4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
4EXSA 3RPCA 2UYXA 5B1UA 4U4LA 4EY2A 4AD9A 5AXRA 5A87A 2AZ4A 2Q0IA 4D1VA 4PVOA 2FU6A 1QH5A 3IELA 1A7TA 3VQZA 5A5ZA 3S0ZA 1P9EA 3SFPA 4KEQA 5HH4A 1DDKA 5B15A 5AEBA 5K0WA 2GFJA 4ZNBA 3TP9A 5A0VA 1XTOA 5ACUA 5K4NA 5HIOA 5HISA 2ZWRA 5ACPA 5A0TA 2Q0JA 3BV6A 3H3EA 3WXCA 5AXOA 3IOGA 3BK1A 2BFZB 2NZEA 4TZEA 5B3RA 4D1UA 3AF6A 2WHGA 2A7MA 5K4MA 3AJ3A 4BZ3A 3X2XA 4KEPA 3I14A 3P2UA 4EYLA 2DOOA 2H6AA 1XM8A 5LSCA 2Y8AA 3BC2A 4BP0A 5LCFA 1BVTA 2M5CA 5LE1A 4LE6A 4UWOB 3IOFA 3PY6A 4HL2A 4PVTA 4RAWA 5EVDA 3ZR9A 4V0HA 4XWTA 3T3OA 3A4YA 3ZNBA 3ZWFA 1MQOA 1A8TA 3SPUA 2WYMC 3FAIA 2QJSA 3F9OA 2BC2A 3IE1A 2ZO4A 4DILA 1VJNA 5LCHA 4EYFA 2Q42A 3DHCA 2BTNA 3T3NA 2OHHA 4B87A 2P1EA 1VGNA 3IE2A 5AHOA 1L9YA 2HB9A 2GMNA 5KILA 2I7TA 4C1HA 5AYAA 4NQ6A 4HKYA 2YNTA 3RKJA 3PY5A 3QH8A 2YNTB 1JJTA 4EXYA 1X8GA 3SW3A 5EV8A 3R2UA 5FQBA 4XWWA 4CHLA 2FM6A 5DPXA 4Z67A 4RL0A 2FU7A 3SD9A 4TYFA 4H0DA 5LS3A 5LM6A 4JO0A 2P18A 2CBNA 3DH8A 4ZO2A 2OHJA 4Z5ZA 5IQKA 5EVKA 1K07A 2BFLA 4J5HA 3L6NA 5EHTA 5FQAA 3VPEA 4DIKA 1BC2A 3I0VA 3IEMA 2BFKA 4J5FA 2I7XA 2YNVA 4C09A 2FU8A 1WUOA 2YNVB 4YSLA 3KNSA 3IE0A 2Y87A 3X30A 2DKFA 5ACWA 1Y44A 4GYUA 3X2YA 4ZEJA 1KO2A 4UWPB 4TZFA 5HH6A 2QINA 4UAMA 3Q6VA 5LMCA 3ADRA 4C1EA 2Y8BA 5EWAA 4Z6XA 2NZFA 2Q9UA 1X8HA 5EH9A 4GYQA 1WUPA 3DHBA 1M2XA 5LLDA 3IDZA 3MD7A 5ACTA 4D1WA 2OHIA 4GCWA 2GCUA 4TZBA 2BG7A 3SRXA 4UWRB 4TYTA 2XF4A 2BGAA 4NQ4A 4RBSA 4EYBA 3I15A 3DHAA 5ACSA 3ZQ4A 4AWZA 2NYPA 4FEKA 4HL1A 5HH5A 3I13A 2YNUA 4Z5YA 1VMEA 4D1TA 5EVBA 2BR6A 2ZZIA 1WW1A 3FCZA 3JXPA 2AIOA 5HIQA 2YCBA 2M5DA 1ZKPA 2P4ZA 2QEDA 2WRSA 4RAMA 2WYMA 3KL7A 1YCHA 3BK2A 1DD6A 2WYLA 2XR1A 4FSBA 4F6HA 3X2ZA 2R2DA 3G1PA 5AHRA 2QDTA 1E5DA 3T9MA 4UWSB 4Z7RA 4AWYB 5K4KA 4ZO3A 2BIBA 4O98A 4EFZA 5FQCA 4C1CA 1X8IA 2YNWA 4FR7A 2VW8A 2BFZA 3AF5A 2YZ3A 1ZTCA 1HLKA 5ACQA 1SMLA 4NQ5A 2BG2A 2FU9A 4C1GA 3PG4A 4P62A 2BG6A 4UBQA 4Z60A 1DXKA 5EW0A 2GKLA 4C1FA 1BMCA 4RL2A 4YSBA 2FHXA 2E7YA 1QH3A 2GFKA 4D02A 5HIPA 2BMIA 4XUKA 1WRAA 1KO3A 5ACXA 4YSKA 5ACVA 4C1DA 3SBLA 4UA4A 1JJEA 3I11A 4TZ9A 4RM5A 4WD6A 4F6ZA 2P97A 5EV6A 3IEKA 2NXAA 3RKKA 2I7VA 2FHXB 1YCFA 2ZNBA 4AX1B 1JT1A 4AX0B 2QDSA 3ESHA 3KNRA 3LVZA 1ZNBA 2BG8B 1YCGA 4NQ2A 5LCAA 5KIKA 2FK6A 1KR3A 2BG8A 5ACRA
