA 3ABIA 5A03A 1WDLA 2BI8A 2GN6A 1P1HA 4Q3DA 2DU8A 1UUFA 1QLJA 4O5OA 3GVIA 2NVUB 2NQ8A 2P2SA 3WNVA 3WQRA 4HX5A 3QHAA 4R5MA 3ZNNA 2BGLA 3FRJA 2AW5A 4DA9A 4YBZA 3LZ6A 1P1KA 3ZU2A 4HBGA 4RQTA 4BO3A 5ICMA 2H5LA 1I33A 3AUSA 3EAGA 4FBGA 3U0BA 4CMBA 1X7DA 4I5GA 3RVDA 4R3NA 1T4BA 2GD1O 3H4VA 5JPIA 1B8UA 4Z9YA 3TJRA 4WLFA 5G2OA 2NV6A 1B3RA 4CM8A 4FD3A 1TI7A 4HWKA 2Z1NA 4AJ4A 3FPLA 1S7CA 2NU7A 3DHYA 3WGGA 1NAIA 4J7CA 1FDVA 1Q7BA 3E82A 1ZNQO 5CP8A 1BTOA 1VJ0A 3MEQA 3WQQA 1XEAA 3BHJA 3B70A 4CM4A 1DC3A 4BNHA 3BMOA 3EGOA 3GZNA 4MKRA 1ULUA 1UP6A 1MLDA 3OECA 3VTZA 2I67A 2OHXA 3G49A 3FN4A 2A94A 2Y1DA 1P9LA 2RIRA 3VAZA 2C29D 3EDMA 2HMSA 4YAEA 3HHPA 3P19A 2HO5A 3T4XA 3KSUA 2H9IA 4JJGA 4H7PA 3H9UA 1PZFA 1U4OA 2JFFA 3V1TC 4BOYA 5K6AA 4YJFA 2QG4A 4PG6A 4JJIA 5IF3A 1Z82A 1YDWA 2GNAA 1XG5A 4LMRA 1XQ1A 5MDHA 1CQJA 3U4DA 3VZPA 1DSSG 3ENKA 1H9AA 4WCFA 4XA8A 1OMOA 4YJDA 4BNKA 5KJFA 2VWHA 2X1HA 3S2EA 1KVTA 4WK6A 3CKYA 3F1KA 3FNGA 3GGGA 1E7RA 3CH6A 2Y1CA 1RJWA 3GH3A 4M55A 1DLJA 4Y6RA 3GY0A 1Z45A 2B37A 5DULA 3GGOA 2C0CA 3C1OA 1H2HA 3K2EA 1XQ6A 3OHSX 4UREA 1U3VA 1XLTA 5JAMA 3GG2A 3DHNA 3VH3A 1G1AA 2B69A 1S6YA 4UULA 3LF1A 1Q0LA 2CDAA 3TOZA 4TWRA 3AOGA 3U4HA 3ANLA 1QYDA 3DZHA 5B12A 3LT4A 3VZQA 3LC7O 3DR3A 3LC1O 3OJ0A 1EE2A 4IDGA 2VTDA 4WCDA 1WW8A 1H9BA 3BHMA 3ZHXA 1A4UA 3N74A 3VPHA 2J5RA 3GA0A 3QP9A 1O9BA 4O63O 1AHIA 4MKXA 2P5UA 2D5CA 4XDZA 3MJTA 2LDXA 3FCOA 5I7EA 2C7VA 5CAEA 1LJ8A 4PG4A 1YL7A 1H6DA 1HXHA 5BSEA 1PL6A 1T4DA 1YRLA 4RF3A 4Y6SA 3ZWWA 4ND1A 4RLHA 4JBGA 4GKVA 3JD4A 3DXFA 3Q1LA 1LDEA 4DRYA 1KYQA 4MIOA 3DQPA 3B1FA 2FHSA 5MGBA 3INGA 4CMCA 4XGIA 4WNIA 1N1EA 1WXDA 1B15A 4WLNA 4OSOA 4YT8A 2A92A 4UVGA 1A7AA 4QEDA 1JWBB 2RH8A 3Q2IA 4GI2A 4PLCA 3RKUA 3ZW8A 1X14A 1WLYA 4E33A 1T1SA 5GZ1A 2NTVA 1AGNA 1P1FA 1PQWA 3KOUA 1QR6A 4YTEA 2X0NA 3IUPA 4EDFA 4DUPA 3AOEA 1H94A 2C5AA 2DT5A 2DM6A 3CZRA 3WFIA 4QT0A 1PGOA 5L53A 1D4FA 3GRPA 3QIVA 3M2PA 1VJ1A 3WYBA 4CLOA 2VHWA 4RVUA 3VPXA 4AVYA 3I5MA 4K9DA 2PK3A 1HKUA 5JC8A 2UUPA 3NTRA 4CM3A 3JQGA 2J8ZA 3GVPA 2I76A 5T8KA 2PKRA 3UKOA 2IXAA 3I52A 3DOJA 1J6UA 1P0FA 3PPIA 1M6WA 5IZ4A 2AG5A 3GAZA 1FJHA 4XR9A 8LDHA 3E6AA 4NJMA 5TT1A 3LLVA 3RKRA 5CPFA 2YZ7A 1PJ3A 1QYWA 3U9LA 4HFNA 3OA0A 3F1LA 3AUTA 1B3BA 4CMHA 4GH5A 1HYEA 1NVTA 1DBVO 2Y05A 3B1JA 1GCOA 4P22A 4YEDA 1D7OA 2Y66A 4I8XA 2UUOA 1U2GA 2NU6A 5BT9A 2GN8A 5CG1A 1I8TA 1UXHA 2R6JA 4Z3KA 4N7RA 3FTPA 1U3UA 5THQA 2NVUA 1ZCJA 2POQX 1VI2A 3UICA 1WP4A 4YT4A 2G76A 3NT5A 3EK2A 2O3QA 3RBVA 2NADA 2IRWA 1IE3A 2G17A 3K9QO 3H6KA 3WMXA 2O3SA 4D45A 4EEZA 4PLWA 4RQUA 4BKQA 4RL6A 3RBZA 1AN9A 1SB9A 1U8XX 1TT7A 3ZDFA 4XB1A 1V8BA 3QY9A 2Q45A 4MVJE 5JAZA 2O3TA 4WEOA 1IOLA 4HFMA 4ZA2A 2F1KA 3ANMA 1QP8A 4FOSA 3INTA 4XB2A 4OYRA 2FSVA 2EWMA 2X5OA 4I5EA 2HJSA 2QW8A 3OBBA 2I99A 3WMWA 3C7AA 4PLFA 2OOSA 3JYQA 4BL5A 3KRTA 3HFGA 1A27A 1GY8A 4D43A 3JQDA 4ZJUA 2BD0A 3WGQA 3WR5A 2ZATA 4E12A 3ASUA 4L0QA 4U6SA 1UAYA 1X15A 4MVJA 3JQ7A 4CUKA 1Y81A 1I32A 1UH5A 2PGDA 1C0PA 1LA2A 4TKLA 2O4UX 4GWKA 3H5AA 2Q2WA 3ETEA 3BMNB 3HZZA 4TRJA 4EJ0A 4IJWA 4ONEA 5LDHA 2DTXA 3TFQA 4FB5A 1E7YA 1VC2A 3GGPA 1R16A 1YL6A 4BMNA 5I9NA 4I08A 3JQ6A 3MOGA 2JCYA 4GMFA 1EUZA 1ONPA 4TVBA 2G1UA 3C24A 4FS3A 2Y93A 2Q4EA 2X8LA 4FFLA 4AJPA 4JX8A 1NFFA 5JY1A 4QO7A 3WGIA 1EDOA 1WPQA 1E7MA 4PZCA 1PR3A 5GY7A 1D8AA 1HEUA 3MWDB 3RC2A 1E3SA 1LDYA 2FP4A 2VWQA 3C8MA 4O6VA 2VRCA 1SOWA 3IQDB 2CSUA 4WCFB 1X0VA 4NNJA 1DIBA 5JAQA 4XQ9A 1KVQA 1WAMA 2OORA 2HMUA 1U1IA 3PJDA 5G0WA 4B8ZA 1V6AA 3GEMA 3M1AA 5A5EA 3HDHA 1NFRA 1P44A 4IZHA 3SX2A 5CPBA 3Q3CA 3LU1A 4QFDA 4J4TA 1DIRA 1K0UA 4XKJA 1TT5B 2J3IA 4UEJA 4ALNA 5COAA 3PJEA 2CMDA 2WSBA 3BTUA 4XIYA 4AICA 2O50A 3WNQA 4RPGA 3ZU3A 2BLLA 4D79A 2DTEA 4EUFA 4XYBA 4TRMA 3TZKA 5BSGA 4KUHA 3IIEA 2Q1WA 1I2ZA 3O26A 4JN6B 4CR7A 4ZVVA 2PH5A 2D59A 3PJGA 