4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
2BG7A 4U4LA 3ZR9A 2ZWRA 1M2XA 2P4ZA 3RKKA 4XWTA 4AD9A 2Y8AA 2BMIA 3T9MA 2P1EA 2BIBA 3IEKA 2Y87A 4TYTA 1WUPA 4UA4A 1X8HA 4AWYB 4HL1A 5HIPA 3DHAA 5FQAA 5ACQA 3SFPA 3ZNBA 1DXKA 2NXAA 4YSLA 3I11A 2QDSA 1VGNA 4RL0A 3F9OA 3KNSA 2Q9UA 5EVBA 4CHLA 2WHGA 1X8GA 4Z5YA 5EH9A 1KO3A 2GMNA 1HLKA 3JXPA 5FQBA 2OHJA 5AXRA 3DH8A 3PY5A 2YCBA 1YCHA 5HISA 4TZBA 5ACUA 5EHTA 3R2UA 5HH4A 5ACXA 2BFZA 3ZQ4A 2WYLA 4FEKA 1XTOA 2OHIA 1DD6A 5ACWA 4TYFA 4Z5ZA 1JT1A 5FQCA 5LMCA 2QJSA 5AXOA 5DPXA 2ZNBA 4O98A 2FHXA 3IOFA 4JO0A 5ACRA 1JJTA 5AHRA 5LM6A 2Q42A 5ACVA 4GYUA 2NYPA 2HB9A 4P62A 4UWRB 2WRSA 2VW8A 1JJEA 4DILA 4ZEJA 1KO2A 4FR7A 3X30A 3VQZA 5EWAA 1KR3A 5A5ZA 4GYQA 5ACPA 5IQKA 1BC2A 4NQ5A 4C1GA 4UWOB 2BFZB 4BP0A 2WYMA 3SPUA 1ZTCA 4V0HA 4UWSB 2BGAA 2QDTA 2ZZIA 3MD7A 4EXSA 2GKLA 3RPCA 2M5CA 4C1HA 2H6AA 5B1UA 3PY6A 5KIKA 4D1UA 3DHCA 3FAIA 5A87A 2P18A 3RKJA 5A0TA 4NQ6A 5LS3A 1YCGA 2ZO4A 5EVDA 5EVKA 2QEDA 1ZKPA 3SW3A 5LE1A 3BK2A 5LCFA 1BMCA 4UAMA 4LE6A 5LLDA 2AZ4A 3BC2A 5EV8A 2CBNA 4B87A 2BG8A 1DDKA 3TP9A 3AJ3A 3IOGA 4PVOA 4EFZA 4RM5A 1WW1A 5K4MA 2GCUA 5LSCA 1BVTA 3I15A 2M5DA 5ACSA 3SD9A 5KILA 5AYAA 2GFJA 2BFLA 3I13A 3X2XA 2FU9A 1VMEA 4J5HA 2AIOA 3WXCA 3A4YA 5A0VA 2GFKA 5B3RA 3KNRA 1P9EA 4EYLA 1A8TA 3LVZA 4EY2A 5EV6A 2I7XA 2FU6A 4RAWA 2BG2A 3X2YA 4HKYA 4EYBA 2BG8B 4RBSA 2YNUA 1A7TA 3PG4A 4XUKA 5B15A 1QH5A 4ZO3A 2Y8BA 3IE1A 2YNVA 3BV6A 4C1FA 2NZEA 2FHXB 4WD6A 4C1DA 2XR1A 5HIOA 2DOOA 3IELA 4DIKA 3G1PA 3SBLA 4XWWA 3KL7A 5K4NA 3ADRA 2XF4A 3FCZA 2P97A 2DKFA 4TZFA 4TZEA 2BG6A 2Q0JA 5HIQA 4NQ2A 4Z7RA 5K4KA 4Z6XA 1WUOA 4PVTA 5EW0A 5LCHA 2OHHA 3AF6A 4RL2A 3DHBA 5LCAA 3P2UA 4UWPB 2YZ3A 3SRXA 2Q0IA 4TZ9A 2I7TA 3VPEA 4KEQA 3AF5A 3ZWFA 3QH8A 4D1WA 1MQOA 4Z67A 4HL2A 3IEMA 2FU8A 2A7MA 2NZFA 4F6HA 4GCWA 1QH3A 4D1TA 2YNWA 4J5FA 1X8IA 3X2ZA 3IE0A 3S0ZA 2FU7A 1XM8A 3Q6VA 4RAMA 1ZNBA 4FSBA 2BTNA 3T3OA 5HH6A 4ZO2A 1YCFA 4BZ3A 4C1CA 2BC2A 4C09A 2WYMC 4AX0B 2E7YA 3IDZA 4C1EA 2R2DA 3IE2A 3I14A 1Y44A 2UYXA 3ESHA 1E5DA 2BFKA 2YNTA 1L9YA 4Z60A 2YNTB 1SMLA 4AX1B 1K07A 5AEBA 2YNVB 3H3EA 5AHOA 4KEPA 4EXYA 4UBQA 3I0VA 3L6NA 1VJNA 4D02A 2I7VA 5HH5A 2FK6A 1WRAA 4YSBA 5ACTA 4D1VA 4H0DA 2FM6A 3BK1A 4AWZA 4EYFA 2QINA 4NQ4A 4YSKA 3T3NA 4ZNBA 4F6ZA 5K0WA 2BR6A