chains in the Genus database with same CATH superfamily
4EXSA 3RPCA 2UYXA 5B1UA 4U4LA 4EY2A 4AD9A 5AXRA 2CFUA 5A87A 2AZ4A 2Q0IA 4D1VA 4PVOA 2FU6A 1QH5A 3IELA 1A7TA 3VQZA 5A5ZA 3S0ZA 1P9EA 3SFPA 4KEQA 5HH4A 1DDKA 5B15A 5AEBA 5K0WA 2GFJA 4ZNBA 3TP9A 5A0VA 1XTOA 5ACUA 5K4NA 5HIOA 5HISA 2ZWRA 5ACPA 5A0TA 2Q0JA 3BV6A 3H3EA 3WXCA 5AXOA 3IOGA 3BK1A 2BFZB 2NZEA 4TZEA 5B3RA 4D1UA 3AF6A 2WHGA 2A7MA 5K4MA 3AJ3A 2CFZA 3X2XA 4BZ3A 4KEPA 3I14A 3P2UA 4EYLA 2DOOA 2H6AA 1XM8A 5LSCA 2Y8AA 3BC2A 4BP0A 5LCFA 1BVTA 2M5CA 5LE1A 4LE6A 4UWOB 3IOFA 3PY6A 4HL2A 4PVTA 4RAWA 5EVDA 3ZR9A 4V0HA 4XWTA 3T3OA 3A4YA 3ZNBA 3ZWFA 1MQOA 1A8TA 3SPUA 2WYMC 2CG2A 3FAIA 2QJSA 3F9OA 2BC2A 3IE1A 2ZO4A 4DILA 1VJNA 5LCHA 4EYFA 2Q42A 3DHCA 2BTNA 3T3NA 2OHHA 4B87A 2P1EA 1VGNA 3IE2A 5AHOA 1L9YA 2HB9A 2GMNA 5AJLA 5KILA 2I7TA 4C1HA 5AYAA 4NQ6A 4HKYA 2YNTA 3RKJA 3PY5A 3QH8A 2YNTB 1JJTA 4EXYA 1X8GA 3SW3A 5EV8A 3R2UA 5FQBA 4XWWA 4CHLA 2FM6A 5DPXA 4Z67A 4RL0A 2FU7A 3SD9A 4AXHA 4TYFA 4H0DA 5LS3A 5LM6A 4JO0A 2P18A 2CBNA 3DH8A 4ZO2A 2OHJA 4Z5ZA 5IQKA 5EVKA 1K07A 2BFLA 4J5HA 3L6NA 5EHTA 5FQAA 3VPEA 4DIKA 1BC2A 3I0VA 3IEMA 2BFKA 4J5FA 2I7XA 2YNVA 4C09A 2FU8A 1WUOA 2YNVB 4YSLA 3KNSA 3IE0A 2Y87A 3X30A 2DKFA 5ACWA 1Y44A 4GYUA 3X2YA 4ZEJA 1KO2A 4UWPB 4TZFA 5HH6A 2QINA 4UAMA 3Q6VA 5LMCA 4AV7A 3ADRA 4C1EA 2Y8BA 5EWAA 4Z6XA 2NZFA 2Q9UA 1X8HA 5EH9A 4GYQA 1WUPA 5A23A 3DHBA 1M2XA 5LLDA 3IDZA 3MD7A 2CG3A 5ACTA 4D1WA 2OHIA 4GCWA 2GCUA 4TZBA 2BG7A 3SRXA 4UWRB 4TYTA 2XF4A 2BGAA 4NQ4A 4RBSA 4EYBA 3I15A 3DHAA 5ACSA 3ZQ4A 4AWZA 2NYPA 4FEKA 4HL1A 5HH5A 3I13A 2YNUA 4Z5YA 1VMEA 4D1TA 5EVBA 2BR6A 2ZZIA 1WW1A 3FCZA 4NURA 3JXPA 2AIOA 5HIQA 2YCBA 2M5DA 1ZKPA 2P4ZA 2QEDA 2WRSA 4RAMA 2WYMA 3KL7A 1YCHA 3BK2A 1DD6A 2WYLA 2XR1A 4FSBA 4F6HA 3X2ZA 2R2DA 3G1PA 5AHRA 2QDTA 1E5DA 3T9MA 4UWSB 4Z7RA 4AWYB 5K4KA 4ZO3A 4PDXA 2BIBA 4O98A 4EFZA 5FQCA 4C1CA 1X8IA 2YNWA 4FR7A 2VW8A 2BFZA 3AF5A 5AIJA 2YZ3A 1ZTCA 1HLKA 5ACQA 1SMLA 4NQ5A 2BG2A 2FU9A 4C1GA 3PG4A 4P62A 2BG6A 4UBQA 4Z60A 1DXKA 5EW0A 2GKLA 4C1FA 