4IJUA 1GQYA 2C82A 3AM3A 3DZGA 4JNKA 2AE1A 4EI2A 1VSVA 4Q39A 5B37A 1J5PA 1RYDA 4KQWA 5C7IO 1R12A 2O3JA 2EKPA 2B4QA 3PVZA 2P5YA 3OJLA 2B5VA 3TN7A 1KVUA 5L4NA 3HQ4O 1W0CA 1A5ZA 4W82A 1V3VA 1H5QA 3MCVA 4MP3A 1CRWG 1U9JA 4B8WA 1Y8RA 3BTVA 4XR4A 4TMFA 1DIAA 4ND5A 1ZJZA 1DO8A 4XQGA 1QXSA 2D5AA 3WX0A 3H3FA 5ER6A 2R00A 4R1SA 1SZJG 5GZ6A 5BR7A 6ADHA 3JQFC 1E7SA 4FSHA 1BGVA 4ZQBA 4RDIA 4GSKA 5TGDA 2W2KB 5LDGA 4FOOA 3L9XA 1PJLA 3GK3A 1N92A 1D1TA 2ZTVA 3F46A 1KEUA 1Y7TA 4OGWA 4JJFA 1ISIA 1XHLA 4C7JA 1R0LA 4BQPA 4S1VA 4XX0A 2HMTA 4PIVA 4QUKA 4WUVA 4KUEA 4UUPA 1IHYA 3PXXA 3PYLA 4D3FA 2EV9A 4G5HA 4CL8A 4YAIA 3Q6IA 3OIGA 1U4SA 4KWHA 1LXCA 1XU7A 3KUXA 3WLFA 3E1KA 3RU9A 4BO2A 4M89A 1I0ZA 2QQ5A 2IZ1A 3GAFA 4OSPA 3WYCA 4MOWA 3TRIA 3I1JA 2XF8A 4GX5A 4NDNE 5TJHA 3S2GA 1PEDA 3ONDA 1DRWA 1ZK0A 2G5CA 4EGFA 1IULA 3AI1A 2EKLA 2BELA 2D2IA 2VHXA 3SLKA 2E6UX 4D41A 1E3EA 1Z6ZA 1ORRA 1E6UA 3F5QA 3STHA 3JD1A 1ZVMA 4D0RA 1O5IA 3OMLA 4AJNA 2FR0A 4EBFA 1I5RA 2FY8A 3FWNA 1NQOA 1F8GA 1L7DA 4RVSA 4TRNA 3ROPA 3E48A 2VUSA 5FFFA 3BMQA 2CVZA 4RLSA 3PIDA 2VCYA 3VPSA 4CMEA 1CQIA 1YGYA 2PLAA 1O94A 3D64A 4B7UA 3HJAA 3DTTA 3COSA 1A9YA 4DXHA 4TQGA 1DFHA 2ZB3A 1WZIA 5JYDA 1IPEA 4MVJG 3U09A 3D5QA 4L75A 2NU9A 4BO9A 1XYGA 2NTNA 4KP7A 2DBRA 1RM5A 3M2TA 1MUUA 2FR1A 3HE3A 1R66A 4XIJA 2HLPA 5L3ZA 3V1UA 5IJZA 3AI2A 2FSSA 4BS9A 3ZV3A 3R3SA 2Q2VA 4II3A 4IZIA 3GUCA 4L74A 1BRMA 3NX4A 5TT0A 4A03A 1M75A 4J0EA 4CLHA 1C0LA 3TZHA 3PWSA 2ZYAA 5KWEA 1NM5A 4CMKA 4CMIA 3W1VA 2PD4A 3D4OA 2D8AA 3I9NA 3DBVO 1LDMA 3TWOA 5HTOA 4KDFA 2B36A 1KETA 5DCWA 4MJLA 1MFZA 5EQFA 1F14A 4BO5A 1E5QA 3EZYA 3RUHA 2Y1FA 5JE8A 4RZHA 1I30A 4CQMA 2E37A 3BXXA 3DBHA 3G1UA 2GN4A 2EERA 1ZEJA 1U5AA 3JD3A 4XRRA 1IHXA 4CLRA 2NUAA 4J4HA 2HK7A 4WE3A 2P9EA 4WLEA 5LC1A 5FEUA 1LLQA 3Q11A 4WASA 1K6IA 1MG5A 4JP3A 4N18A 2GCGA 3ZHBA 1MXFA 1EQUA 4ZICA 1DIGA 3DL2A 3UXYA 4WCFC 4E2YA 3HWRA 1Q7GA 3T7EA 5TLSA 1RM3A 1BWSA 4YWJA 1E1NA 1R37A 2J5QA 2C2YA 2Q1SA 1EFLA 2ZIZA 4PZDA 1QORA 4PLZA 3WIDA 1DOHA 5JSFA 3QA9A 4PCVA 5JNLA 2H1SA 2Q2QA 2VOEA 4CR8A 3ZV4A 1YQXA 1KBZA 4BO4A 4DLLA 1EMDA 3GLQA 3DBLB 1T2FA 4F45A 1GUZA 4B79A 4XJTA 4FJ1A 2QRLA 5JMPA 3KHUA 3AY7A 4OM8A 3JYPA 5A02A 5KIAA 1SEPA 4WLUA 3AM5A 1JWAB 2J3KA 2DTDA 2X0IA 2I6TA 2Q1TA 4UEOA 5G4KB 4UAGA 4DMMA 5I7SA 3V5NA 3PHJA 4HV4A 1LSUA 1VKOA 3C3XA 3UUWA 2ILTA 4U6QA 5C7LO 1ENYA 1IL0A 2Y0DA 3ROMA 3PTZA 2J3HA 3C85A 3GEDA 5FYDA 1EVYA 3ZH2A 1LSSA 3EMKA 3PFFA 3NKLA 4WJZA 4CLEA 1NWCA 4MIEA 4YJGA 3D7LA 2HRZA 5FI3A 3V2UA 2FMUA 4B4UA 3WIEA 4DVJA 4I1IA 1P1IA 3V2HA 1SB8A 4J90A 2W2KA 2B4RO 2PV7A 1LRKA 2BHLA 4Y6PA 2DBVO 5T64A 4BO0A 2WYWA 2JAHA 1EVJA 3JV7A 2F00A 2FR8A 1W4ZA 3I9MA 4OAQA 4PG8A 2PFGA 4FIZA 4G65A 5IG2A 4TSKA 1NFQA 3KXDA 4IY1A 2IODA 3LK7A 3UHAA 3VH1A 1NPDA 1Q7CA 3WBBA 1CIVA 4Q3BA 3R3JA 3ZWBA 1HDXA 2BGKA 2V6FA 1K3TA 3B6ZA 3I4FA 4DGSA 5DN9A 3UAGA 1ZSYA 3UW3A 1LC0A 1LLCA 1YQDA 4R54A 2YQ5A 4D7AA 1BXGB 5JY6A 4OXNA 1Q0HA 3WG9A 4KOAA 4LVUA 1FDTA 1C0IA 1DAPA 3WSVA 1LQUA 1X0XA 3M6IA 4UUNA 3D3EA 4R16A 3I9OA 2Y0CA 2YHUA 2GUGA 1SOVA 4FFRA 1GPJA 4BNIA 3IKTA 3GMSA 2GPTA 1VL8A 3JYLA 4E5PA 3ST7A 3I83A 4J91A 1JKFA 2J3JA 2DFVA 4ND4A 4I5DA 2OO5A 4R51A 1Z75A 4RVHA 4NR0A 1XA0A 5JFOA 1JLLA 5GMOA 1E6WA 3NGLA 4HNGA 3WTCA 1E1MA 3QWBA 3WGOA 3DHEA 5TX7A 3FSRA 1Z74A 1JU9A 4HKTA 4MVJH 4E5MA 1NX6A 2WYUA 5I7VA 2TMDA 1UXJA 2RCYA 4B4WA 3RWBA 4W9NA 4CM8B 4IINA 5ES3A 3L0DA 2JD2A 3RD5A 3K92A 2PKQP 1K5HA 1N2SA 4GKBA 2FZWA 4OOFA 4GSLA 2CVQA 2YFHA 2GF2A 3OETA 4M54A 5I7FA 5JC1A 4YAJA 4IXWA 1D1SA 2GERA 1O8CA 1GTMA 2AA3A 2X6TA 1GD1O 1UP4A 2ZK7A 3K6JA 3Q0EA 4FGSA 4GVLA 4R1UA 5EESA 4BGIA 1YVEI 5HS6A 3ZWVA 3WJAA 2JCVA 4NFYA 3MJSA 3WTBA 4D46A 2Y1GA 4A26A 1OOEA 1BDMA 1JVSA 3DZJA 2O4CA 2EKQA 1J0XO 4BNLA 4UEKA 1LTHR 4CM9D 1EUDA 5AXCA 4XD2A 3NJ8A 2Y0EA 1F17A 1Y5MA 3AOEC 