chains in the Genus database with same CATH superfamily
2BG7A 4U4LA 3ZR9A 2YHEA 2ZWRA 1M2XA 2P4ZA 5AIJA 3RKKA 4XWTA 4AD9A 5A23A 2Y8AA 2BMIA 3T9MA 2P1EA 2BIBA 3IEKA 2Y87A 4TYTA 1WUPA 4UA4A 1X8HA 4AWYB 4HL1A 5HIPA 3DHAA 5FQAA 5ACQA 3SFPA 3ZNBA 1DXKA 2NXAA 4YSLA 3I11A 2QDSA 1VGNA 4RL0A 3F9OA 3KNSA 2Q9UA 5EVBA 4CHLA 2WHGA 1X8GA 4Z5YA 5EH9A 4AV7A 1KO3A 2GMNA 1HLKA 3JXPA 5FQBA 2OHJA 5AXRA 3DH8A 3PY5A 2YCBA 1YCHA 5HISA 4TZBA 5ACUA 5EHTA 3R2UA 5HH4A 5ACXA 2BFZA 3ZQ4A 2WYLA 4FEKA 1XTOA 2OHIA 1DD6A 5ACWA 4TYFA 4Z5ZA 1JT1A 5FQCA 5LMCA 2QJSA 5AXOA 5DPXA 2ZNBA 4O98A 2FHXA 3IOFA 4JO0A 5ACRA 1JJTA 5AHRA 5LM6A 2Q42A 5ACVA 4GYUA 2NYPA 2HB9A 4P62A 4UWRB 2WRSA 2VW8A 1JJEA 4DILA 4ZEJA 1KO2A 4FR7A 3X30A 3VQZA 5EWAA 1KR3A 5A5ZA 4GYQA 5ACPA 5IQKA 1BC2A 4NQ5A 4C1GA 4UWOB 2BFZB 4BP0A 2WYMA 3SPUA 1ZTCA 2CG2A 4V0HA 4UWSB 2BGAA 2QDTA 2ZZIA 3MD7A 4EXSA 2GKLA 3RPCA 2M5CA 4C1HA 2H6AA 5B1UA 3PY6A 5KIKA 4D1UA 4PDXA 3DHCA 3FAIA 5A87A 2P18A 3RKJA 5A0TA 4NQ6A 5LS3A 1YCGA 2ZO4A 5EVDA 5EVKA 2QEDA 1ZKPA 3SW3A 5LE1A 3BK2A 5LCFA 1BMCA 4UAMA 4LE6A 5LLDA 2AZ4A 3BC2A 5EV8A 2CBNA 4B87A 2BG8A 1DDKA 3TP9A 3AJ3A 3IOGA 4PVOA 4EFZA 4RM5A 1WW1A 5K4MA 2GCUA 5LSCA 1BVTA 3I15A 2M5DA 5ACSA 3SD9A 5KILA 5AYAA 2GFJA 2BFLA 3I13A 3X2XA 2FU9A 1VMEA 4J5HA 2AIOA 3WXCA 3A4YA 5A0VA 2GFKA 5B3RA 3KNRA 1P9EA 4EYLA 1A8TA 3LVZA 4EY2A 5EV6A 2I7XA 2FU6A 4RAWA 2BG2A 3X2YA 4HKYA 4EYBA 2BG8B 4RBSA 2YNUA 1A7TA 3PG4A 4XUKA 5B15A 1QH5A 4ZO3A 2Y8BA 3IE1A 2YNVA 3BV6A 4C1FA 2NZEA 2FHXB 4WD6A 4C1DA 2XR1A 5HIOA 2DOOA 3IELA 4DIKA 3G1PA 3SBLA 4XWWA 3KL7A 5K4NA 3ADRA 2XF4A 3FCZA 2P97A 2DKFA 4TZFA 4TZEA 2BG6A 2Q0JA 5HIQA 4NQ2A 4Z7RA 5K4KA 4Z6XA 1WUOA 4PVTA 5EW0A 5LCHA 2OHHA 3AF6A 4RL2A 5AJLA 3DHBA 5LCAA 3P2UA 4UWPB 2CG3A 2YZ3A 3SRXA 2Q0IA 4TZ9A 2I7TA 3VPEA 4KEQA 3AF5A 3ZWFA 3QH8A 4D1WA 1MQOA 4Z67A 4NURA 4HL2A 3IEMA 2FU8A 2A7MA 2NZFA 4F6HA 4GCWA 1QH3A 4D1TA 2YNWA 4J5FA 2CFUA 1X8IA 3X2ZA 3IE0A 3S0ZA 2FU7A 1XM8A 3Q6VA 4RAMA 1ZNBA 4FSBA 2BTNA 3T3OA 5HH6A 4ZO2A 1YCFA 4BZ3A 4C1CA 2BC2A 4C09A 2WYMC 