1BMCA 4RL2A 4YSBA 2FHXA 2E7YA 1QH3A 2GFKA 4D02A 5HIPA 2BMIA 4XUKA 1WRAA 1KO3A 5ACXA 4YSKA 5ACVA 4C1DA 3SBLA 4UA4A 1JJEA 3I11A 4TZ9A 4RM5A 4WD6A 4F6ZA 2P97A 5EV6A 3IEKA 2NXAA 3RKKA 2I7VA 2FHXB 1YCFA 2ZNBA 4AX1B 2YHEA 1JT1A 4AX0B 2QDSA 3ESHA 3KNRA 3LVZA 1ZNBA 2BG8B 1YCGA 4NQ2A 5LCAA 5KIKA 2FK6A 1KR3A 2BG8A 5ACRA
chains in the Genus database with same CATH topology
4EXSA 3RPCA 2UYXA 5B1UA 4U4LA 4EY2A 4AD9A 5AXRA 5A87A 2AZ4A 2Q0IA 4D1VA 4PVOA 2FU6A 1QH5A 3IELA 1A7TA 3VQZA 5A5ZA 3S0ZA 1P9EA 3SFPA 4KEQA 5HH4A 1DDKA 5B15A 5AEBA 5K0WA 2GFJA 4ZNBA 3TP9A 5A0VA 1XTOA 5ACUA 5K4NA 5HIOA 5HISA 2ZWRA 5ACPA 5A0TA 2Q0JA 3BV6A 3H3EA 3WXCA 5AXOA 3IOGA 3BK1A 2BFZB 2NZEA 4TZEA 5B3RA 4D1UA 3AF6A 2WHGA 2A7MA 5K4MA 3AJ3A 4BZ3A 3X2XA 4KEPA 3I14A 3P2UA 4EYLA 2DOOA 2H6AA 1XM8A 5LSCA 2Y8AA 3BC2A 4BP0A 5LCFA 1BVTA 2M5CA 5LE1A 4LE6A 4UWOB 3IOFA 3PY6A 4HL2A 4PVTA 4RAWA 5EVDA 3ZR9A 4V0HA 4XWTA 3T3OA 3A4YA 3ZNBA 3ZWFA 1MQOA 1A8TA 3SPUA 2WYMC 3FAIA 2QJSA 3F9OA 2BC2A 3IE1A 2ZO4A 4DILA 1VJNA 5LCHA 4EYFA 2Q42A 3DHCA 2BTNA 3T3NA 2OHHA 4B87A 2P1EA 1VGNA 3IE2A 5AHOA 1L9YA 2HB9A 2GMNA 5KILA 2I7TA 4C1HA 5AYAA 4NQ6A 4HKYA 2YNTA 3RKJA 3PY5A 3QH8A 2YNTB 1JJTA 4EXYA 1X8GA 3SW3A 5EV8A 3R2UA 5FQBA 4XWWA 4CHLA 2FM6A 5DPXA 4Z67A 4RL0A 2FU7A 3SD9A 4TYFA 4H0DA 5LS3A 5LM6A 4JO0A 2P18A 2CBNA 3DH8A 4ZO2A 2OHJA 4Z5ZA 5IQKA 5EVKA 1K07A 2BFLA 4J5HA 3L6NA 5EHTA 5FQAA 3VPEA 4DIKA 1BC2A 3I0VA 3IEMA 2BFKA 4J5FA 2I7XA 2YNVA 4C09A 2FU8A 1WUOA 2YNVB 4YSLA 3KNSA 3IE0A 2Y87A 3X30A 2DKFA 5ACWA 1Y44A 4GYUA 3X2YA 4ZEJA 1KO2A 4UWPB 4TZFA 5HH6A 2QINA 4UAMA 3Q6VA 5LMCA 3ADRA 4C1EA 2Y8BA 5EWAA 4Z6XA 2NZFA 2Q9UA 1X8HA 5EH9A 4GYQA 1WUPA 3DHBA 1M2XA 5LLDA 3IDZA 3MD7A 5ACTA 4D1WA 2OHIA 4GCWA 2GCUA 4TZBA 2BG7A 3SRXA 4UWRB 4TYTA 2XF4A 2BGAA 4NQ4A 4RBSA 4EYBA 3I15A 3DHAA 5ACSA 3ZQ4A 4AWZA 2NYPA 4FEKA 4HL1A 5HH5A 3I13A 2YNUA 4Z5YA 1VMEA 4D1TA 5EVBA 2BR6A 2ZZIA 1WW1A 3FCZA 3JXPA 2AIOA 5HIQA 2YCBA 2M5DA 1ZKPA 2P4ZA 2QEDA 2WRSA 4RAMA 2WYMA 3KL7A 1YCHA 3BK2A 1DD6A 2WYLA 2XR1A 4FSBA 4F6HA 3X2ZA 2R2DA 3G1PA 5AHRA 2QDTA 1E5DA 3T9MA 4UWSB 4Z7RA 4AWYB 5K4KA 4ZO3A 2BIBA 4O98A 4EFZA 5FQCA 4C1CA 1X8IA 2YNWA 4FR7A 2VW8A 