4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
4RL2A 5ACVA 4TZFA 3KNSA 1DXKA 5LCHA 2R2DA 4TYTA 4RM5A 4WD6A 5HISA 4EXYA 3S0ZA 4YSLA 4C1GA 2XF4A 4HKYA 2P97A 4RAMA 3DHAA 5LS3A 2GMNA 3MD7A 5B15A 2BIBA 3SD9A 2GKLA 2QJSA 5ACSA 5HH6A 3ESHA 3G1PA 4Z5YA 2Q0JA 2QINA 1XTOA 3LVZA 4NQ2A 4C1FA 5FQAA 2Q42A 5EHTA 1M2XA 3I14A 1MQOA 1XM8A 1JT1A 4ZEJA 5A0TA 3I15A 4AX0B 1DDKA 5EWAA 4XWTA 2ZNBA 2VW8A 5A5ZA 4U4LA 4J5FA 4FR7A 2FU6A 5K4KA 2NZFA 2OHJA 3BC2A 5AYAA 5EVDA 4C09A 4BP0A 3BK2A 1ZTCA 5ACRA 5AEBA 2AZ4A 3T9MA 1A8TA 3BV6A 4GYUA 1KO2A 2YNVB 3IOGA 3R2UA 5B3RA 2UYXA 3RKKA 3SRXA 4GCWA 5ACUA 2DOOA 4EYFA 5LMCA 2BGAA 4D1UA 4TZ9A 5K0WA 1YCHA 3PG4A 4C1HA 3T3OA 2BFZB 4AD9A 2AIOA 4EY2A 1YCFA 2YNTA 3IDZA 4Z6XA 3DHCA 1SMLA 5IQKA 3PY5A 3BK1A 1A7TA 5FQBA 3I11A 4D1TA 4O98A 2I7VA 4B87A 5EH9A 4JO0A 4HL2A 2FM6A 5DPXA 2ZO4A 4Z60A 2YCBA 2BG7A 2P18A 2GFKA 3SW3A 4BZ3A 2GFJA 4UWOB 3X2ZA 4Z5ZA 2P4ZA 5AHOA 5LM6A 3Q6VA 5HH5A 2M5DA 1WUOA 3TP9A 4EXSA 4ZO2A 4UWPB 1KR3A 2BFKA 2FU9A 5HH4A 4D1WA 3AF5A 5ACPA 4KEPA 1X8IA 2FHXB 2QDTA 5HIPA 3T3NA 2H6AA 2BG8B 4AWYB 5HIOA 2BG8A 3IOFA 5LLDA 4PVTA 2ZWRA 2CBNA 5ACQA 5FQCA 5LCAA 3P2UA 3WXCA 1L9YA 3I13A 5LSCA 4EFZA 2FU7A 4J5HA 1WRAA 3L6NA 1YCGA 4NQ4A 2YNVA 3SPUA 5EVKA 1KO3A 4EYBA 2QEDA 2Y8AA 3KNRA 2FK6A 4NQ5A 2QDSA 3SFPA 5EVBA 5KIKA 4C1DA 1VGNA 4RAWA 2ZZIA 2P1EA 2NXAA 2NYPA 2BMIA 2M5CA 3IE2A 5A0VA 5HIQA 1K07A 4C1CA 4DIKA 5EW0A 2Y87A 2BFZA 1JJTA 2BG6A 4H0DA 2HB9A 3AF6A 2Q9UA 1ZKPA 5EV8A 4Z7RA 3ZWFA 4D1VA 3VPEA 3X2YA 3ADRA 5LCFA 3DH8A 4LE6A 4TZEA 2WYMC 5ACWA 4KEQA 4HL1A 3SBLA 2A7MA 3IE1A 2GCUA 4NQ6A 2WYLA 4RBSA 5K4NA 4TYFA 2YZ3A 4ZO3A 4DILA 5A87A 4FEKA 4UWSB 1ZNBA 3ZR9A 4YSKA 4P62A 3FCZA 1X8GA 3ZQ4A 2WHGA 4PVOA 1HLKA 2FU8A 2WYMA 2YNUA 3X2XA 2WRSA 3F9OA 4AWZA 2OHHA 3A4YA 1P9EA 5AXOA 3H3EA 3ZNBA 4XWWA 2FHXA 1VJNA 5ACTA 2DKFA 2I7XA 1BC2A 3IELA 4V0HA 4XUKA 3QH8A 4CHLA 1QH5A 3PY6A 3VQZA 2XR1A 5KILA 2E7YA 3JXPA 4TZBA 3FAIA 4EYLA 4UAMA 4F6HA 1VMEA 2YNWA 1BVTA 4RL0A 5EV6A 2Q0IA 1WW1A 3IEKA 5AXRA 5B1UA 5LE1A 4F6ZA 1WUPA 4UBQA 4YSBA 3DHBA 3KL7A 3IE0A 4FSBA 5AHRA 5ACXA 4AX1B 1QH3A 1E5DA 4GYQA 1X8HA 2NZEA 3X30A 2OHIA 3IEMA 1JJEA 2I7TA 2BC2A 4C1EA 2BR6A 4UA4A 4ZNBA 2BG2A 1DD6A 2YNTB 4Z67A 2BFLA 1BMCA 3RKJA 3AJ3A 4UWRB 3I0VA 5K4MA 4D02A 1Y44A 2BTNA 3RPCA 2Y8BA