4AX0B 2E7YA 3IDZA 4C1EA 2R2DA 3IE2A 3I14A 1Y44A 2UYXA 3ESHA 1E5DA 2BFKA 2YNTA 1L9YA 4Z60A 2YNTB 2CFZA 1SMLA 4AX1B 1K07A 5AEBA 2YNVB 3H3EA 5AHOA 4AXHA 4KEPA 4EXYA 4UBQA 3I0VA 3L6NA 1VJNA 4D02A 2I7VA 5HH5A 2FK6A 1WRAA 4YSBA 5ACTA 4D1VA 4H0DA 2FM6A 3BK1A 4AWZA 4EYFA 2QINA 4NQ4A 4YSKA 3T3NA 4ZNBA 4F6ZA 5K0WA 2BR6A
chains in the Genus database with same CATH topology
2BG7A 4U4LA 3ZR9A 2ZWRA 1M2XA 2P4ZA 3RKKA 4XWTA 4AD9A 2Y8AA 2BMIA 3T9MA 2P1EA 2BIBA 3IEKA 2Y87A 4TYTA 1WUPA 4UA4A 1X8HA 4AWYB 4HL1A 5HIPA 3DHAA 5FQAA 5ACQA 3SFPA 3ZNBA 1DXKA 2NXAA 4YSLA 3I11A 2QDSA 1VGNA 4RL0A 3F9OA 3KNSA 2Q9UA 5EVBA 4CHLA 2WHGA 1X8GA 4Z5YA 5EH9A 1KO3A 2GMNA 1HLKA 3JXPA 5FQBA 2OHJA 5AXRA 3DH8A 3PY5A 2YCBA 1YCHA 5HISA 4TZBA 5ACUA 5EHTA 3R2UA 5HH4A 5ACXA 2BFZA 3ZQ4A 2WYLA 4FEKA 1XTOA 2OHIA 1DD6A 5ACWA 4TYFA 4Z5ZA 1JT1A 5FQCA 5LMCA 2QJSA 5AXOA 5DPXA 2ZNBA 4O98A 2FHXA 3IOFA 4JO0A 5ACRA 1JJTA 5AHRA 5LM6A 2Q42A 5ACVA 4GYUA 2NYPA 2HB9A 4P62A 4UWRB 2WRSA 2VW8A 1JJEA 4DILA 4ZEJA 1KO2A 4FR7A 3X30A 3VQZA 5EWAA 1KR3A 5A5ZA 4GYQA 5ACPA 5IQKA 1BC2A 4NQ5A 4C1GA 4UWOB 2BFZB 4BP0A 2WYMA 3SPUA 1ZTCA 4V0HA 4UWSB 2BGAA 2QDTA 2ZZIA 3MD7A 4EXSA 2GKLA 3RPCA 2M5CA 4C1HA 2H6AA 5B1UA 3PY6A 5KIKA 4D1UA 3DHCA 3FAIA 5A87A 2P18A 3RKJA 5A0TA 4NQ6A 5LS3A 1YCGA 2ZO4A 5EVDA 5EVKA 2QEDA 1ZKPA 3SW3A 5LE1A 3BK2A 5LCFA 1BMCA 4UAMA 4LE6A 5LLDA 2AZ4A 3BC2A 5EV8A 2CBNA 4B87A 2BG8A 1DDKA 3TP9A 3AJ3A 3IOGA 4PVOA 4EFZA 4RM5A 1WW1A 5K4MA 2GCUA 5LSCA 1BVTA 3I15A 2M5DA 5ACSA 3SD9A 5KILA 5AYAA 2GFJA 2BFLA 3I13A 3X2XA 2FU9A 1VMEA 4J5HA 2AIOA 3WXCA 3A4YA 5A0VA 2GFKA 5B3RA 3KNRA 1P9EA 4EYLA 1A8TA 3LVZA 4EY2A 5EV6A 2I7XA 2FU6A 4RAWA 2BG2A 3X2YA 4HKYA 4EYBA 2BG8B 4RBSA 2YNUA 1A7TA 3PG4A 4XUKA 5B15A 1QH5A 4ZO3A 2Y8BA 3IE1A 2YNVA 3BV6A 4C1FA 2NZEA 2FHXB 4WD6A 4C1DA 2XR1A 5HIOA 2DOOA 3IELA 4DIKA 3G1PA 3SBLA 4XWWA 3KL7A 5K4NA 3ADRA 2XF4A 3FCZA 2P97A 2DKFA 4TZFA 4TZEA 2BG6A 2Q0JA 5HIQA 4NQ2A 4Z7RA 5K4KA 4Z6XA 1WUOA 4PVTA 5EW0A 5LCHA 2OHHA 3AF6A 4RL2A 3DHBA 5LCAA 3P2UA 4UWPB 2YZ3A 3SRXA 2Q0IA 4TZ9A 2I7TA 3VPEA 4KEQA 3AF5A 3ZWFA 3QH8A 4D1WA 1MQOA 4Z67A 4HL2A 3IEMA 2FU8A 2A7MA 2NZFA 4F6HA 4GCWA 1QH3A 4D1TA 2YNWA 