2BFZA 3AF5A 2YZ3A 1ZTCA 1HLKA 5ACQA 1SMLA 4NQ5A 2BG2A 2FU9A 4C1GA 3PG4A 4P62A 2BG6A 4UBQA 4Z60A 1DXKA 5EW0A 2GKLA 4C1FA 1BMCA 4RL2A 4YSBA 2FHXA 2E7YA 1QH3A 2GFKA 4D02A 5HIPA 2BMIA 4XUKA 1WRAA 1KO3A 5ACXA 4YSKA 5ACVA 4C1DA 3SBLA 4UA4A 1JJEA 3I11A 4TZ9A 4RM5A 4WD6A 4F6ZA 2P97A 5EV6A 3IEKA 2NXAA 3RKKA 2I7VA 2FHXB 1YCFA 2ZNBA 4AX1B 1JT1A 4AX0B 2QDSA 3ESHA 3KNRA 3LVZA 1ZNBA 2BG8B 1YCGA 4NQ2A 5LCAA 5KIKA 2FK6A 1KR3A 2BG8A 5ACRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXS A;  3RPC A;  2UYX A;  5B1U A;  4U4L A;  4EY2 A;  4AD9 A;  5AXR A;  5A87 A;  2AZ4 A;  2Q0I A;  4D1V A;  4PVO A;  2FU6 A;  1QH5 A;  3IEL A;  1A7T A;  3VQZ A;  5A5Z A;  3S0Z A;  1P9E A;  3SFP A;  4KEQ A;  5HH4 A;  1DDK A;  5B15 A;  5AEB A;  5K0W A;  2GFJ A;  4ZNB A;  3TP9 A;  5A0V A;  1XTO A;  5ACU A;  5K4N A;  5HIO A;  5HIS A;  2ZWR A;  5ACP A;  5A0T A;  2Q0J A;  3BV6 A;  3H3E A;  3WXC A;  5AXO A;  3IOG A;  3BK1 A;  2BFZ B;  2NZE A;  4TZE A;  5B3R A;  4D1U A;  3AF6 A;  2WHG A;  2A7M A;  5K4M A;  3AJ3 A;  4BZ3 A;  3X2X A;  4KEP A;  3I14 A;  3P2U A;  4EYL A;  2DOO A;  2H6A A;  1XM8 A;  5LSC A;  2Y8A A;  3BC2 A;  4BP0 A;  5LCF A;  1BVT A;  2M5C A;  5LE1 A;  4LE6 A;  4UWO B;  3IOF A;  3PY6 A;  4HL2 A;  4PVT A;  4RAW A;  5EVD A;  3ZR9 A;  4V0H A;  4XWT A;  3T3O A;  3A4Y A;  3ZNB A;  3ZWF A;  1MQO A;  1A8T A;  3SPU A;  2WYM C;  3FAI A;  2QJS A;  3F9O A;  2BC2 A;  3IE1 A;  2ZO4 A;  4DIL A;  1VJN A;  5LCH A;  4EYF A;  2Q42 A;  3DHC A;  2BTN A;  3T3N A;  2OHH A;  4B87 A;  2P1E A;  1VGN A;  3IE2 A;  5AHO A;  1L9Y A;  2HB9 A;  2GMN A;  5KIL A;  2I7T A;  4C1H A;  5AYA A;  4NQ6 A;  4HKY A;  2YNT A;  3RKJ A;  3PY5 A;  3QH8 A;  2YNT B;  1JJT A;  4EXY A;  1X8G A;  3SW3 A;  5EV8 A;  3R2U A;  5FQB A;  4XWW A;  4CHL A;  2FM6 A;  5DPX A;  4Z67 A;  4RL0 A;  2FU7 A;  3SD9 A;  4TYF A;  4H0D A;  5LS3 A;  5LM6 A;  4JO0 A;  2P18 A;  2CBN A;  3DH8 A;  4ZO2 A;  2OHJ A;  4Z5Z A;  5IQK A;  5EVK A;  1K07 A;  2BFL A;  4J5H A;  3L6N A;  5EHT A;  5FQA A;  3VPE A;  4DIK A;  1BC2 A;  3I0V A;  3IEM A;  2BFK A;  4J5F A;  2I7X A;  2YNV A;  4C09 A;  2FU8 A;  1WUO A;  2YNV B;  4YSL A;  3KNS A;  