chains in the Genus database with same CATH superfamily
4RL2A 5ACVA 4TZFA 3KNSA 1DXKA 5LCHA 2R2DA 4TYTA 4RM5A 2CFZA 4WD6A 5HISA 4EXYA 3S0ZA 4YSLA 4C1GA 2XF4A 4HKYA 2P97A 4RAMA 3DHAA 5LS3A 2GMNA 3MD7A 4AXHA 5B15A 2BIBA 3SD9A 2GKLA 2QJSA 5ACSA 5HH6A 3ESHA 3G1PA 4Z5YA 2Q0JA 2QINA 1XTOA 3LVZA 5AIJA 4NQ2A 4C1FA 5FQAA 2Q42A 5EHTA 1M2XA 3I14A 1MQOA 1XM8A 1JT1A 4ZEJA 5A0TA 3I15A 4AX0B 1DDKA 5EWAA 4XWTA 2ZNBA 2VW8A 5A5ZA 4U4LA 4J5FA 4FR7A 2FU6A 5K4KA 2NZFA 2OHJA 3BC2A 5AYAA 5EVDA 4C09A 4BP0A 5AJLA 3BK2A 1ZTCA 5ACRA 5AEBA 2AZ4A 3T9MA 1A8TA 3BV6A 4GYUA 1KO2A 2YNVB 3IOGA 3R2UA 5B3RA 2UYXA 3RKKA 3SRXA 4GCWA 5ACUA 2DOOA 4EYFA 5LMCA 2BGAA 4D1UA 4TZ9A 5K0WA 1YCHA 3PG4A 4AV7A 4C1HA 3T3OA 2BFZB 4AD9A 2AIOA 4EY2A 1YCFA 2YNTA 4PDXA 3IDZA 4Z6XA 3DHCA 2CG2A 1SMLA 5IQKA 3PY5A 3BK1A 1A7TA 5FQBA 3I11A 4D1TA 4O98A 2I7VA 4B87A 5EH9A 4JO0A 4HL2A 2FM6A 5DPXA 2ZO4A 4Z60A 2YCBA 2BG7A 2P18A 2GFKA 3SW3A 4BZ3A 2GFJA 4UWOB 3X2ZA 4Z5ZA 2P4ZA 5AHOA 5LM6A 3Q6VA 5HH5A 2M5DA 1WUOA 3TP9A 4EXSA 4ZO2A 4UWPB 1KR3A 2CG3A 2BFKA 2FU9A 5HH4A 4D1WA 3AF5A 5ACPA 4KEPA 1X8IA 2FHXB 2QDTA 5HIPA 3T3NA 2H6AA 2BG8B 4AWYB 5HIOA 2BG8A 3IOFA 5LLDA 4PVTA 2ZWRA 2CBNA 5ACQA 5FQCA 5LCAA 3P2UA 3WXCA 1L9YA 3I13A 5LSCA 4EFZA 2FU7A 4J5HA 1WRAA 3L6NA 1YCGA 4NQ4A 2YNVA 3SPUA 5EVKA 1KO3A 4EYBA 2QEDA 2Y8AA 3KNRA 2FK6A 4NQ5A 2QDSA 3SFPA 5EVBA 5KIKA 4C1DA 1VGNA 4RAWA 2ZZIA 2P1EA 2NXAA 2NYPA 2BMIA 2M5CA 3IE2A 5A0VA 5HIQA 1K07A 4C1CA 4DIKA 5EW0A 2Y87A 2BFZA 1JJTA 2BG6A 4H0DA 2HB9A 3AF6A 2Q9UA 1ZKPA 5EV8A 4Z7RA 3ZWFA 4D1VA 3VPEA 3X2YA 3ADRA 5LCFA 3DH8A 4LE6A 4TZEA 2WYMC 5ACWA 4KEQA 4HL1A 3SBLA 2A7MA 3IE1A 2GCUA 4NQ6A 2WYLA 4RBSA 5K4NA 4TYFA 2YZ3A 4ZO3A 4DILA 5A87A 4FEKA 4UWSB 1ZNBA 3ZR9A 4YSKA 4P62A 3FCZA 1X8GA 3ZQ4A 2WHGA 4PVOA 1HLKA 2FU8A 2WYMA 2YNUA 3X2XA 2WRSA 3F9OA 4AWZA 2OHHA 3A4YA 1P9EA 5AXOA 3H3EA 3ZNBA 4XWWA 2FHXA 1VJNA 5ACTA 2DKFA 2I7XA 1BC2A 3IELA 4V0HA 4XUKA 3QH8A 4CHLA 1QH5A 3PY6A 3VQZA 2XR1A 5KILA 2E7YA 4NURA 3JXPA 4TZBA 3FAIA 4EYLA 4UAMA 4F6HA 1VMEA 2YNWA 1BVTA 4RL0A 