4J5FA 1X8IA 3X2ZA 3IE0A 3S0ZA 2FU7A 1XM8A 3Q6VA 4RAMA 1ZNBA 4FSBA 2BTNA 3T3OA 5HH6A 4ZO2A 1YCFA 4BZ3A 4C1CA 2BC2A 4C09A 2WYMC 4AX0B 2E7YA 3IDZA 4C1EA 2R2DA 3IE2A 3I14A 1Y44A 2UYXA 3ESHA 1E5DA 2BFKA 2YNTA 1L9YA 4Z60A 2YNTB 1SMLA 4AX1B 1K07A 5AEBA 2YNVB 3H3EA 5AHOA 4KEPA 4EXYA 4UBQA 3I0VA 3L6NA 1VJNA 4D02A 2I7VA 5HH5A 2FK6A 1WRAA 4YSBA 5ACTA 4D1VA 4H0DA 2FM6A 3BK1A 4AWZA 4EYFA 2QINA 4NQ4A 4YSKA 3T3NA 4ZNBA 4F6ZA 5K0WA 2BR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG7 A;  4U4L A;  3ZR9 A;  2ZWR A;  1M2X A;  2P4Z A;  3RKK A;  4XWT A;  4AD9 A;  2Y8A A;  2BMI A;  3T9M A;  2P1E A;  2BIB A;  3IEK A;  2Y87 A;  4TYT A;  1WUP A;  4UA4 A;  1X8H A;  4AWY B;  4HL1 A;  5HIP A;  3DHA A;  5FQA A;  5ACQ A;  3SFP A;  3ZNB A;  1DXK A;  2NXA A;  4YSL A;  3I11 A;  2QDS A;  1VGN A;  4RL0 A;  3F9O A;  3KNS A;  2Q9U A;  5EVB A;  4CHL A;  2WHG A;  1X8G A;  4Z5Y A;  5EH9 A;  1KO3 A;  2GMN A;  1HLK A;  3JXP A;  5FQB A;  2OHJ A;  5AXR A;  3DH8 A;  3PY5 A;  2YCB A;  1YCH A;  5HIS A;  4TZB A;  5ACU A;  5EHT A;  3R2U A;  5HH4 A;  5ACX A;  2BFZ A;  3ZQ4 A;  2WYL A;  4FEK A;  1XTO A;  2OHI A;  1DD6 A;  5ACW A;  4TYF A;  4Z5Z A;  1JT1 A;  5FQC A;  5LMC A;  2QJS A;  5AXO A;  5DPX A;  2ZNB A;  4O98 A;  2FHX A;  3IOF A;  4JO0 A;  5ACR A;  1JJT A;  5AHR A;  5LM6 A;  2Q42 A;  5ACV A;  4GYU A;  2NYP A;  2HB9 A;  4P62 A;  4UWR B;  2WRS A;  2VW8 A;  1JJE A;  4DIL A;  4ZEJ A;  1KO2 A;  4FR7 A;  3X30 A;  3VQZ A;  5EWA A;  1KR3 A;  5A5Z A;  4GYQ A;  5ACP A;  5IQK A;  1BC2 A;  4NQ5 A;  4C1G A;  4UWO B;  2BFZ B;  4BP0 A;  2WYM A;  3SPU A;  1ZTC A;  4V0H A;  4UWS B;  2BGA A;  2QDT A;  2ZZI A;  3MD7 A;  4EXS A;  2GKL A;  3RPC A;  2M5C A;  4C1H A;  2H6A A;  5B1U A;  3PY6 A;  5KIK A;  4D1U A;  3DHC A;  3FAI A;  5A87 A;  2P18 A;  3RKJ A;  5A0T A;  4NQ6 A;  5LS3 A;  1YCG A;  2ZO4 A;  5EVD A;  5EVK A;  2QED A;  1ZKP A;  3SW3 A;  5LE1 A;  3BK2 A;  5LCF A;  1BMC A;  4UAM A;  4LE6 A;  5LLD A;  2AZ4 A;  3BC2 A;  5EV8 A;  2CBN A;  4B87 A;  2BG8 A;  1DDK A;  3TP9 A;  3AJ3 A;  3IOG A;  4PVO A;  4EFZ A;  4RM5 A;  1WW1 A;  5K4M A;  2GCU A;  5LSC A;  1BVT A;  3I15 A;  2M5D A;  