3P5SA 4J1TA 1KIFA 4H3VA 2HUNA 3DZBA 2ZTUA 5AVOA 2YQ4A 3DMTC 4ZRNA 4R1TA 1XIVA 5A1TA 1G6KA 4GVXA 2FPGA 5DT9A 2HSDA 1DC5A 4FFPA 5A04A 1E92A 2GN9A 4PLVA 3KBOA 1NYTA 5EPOA 1PS8A 5G0UA 4F6CA 8ADHA 5CDTA 4E6PA 4E3ZA 4CMJA 1QG6A 3O8QB 3ZU5A 4BO8A 5BNTA 3K5PA 3KETA 1PS0A 3WWZA 2OUIA 4Q3NA 4CLRB 1YXMA 4D0SA 3W4IA 2IZZA 3ZN2A 4BV9A 3PYXA 3CZMA 1CEQA 3QJ5A 2XXBA 4G2NA 3ULKA 3UH1A 1KVRA 4NIMA 3HDQA 5DP2A 2EIHA 2QRJA 1ENPA 4WOKA 4IDEA 4MIYA 4FW8A 4KTTE 1O89A 3V1YA 4DYVA 3PZRA 3WJ7A 3L6OO 4LRSB 3DFZA 1CWUA 4WEQA 2WDZA 1C3VA 3SC4A 3QWAA 3GHHA 1ADBA 3ONFA 4OL9A 2VN8A 3GRKA 5T57A 1QSGA 1YONA 1TXGA 2HMVA 2PZJA 1KEVA 2CDBA 2V6GA 1SAYA 5LCXA 3ONEA 2X22A 2NVWA 3G1TA 5L4LA 3GHYA 1HF3A 5TS3A 5EIOA 5L4SA 3PGJA 5JAIA 4XRGA 1IPFA 4M86A 1OI7A 1ZSNA 1E0DA 3ITDA 3TZCA 1NPYA 4URFA 3RU7A 3P2OA 3NDJA 4PVDA 1SC6A 1W8DA 1Q2XA 4GBJA 2V65A 3I9KA 4PG7A 5IXYA 3L07A 4J2HA 3D5TA 3MJEA 4J16A 1E3JA 3RFVA 7MDHA 4PLYA 1A7KA 3GF4A 2GR9A 1PR9A 4BB6A 2AEFA 1HSOA 4CPDA 3JCZA 3NRCA 1EK5A 4FC7A 4AG3A 5KCZA 4L73A 4PVCA 2JFGA 5TNXA 2VHYA 3KLPX 2YHIA 4A7PA 1ZMTA 4JBIA 4FR5A 1PX0A 1VRWA 1AUPA 1I3MA 1LDGA 1N1GA 1PJCA 1PSDA 3HN2A 4XWYA 4NFHA 4CLOB 5K9ZA 4YT2A 3F6YA 1Q0QA 2G0TA 1N5DA 2OL4A 3E9QA 1ML3A 3LC2O 1CETA 3AK4A 1G0OA 4RVDA 4E13A 2BF7A 1GPDG 3KO8A 2LDBA 3JQGB 2C54A 3D1LA 4W9NC 1ZK1A 3AFMA 3ZI0A 4EITA 3ZWCA 5L45A 1AXGA 4N5MA 5IDQA 4NBWA 3IAHA 4GWGA 1YB5A 5CFZA 1UDBA 5H83A 5K0ZA 5KVQA 1DPGA 2BFAA 3PHGA 4RPLA 1PWXA 5EMHA 3OSUA 3RIHA 2X4GA 3UN1A 1HSZA 5U9CA 2J6IA 4NBUA 3BTSA 4RF4A 4PG5A 1NBOA 2VTEA 3X2FA 4ALLA 3RQSA 3TSCA 1LLUA 2H6EA 1QYCA 4D42A 5HS4A 1C1DA 1K2WA 3DZKA 4DREA 3GEGA 2O2YA 3NT4A 3WICA 5JCJA 2ZJ1A 4WGGA 1NTOA 3DC2A 3PQEA 4GGOA 3SXPA 1VJTA 1B16A 1YBAA 2ZB4A 4JP2A 4YJHA 4PRLA 1HRDA 3WGHA 4DC1A 3DO5A 3ZHYA 1T2CA 4JK3A 1M66A 4M49A 3WQSB 1BDBA 9LDTA 5CDUA 5U1PA 4EZBA 2NM0A 5G4LA 1CDOA 3EW7A 1YKFA 1BW9B 1QKIA 3KLMX 2VZ8A 3JQ8B 3DONA 5G0SA 3SC6A 1HTBA 4B4VA 5KKAA 1YQGA 1F0YA 3F47A 3WDSA 4H16A 1BG6A 3EYWA 1ZUD1 3PLRA 3P2YA 3FD8A 1U7TA 1MC5A 3U5TA 1N9GB 4U0JA 3WGZA 3TF5A 1LQTA 4R5HA 3HDYA 4NBTA 4YQYA 3FNFA 3JQBA 1VSUA 2BMAA 4OQYA 3ADPA 4W6ZA 1OZAA 3GT0A 3S55A 4DQXA 4ESOA 1DIHA 2E49A 2GRAA 4K6FA 1MB4A 2DVMA 4ALIA 2O3RA 3WOHA 3ETDA 5T8KC 5F1KA 5CDSA 4LGVA 2P91A 3BMNA 4EUEA 2B0JA 3EC7A 4YXFA 4LK3A 1O0SA 3L4SO 1PGNA 3O38A 3K30A 3UFXA 3GNSA 3CSDA 4YVFA 4YDRA 5G0TA 1Y9EA 1MX3A 2JFHA 1T2EA 1FDSA 2Z5LA 4UUOA 3FR7A 4DYDA 4Y8VA 2VYNA 1F8FA 3RFTA 3W8FA 4J4BA 2P4HX 4HADA 4BNNA 3FF4A 1BMDA 2ET6A 1EVZA 1E5LA 2D3TA 2VT3A 4TKMA 3GVHA 1LC3A 4KZPA 1ZK4A 5DNAA 2X7HA 3QWFA 1E7WA 3O8QA 4MINA 3OEWA 4QQRA 4BKUA 5JLAA 4E2ZA 3ITKA 3PIIA 4LVCA 5F21A 3KYCB 2XOXA 1YS4A 2Q4BA 3PQDA 4IDDA 3H5NA 3ZV6A 3CIFA 1Z73A 3A28A 5C3MA 2EW8A 2BRUA 2ZCVA 1NP3A 1R4NA 1YH3A 3JD2A 1HDZA 2BFOA 3DWFA 5U4QA 4XYMA 4R69A 4RDHA 1HETA 1CERA 3JYOA 4FFOA 3PQFA 1U7HA 1O95A 4J43A 4XZ3A 4CQLB 3VTFA 5H81A 4Z0TA 3JD0A 5FF9A 1AHHA 3G0OA 3NYWA 4BKRA 1M2WA 2PKQO 4P4GA 3VH4A 3VZRA 1RPNA 3B20A 5TSDA 3ZWYA 4NZ9A 2ZB7A 1ENOA 1HE2A 3OIFA 2Q3EA 3ICPA 3INRA 3HG7A 2QYSA 2JL1A 5F5LA 6LDHA 4MVJD 4PRKA 2B35A 4J2OA 1FF9A 1ZFNA 4I9NA 4NU5A 5EQDA 3A14A 3EVTA 3ICCA 4WOJA 3FR8A 2JHFA 2AXQA 2HMWA 4U8GA 2EHDA 1ZJYA 3LQFA 2RHRA 4AJOA 3SEFA 2NSDA 2XPCA 2DBZA 4B7CA 2ZTMA 5ENVA 2VUTA 4ZHSA 4DBZA 4JQCA 3PWKA 2A35A 1C1XB 1LI4A 2X9VA 2H63A 3DMTA 2DQ4A 4YPOA 5A9RA 1HDCA 1EUCA 5EN4A 1E6EA 1NR1A 1NVGA 1LBEA 2OBYA 2WM3A 4IDFA 4D3SA 4PFJA 2YHIB 4QO8A 2DUWA 2B5WA 2WD8A 5IDYA 3W6ZA 1JKJA 1P45A 4DMLA 1I01A 4ID9A 4MP8A 5CDYA 1UXIA 1ID1A 5L7TA 2QZZA 1QMGA 3LLSA 2YJZA 1DEHA 2AQIA
chains in the Genus database with same CATH superfamily