5EV6A 2Q0IA 1WW1A 3IEKA 5AXRA 5B1UA 5LE1A 4F6ZA 1WUPA 4UBQA 4YSBA 3DHBA 3KL7A 2CFUA 3IE0A 4FSBA 5AHRA 5ACXA 2YHEA 4AX1B 1QH3A 1E5DA 5A23A 4GYQA 1X8HA 2NZEA 3X30A 2OHIA 3IEMA 1JJEA 2I7TA 2BC2A 4C1EA 2BR6A 4UA4A 4ZNBA 2BG2A 1DD6A 2YNTB 4Z67A 2BFLA 1BMCA 3RKJA 3AJ3A 4UWRB 3I0VA 5K4MA 4D02A 1Y44A 2BTNA 3RPCA 2Y8BA
chains in the Genus database with same CATH topology
4RL2A 5ACVA 4TZFA 3KNSA 1DXKA 5LCHA 2R2DA 4TYTA 4RM5A 4WD6A 5HISA 4EXYA 3S0ZA 4YSLA 4C1GA 2XF4A 4HKYA 2P97A 4RAMA 3DHAA 5LS3A 2GMNA 3MD7A 5B15A 2BIBA 3SD9A 2GKLA 2QJSA 5ACSA 5HH6A 3ESHA 3G1PA 4Z5YA 2Q0JA 2QINA 1XTOA 3LVZA 4NQ2A 4C1FA 5FQAA 2Q42A 5EHTA 1M2XA 3I14A 1MQOA 1XM8A 1JT1A 4ZEJA 5A0TA 3I15A 4AX0B 1DDKA 5EWAA 4XWTA 2ZNBA 2VW8A 5A5ZA 4U4LA 4J5FA 4FR7A 2FU6A 5K4KA 2NZFA 2OHJA 3BC2A 5AYAA 5EVDA 4C09A 4BP0A 3BK2A 1ZTCA 5ACRA 5AEBA 2AZ4A 3T9MA 1A8TA 3BV6A 4GYUA 1KO2A 2YNVB 3IOGA 3R2UA 5B3RA 2UYXA 3RKKA 3SRXA 4GCWA 5ACUA 2DOOA 4EYFA 5LMCA 2BGAA 4D1UA 4TZ9A 5K0WA 1YCHA 3PG4A 4C1HA 3T3OA 2BFZB 4AD9A 2AIOA 4EY2A 1YCFA 2YNTA 3IDZA 4Z6XA 3DHCA 1SMLA 5IQKA 3PY5A 3BK1A 1A7TA 5FQBA 3I11A 4D1TA 4O98A 2I7VA 4B87A 5EH9A 4JO0A 4HL2A 2FM6A 5DPXA 2ZO4A 4Z60A 2YCBA 2BG7A 2P18A 2GFKA 3SW3A 4BZ3A 2GFJA 4UWOB 3X2ZA 4Z5ZA 2P4ZA 5AHOA 5LM6A 3Q6VA 5HH5A 2M5DA 1WUOA 3TP9A 4EXSA 4ZO2A 4UWPB 1KR3A 2BFKA 2FU9A 5HH4A 4D1WA 3AF5A 5ACPA 4KEPA 1X8IA 2FHXB 2QDTA 5HIPA 3T3NA 2H6AA 2BG8B 4AWYB 5HIOA 2BG8A 3IOFA 5LLDA 4PVTA 2ZWRA 2CBNA 5ACQA 5FQCA 5LCAA 3P2UA 3WXCA 1L9YA 3I13A 5LSCA 4EFZA 2FU7A 4J5HA 1WRAA 3L6NA 1YCGA 4NQ4A 2YNVA 3SPUA 5EVKA 1KO3A 4EYBA 2QEDA 2Y8AA 3KNRA 2FK6A 4NQ5A 2QDSA 3SFPA 5EVBA 5KIKA 4C1DA 1VGNA 4RAWA 2ZZIA 2P1EA 2NXAA 2NYPA 2BMIA 2M5CA 3IE2A 5A0VA 5HIQA 1K07A 4C1CA 4DIKA 5EW0A 2Y87A 2BFZA 1JJTA 2BG6A 4H0DA 2HB9A 3AF6A 2Q9UA 1ZKPA 5EV8A 4Z7RA 3ZWFA 4D1VA 3VPEA 3X2YA 3ADRA 5LCFA 3DH8A 4LE6A 4TZEA 2WYMC 5ACWA 4KEQA 4HL1A 3SBLA 2A7MA 3IE1A 2GCUA 4NQ6A 2WYLA 4RBSA 5K4NA 4TYFA 2YZ3A 4ZO3A 4DILA 5A87A 4FEKA 4UWSB 1ZNBA 3ZR9A 4YSKA 4P62A 3FCZA 1X8GA 3ZQ4A 2WHGA 4PVOA 1HLKA 2FU8A 2WYMA 2YNUA 3X2XA 2WRSA 3F9OA 4AWZA 2OHHA 3A4YA 1P9EA 5AXOA 3H3EA 3ZNBA 4XWWA 2FHXA 1VJNA 5ACTA 2DKFA 2I7XA 