5ACS A;  3SD9 A;  5KIL A;  5AYA A;  2GFJ A;  2BFL A;  3I13 A;  3X2X A;  2FU9 A;  1VME A;  4J5H A;  2AIO A;  3WXC A;  3A4Y A;  5A0V A;  2GFK A;  5B3R A;  3KNR A;  1P9E A;  4EYL A;  1A8T A;  3LVZ A;  4EY2 A;  5EV6 A;  2I7X A;  2FU6 A;  4RAW A;  2BG2 A;  3X2Y A;  4HKY A;  4EYB A;  2BG8 B;  4RBS A;  2YNU A;  1A7T A;  3PG4 A;  4XUK A;  5B15 A;  1QH5 A;  4ZO3 A;  2Y8B A;  3IE1 A;  2YNV A;  3BV6 A;  4C1F A;  2NZE A;  2FHX B;  4WD6 A;  4C1D A;  2XR1 A;  5HIO A;  2DOO A;  3IEL A;  4DIK A;  3G1P A;  3SBL A;  4XWW A;  3KL7 A;  5K4N A;  3ADR A;  2XF4 A;  3FCZ A;  2P97 A;  2DKF A;  4TZF A;  4TZE A;  2BG6 A;  2Q0J A;  5HIQ A;  4NQ2 A;  4Z7R A;  5K4K A;  4Z6X A;  1WUO A;  4PVT A;  5EW0 A;  5LCH A;  2OHH A;  3AF6 A;  4RL2 A;  3DHB A;  5LCA A;  3P2U A;  4UWP B;  2YZ3 A;  3SRX A;  2Q0I A;  4TZ9 A;  2I7T A;  3VPE A;  4KEQ A;  3AF5 A;  3ZWF A;  3QH8 A;  4D1W A;  1MQO A;  4Z67 A;  4HL2 A;  3IEM A;  2FU8 A;  2A7M A;  2NZF A;  4F6H A;  4GCW A;  1QH3 A;  4D1T A;  2YNW A;  4J5F A;  1X8I A;  3X2Z A;  3IE0 A;  3S0Z A;  2FU7 A;  1XM8 A;  3Q6V A;  4RAM A;  1ZNB A;  4FSB A;  2BTN A;  3T3O A;  5HH6 A;  4ZO2 A;  1YCF A;  4BZ3 A;  4C1C A;  2BC2 A;  4C09 A;  2WYM C;  4AX0 B;  2E7Y A;  3IDZ A;  4C1E A;  2R2D A;  3IE2 A;  3I14 A;  1Y44 A;  2UYX A;  3ESH A;  1E5D A;  2BFK A;  2YNT A;  1L9Y A;  4Z60 A;  2YNT B;  1SML A;  4AX1 B;  1K07 A;  5AEB A;  2YNV B;  3H3E A;  5AHO A;  4KEP A;  4EXY A;  4UBQ A;  3I0V A;  3L6N A;  1VJN A;  4D02 A;  2I7V A;  5HH5 A;  2FK6 A;  1WRA A;  4YSB A;  5ACT A;  4D1V A;  4H0D A;  2FM6 A;  3BK1 A;  4AWZ A;  4EYF A;  2QIN A;  4NQ4 A;  4YSK A;  3T3N A;  4ZNB A;  4F6Z A;  5K0W A;  2BR6 A; 
#chains in the Genus database with same CATH topology
 2BG7 A;  4U4L A;  3ZR9 A;  2YHE A;  2ZWR A;  1M2X A;  2P4Z A;  5AIJ A;  3RKK A;  4XWT A;  4AD9 A;  5A23 A;  2Y8A A;  2BMI A;  3T9M A;  2P1E A;  2BIB A;  3IEK A;  2Y87 A;  4TYT A;  1WUP A;  4UA4 A;  1X8H A;  4AWY B;  4HL1 A;  5HIP A;  3DHA A;  5FQA A;  5ACQ A;  3SFP A;  3ZNB A;  1DXK A;  2NXA A;  4YSL A;  3I11 A;  2QDS A;  1VGN A;  4RL0 A;  3F9O A;  3KNS A;  2Q9U A;  5EVB A;  4CHL A;  2WHG A;  1X8G A;  