4JLPA 4NQZA 1G21E 3BRCA 4AJ1A 1NASA 2FX5A 3LT5A 1FP1D 3BXFA 3K4QA 2M6SA 4Y9DA 3UK1A 2MSDB 3ORRA 4QTYA 3FTNA 3OM9A 4G1MB 4H0NA 1PK7A 3DZDA 4XQ0A 2O8DB 3FRHA 1QDLB 4EQ6B 4Q7EA 4CIAA 1T6ZA 1U5CA 5BQPA 2XGJA 2EBWA 4C7OB 2FUCA 4QUDA 1HEYA 3IKMB 3TOVA 3NR2A 2IOQA 1JSZA 4D8TA 1MX5A 5DKFA 1JKXA 1V5GA 4FYWA 3TXXA 4EA8A 1ZQ1A 2H3EA 3LRTA 5AKYA 3ZDEA 1HE5A 2IGTA 1C1DB 3KWJA 3ORHA 1FK8A 3DWGA 1L1FA 1ZC3A 2REBA 3WFJA 2E82A 1X13A 2PX0A 2QRNA 3AT1A 4BNZA 1FFYA 4DFDA 3GDGA 4GPEA 3UATA 4UCFA 1ISHA 1G98A 1PLLA 4M0LA 2QZ4A 4E3WA 3JSAA 1GAXA 1FCJA 1ZH2A 2Y1OA 3A4NA 1WUKS 3OZTA 3R7LA 3IRVA 3EIFA 3FZYA 1ISMA 1L6IA 3PVSA 4RYDA 4LJ8A 2OBXA 4DADA 5ED4A 4NMLA 2Q9BA 4R84A 4XPIB 3ZUGA 1Z8NA 1P7YA 2WJIA 1Z2CA 1PAUA 4QFCA 2A9KA 3DA8A 4RO0A 1E0KA 4ETMA 4F2PA 2SHKA 4HNHA 1NLYA 4XJXA 2C9DA 3GJ7A 1DUSA 5JMWA 1DCMA 4HNQA 4N6GA 4JLMA 2C78A 4OFBA 4RKFA 4A6XA 4AJIA 3CZQA 4RTQA 3FW1A 3GGJA 4IG9A 4HLUA 3TQRA 5K20A 1JN0A 1ZJJA 3CLSD 3RSQA 1SC3A 2P7HA 3E9CA 5BN1A 2IYQA 2H00A 3E3NA 1MG0A 1Z6GA 4UU8A 2G09A 1PYGA 3KXPA 4YI3A 1N9GA 3HA7A 2XYPA 1UBUS 4OXRA 1IUPA 3LPAA 2I4NA 1VHTA 5LBUA 1N9KA 3VZDA 3IIKA 4BUCA 1DFIA 1MIHA 4NRDA 4PQRA 1RXVA 4YDSA 5DK6A 2QVZX 1QGAA 5AXAA 2I29A 1YMQA 4MUHA 2K5UA 3PEFA 3CT4A 1PHRA 1ACJA 1J5EB 1M2NA 1QKKA 2D62A 1XALA 2I4TA 4P3KA 4TZ6A 2ILVA 4N9QA 4U4AA 4Y9UA 2IEBA 4LJYA 1VQ1A 1QHFA 1Z36A 2WM2A 3GMDA 4ZANA 3DMDA 4IS2A 3QVUA 1CJUC 3DV0A 3TYXA 3V4LA 4KQMA 3GD5A 5B58T 2RJOA 4IJQA 3W1EA 3CVUA 3KZVA 5EKTA 2D1RA 3EYAA 5FUYA 1EVIA 5E7IA 2ZJ6A 1VE9A 3A8TA 3G02A 4XWKA 1VLLA 1X1EA 3CF4A 5I4IA 1E2QA 5GV7A 4I1VA 2A5GA 5F3RA 5F4ZA 4BB5A 1XCLA 3OF2A 3QXGA 5BWBA 1VPTA 4BNMA 4C7VA 4GDFA 1K7FB 1LPNA 3GW8A 4R2IA 3MIIA 1XR3A 2CV1A 5EKUA 2WYHA 1ZOOA 5TIIA 2P9TA 2C5FA 1JDVA 2GEVA 2YASA 4N0EA 1XNRB 4NZZA 1BHSA 2XXAB 4LF7B 3X44A 3ABOB 4CM6A 4AZWA 1Y5RA 2HCRA 2V6BA 4IIEA 3UKJA 3WSTA 1IBCA 1Y3AA 1LDBA 1ZK3A 3NB0A 4ARZB 1G38A 5A5VA 1AF7A 3CPEA 4FFBB 5G1OA 1MC1A 1CRPA 3NVDA 1PGPA 1HFKA 2RGWA 4JXKA 2F67A 2PGNA 3I9LA 3MLBA 1L9KA 4XCVA 3AHCA 2F9LA 1KEWA 2BDEA 2G71A 5JW6A 2MYTA 1OYYA 4ENPA 3QVJA 4IYRA 5DI3B 1PQYA 1KDZA 5HIIA 2UAGA 3ADOA 1KZHA 5LQCA 4TTQA 1DBQA 3VR0A 4EYOA 4RZXA 1XRSB 1LJUA 1Z2AA 4KMOA 4F4HA 2BH9A 4OB6A 3R9IA 1L7VC 1PTJC 5HE9A 1GP2A 3DEIA 2Q3CA 4GG1A 4MYSA 2HJ9A 2VLIA 3BCHA 3T7AA 3VDRA 2QLNA 3O6VA 1X1BA 5F64A 3PR1A 3C3EA 1U8FO 1SQ0A 4QLBA 6NULA 3F3SA 3SVTA 1OT5A 4I4TA 2IBTA 1EFCA 5EIWA 3TJMA 3ILVA 3LECA 3LF2A 3PU6A 5LA6F 3AR2A 5HBRA 1E1DA 4J1SA 4DQUA 3EIUA 4JCOA 5ALTA 3ZGVA 3IHKA 2J3EA 1CYEA 2IZ0A 3ECSA 1Q12A 2PMEA 1IZYA 4ND3A 4PLPA 3P71T 2OZLA 1O0BA 3JPWA 1XRPA 2W4QA 2JAUA 2V74B 1NIJA 3OFVA 1M76A 2WF8A 4HP8A 3Q7TA 4OK5A 5EXEA 1SK8A 1W0KA 1JFLA 1HL3A 3E4CA 1OU0A 3P45A 4KBFA 4ZT4A 1DQZA 5I3CA 3DGFC 2RFLA 1H2AS 4INAA 2TMGA 3C1TA 1Q22A 2WEKA 5A3JA 5IDXA 1Z5PA 1DUVG 4JL5A 1WNTA 2M6RA 1MABB 1WULS 1FXUA 2ZI6A 3LCJA 3G17A 4OQ4A 4RD0A 3EDOA 3RS3A 3I5UA 2ZM6B 5JT1A 1RXEA 5HP4A 4XYGA 1UADA 4TUYB 3U49A 3W2IA 1A7JA 3KPYA 1IZZA 1ODIA 1VKRA 4ILKA 4MV1A 3RK0A 2AZXA 6CHYA 2O8NA 1G0NA 4PYOA 3J80A 3HL4A 2HCJB 2YX1A 1MO4A 5TR9A 3U7RA 3U4CA 1TF5A 2GEDA 3BSSA 3O91A 1RS0A 3WLOA 4AS1A 5BV0A 1BC5A 3JQ9A 1Y42X 3A4IA 3KQSA 3ZWPA 1I2AA 2C7GA 1S2NA 1QM5A 2WHRA 2ZANA 4IBOA 4ZU3A 4EA7A 2H65A 1XDWA 1V1MB 1YCFA 5FQOA 1QTNA 2I03A 5B7PA 3KK0A 3HO1A 4QYIA 2X6QA 1ONNA 2IL1A 3D6FA 1ZKDA 1FS6A 1TLTA 4HDOB 2YKGA 4E0BA 4EX7A 4KXXA 1JG7A 3B89A 1DBSA 3T1OA 1AD2A 5DHAA 4EMBA 4FZVA 4DLBA 3SZOA 3TRJA 2XH8A 2Z56A 1ZOPA 3OE7D 4QGSA 3IEVA 4GYJA 5CJ2A 1XNJA 4AZ3B 5THKA 4FHFA 3DGEC 3VKHA 1T4CB 4UVIA 5GONB 5J4LA 3EGXA 4ZO7A 3UV3A 2IYOA 3LCRA 2C97A 4Y0AA 2WTAA 4QX6A 2I65A 3T3IA 5CVTA 4OIMA 1IHDA 2BMFA 1KU6A 1K75A 4G5QA 4DWOA 3SLGA 5BXQC 2ZSKA 3Q6NA 2XMSA 1HE4A 3IKVA 4GX1A 3OMXA 2BFPA 3FKSD 1RAHA 2XQGA 2R86A 3T3GA 5BWOA 2O57A 4QLOA 5B1HA 7REQA 1EVKA 4FEYA 2PT7A 3FZQA 3WOVA 3L79A 5DBGA 3SDZA 1U2DA 3BFKA 3OFSA 4LC1A 4F5ZA 2ZQYA 4QBTA 2IS4A 1XZIA 4HZGA 4QATA 5FA8A 2AOVA 2QRKA 2RGXA 