1BC2A 3IELA 4V0HA 4XUKA 3QH8A 4CHLA 1QH5A 3PY6A 3VQZA 2XR1A 5KILA 2E7YA 3JXPA 4TZBA 3FAIA 4EYLA 4UAMA 4F6HA 1VMEA 2YNWA 1BVTA 4RL0A 5EV6A 2Q0IA 1WW1A 3IEKA 5AXRA 5B1UA 5LE1A 4F6ZA 1WUPA 4UBQA 4YSBA 3DHBA 3KL7A 3IE0A 4FSBA 5AHRA 5ACXA 4AX1B 1QH3A 1E5DA 4GYQA 1X8HA 2NZEA 3X30A 2OHIA 3IEMA 1JJEA 2I7TA 2BC2A 4C1EA 2BR6A 4UA4A 4ZNBA 2BG2A 1DD6A 2YNTB 4Z67A 2BFLA 1BMCA 3RKJA 3AJ3A 4UWRB 3I0VA 5K4MA 4D02A 1Y44A 2BTNA 3RPCA 2Y8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RL2 A;  5ACV A;  4TZF A;  3KNS A;  1DXK A;  5LCH A;  2R2D A;  4TYT A;  4RM5 A;  4WD6 A;  5HIS A;  4EXY A;  3S0Z A;  4YSL A;  4C1G A;  2XF4 A;  4HKY A;  2P97 A;  4RAM A;  3DHA A;  5LS3 A;  2GMN A;  3MD7 A;  5B15 A;  2BIB A;  3SD9 A;  2GKL A;  2QJS A;  5ACS A;  5HH6 A;  3ESH A;  3G1P A;  4Z5Y A;  2Q0J A;  2QIN A;  1XTO A;  3LVZ A;  4NQ2 A;  4C1F A;  5FQA A;  2Q42 A;  5EHT A;  1M2X A;  3I14 A;  1MQO A;  1XM8 A;  1JT1 A;  4ZEJ A;  5A0T A;  3I15 A;  4AX0 B;  1DDK A;  5EWA A;  4XWT A;  2ZNB A;  2VW8 A;  5A5Z A;  4U4L A;  4J5F A;  4FR7 A;  2FU6 A;  5K4K A;  2NZF A;  2OHJ A;  3BC2 A;  5AYA A;  5EVD A;  4C09 A;  4BP0 A;  3BK2 A;  1ZTC A;  5ACR A;  5AEB A;  2AZ4 A;  3T9M A;  1A8T A;  3BV6 A;  4GYU A;  1KO2 A;  2YNV B;  3IOG A;  3R2U A;  5B3R A;  2UYX A;  3RKK A;  3SRX A;  4GCW A;  5ACU A;  2DOO A;  4EYF A;  5LMC A;  2BGA A;  4D1U A;  4TZ9 A;  5K0W A;  1YCH A;  3PG4 A;  4C1H A;  3T3O A;  2BFZ B;  4AD9 A;  2AIO A;  4EY2 A;  1YCF A;  2YNT A;  3IDZ A;  4Z6X A;  3DHC A;  1SML A;  5IQK A;  3PY5 A;  3BK1 A;  1A7T A;  5FQB A;  3I11 A;  4D1T A;  4O98 A;  2I7V A;  4B87 A;  5EH9 A;  4JO0 A;  4HL2 A;  2FM6 A;  5DPX A;  2ZO4 A;  4Z60 A;  2YCB A;  2BG7 A;  2P18 A;  2GFK A;  3SW3 A;  4BZ3 A;  2GFJ A;  4UWO B;  3X2Z A;  4Z5Z A;  2P4Z A;  5AHO A;  5LM6 A;  3Q6V A;  5HH5 A;  2M5D A;  1WUO A;  3TP9 A;  4EXS A;  4ZO2 A;  4UWP B;  1KR3 A;  2BFK A;  2FU9 A;  5HH4 A;  4D1W A;  3AF5 A;  5ACP A;  4KEP A;  1X8I A;  2FHX B;  2QDT A;  5HIP A;  3T3N A;  2H6A A;  2BG8 B;  4AWY B;  5HIO A;  2BG8 A;  3IOF A;  5LLD A;  4PVT A;  2ZWR A;  2CBN A;  5ACQ A;  5FQC A;  5LCA A;  3P2U A;  3WXC A;  1L9Y A;  