3IE0 A;  2Y87 A;  3X30 A;  2DKF A;  5ACW A;  1Y44 A;  4GYU A;  3X2Y A;  4ZEJ A;  1KO2 A;  4UWP B;  4TZF A;  5HH6 A;  2QIN A;  4UAM A;  3Q6V A;  5LMC A;  3ADR A;  4C1E A;  2Y8B A;  5EWA A;  4Z6X A;  2NZF A;  2Q9U A;  1X8H A;  5EH9 A;  4GYQ A;  1WUP A;  3DHB A;  1M2X A;  5LLD A;  3IDZ A;  3MD7 A;  5ACT A;  4D1W A;  2OHI A;  4GCW A;  2GCU A;  4TZB A;  2BG7 A;  3SRX A;  4UWR B;  4TYT A;  2XF4 A;  2BGA A;  4NQ4 A;  4RBS A;  4EYB A;  3I15 A;  3DHA A;  5ACS A;  3ZQ4 A;  4AWZ A;  2NYP A;  4FEK A;  4HL1 A;  5HH5 A;  3I13 A;  2YNU A;  4Z5Y A;  1VME A;  4D1T A;  5EVB A;  2BR6 A;  2ZZI A;  1WW1 A;  3FCZ A;  3JXP A;  2AIO A;  5HIQ A;  2YCB A;  2M5D A;  1ZKP A;  2P4Z A;  2QED A;  2WRS A;  4RAM A;  2WYM A;  3KL7 A;  1YCH A;  3BK2 A;  1DD6 A;  2WYL A;  2XR1 A;  4FSB A;  4F6H A;  3X2Z A;  2R2D A;  3G1P A;  5AHR A;  2QDT A;  1E5D A;  3T9M A;  4UWS B;  4Z7R A;  4AWY B;  5K4K A;  4ZO3 A;  2BIB A;  4O98 A;  4EFZ A;  5FQC A;  4C1C A;  1X8I A;  2YNW A;  4FR7 A;  2VW8 A;  2BFZ A;  3AF5 A;  2YZ3 A;  1ZTC A;  1HLK A;  5ACQ A;  1SML A;  4NQ5 A;  2BG2 A;  2FU9 A;  4C1G A;  3PG4 A;  4P62 A;  2BG6 A;  4UBQ A;  4Z60 A;  1DXK A;  5EW0 A;  2GKL A;  4C1F A;  1BMC A;  4RL2 A;  4YSB A;  2FHX A;  2E7Y A;  1QH3 A;  2GFK A;  4D02 A;  5HIP A;  2BMI A;  4XUK A;  1WRA A;  1KO3 A;  5ACX A;  4YSK A;  5ACV A;  4C1D A;  3SBL A;  4UA4 A;  1JJE A;  3I11 A;  4TZ9 A;  4RM5 A;  4WD6 A;  4F6Z A;  2P97 A;  5EV6 A;  3IEK A;  2NXA A;  3RKK A;  2I7V A;  2FHX B;  1YCF A;  2ZNB A;  4AX1 B;  1JT1 A;  4AX0 B;  2QDS A;  3ESH A;  3KNR A;  3LVZ A;  1ZNB A;  2BG8 B;  1YCG A;  4NQ2 A;  5LCA A;  5KIK A;  2FK6 A;  1KR3 A;  2BG8 A;  5ACR A; 
#chains in the Genus database with same CATH topology
 4EXS A;  3RPC A;  2UYX A;  5B1U A;  4U4L A;  4EY2 A;  4AD9 A;  5AXR A;  2CFU A;  5A87 A;  2AZ4 A;  2Q0I A;  4D1V A;  4PVO A;  2FU6 A;  1QH5 A;  3IEL A;  1A7T A;  3VQZ A;  5A5Z A;  3S0Z A;  1P9E A;  3SFP A;  4KEQ A;  5HH4 A;  1DDK A;  5B15 A;  5AEB A;  5K0W A;  2GFJ A;  4ZNB A;  3TP9 A;  5A0V A;  1XTO A;  5ACU A;  5K4N A;  5HIO A;  5HIS A;  2ZWR A;  5ACP A;  5A0T A;  2Q0J A;  3BV6 A;  3H3E A;  3WXC A;  