1JFFB 3MM4A 4K9MA 4LG1A 4RE6A 5AXBA 3HUUA 1P8JA 2VYVA 4DY6A 1XRNA 3ZDAA 1TW2A 3UT5B 3LK6A 2BOVA 1GIAA 3HWX1 4CM4B 1X2EA 4MPDA 4LSZA 1L5FA 3UMGA 1A4RA 3L7CA 4G01B 4DR5B 3HU3A 4EZEA 3GJ6A 4HUJA 2DHDA 3ELDA 4WHMA 3WYAA 3IE2A 5AK0A 1PHPA 1G3UA 2GXAA 1NTRA 4GPBA 1L8AA 4NNPA 4WBXC 3JRNA 1FB5A 2HK8A 4HXGA 2I3BA 2FV8A 3PJRA 3DMHA 1WW3A 1G6Q1 3I9JA 1N3IA 2OYSA 4BV3A 3LP6A 3U48A 3MCZA 3U60B 1T35A 2J0QA 1A8HA 2XUHA 3DBRB 4C05A 1NI4A 5KOHB 3PEYA 2Z5GA 4OXYA 3IMKA 5C46F 4OAPA 5K3EA 5KMGA 5LIPA 5LB4A 4ALMA 1K66A 4JH0A 2JGDB 5CYPA 3UAVA 1KSJA 4YYZA 4JYAB 1UZMA 1CVRA 3LGAA 5AHWA 2LCQA 3ZWMA 4DWVA 3DE7X 4U7PB 5G0VA 1PTJA 1P31A 3WLSA 3O4HA 4B3MB 2GN2A 3DZ8A 3RJ5A 2WRZA 3ZJTA 4E21A 1HT3A 4EPYA 1WF6A 1EGAA 3EXG2 3WLIA 1A76A 1GDTA 5FB3A 2B83A 1WXXA 1VL2A 1E69A 4C5BA 5F35A 5HA5A 3X3HA 1OX4B 1EAMA 5JPCA 1QB7A 4PHGA 4LXUA 2PQ6A 3EODA 1PBTA 5DOVA 4X3OA 2NLOA 4PFQA 3E2MA 5J4KA 2FRVA 3IP3A 2EFYA 4I4TF 4N48A 2WDPA 1HDRA 4OJQA 5JH7A 5K4AA 4IHJA 4U6NA 1NWHA 1UBLS 4M1YA 1XQ9A 4IXNA 1DHTA 5IDVA 4XLLA 3DV0B 2DUUA 2W58A 2DPHA 4NU6A 4MTCA 3WNCA 1LCIA 2VA8A 3D3WA 3WDLA 4DM7A 4Z6KA 4G0OA 5CB0A 4N41A 1K3UB 4HS4A 1DRVA 1M6HA 4F12A 2ZRQA 5CCBA 4DLRA 4DA4A 1P60A 1EZZA 2H9YA 3BWMA 2JIRA 3T5GA 4OQZA 3M33A 3WKBA 5BNZA 1CNFA 4MMZB 1C1YA 4HDSB 3SYMA 2KLBA 1SXQA 2VPWA 5I51A 4I2NA 1YDGA 2JFBA 4ZJZA 2V54A 3FI9A 1XCJA 3AJRA 1YJXA 2IZ5A 2X9GA 3L82B 4JYCA 1T6XA 4F38A 1PFGA 1R27A 1UM9A 2YZGA 3LPMA 2ZWVA 4MVJM 5FBRB 4L8LA 1Z47A 4RS4A 5L6MB 1D4ZA 1GGEA 4CIDA 4I5FA 5A1JA 1U1DA 3V8BA 3NP7A 3LBHA 5B1YA 2XTJA 1BMFA 3MILA 4AMBA 1NBMD 5BOVA 5KO2A 5B3LA 2PH1A 2B1RA 2K7ZA 3OT1B 4LXXA 4B76A 2YZNA 5BRAA 2XB4A 3TECE 3BIFA 1OWMA 1NVMB 3EAQA 4FWBA 1EGHA 3USCS 2VDNB 4RW0A 1G16A 1R5JA 1FBTA 3KC2A 2QF7A 3PE4A 3RRYA 5HCNA 2QQGA 3OQBA 4X93A 3RBAA 3U3OA 3AO0B 4BLPA 1MZPA 3F4LA 4UATA 1ECPA 2GCEA 4XM2A 4EW1A 3N0TA 3A6PC 1E77A 5JJIA 3D81A 3BH0A 3PQ2A 3ZLUA 4X00A 1L8QA 4NFSA 3RAJA 1RYEA 3OTHA 3TQOA 5L40A 2YWFA 5JARA 1AX9A 2GD6A 2HREA 1OYOA 2PA3A 2A0FA 2ZWOA 3FWKA 4KRXA 5T7BA 4R1NA 5KYUA 1SCUA 3UGJA 1SBZA 1A2KC 2BH2A 1GKUB 2REXB 4DAOA 3FPSA 3QMMA 1C4XA 3B6KA 3CXRA 1WDWB 4F2HA 2WG2A 4AY5A 3DKVA 3MCAA 3GT4A 3PDWA 2WSMA 3RU2A 3SEAA 3DT6A 4Z5XA 4YJ3A 4Y9TA 1N3LA 4TQUS 3TSWA 1JQAA 2GPBA 2XMCA 1JQ3A 4V2IA 1JDJA 3RLFA 5JXWA 5JBIA 2RHHA 2VNSA 3L7NA 3NHLA 2DRIA 2BJWA 3Q3JB 3JZMA 5FNVB 5HWSA 1F2TA 1JYEA 1CUGA 3TBKA 1UPXA 5CNKA 2HA5A 1Q44A 2H5IA 5IYZA 4KH0A 3PIRA 1RTKA 4KSCA 5ARCA 1UINA 2P2LA 5EERA 4DARA 3AESB 1CQZA 5A4KA 1M7BA 3L2OB 4QULA 2W7TA 5T5QA 2O8EB 1LPPA 3RS2A 1QX4A 2OXEA 1JMKC 1FUKA 4OMUA 2QQFA 5D2CA 2OXRA 5G3ZA 3K2IA 4CFSA 2C2GA 4KPGA 3I42A 2ZTLA 4NJMB 2Q9UA 5IM5A 5BSWA 3B52X 1XLTC 1RRVA 2FP3A 2EGUA 3RREA 4C20A 2YUIA 5WRFA 5A3VA 1QTQA 3DAPA 4W5QA 1B43A 1PF7E 1E4YA 3WSWA 3W5SA 1MOPA 2VXOA 2CXRA 2X9NA 4OD0A 1THMA 3V7NA 4ZRMA 4L0CA 3QVOA 4UVDA 5DYTA 5ILGA 2AOWA 1CR0A 4CF3A 5KYXA 3H84A 2CMHA 4GECA 4LWPA 5D6OA 2HPZA 4EFDA 1KRWA 4HH4A 1R0KA 4JLDA 5EP1A 4EJMA 2A0YA 5FI5A 2P1DA 3VHRA 3DKKA 4I19A 1IBRA 3KT6A 1BNCA 2JLSA 2LIVA 5JS2A 2HF7A 2O2IA 3HZHA 4LCEA 1NDHA 5ILQA 5HMMA 5HSGA 1W5AA 1L7EA 2CHEA 1RJ9B 4W1PA 1QK5A 1W0JA 2P1ZA 3AWIA 2VP2A 3D6UA 1WUYA 4EJ2A 3LUDA 2Y4NA 3QOXA 2CZCA 5AYVA 4MA5A 5F1YA 5IAGA 5CYGA 1U0FA 4HEQA 4A0SA 3E2IA 1TTTA 3PCXA 3H4TA 1U65A 4NG5A 2J6BA 2JFNA 1XZCA 1PZNA 2NG1A 2B2XA 3OFND 4XPZA 7YASA 4BXOB 3T9BA 3U3KA 3BJMA 1TFRA 4FHGA 3PC2A 4WXEA 3WLLA 4A8JA 5LLSA 3A27A 4S1OA 2ZB8A 2QPOA 2ZT5A 4JHLA 1RWOA 1X38A 1MPXA 2HU7A 2N3ZA 5DTRA 5BNIA 2OK8A 5K3DA 2QTVB 3KALA 4F8JA 5K8JB 1OLXB 2AR7A 2DUNA 2XNHA 3BERA 1U3TA 1P3DA 1PJRA 4CODB 1QF7A 1R6BX 3DWIA 3GDOA 4Q1DA 1L5RA 3BXGA 4XGNA 2AOUA 4YJHB 4YRBA 3H83A 1SO8A 1VXOA 3WGVA 3B9QA 3DDUA 3NATA 2JBAA 3A6HA 121PA 2FPIA 4Y0NA 3ZDZB 1EM6A 5DHFA 2YXEA 3NPAA 3R3UA 5T67A 4AN4A 3ZXYA 