3I13 A;  5LSC A;  4EFZ A;  2FU7 A;  4J5H A;  1WRA A;  3L6N A;  1YCG A;  4NQ4 A;  2YNV A;  3SPU A;  5EVK A;  1KO3 A;  4EYB A;  2QED A;  2Y8A A;  3KNR A;  2FK6 A;  4NQ5 A;  2QDS A;  3SFP A;  5EVB A;  5KIK A;  4C1D A;  1VGN A;  4RAW A;  2ZZI A;  2P1E A;  2NXA A;  2NYP A;  2BMI A;  2M5C A;  3IE2 A;  5A0V A;  5HIQ A;  1K07 A;  4C1C A;  4DIK A;  5EW0 A;  2Y87 A;  2BFZ A;  1JJT A;  2BG6 A;  4H0D A;  2HB9 A;  3AF6 A;  2Q9U A;  1ZKP A;  5EV8 A;  4Z7R A;  3ZWF A;  4D1V A;  3VPE A;  3X2Y A;  3ADR A;  5LCF A;  3DH8 A;  4LE6 A;  4TZE A;  2WYM C;  5ACW A;  4KEQ A;  4HL1 A;  3SBL A;  2A7M A;  3IE1 A;  2GCU A;  4NQ6 A;  2WYL A;  4RBS A;  5K4N A;  4TYF A;  2YZ3 A;  4ZO3 A;  4DIL A;  5A87 A;  4FEK A;  4UWS B;  1ZNB A;  3ZR9 A;  4YSK A;  4P62 A;  3FCZ A;  1X8G A;  3ZQ4 A;  2WHG A;  4PVO A;  1HLK A;  2FU8 A;  2WYM A;  2YNU A;  3X2X A;  2WRS A;  3F9O A;  4AWZ A;  2OHH A;  3A4Y A;  1P9E A;  5AXO A;  3H3E A;  3ZNB A;  4XWW A;  2FHX A;  1VJN A;  5ACT A;  2DKF A;  2I7X A;  1BC2 A;  3IEL A;  4V0H A;  4XUK A;  3QH8 A;  4CHL A;  1QH5 A;  3PY6 A;  3VQZ A;  2XR1 A;  5KIL A;  2E7Y A;  3JXP A;  4TZB A;  3FAI A;  4EYL A;  4UAM A;  4F6H A;  1VME A;  2YNW A;  1BVT A;  4RL0 A;  5EV6 A;  2Q0I A;  1WW1 A;  3IEK A;  5AXR A;  5B1U A;  5LE1 A;  4F6Z A;  1WUP A;  4UBQ A;  4YSB A;  3DHB A;  3KL7 A;  3IE0 A;  4FSB A;  5AHR A;  5ACX A;  4AX1 B;  1QH3 A;  1E5D A;  4GYQ A;  1X8H A;  2NZE A;  3X30 A;  2OHI A;  3IEM A;  1JJE A;  2I7T A;  2BC2 A;  4C1E A;  2BR6 A;  4UA4 A;  4ZNB A;  2BG2 A;  1DD6 A;  2YNT B;  4Z67 A;  2BFL A;  1BMC A;  3RKJ A;  3AJ3 A;  4UWR B;  3I0V A;  5K4M A;  4D02 A;  1Y44 A;  2BTN A;  3RPC A;  2Y8B A; 
#chains in the Genus database with same CATH topology
 4RL2 A;  5ACV A;  4TZF A;  3KNS A;  1DXK A;  5LCH A;  2R2D A;  4TYT A;  4RM5 A;  2CFZ A;  4WD6 A;  5HIS A;  4EXY A;  3S0Z A;  4YSL A;  4C1G A;  2XF4 A;  4HKY A;  2P97 A;  4RAM A;  3DHA A;  5LS3 A;  2GMN A;  3MD7 A;  4AXH A;  5B15 A;  2BIB A;  3SD9 A;  2GKL A;  2QJS A;  5ACS A;  5HH6 A;  3ESH A;  3G1P A;  4Z5Y A;  2Q0J A;  2QIN A;  1XTO A;  3LVZ A;  5AIJ A;  4NQ2 A;  4C1F A;  5FQA A;  2Q42 A;  5EHT A;  