5AXO A;  3IOG A;  3BK1 A;  2BFZ B;  2NZE A;  4TZE A;  5B3R A;  4D1U A;  3AF6 A;  2WHG A;  2A7M A;  5K4M A;  3AJ3 A;  2CFZ A;  3X2X A;  4BZ3 A;  4KEP A;  3I14 A;  3P2U A;  4EYL A;  2DOO A;  2H6A A;  1XM8 A;  5LSC A;  2Y8A A;  3BC2 A;  4BP0 A;  5LCF A;  1BVT A;  2M5C A;  5LE1 A;  4LE6 A;  4UWO B;  3IOF A;  3PY6 A;  4HL2 A;  4PVT A;  4RAW A;  5EVD A;  3ZR9 A;  4V0H A;  4XWT A;  3T3O A;  3A4Y A;  3ZNB A;  3ZWF A;  1MQO A;  1A8T A;  3SPU A;  2WYM C;  2CG2 A;  3FAI A;  2QJS A;  3F9O A;  2BC2 A;  3IE1 A;  2ZO4 A;  4DIL A;  1VJN A;  5LCH A;  4EYF A;  2Q42 A;  3DHC A;  2BTN A;  3T3N A;  2OHH A;  4B87 A;  2P1E A;  1VGN A;  3IE2 A;  5AHO A;  1L9Y A;  2HB9 A;  2GMN A;  5AJL A;  5KIL A;  2I7T A;  4C1H A;  5AYA A;  4NQ6 A;  4HKY A;  2YNT A;  3RKJ A;  3PY5 A;  3QH8 A;  2YNT B;  1JJT A;  4EXY A;  1X8G A;  3SW3 A;  5EV8 A;  3R2U A;  5FQB A;  4XWW A;  4CHL A;  2FM6 A;  5DPX A;  4Z67 A;  4RL0 A;  2FU7 A;  3SD9 A;  4AXH A;  4TYF A;  4H0D A;  5LS3 A;  5LM6 A;  4JO0 A;  2P18 A;  2CBN A;  3DH8 A;  4ZO2 A;  2OHJ A;  4Z5Z A;  5IQK A;  5EVK A;  1K07 A;  2BFL A;  4J5H A;  3L6N A;  5EHT A;  5FQA A;  3VPE A;  4DIK A;  1BC2 A;  3I0V A;  3IEM A;  2BFK A;  4J5F A;  2I7X A;  2YNV A;  4C09 A;  2FU8 A;  1WUO A;  2YNV B;  4YSL A;  3KNS A;  3IE0 A;  2Y87 A;  3X30 A;  2DKF A;  5ACW A;  1Y44 A;  4GYU A;  3X2Y A;  4ZEJ A;  1KO2 A;  4UWP B;  4TZF A;  5HH6 A;  2QIN A;  4UAM A;  3Q6V A;  5LMC A;  4AV7 A;  3ADR A;  4C1E A;  2Y8B A;  5EWA A;  4Z6X A;  2NZF A;  2Q9U A;  1X8H A;  5EH9 A;  4GYQ A;  1WUP A;  5A23 A;  3DHB A;  1M2X A;  5LLD A;  3IDZ A;  3MD7 A;  2CG3 A;  5ACT A;  4D1W A;  2OHI A;  4GCW A;  2GCU A;  4TZB A;  2BG7 A;  3SRX A;  4UWR B;  4TYT A;  2XF4 A;  2BGA A;  4NQ4 A;  4RBS A;  4EYB A;  3I15 A;  3DHA A;  5ACS A;  3ZQ4 A;  4AWZ A;  2NYP A;  4FEK A;  4HL1 A;  5HH5 A;  3I13 A;  2YNU A;  4Z5Y A;  1VME A;  4D1T A;  5EVB A;  2BR6 A;  2ZZI A;  1WW1 A;  3FCZ A;  4NUR A;  3JXP A;  2AIO A;  5HIQ A;  2YCB A;  2M5D A;  1ZKP A;  2P4Z A;  2QED A;  2WRS A;  4RAM A;  2WYM A;  3KL7 A;  1YCH A;  3BK2 A;  1DD6 A;  2WYL A;  2XR1 A;  4FSB A;  4F6H A;  3X2Z A;  2R2D A;  3G1P A;  