5IVPA 4X7MA 2JRLA 4MGZR 3H0KA 4WGFA 1NZDA 1XU4A 4C3VA 3N75A 4OKIA 4E5YA 3OZAA 3THSA 4BQOA 2XY4A 4RDXA 1HKHA 5BSTA 4AY3A 3N2YA 1X7ZA 4D8YA 1FPMA 1L4EA 3LWDA 3P0HA 1JRLA 1ZD3A 2I5PO 3JQBC 4OGKA 1HDYA 4IUCS 3DFUA 4UOEA 4FYVA 4A3SA 2B94A 4EO9A 5E6UA 2I3AA 1MEJA 3G6WA 2OHVA 4JI7B 4GU5A 4PHHA 4BKOA 2GYWA 4PPGA 1OPXA 3KKMA 1T5HX 1U8EA 3IQEA 1SCJA 3ZK8A 1Z6YA 4TLDA 4F3NA 2VAWA 1NT4A 5ALHA 4DR6B 3W9UA 1HMPA 2H1LA 2AK3A 2C3UA 4KN9S 5TEWA 1RHKA 1TO1E 2FFBA 2ZJ5A 3RRZA 3CLRD 4C5CA 1XJQA 4ZO8A 3DP7A 1JKIA 2RGUA 1JNYA 2IGBA 3IV6A 3RFXA 3V4FA 4B0PA 4C4PA 4ZMRA 3LS2A 4Z4CA 3VNAA 5D6NA 2NZUG 2RHTA 2FCRA 1R9MA 1H2YA 2QXTA 4FFVA 3F6EX 1IEWA 2IP2A 3L92A 2HDHA 4JP5A 4UNSA 4RTMA 5I48A 4P4LA 3EA4A 5T3YA 1F4VA 3KJHA 1GQ2A 3N0VA 3C3KA 4R41A 3QENA 3T61A 3USES 1CEXA 4CWAA 1GITA 1HE3A 1W7AA 2PD3A 3QPCA 1MQ8B 4CDMA 1J0BA 2QSUA 3AWDA 3FZNA 5IZCC 4RU1A 2YNMA 2WP8J 3K1YA 2J1LA 2BEWA 1VP9A 2WF9A 3KKEA 3SJUA 4CMEC 1DRUA 4DVGA 2VJAA 3DXZA 2I6XA 4X0EA 3FCEA 3ILSA 2Z8XA 2B30A 1GPYA 3CONA 3A3OA 2O7NA 1NXWA 3P9KA 5KX5A 1PU2A 2BGTA 1WDMA 3E8XA 1HE1C 4QODA 2PZLA 2FOIA 2XQVA 3QPVA 4E30A 4WLVA 4ZJPA 4MS3B 7ADHA 1RXYA 4JJKA 1FUIA 1UMCA 3DPSA 1NVUQ 2VK2A 3FKSA 3HBJA 3OQHA 4M9QA 2IS6A 1T15A 2FRDC 4GAEA 4LBZA 1J49A 3Q88A 4MAMA 5HJ7A 1B14A 2YY7A 3DOCA 4IIVA 3VKUA 1YB7A 4J2TA 5EKSA 3ZQ4A 2ZVPX 3R7FA 4D9BA 1EFPB 4WL0A 3RTEA 2P9HA 3QPDA 4C0KA 3OZEA 4JY7A 4NSNA 4KXUA 5FBZA 2AQHA 3AERA 2IDKA 4O25A 4XSVA 4URWR 2QXUA 3AVVA 2QW0X 4K0RA 3L77A 3H5VA 1Y8RB 1E3WA 2PWPA 3H11A 2PNJA 4JEUA 3FNEA 1H1LB 1CUSA 3KUKA 3AKEA 3GLUA 4GC5A 1YE5A 4HTFB 4EG0A 3UPTA 3IL2A 4IHAA 1D04A 2N1BA 4DDVA 4EYEA 1S8FA 5LQAA 4B3JA 5EXTA 2CLCX 2WD9A 5FI0B 1LFDB 4OHRA 3P4YA 4GI1A 3LRPA 4U5XA 3O9ZA 2VNAA 1X8KA 3LNTA 3VV3A 2QTRA 3OAAD 3UG6A 3QEBZ 1PX2A 5DTIA 1QVVA 1G5FA 2HD4A 3ENVA 1NR7A 2OYRA 5EZQA 4EABA 1G9TA 4F2WA 3MWEB 3N8GA 1E1LA 4X61A 1O5OA 4M1QA 2CXOA 4B2LA 1T1RA 3HWSA 4B6RA 1GPMA 4FP9A 3FRIA 3PR3A 1PEAA 3TEMA 5EYPB 4OKNA 3VR4D 3QEMA 4P7JA 2PZKA 2D2VA 3TTTA 5IKMA 3HN6A 2BAGA 3SQLA 1F1JA 1NQUA 5K0LA 5AI8A 1U3CA 3RK1A 2IPMA 3FHLA 2XGMA 3NJRA 3BT7A 4Z51A 2P7IA 5AXDA 2GZSA 3QQPA 2IEIA 1PIWA 3EBLA 4B45A 4D25A 4QXMA 3EZ2A 4DIOA 2ZJAA 1B8VA 2BZ1A 2O06A 1LLFA 1R4MA 1CQWA 4H1VA 1ECCA 3JQCA 3OZXA 4Z3DA 3W2FA 3WKCA 1DXOA 5A4JA 1RP1A 1YS9A 1Z0SA 3OO0A 4HSGA 4QPNA 5KSPA 5A5DA 1ENZA 1ZXXA 3DLAA 4KDRA 5JFTA 1PWHA 1RMQA 2Q6LA 1NULA 3P7MA 2EVWX 1ZC4A 2CL5A 2HA7A 2IIPA 1ESMA 3C7DB 3ZD9A 1YQEA 1IPHA 1HEIA 1UPTA 1EJ0A 4HVTA 2UKDA 4IR7A 3IDFA 3L1JA 1LBIA 2UZ1B 4MCJA 2IE0A 4P7KA 2JIZA 3HA3A 3MTEA 1KMNA 1N8KA 2FFHA 4G5YA 4K6CA 3SYNA 2HXSA 1XWWA 4GICA 4K9QA 1N7IA 3HBFA 3OA2A 3OPMA 4TROA 4MDHA 1M5RA 4RCYA 3ZS9A 2FPPB 4YP6A 3VYWA 1R2QA 1OGYA 2GAAA 4CEHA 1E2GA 3KVYA 4EF6A 5D3ZA 5HZGA 2YV4A 2PUBA 5BSFA 4J1QA 3SXUA 2F2TA 2PMDA 5F5XA 2N42A 3LFHA 1N2IA 3N39C 1OFGA 5JDCC 2NNLD 2Z1MA 3CEPB 3MJCA 1BOOA 1TIBA 3ELYA 5B64A 2J85A 2Q5IA 4B2IA 3AILA 4MPTA 3R5JA 2QD1A 4J0FA 2WFAA 4CKBA 4C7OA 1Z0AA 1XCBA 2FWAA 3OEYA 1GL7A 1P4JA 2E6KA 4HL6A 3KJQA 1PL8A 3Q1KA 1WX1A 4KQJA 1DL5A 2B7CA 4WZBA 1AK9A 2I2XB 4S1PA 5CCDA 2OBNA 3E03A 2ADMA 2ISSD 3ET5A 3F5MA 3FG9A 5H70A 2AFIA 5EP4A 1I51A 1BS1A 1V9LA 5GWXA 5BSUA 4UAVA 1EZ1A 4I9GA 5LSAA 5IS2A 4ZYXA 5C53B 1W36C 2XNKA 4JOCA 4KMSA 4PC1A 2SECE 5ULLA 2GLXA 1I0IA 1I10A 4ZT5A 2AC2A 3DZFA 2ZSFA 5JADA 3VM6A 1WUHS 2JF0A 4TZKA 5ALUA 2R47A 3D8RA 3GZNB 3C8HA 5EEGA 4P3YA 1LSOA 4OJYA 6AT1A 5IN4A 1SXJD 3D4PA 3NOOA 4ROSA 1N0UA 1WA5A 4I1YA 1X80B 1BEUB 3BBLA 2YIVX 4FDMA 4D4GA 4Z9FA 2C7BA 4L76A 3UTDA 3RS7A 2O7SA 3WQHA 4IIDA 4KJZA 5BN3B 1OXVA 1V37A 3AVOA 4JKOA 1HYHA 4R8RA 2IYPA 1P73A 3NEAA 4TV8F 2KI5A 4CL3A 3DLPX 4CMIB 2E4AA 2I1LA 3IJ5A 3LIPA 3RC1A 4B31A 3WGUA 1GDHA 2Q6OA 2Y1EA 3E9NA 1FTNA 3EWSA 4U7TB 2W98A 5F23A 3T9EA 4G26A 1RLMA 4W1RA 1DQPA 1EDZA 