1M2X A;  3I14 A;  1MQO A;  1XM8 A;  1JT1 A;  4ZEJ A;  5A0T A;  3I15 A;  4AX0 B;  1DDK A;  5EWA A;  4XWT A;  2ZNB A;  2VW8 A;  5A5Z A;  4U4L A;  4J5F A;  4FR7 A;  2FU6 A;  5K4K A;  2NZF A;  2OHJ A;  3BC2 A;  5AYA A;  5EVD A;  4C09 A;  4BP0 A;  5AJL A;  3BK2 A;  1ZTC A;  5ACR A;  5AEB A;  2AZ4 A;  3T9M A;  1A8T A;  3BV6 A;  4GYU A;  1KO2 A;  2YNV B;  3IOG A;  3R2U A;  5B3R A;  2UYX A;  3RKK A;  3SRX A;  4GCW A;  5ACU A;  2DOO A;  4EYF A;  5LMC A;  2BGA A;  4D1U A;  4TZ9 A;  5K0W A;  1YCH A;  3PG4 A;  4AV7 A;  4C1H A;  3T3O A;  2BFZ B;  4AD9 A;  2AIO A;  4EY2 A;  1YCF A;  2YNT A;  4PDX A;  3IDZ A;  4Z6X A;  3DHC A;  2CG2 A;  1SML A;  5IQK A;  3PY5 A;  3BK1 A;  1A7T A;  5FQB A;  3I11 A;  4D1T A;  4O98 A;  2I7V A;  4B87 A;  5EH9 A;  4JO0 A;  4HL2 A;  2FM6 A;  5DPX A;  2ZO4 A;  4Z60 A;  2YCB A;  2BG7 A;  2P18 A;  2GFK A;  3SW3 A;  4BZ3 A;  2GFJ A;  4UWO B;  3X2Z A;  4Z5Z A;  2P4Z A;  5AHO A;  5LM6 A;  3Q6V A;  5HH5 A;  2M5D A;  1WUO A;  3TP9 A;  4EXS A;  4ZO2 A;  4UWP B;  1KR3 A;  2CG3 A;  2BFK A;  2FU9 A;  5HH4 A;  4D1W A;  3AF5 A;  5ACP A;  4KEP A;  1X8I A;  2FHX B;  2QDT A;  5HIP A;  3T3N A;  2H6A A;  2BG8 B;  4AWY B;  5HIO A;  2BG8 A;  3IOF A;  5LLD A;  4PVT A;  2ZWR A;  2CBN A;  5ACQ A;  5FQC A;  5LCA A;  3P2U A;  3WXC A;  1L9Y A;  3I13 A;  5LSC A;  4EFZ A;  2FU7 A;  4J5H A;  1WRA A;  3L6N A;  1YCG A;  4NQ4 A;  2YNV A;  3SPU A;  5EVK A;  1KO3 A;  4EYB A;  2QED A;  2Y8A A;  3KNR A;  2FK6 A;  4NQ5 A;  2QDS A;  3SFP A;  5EVB A;  5KIK A;  4C1D A;  1VGN A;  4RAW A;  2ZZI A;  2P1E A;  2NXA A;  2NYP A;  2BMI A;  2M5C A;  3IE2 A;  5A0V A;  5HIQ A;  1K07 A;  4C1C A;  4DIK A;  5EW0 A;  2Y87 A;  2BFZ A;  1JJT A;  2BG6 A;  4H0D A;  2HB9 A;  3AF6 A;  2Q9U A;  1ZKP A;  5EV8 A;  4Z7R A;  3ZWF A;  4D1V A;  3VPE A;  3X2Y A;  3ADR A;  5LCF A;  3DH8 A;  4LE6 A;  4TZE A;  2WYM C;  5ACW A;  4KEQ A;  4HL1 A;  3SBL A;  2A7M A;  3IE1 A;  2GCU A;  4NQ6 A;  2WYL A;  4RBS A;  5K4N A;  4TYF A;  2YZ3 A;  4ZO3 A;  4DIL A;  5A87 A;  4FEK A;  4UWS B;  1ZNB A;  3ZR9 A;  4YSK A;  4P62 A;  3FCZ A;  1X8G A;  3ZQ4 A;  2WHG A;  4PVO A;  1HLK A;  2FU8 A;  2WYM A;  