5AHR A;  2QDT A;  1E5D A;  3T9M A;  4UWS B;  4Z7R A;  4AWY B;  5K4K A;  4ZO3 A;  4PDX A;  2BIB A;  4O98 A;  4EFZ A;  5FQC A;  4C1C A;  1X8I A;  2YNW A;  4FR7 A;  2VW8 A;  2BFZ A;  3AF5 A;  5AIJ A;  2YZ3 A;  1ZTC A;  1HLK A;  5ACQ A;  1SML A;  4NQ5 A;  2BG2 A;  2FU9 A;  4C1G A;  3PG4 A;  4P62 A;  2BG6 A;  4UBQ A;  4Z60 A;  1DXK A;  5EW0 A;  2GKL A;  4C1F A;  1BMC A;  4RL2 A;  4YSB A;  2FHX A;  2E7Y A;  1QH3 A;  2GFK A;  4D02 A;  5HIP A;  2BMI A;  4XUK A;  1WRA A;  1KO3 A;  5ACX A;  4YSK A;  5ACV A;  4C1D A;  3SBL A;  4UA4 A;  1JJE A;  3I11 A;  4TZ9 A;  4RM5 A;  4WD6 A;  4F6Z A;  2P97 A;  5EV6 A;  3IEK A;  2NXA A;  3RKK A;  2I7V A;  2FHX B;  1YCF A;  2ZNB A;  4AX1 B;  2YHE A;  1JT1 A;  4AX0 B;  2QDS A;  3ESH A;  3KNR A;  3LVZ A;  1ZNB A;  2BG8 B;  1YCG A;  4NQ2 A;  5LCA A;  5KIK A;  2FK6 A;  1KR3 A;  2BG8 A;  5ACR A; 
#chains in the Genus database with same CATH homology
 4EXS A;  3RPC A;  2UYX A;  5B1U A;  4U4L A;  4EY2 A;  4AD9 A;  5AXR A;  5A87 A;  2AZ4 A;  2Q0I A;  4D1V A;  4PVO A;  2FU6 A;  1QH5 A;  3IEL A;  1A7T A;  3VQZ A;  5A5Z A;  3S0Z A;  1P9E A;  3SFP A;  4KEQ A;  5HH4 A;  1DDK A;  5B15 A;  5AEB A;  5K0W A;  2GFJ A;  4ZNB A;  3TP9 A;  5A0V A;  1XTO A;  5ACU A;  5K4N A;  5HIO A;  5HIS A;  2ZWR A;  5ACP A;  5A0T A;  2Q0J A;  3BV6 A;  3H3E A;  3WXC A;  5AXO A;  3IOG A;  3BK1 A;  2BFZ B;  2NZE A;  4TZE A;  5B3R A;  4D1U A;  3AF6 A;  2WHG A;  2A7M A;  5K4M A;  3AJ3 A;  4BZ3 A;  3X2X A;  4KEP A;  3I14 A;  3P2U A;  4EYL A;  2DOO A;  2H6A A;  1XM8 A;  5LSC A;  2Y8A A;  3BC2 A;  4BP0 A;  5LCF A;  1BVT A;  2M5C A;  5LE1 A;  4LE6 A;  4UWO B;  3IOF A;  3PY6 A;  4HL2 A;  4PVT A;  4RAW A;  5EVD A;  3ZR9 A;  4V0H A;  4XWT A;  3T3O A;  3A4Y A;  3ZNB A;  3ZWF A;  1MQO A;  1A8T A;  3SPU A;  2WYM C;  3FAI A;  2QJS A;  3F9O A;  2BC2 A;  3IE1 A;  2ZO4 A;  4DIL A;  1VJN A;  5LCH A;  4EYF A;  2Q42 A;  3DHC A;  2BTN A;  3T3N A;  2OHH A;  4B87 A;  2P1E A;  1VGN A;  3IE2 A;  5AHO A;  1L9Y A;  2HB9 A;  2GMN A;  5KIL A;  2I7T A;  4C1H A;  5AYA A;  4NQ6 A;  4HKY A;  2YNT A;  3RKJ A;  3PY5 A;  3QH8 A;  2YNT B;  1JJT A;  4EXY A;  1X8G A;  3SW3 