2JH3A 3UC9A 4GOKA 3KUDA 2YJ6A 4MHOA 5EWMA 2JG3A 2ONYA 4JB8A 4R8KA 3QF4B 4UHEA 3HXTA 1Z0KA 3FDIA 1BFDA 3MD0A 4V0RA 1U28A 4X6XA 1MDFA 2H1FA 1IZ8A 2NSLA 2Z95A 4HLDA 1XEWX 3PC8A 4C4RA 2FUG6 1XRQA 3KEGA 2O54A 1DHRA 3T9DA 2JAPA 4OLFA 3H2BA 2BZSA 3RYCB 1B8NA 1PJBA 3PP8A 3V4RA 1JDPA 5KYVA 3MERA 3HNOA 2I4OA 3HGMA 1MJHA 3GQVA 4TTSA 3GLSA 5TJ9A 3SR0A 4G36A 5DBIA 4EGSA 3IJPA 3SM3A 5IASA 1WL8A 1F12A 2NO1A 2YZKA 1WBBA 1GTSA 2X19A 1CVIA 4OF4A 3OH8A 2EBHX 1LU9A 3R7NA 4KL8S 3PVCA 3ZD6A 1WDKA 1CBUA 1V4VA 3GGSA 1W29A 1YK1A 4I0WB 1NUQA 1CUEA 3ZW9A 1WD5A 4YUVA 5M7EA 2JAOA 2BEJA 4JU9A 3P9QA 3QUSA 3REOA 3UOGA 5HGJA 2QN9A 3D2BA 4A73A 4TM8A 2RB4A 2ZBEA 4MEJA 4CETA 1PP4A 3WXBA 2YMQA 5J1TB 2Y1KA 2B4AA 3HCPA 2ODWA 4ETIA 2ATEA 2QX7A 4U3JA 1ZUHA 2O2JA 4AJKA 3T7TA 5LQUA 2HAEA 3KQMA 4RIHA 1U63A 3UWOA 3X43A 5KJ1A 2YIJA 4PLGA 3I0ZA 1E9EA 3E22A 2VF5X 1JS1X 1W2GA 2VT2A 3NM5A 1DEOA 3P9PA 2H48A 2Q1UA 2XQFA 2ZVDA 1RMTA 5CEJA 2J9XB 3AU9A 4WPGA 2XRZA 3AJAA 2RAFA 3SSNA 3SS7X 1XK7A 1WMAA 4RD3A 1FYFA 5A7GA 5JJCA 3KB6A 3N86A 1VE6A 4KKVA 2EW2A 2GPYA 4JI8B 4HN2A 3HXQA 2J4DA 3H11B 2PNFA 2W6JD 4MLPA 1B6GA 2G3YA 1P0PA 4QGGA 4EO7A 3BGSA 1H4VB 1Z35A 4RVFA 3FGZA 1UWLA 1RU3A 1TRKA 2QYHA 3B7PA 4LTNA 3FTCA 1W75A 2I22A 2XCUA 1JQ5A 2J0UB 3KYDA 4JLNA 1MC8A 1XDGA 1JAHA 3IR6A 4ITUA 9LDBA 3NHRA 4YJGB 2O0MA 2G5TA 4JUIA 3BHIA 2F1IA 2G25A 2PD6A 1C4OA 2JK0A 2PZGA 2UDPA 4HNSA 4UVEA 4F60A 1OH7A 2ZIXB 3H13A 1D3AA 2FMKA 4PU0A 4GYWA 1ZD8A 2IC5A 1CDZA 3M3HA 2XBMA 1L8XA 1OBCA 4H3SA 2A2ZA 3TL2A 3G2IA 1IWBB 4J3JA 5COBA 4KDEA 1M1XB 4DJ5X 5D5PA 5ITZB 2C2OA 2VQFB 2CF5A 1M0WA 2IZ6A 2YWGA 2ZOSA 4KB5A 4FC6A 4PZ0A 5EHIA 2DT8A 4IIUA 1BYUA 1JAYA 1ZN7A 2Q3LA 3OOJA 2QQ0A 2A9JA 4QU5A 3SD7A 1S3FA 4TWZA 3DPIA 3N0WA 4AF6A 1RVV1 1SURA 1YVPA 4B6PA 4EARA 3KZCA 4HB4A 1BQ4A 1GYPA 1X1TA 2OAQ1 3M6VA 3Q7RA 5DEOA 4BVAA 3EF3A 4J94A 3AFGA 3MT7A 2XNDA 1JR6A 1EFDN 1YJQA 2C9BA 3CT6A 3G82C 4QTTB 4Y2GA 3JQAA 4L8VA 4TS9A 4C7KA 2A9VA 1RYNA 5FWYA 5A04A 1Q3HA 2QHXA 2JGMA 4OV6B 2PGJA 5D5HA 3KSZO 4OL0A 3IC5A 2JD1A 2XMQA 3F7NA 4NY1A 3PITA 5EHZA 3EIQA 3IOBA 3OJEA 1QHGA 3IOEA 3QOYA 3HV2A 1YZLA 5DJ5A 2JHPA 3T35A 4YQFA 4YRGA 3I61A 1JIQA 1NUPA 1ZS9A 4IW3B 4M1SA 2Q5HA 2QP9X 2OZKA 4JITA 3HACA 3VI3B 4DKXA 5FPKA 1KAEA 2GJAA 1UKAA 4MUGA 4N8EA 1QLJA 3QI7A 4WBNF 5EZ5A 3VAYA 3T5CA 4DZTA 3WNVA 5IT5A 4K9PA 3H5TA 1U0BB 5TDHA 3KJFA 1SHJA 3RRMA 2QRVB 4CG2A 2OORC 2XRMA 4ESVA 3THYB 4YBZA 2VZLA 4RKWA 2VXCA 5FA5A 3WQSB 2QA5A 3ETLA 2PX2A 2XCTB 1JIJA 3E3OA 3DE2X 1ETUA 4WFIA 1GTG1 4YCBA 2WAAA 1T9BA 2X0FA 3SZRA 3U0BA 4I5GA 3MB8A 2ADOA 5E6SB 4R3NA 1G8KA 1T4BA 5BRNA 3TXYA 5KYKA 4QWWA 5ARDA 3UAZA 3BN3A 5CB8A 2QI9F 1HOTA 4LRXA 1IFXA 1Y98A 1AQUA 3BD8A 2NV6A 3T15A 3C6XA 4P83A 5EXSA 4F91B 5IT0A 1D1QA 3HY4A 2B1IA 2Z1NA 2VBGA 4AJ4A 4AF8A 3WLJA 1AO0A 3GAAA 4R8SA 4RIFA 1S7CA 5E7MA 1XHEA 5FUMA 5CXUA 1E64A 1FDVA 2HQSA 2QZPA 2FW6A 2FETA 2G5GX 3FYCA 1VJ0A 3WQQA 2A3RA 1QUEA 3RT7A 4CIWA 1SHLA 3B70A 1I7DA 3URKA 2B8TA 2OENG 1DC3A 4WN9A 3GZNA 4OQNA 4BNHA 3OQJA 2D7DA 2IZ7A 2XD4A 3VR4A 1ULUA 3GCXA 4PSCA 1UP6A 1MLDA 3IB6A 3OECA 5K8TA 3ZIDA 1D9XA 1VCIA 3QE9Y 2OESA 2Y1DA 3UKDA 4FNOA 3UW1A 1QCYA 2C96A 2JARA 2C29D 4FEGA 1GL9B 4B6SA 3O93A 2QTLA 2YBEA 4DSUA 2WK1A 4G1CA 4HEJA 2ORWA 3ZHRA 1I4TD 1YNOA 2XDAA 3KWLA 4LUCA 1THZA 1WKBA 3LY9A 2RI0A 3P19A 2JASA 1ZLXA 3DDOA 3K0FA 3KSUA 5EP3A 3BWBA 1LV7A 3AUXA 4WBNA 4ZVLA 3B38A 1QFSA 3EFOA 1DUIA 5C0OE 3ZHQA 2O2EA 1U4OA 3IIJA 3FJOA 2JFPA 4RCZA 3JQQA 1R7RA 5P8WA 2JFFA 3CNHA 2ZJZA 2ZLBA 4G1EB 4BOYA 1N1MA 3AQ4A 3BCUA 4RABA 1GR1A 3QF4A 1EDDA 1WIWA 5CITA 2BHSA 3HM2A 2BYTA 1UBCA 1YR1A 1S2MA 1AO3A 1YDWA 4JJIA 5IF3A 3IAS1 4PC6A 1IHUA 1H4SA 5ED0A 4BKMA 3DEZA 2IOFK 4HDNA 5CNIA 1MV5A 5KWSA 1UKYA 3TK1A 2ZUWA 2PU5A 5AUPB 1FU7A 1GNVA 3PQ6A 3L1KA 1GT91 3F3KA 4WCFA 4WY8A 2AC4A 4DNQA 