2YNU A;  3X2X A;  2WRS A;  3F9O A;  4AWZ A;  2OHH A;  3A4Y A;  1P9E A;  5AXO A;  3H3E A;  3ZNB A;  4XWW A;  2FHX A;  1VJN A;  5ACT A;  2DKF A;  2I7X A;  1BC2 A;  3IEL A;  4V0H A;  4XUK A;  3QH8 A;  4CHL A;  1QH5 A;  3PY6 A;  3VQZ A;  2XR1 A;  5KIL A;  2E7Y A;  4NUR A;  3JXP A;  4TZB A;  3FAI A;  4EYL A;  4UAM A;  4F6H A;  1VME A;  2YNW A;  1BVT A;  4RL0 A;  5EV6 A;  2Q0I A;  1WW1 A;  3IEK A;  5AXR A;  5B1U A;  5LE1 A;  4F6Z A;  1WUP A;  4UBQ A;  4YSB A;  3DHB A;  3KL7 A;  2CFU A;  3IE0 A;  4FSB A;  5AHR A;  5ACX A;  2YHE A;  4AX1 B;  1QH3 A;  1E5D A;  5A23 A;  4GYQ A;  1X8H A;  2NZE A;  3X30 A;  2OHI A;  3IEM A;  1JJE A;  2I7T A;  2BC2 A;  4C1E A;  2BR6 A;  4UA4 A;  4ZNB A;  2BG2 A;  1DD6 A;  2YNT B;  4Z67 A;  2BFL A;  1BMC A;  3RKJ A;  3AJ3 A;  4UWR B;  3I0V A;  5K4M A;  4D02 A;  1Y44 A;  2BTN A;  3RPC A;  2Y8B A; 
#chains in the Genus database with same CATH homology
 4RL2 A;  5ACV A;  4TZF A;  3KNS A;  1DXK A;  5LCH A;  2R2D A;  4TYT A;  4RM5 A;  4WD6 A;  5HIS A;  4EXY A;  3S0Z A;  4YSL A;  4C1G A;  2XF4 A;  4HKY A;  2P97 A;  4RAM A;  3DHA A;  5LS3 A;  2GMN A;  3MD7 A;  5B15 A;  2BIB A;  3SD9 A;  2GKL A;  2QJS A;  5ACS A;  5HH6 A;  3ESH A;  3G1P A;  4Z5Y A;  2Q0J A;  2QIN A;  1XTO A;  3LVZ A;  4NQ2 A;  4C1F A;  5FQA A;  2Q42 A;  5EHT A;  1M2X A;  3I14 A;  1MQO A;  1XM8 A;  1JT1 A;  4ZEJ A;  5A0T A;  3I15 A;  4AX0 B;  1DDK A;  5EWA A;  4XWT A;  2ZNB A;  2VW8 A;  5A5Z A;  4U4L A;  4J5F A;  4FR7 A;  2FU6 A;  5K4K A;  2NZF A;  2OHJ A;  3BC2 A;  5AYA A;  5EVD A;  4C09 A;  4BP0 A;  3BK2 A;  1ZTC A;  5ACR A;  5AEB A;  2AZ4 A;  3T9M A;  1A8T A;  3BV6 A;  4GYU A;  1KO2 A;  2YNV B;  3IOG A;  3R2U A;  5B3R A;  2UYX A;  3RKK A;  3SRX A;  4GCW A;  5ACU A;  2DOO A;  4EYF A;  5LMC A;  2BGA A;  4D1U A;  4TZ9 A;  5K0W A;  1YCH A;  3PG4 A;  4C1H A;  3T3O A;  2BFZ B;  4AD9 A;  2AIO A;  4EY2 A;  1YCF A;  2YNT A;  3IDZ A;  4Z6X A;  3DHC A;  1SML A;  5IQK A;  3PY5 A;  3BK1 A;  1A7T A;  5FQB A;  3I11 A;  4D1T A;  4O98 A;  2I7V A;  4B87 A;  5EH9 A;  4JO0 A;  4HL2 A;  2FM6 A;  5DPX A;  2ZO4 A;  4Z60 A;  2YCB A;  2BG7 A;  2P18 A;  2GFK A;  3SW3 