4Z5Y A;  5EH9 A;  4AV7 A;  1KO3 A;  2GMN A;  1HLK A;  3JXP A;  5FQB A;  2OHJ A;  5AXR A;  3DH8 A;  3PY5 A;  2YCB A;  1YCH A;  5HIS A;  4TZB A;  5ACU A;  5EHT A;  3R2U A;  5HH4 A;  5ACX A;  2BFZ A;  3ZQ4 A;  2WYL A;  4FEK A;  1XTO A;  2OHI A;  1DD6 A;  5ACW A;  4TYF A;  4Z5Z A;  1JT1 A;  5FQC A;  5LMC A;  2QJS A;  5AXO A;  5DPX A;  2ZNB A;  4O98 A;  2FHX A;  3IOF A;  4JO0 A;  5ACR A;  1JJT A;  5AHR A;  5LM6 A;  2Q42 A;  5ACV A;  4GYU A;  2NYP A;  2HB9 A;  4P62 A;  4UWR B;  2WRS A;  2VW8 A;  1JJE A;  4DIL A;  4ZEJ A;  1KO2 A;  4FR7 A;  3X30 A;  3VQZ A;  5EWA A;  1KR3 A;  5A5Z A;  4GYQ A;  5ACP A;  5IQK A;  1BC2 A;  4NQ5 A;  4C1G A;  4UWO B;  2BFZ B;  4BP0 A;  2WYM A;  3SPU A;  1ZTC A;  2CG2 A;  4V0H A;  4UWS B;  2BGA A;  2QDT A;  2ZZI A;  3MD7 A;  4EXS A;  2GKL A;  3RPC A;  2M5C A;  4C1H A;  2H6A A;  5B1U A;  3PY6 A;  5KIK A;  4D1U A;  4PDX A;  3DHC A;  3FAI A;  5A87 A;  2P18 A;  3RKJ A;  5A0T A;  4NQ6 A;  5LS3 A;  1YCG A;  2ZO4 A;  5EVD A;  5EVK A;  2QED A;  1ZKP A;  3SW3 A;  5LE1 A;  3BK2 A;  5LCF A;  1BMC A;  4UAM A;  4LE6 A;  5LLD A;  2AZ4 A;  3BC2 A;  5EV8 A;  2CBN A;  4B87 A;  2BG8 A;  1DDK A;  3TP9 A;  3AJ3 A;  3IOG A;  4PVO A;  4EFZ A;  4RM5 A;  1WW1 A;  5K4M A;  2GCU A;  5LSC A;  1BVT A;  3I15 A;  2M5D A;  5ACS A;  3SD9 A;  5KIL A;  5AYA A;  2GFJ A;  2BFL A;  3I13 A;  3X2X A;  2FU9 A;  1VME A;  4J5H A;  2AIO A;  3WXC A;  3A4Y A;  5A0V A;  2GFK A;  5B3R A;  3KNR A;  1P9E A;  4EYL A;  1A8T A;  3LVZ A;  4EY2 A;  5EV6 A;  2I7X A;  2FU6 A;  4RAW A;  2BG2 A;  3X2Y A;  4HKY A;  4EYB A;  2BG8 B;  4RBS A;  2YNU A;  1A7T A;  3PG4 A;  4XUK A;  5B15 A;  1QH5 A;  4ZO3 A;  2Y8B A;  3IE1 A;  2YNV A;  3BV6 A;  4C1F A;  2NZE A;  2FHX B;  4WD6 A;  4C1D A;  2XR1 A;  5HIO A;  2DOO A;  3IEL A;  4DIK A;  3G1P A;  3SBL A;  4XWW A;  3KL7 A;  5K4N A;  3ADR A;  2XF4 A;  3FCZ A;  2P97 A;  2DKF A;  4TZF A;  4TZE A;  2BG6 A;  2Q0J A;  5HIQ A;  4NQ2 A;  4Z7R A;  5K4K A;  4Z6X A;  1WUO A;  4PVT A;  5EW0 A;  5LCH A;  2OHH A;  3AF6 A;  4RL2 A;  5AJL A;  3DHB A;  5LCA A;  3P2U A;  4UWP B;  2CG3 A;  2YZ3 A;  3SRX A;  2Q0I A;  4TZ9 A;  2I7T A;  3VPE A;  