3NHZA 1HNNA 3ZQJA 4TSFA 4GZMA 4WK6A 1FVFA 5KU7A 1FC0A 3FNGA 4W5WA 3COWA 2Y1CA 1RJWA 4M55A 1DLJA 1Q57A 3A25A 1JR4A 1X1CA 1YJCA 4PHCA 5DULA 4YXWD 3AG6A 3VA7A 1H2HA 4S24A 1XQ6A 1U3VA 2J6HA 3VH3A 5C8VA 2B69A 2CHUA 3KKKA 3N9IA 5EMKA 4OBWA 1OTHA 2PRZA 4IGIA 4LYFA 1KJZA 1U9YA 2JH9A 1L4FA 3EFBA 4TWRA 4OGLA 3AOGA 3G2HA 4LECA 1RFGE 3ZBPA 2H54A 3LT4A 5B12A 4JEIA 2QZSA 5F2OA 1ZGCA 4HVCA 3C6QA 1EE2A 1KMHA 4X20B 4B83A 2CFSA 2MINB 3FUCA 4M9CA 4K9OA 3C8DA 4WCDA 1H9BA 3GJRA 5DSXA 3J7AC 2BKUA 1A4UA 1KYIA 2N46A 3VPHA 4KSBA 2CWDA 1KZ1A 4U3JB 1VYUA 1JE0A 3AZPA 1M8GA 2ODPA 4O4IB 2JBHA 2ZYTX 2IOYA 3TKLA 4MQ4A 2R5FA 1A2QA 1AB6A 4RENA 1EGVB 5AK5A 5H68A 2GPWA 1LJ8A 1AA9A 1NW5A 1H6DA 1YL7A 4B80A 1PL6A 2R4TA 3BPSA 2W6OA 4FZ5A 1YRLA 4IH9A 2I4LA 4ND1A 1X87A 3ZWWA 5IUNC 4JBGA 1GARA 4C4YA 2O9JA 5AW6A 3Q1LA 4ENQA 3EZNA 4MV7A 5I9TA 2FHSA 2IVFA 3KX2A 5FX2A 2W2OA 1R8JA 7AT1A 2G6BA 3D3KA 1ND5A 1RXSA 1B15A 2YZMA 2M9MA 3RTDA 5CB6A 1ZVQA 3SLRA 3UGQA 3HB7A 4PLCA 3WYFA 1V6CA 3TTXA 3ADBA 4ZVNA 3DCIA 5GVSA 2JI8A 2R8OA 3TI7A 3D8NA 1LBHA 3FXAA 4JI3B 5C34B 5GZ1A 1P1FA 1IEXA 1PQWA 1QR6A 5CXSA 2AF4C 4EECA 1C4WA 5JRDS 2C5AA 2ORED 3L0OA 4QT0A 1PGOA 1CEEA 3RVBA 2A1TR 4X24A 1E2KA 1W4BA 3M2PA 1VJ1A 3ZJ5A 4X9XA 4AP5A 2DPYA 3HCBA 5I9SA 1EDBA 1PEKE 1TW3A 2J5BA 5D1HA 4UDOA 1QE5A 3VPXA 4JLOA 2WWYA 1F2TB 1NVVR 5ALRA 3OCCA 4K9DA 3ECAA 3WHLA 1R6UA 2WZQA 2VS1A 1EFAA 2DHQA 3NTRA 1KYTA 1R0YA 4L78A 4A6DA 1JL3A 2I76A 1HM5A 1PR5A 1D2GA 3I52A 2H1OA 1ZM3A 1J6UA 4OHWA 4EW3A 4Q9KA 3PPIA 3T7KA 1XDZA 4QVIA 4R40A 3P4XA 4XR9A 3OD5A 1P17A 1RR6A 1SBIA 4NJMA 2IYZA 4BMPB 1LI7A 2XNJA 3VU3A 3H99A 5E1DA 3E7WA 2PXXA 1KJQA 4R6XA 1G8YA 3F1LA 1JR3E 1PNOA 4CMHA 5MHTA 3SKYA 4HYQA 2ZKIA 1ODSA 4HXFB 5L8VA 1NVTA 2Y05A 3K2QA 4X62B 1BE1A 4GC9A 2G80A 1SPBS 2VJPA 3NWOA 1II0A 2ZYSA 3OJXA 1TQDA 3SKVA 1U2GA 2DYKA 2NU6A 4LHWA 2QVCA 4R2WA 1I8TA 4Z3KA 2DR2A 3KZMA 3BWCA 1U3UA 3MUOA 1DQYA 4C7MA 3JALB 3FOFC 1ZCJA 2H1VA 1VI2A 2J46A 2G76A 3B7GA 3NT5A 5KU1A 2CB0A 2V97A 1AN0A 1DQSA 4PSAA 1FSZA 2YL2A 4WKPA 1PD0A 1X6VA 1ZY2A 2O3SA 5DGXA 2HA6A 4HB2A 4WKOA 2H4ZA 4LXYA 4EEZA 1YRAA 3BBPA 5FOUA 3RBZA 1AN9A 1SVIA 5JWRA 3QKRA 1SB9A 1HUQA 1BHO1 1CHDA 3B8HA 1HFJA 4JVNA 1V8BA 3QY9A 3PA8A 4XB1A 5BV2P 4QOIA 1C3XA 5JAZA 2TECE 4UE6A 5DYIA 4V0QA 1QAOA 1QP8A 2ZE8A 3RC3A 1KGSA 4R2JA 1XMOB 4OYRA 2K87A 2EWMA 3U16A 3CN9A 1FW6A 2HJSA 4K9LA 3HU2A 3AR5A 5CYFA 1NW8A 1G21A 1BXRB 10MHA 4H6XA 2GTPA 4I1RA 3D8SA 4WVFA 4IZOA 1JAIA 2FEXA 2OOSA 3JYQA 3V3TA 3EA5A 4MR8A 4KOEC 2XGOA 3WGQA 1GZHB 5LNK1 2BEUA 3NFYA 4O2AB 2RK6A 4UTVA 1UH5A 3O94A 3ZS8A 2QD3A 4IF6A 3SF8A 3IX7A 3IURA 4EHNA 3LO5A 4GWKA 5AKKA 4Q7QA 5EIAA 4AG6A 3HZZA 3KPUA 2YQZA 4EJ0A 2ST1A 1WPRA 4GLFA 3AHIA 4IJWA 2XWSA 4FZRA 1HRKA 4J0HA 3ZCSA 5KIAA 5FTJA 1M1YA 2C83A 5TPZD 1R16A 3ZWDA 4ENVA 2V6JA 5I9NA 4E08A 1UL1X 4I08A 4Y2UA 4YIKA 1JSCA 4O29A 1EUZA 1FYDA 4RZUA 3C24A 4FS3A 3QEOA 3EFOB 3T94A 3ZX4A 1A8PA 4EOGA 1TCBA 3PDIA 5K8IA 2RGNC 2P3QA 2BZGA 3AC0A 4QBGB 2YFKA 2VYFA 4AJPA 4JX8A 1NFFA 3NHBA 4QO7A 4P7GA 4W63A 3VSDA 3WGIA 5PNTA 3A10A 5LXTF 4FR2A 1T0PA 4MWGA 2INGX 1J20A 1IQRA 5K1ZA 2H51A 4BFVA 3AJDA 2WFLB 4FMBB 4KIFA 3U1BA 1D8AA 1HEUA 2C5LA 2W2VA 4NNOA 1QE0A 4O6VA 4R7ZA 1KH3A 2VWQA 4CL2A 1W46A 5FLXA 3IQDB 2CSUA 2RAVA 3ZKAA 1KY3A 4LDAA 1DIBA 3IR7A 1KVQA 4MYRA 4WRRA 2HMUA 1U2DC 3IUEA 2AJBA 3PJDA 4B8ZA 2ECOA 2H08A 3EIOA 3GEMA 4ZK6A 1TM4E 5LMZA 3MGGA 3RE1A 3OPVA 1OA1A 1FLDA 4LOJA 3FLMA 3I05A 1J06A 4UCQA 5EFZA 4CCWA 5D86A 4RD6A 1NRJB 2VP5A 3LU1A 2WJVA 1SCQA 3AF2A 3O73A 4J4TA 1TT5B 4JUAA 1A1VA 1X7YB 2CMDA 4XIYA 4AICA 2PSFA 1U9IC 2O50A 4D80A 4RPGA 2BEWB 1YOBA 1NG1A 3ZU3A 4S12A 4KXLA 5TMEA 4G3XA 4ZC8A 4RA6A 4TRMA 3CRQA 4Y1RB 3UO8B 1SJ9A 2G0NA 1ZI9A 1KMHB 4EB6A 5AESA 3IIEA 1I2ZA 2CKMA 2J0VA 1E89A 2QM8A 4ZVVA 2PH5A 3LNCA 1J0EA 2D59A 4ADSG 3ADCA