A;  5EV8 A;  3R2U A;  5FQB A;  4XWW A;  4CHL A;  2FM6 A;  5DPX A;  4Z67 A;  4RL0 A;  2FU7 A;  3SD9 A;  4TYF A;  4H0D A;  5LS3 A;  5LM6 A;  4JO0 A;  2P18 A;  2CBN A;  3DH8 A;  4ZO2 A;  2OHJ A;  4Z5Z A;  5IQK A;  5EVK A;  1K07 A;  2BFL A;  4J5H A;  3L6N A;  5EHT A;  5FQA A;  3VPE A;  4DIK A;  1BC2 A;  3I0V A;  3IEM A;  2BFK A;  4J5F A;  2I7X A;  2YNV A;  4C09 A;  2FU8 A;  1WUO A;  2YNV B;  4YSL A;  3KNS A;  3IE0 A;  2Y87 A;  3X30 A;  2DKF A;  5ACW A;  1Y44 A;  4GYU A;  3X2Y A;  4ZEJ A;  1KO2 A;  4UWP B;  4TZF A;  5HH6 A;  2QIN A;  4UAM A;  3Q6V A;  5LMC A;  3ADR A;  4C1E A;  2Y8B A;  5EWA A;  4Z6X A;  2NZF A;  2Q9U A;  1X8H A;  5EH9 A;  4GYQ A;  1WUP A;  3DHB A;  1M2X A;  5LLD A;  3IDZ A;  3MD7 A;  5ACT A;  4D1W A;  2OHI A;  4GCW A;  2GCU A;  4TZB A;  2BG7 A;  3SRX A;  4UWR B;  4TYT A;  2XF4 A;  2BGA A;  4NQ4 A;  4RBS A;  4EYB A;  3I15 A;  3DHA A;  5ACS A;  3ZQ4 A;  4AWZ A;  2NYP A;  4FEK A;  4HL1 A;  5HH5 A;  3I13 A;  2YNU A;  4Z5Y A;  1VME A;  4D1T A;  5EVB A;  2BR6 A;  2ZZI A;  1WW1 A;  3FCZ A;  3JXP A;  2AIO A;  5HIQ A;  2YCB A;  2M5D A;  1ZKP A;  2P4Z A;  2QED A;  2WRS A;  4RAM A;  2WYM A;  3KL7 A;  1YCH A;  3BK2 A;  1DD6 A;  2WYL A;  2XR1 A;  4FSB A;  4F6H A;  3X2Z A;  2R2D A;  3G1P A;  5AHR A;  2QDT A;  1E5D A;  3T9M A;  4UWS B;  4Z7R A;  4AWY B;  5K4K A;  4ZO3 A;  2BIB A;  4O98 A;  4EFZ A;  5FQC A;  4C1C A;  1X8I A;  2YNW A;  4FR7 A;  2VW8 A;  2BFZ A;  3AF5 A;  2YZ3 A;  1ZTC A;  1HLK A;  5ACQ A;  1SML A;  4NQ5 A;  2BG2 A;  2FU9 A;  4C1G A;  3PG4 A;  4P62 A;  2BG6 A;  4UBQ A;  4Z60 A;  1DXK A;  5EW0 A;  2GKL A;  4C1F A;  1BMC A;  4RL2 A;  4YSB A;  2FHX A;  2E7Y A;  1QH3 A;  2GFK A;  4D02 A;  5HIP A;  2BMI A;  4XUK A;  1WRA A;  1KO3 A;  5ACX A;  4YSK A;  5ACV A;  4C1D A;  3SBL A;  4UA4 A;  1JJE A;  3I11 A;  4TZ9 A;  4RM5 A;  4WD6 A;  4F6Z A;  2P97 A;  5EV6 A;  3IEK A;  2NXA A;  3RKK A;  2I7V A;  2FHX B;  1YCF A;  2ZNB A;  4AX1 B;  1JT1 A;  4AX0 B;  2QDS A;  3ESH A;  3KNR A;  3LVZ A;  1ZNB A;  2BG8 B;  1YCG A;  4NQ2 A;  5LCA A;  5KIK A;  2FK6 A;  1KR3 A;  2BG8 A;  5ACR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...