4KEQ A;  3AF5 A;  3ZWF A;  3QH8 A;  4D1W A;  1MQO A;  4Z67 A;  4NUR A;  4HL2 A;  3IEM A;  2FU8 A;  2A7M A;  2NZF A;  4F6H A;  4GCW A;  1QH3 A;  4D1T A;  2YNW A;  4J5F A;  2CFU A;  1X8I A;  3X2Z A;  3IE0 A;  3S0Z A;  2FU7 A;  1XM8 A;  3Q6V A;  4RAM A;  1ZNB A;  4FSB A;  2BTN A;  3T3O A;  5HH6 A;  4ZO2 A;  1YCF A;  4BZ3 A;  4C1C A;  2BC2 A;  4C09 A;  2WYM C;  4AX0 B;  2E7Y A;  3IDZ A;  4C1E A;  2R2D A;  3IE2 A;  3I14 A;  1Y44 A;  2UYX A;  3ESH A;  1E5D A;  2BFK A;  2YNT A;  1L9Y A;  4Z60 A;  2YNT B;  2CFZ A;  1SML A;  4AX1 B;  1K07 A;  5AEB A;  2YNV B;  3H3E A;  5AHO A;  4AXH A;  4KEP A;  4EXY A;  4UBQ A;  3I0V A;  3L6N A;  1VJN A;  4D02 A;  2I7V A;  5HH5 A;  2FK6 A;  1WRA A;  4YSB A;  5ACT A;  4D1V A;  4H0D A;  2FM6 A;  3BK1 A;  4AWZ A;  4EYF A;  2QIN A;  4NQ4 A;  4YSK A;  3T3N A;  4ZNB A;  4F6Z A;  5K0W A;  2BR6 A; 
#chains in the Genus database with same CATH homology
 2BG7 A;  4U4L A;  3ZR9 A;  2ZWR A;  1M2X A;  2P4Z A;  3RKK A;  4XWT A;  4AD9 A;  2Y8A A;  2BMI A;  3T9M A;  2P1E A;  2BIB A;  3IEK A;  2Y87 A;  4TYT A;  1WUP A;  4UA4 A;  1X8H A;  4AWY B;  4HL1 A;  5HIP A;  3DHA A;  5FQA A;  5ACQ A;  3SFP A;  3ZNB A;  1DXK A;  2NXA A;  4YSL A;  3I11 A;  2QDS A;  1VGN A;  4RL0 A;  3F9O A;  3KNS A;  2Q9U A;  5EVB A;  4CHL A;  2WHG A;  1X8G A;  4Z5Y A;  5EH9 A;  1KO3 A;  2GMN A;  1HLK A;  3JXP A;  5FQB A;  2OHJ A;  5AXR A;  3DH8 A;  3PY5 A;  2YCB A;  1YCH A;  5HIS A;  4TZB A;  5ACU A;  5EHT A;  3R2U A;  5HH4 A;  5ACX A;  2BFZ A;  3ZQ4 A;  2WYL A;  4FEK A;  1XTO A;  2OHI A;  1DD6 A;  5ACW A;  4TYF A;  4Z5Z A;  1JT1 A;  5FQC A;  5LMC A;  2QJS A;  5AXO A;  5DPX A;  2ZNB A;  4O98 A;  2FHX A;  3IOF A;  4JO0 A;  5ACR A;  1JJT A;  5AHR A;  5LM6 A;  2Q42 A;  5ACV A;  4GYU A;  2NYP A;  2HB9 A;  4P62 A;  4UWR B;  2WRS A;  2VW8 A;  1JJE A;  4DIL A;  4ZEJ A;  1KO2 A;  4FR7 A;  3X30 A;  3VQZ A;  5EWA A;  1KR3 A;  5A5Z A;  4GYQ A;  5ACP A;  5IQK A;  1BC2 A;  4NQ5 A;  4C1G A;  4UWO B;  2BFZ B;  4BP0 A;  2WYM A;  3SPU A;  1ZTC A;  4V0H A;  4UWS B;  2BGA A;  2QDT A;  2ZZI A;  3MD7 A;  4EXS A;  2GKL A;  3RPC A;  2M5C A;  4C1H A;  2H6A A;  5B1U