A;  4BZ3 A;  2GFJ A;  4UWO B;  3X2Z A;  4Z5Z A;  2P4Z A;  5AHO A;  5LM6 A;  3Q6V A;  5HH5 A;  2M5D A;  1WUO A;  3TP9 A;  4EXS A;  4ZO2 A;  4UWP B;  1KR3 A;  2BFK A;  2FU9 A;  5HH4 A;  4D1W A;  3AF5 A;  5ACP A;  4KEP A;  1X8I A;  2FHX B;  2QDT A;  5HIP A;  3T3N A;  2H6A A;  2BG8 B;  4AWY B;  5HIO A;  2BG8 A;  3IOF A;  5LLD A;  4PVT A;  2ZWR A;  2CBN A;  5ACQ A;  5FQC A;  5LCA A;  3P2U A;  3WXC A;  1L9Y A;  3I13 A;  5LSC A;  4EFZ A;  2FU7 A;  4J5H A;  1WRA A;  3L6N A;  1YCG A;  4NQ4 A;  2YNV A;  3SPU A;  5EVK A;  1KO3 A;  4EYB A;  2QED A;  2Y8A A;  3KNR A;  2FK6 A;  4NQ5 A;  2QDS A;  3SFP A;  5EVB A;  5KIK A;  4C1D A;  1VGN A;  4RAW A;  2ZZI A;  2P1E A;  2NXA A;  2NYP A;  2BMI A;  2M5C A;  3IE2 A;  5A0V A;  5HIQ A;  1K07 A;  4C1C A;  4DIK A;  5EW0 A;  2Y87 A;  2BFZ A;  1JJT A;  2BG6 A;  4H0D A;  2HB9 A;  3AF6 A;  2Q9U A;  1ZKP A;  5EV8 A;  4Z7R A;  3ZWF A;  4D1V A;  3VPE A;  3X2Y A;  3ADR A;  5LCF A;  3DH8 A;  4LE6 A;  4TZE A;  2WYM C;  5ACW A;  4KEQ A;  4HL1 A;  3SBL A;  2A7M A;  3IE1 A;  2GCU A;  4NQ6 A;  2WYL A;  4RBS A;  5K4N A;  4TYF A;  2YZ3 A;  4ZO3 A;  4DIL A;  5A87 A;  4FEK A;  4UWS B;  1ZNB A;  3ZR9 A;  4YSK A;  4P62 A;  3FCZ A;  1X8G A;  3ZQ4 A;  2WHG A;  4PVO A;  1HLK A;  2FU8 A;  2WYM A;  2YNU A;  3X2X A;  2WRS A;  3F9O A;  4AWZ A;  2OHH A;  3A4Y A;  1P9E A;  5AXO A;  3H3E A;  3ZNB A;  4XWW A;  2FHX A;  1VJN A;  5ACT A;  2DKF A;  2I7X A;  1BC2 A;  3IEL A;  4V0H A;  4XUK A;  3QH8 A;  4CHL A;  1QH5 A;  3PY6 A;  3VQZ A;  2XR1 A;  5KIL A;  2E7Y A;  3JXP A;  4TZB A;  3FAI A;  4EYL A;  4UAM A;  4F6H A;  1VME A;  2YNW A;  1BVT A;  4RL0 A;  5EV6 A;  2Q0I A;  1WW1 A;  3IEK A;  5AXR A;  5B1U A;  5LE1 A;  4F6Z A;  1WUP A;  4UBQ A;  4YSB A;  3DHB A;  3KL7 A;  3IE0 A;  4FSB A;  5AHR A;  5ACX A;  4AX1 B;  1QH3 A;  1E5D A;  4GYQ A;  1X8H A;  2NZE A;  3X30 A;  2OHI A;  3IEM A;  1JJE A;  2I7T A;  2BC2 A;  4C1E A;  2BR6 A;  4UA4 A;  4ZNB A;  2BG2 A;  1DD6 A;  2YNT B;  4Z67 A;  2BFL A;  1BMC A;  3RKJ A;  3AJ3 A;  4UWR B;  3I0V A;  5K4M A;  4D02 A;  1Y44 A;  2BTN A;  3RPC A;  2Y8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...