A;  3PY6 A;  5KIK A;  4D1U A;  3DHC A;  3FAI A;  5A87 A;  2P18 A;  3RKJ A;  5A0T A;  4NQ6 A;  5LS3 A;  1YCG A;  2ZO4 A;  5EVD A;  5EVK A;  2QED A;  1ZKP A;  3SW3 A;  5LE1 A;  3BK2 A;  5LCF A;  1BMC A;  4UAM A;  4LE6 A;  5LLD A;  2AZ4 A;  3BC2 A;  5EV8 A;  2CBN A;  4B87 A;  2BG8 A;  1DDK A;  3TP9 A;  3AJ3 A;  3IOG A;  4PVO A;  4EFZ A;  4RM5 A;  1WW1 A;  5K4M A;  2GCU A;  5LSC A;  1BVT A;  3I15 A;  2M5D A;  5ACS A;  3SD9 A;  5KIL A;  5AYA A;  2GFJ A;  2BFL A;  3I13 A;  3X2X A;  2FU9 A;  1VME A;  4J5H A;  2AIO A;  3WXC A;  3A4Y A;  5A0V A;  2GFK A;  5B3R A;  3KNR A;  1P9E A;  4EYL A;  1A8T A;  3LVZ A;  4EY2 A;  5EV6 A;  2I7X A;  2FU6 A;  4RAW A;  2BG2 A;  3X2Y A;  4HKY A;  4EYB A;  2BG8 B;  4RBS A;  2YNU A;  1A7T A;  3PG4 A;  4XUK A;  5B15 A;  1QH5 A;  4ZO3 A;  2Y8B A;  3IE1 A;  2YNV A;  3BV6 A;  4C1F A;  2NZE A;  2FHX B;  4WD6 A;  4C1D A;  2XR1 A;  5HIO A;  2DOO A;  3IEL A;  4DIK A;  3G1P A;  3SBL A;  4XWW A;  3KL7 A;  5K4N A;  3ADR A;  2XF4 A;  3FCZ A;  2P97 A;  2DKF A;  4TZF A;  4TZE A;  2BG6 A;  2Q0J A;  5HIQ A;  4NQ2 A;  4Z7R A;  5K4K A;  4Z6X A;  1WUO A;  4PVT A;  5EW0 A;  5LCH A;  2OHH A;  3AF6 A;  4RL2 A;  3DHB A;  5LCA A;  3P2U A;  4UWP B;  2YZ3 A;  3SRX A;  2Q0I A;  4TZ9 A;  2I7T A;  3VPE A;  4KEQ A;  3AF5 A;  3ZWF A;  3QH8 A;  4D1W A;  1MQO A;  4Z67 A;  4HL2 A;  3IEM A;  2FU8 A;  2A7M A;  2NZF A;  4F6H A;  4GCW A;  1QH3 A;  4D1T A;  2YNW A;  4J5F A;  1X8I A;  3X2Z A;  3IE0 A;  3S0Z A;  2FU7 A;  1XM8 A;  3Q6V A;  4RAM A;  1ZNB A;  4FSB A;  2BTN A;  3T3O A;  5HH6 A;  4ZO2 A;  1YCF A;  4BZ3 A;  4C1C A;  2BC2 A;  4C09 A;  2WYM C;  4AX0 B;  2E7Y A;  3IDZ A;  4C1E A;  2R2D A;  3IE2 A;  3I14 A;  1Y44 A;  2UYX A;  3ESH A;  1E5D A;  2BFK A;  2YNT A;  1L9Y A;  4Z60 A;  2YNT B;  1SML A;  4AX1 B;  1K07 A;  5AEB A;  2YNV B;  3H3E A;  5AHO A;  4KEP A;  4EXY A;  4UBQ A;  3I0V A;  3L6N A;  1VJN A;  4D02 A;  2I7V A;  5HH5 A;  2FK6 A;  1WRA A;  4YSB A;  5ACT A;  4D1V A;  4H0D A;  2FM6 A;  3BK1 A;  4AWZ A;  4EYF A;  2QIN A;  4NQ4 A;  4YSK A;  3T3N A;  4ZNB A;  4F6Z A;  5K0W A;  2BR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...