4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
2NYPA 1JT1A 2Q0JA 5EVBA 2XR1A 4C1DA 2UYXA 2P1EA 2I7VA 2BR6A 2YNTA 3ZQ4A 1DXKA 4RBSA 4FR7A 4YSKA 4C1CA 4F6HA 3RPCA 2QDSA 3IE0A 3PY6A 2FK6A 1X8GA 4PVTA 4ZO3A 1YCHA 3ADRA 4WD6A 3I0VA 4KEQA 3X2YA 5KILA 5EHTA 4EYBA 3KNSA 4EY2A 1JJTA 5ACSA 3F9OA 2GMNA 4B87A 3Q6VA 5B3RA 3TP9A 2BFLA 3VPEA 2XF4A 4TZBA 4ZNBA 4D1TA 4D1UA 3R2UA 4H0DA 5ACPA 5HH5A 5AXOA 5FQAA 2YNVA 5ACWA 3IOFA 2GKLA 4HL1A 5ACQA 1VGNA 1P9EA 1QH5A 3T3OA 4RM5A 1JJEA 5K4KA 3H3EA 4HKYA 4TYFA 2BIBA 3AF5A 3DHBA 3SRXA 3LVZA 3ESHA 2BG2A 5A5ZA 3P2UA 4DILA 1ZNBA 4TZFA 4KEPA 3BV6A 3T9MA 4XWTA 4J5HA 2BG8B 5ACRA 4AWYB 2R2DA 3BK2A 2NXAA 4TYTA 4C1HA 1KO3A 3I11A 3ZNBA 3BC2A 4GCWA 5EH9A 4Z5YA 4UWOB 3RKKA 5ACVA 5EV8A 4AD9A 4NQ5A 5IQKA 2QJSA 1ZKPA 2ZWRA 4RAWA 2FU8A 2BG7A 5EWAA 3WXCA 2OHJA 2DOOA 2I7XA 4HL2A 4V0HA 5DPXA 4XUKA 2GCUA 5HIPA 3X2ZA 3SW3A 5AEBA 5HH4A 5LS3A 2FU6A 4EYFA 3I15A 2Y87A 4GYQA 2GFJA 4P62A 3JXPA 3IDZA 4C09A 1VMEA 3FAIA 2OHHA 2H6AA 4XWWA 3RKJA 3PY5A 2E7YA 4EXSA 1KO2A 2M5DA 2BG6A 5LLDA 5B15A 2FHXA 4YSBA 4DIKA 1A7TA 2FHXB 1QH3A 4UA4A 2AIOA 3SPUA 4EFZA 2GFKA 2ZNBA 4LE6A 2BFZA 2ZZIA 4BP0A 2YCBA 4Z60A 1WW1A 5K0WA 1BVTA 5AXRA 1Y44A 2BFZB 4YSLA 4AX0B 3I13A 1SMLA 4PVOA 4EYLA 1XTOA 5A0VA 1E5DA 5AYAA 3AJ3A 3VQZA 1DD6A 4JO0A 2Q42A 1WRAA 2Y8AA 5EV6A 1WUOA 4CHLA 1A8TA 5HH6A 2M5CA 2YNWA 4O98A 2WYMC 4ZEJA 2BG8A 3IE2A 4TZEA 4AWZA 5AHRA 2QEDA 2FU9A 1X8HA 2NZFA 4UBQA 2P18A 3IE1A 4UWPB 3FCZA 3I14A 5A87A 3QH8A 1MQOA 3SBLA 4D02A 5ACUA 1M2XA 1L9YA 1YCFA 5KIKA 3MD7A 1BC2A 3IOGA 4RL0A 3X30A 4J5FA 4NQ6A 5FQBA 1X8IA 3BK1A 5LCHA 4UWSB 3ZWFA 3PG4A 5LCAA 1HLKA 1K07A 3DH8A 3AF6A 4C1FA 3IELA 4RL2A 5FQCA 3ZR9A 2BFKA 4UAMA 4F6ZA 3X2XA 4TZ9A 4ZO2A 4U4LA 2BC2A 2CBNA 5EVKA 4Z7RA 5EVDA 4FEKA 4Z6XA 4D1VA 4NQ4A 2YNTB 3T3NA 5LMCA 3L6NA 2FM6A 4EXYA 2YNUA 1ZTCA 2P97A 2WYLA 2I7TA 3DHCA 5ACTA 2WHGA 5LSCA 2FU7A 5LE1A 5HISA 4C1GA 1WUPA 2OHIA 3A4YA 3DHAA 5EW0A 3IEKA 3KNRA 2WYMA 2BGAA 3SD9A 1DDKA 1YCGA 3G1PA 4NQ2A 4Z5ZA 1KR3A 2BMIA 5LCFA 4D1WA 3IEMA 1XM8A 2VW8A 2DKFA 2P4ZA 5B1UA 5HIOA 4C1EA 4RAMA 5AHOA 2YNVB 4FSBA 5K4MA 2QINA 3SFPA 2WRSA 4UWRB 2QDTA 2Q9UA 5K4NA 4BZ3A 5LM6A 2ZO4A 2Q0IA 2AZ4A 2BTNA 2HB9A 3KL7A 2Y8BA 4AX1B 5HIQA 1VJNA 5ACXA 4GYUA 2A7MA 2NZEA 1BMCA 5A0TA 4Z67A 2YZ3A 3S0ZA
chains in the Genus database with same CATH superfamily
2NYPA 1JT1A 2Q0JA 5EVBA 2XR1A 4C1DA 2UYXA 2P1EA 2YHEA 2I7VA 2BR6A 2YNTA 3ZQ4A 1DXKA 4RBSA 4FR7A 5AJLA 4YSKA 4C1CA 4F6HA 3RPCA 2QDSA 3IE0A 3PY6A 2FK6A 1X8GA 4PVTA 4ZO3A 1YCHA 3ADRA 4WD6A 3I0VA 4KEQA 3X2YA 5KILA 5EHTA 4EYBA 3KNSA 4EY2A 1JJTA 5ACSA 3F9OA 2GMNA 4B87A 5AIJA 3Q6VA 5B3RA 3TP9A 2BFLA 3VPEA 2XF4A 4TZBA 4ZNBA 4D1TA 4D1UA 3R2UA 4H0DA 5ACPA 5HH5A 5AXOA 2CG3A 5FQAA 2YNVA 5ACWA 3IOFA 2GKLA 4HL1A 5ACQA 1VGNA 1P9EA 1QH5A 3T3OA 4RM5A 1JJEA 5K4KA 3H3EA 4HKYA 4TYFA 2BIBA 3AF5A 3DHBA 3SRXA 3LVZA 3ESHA 2BG2A 5A5ZA 3P2UA 4DILA 1ZNBA 4TZFA 4KEPA 3BV6A 3T9MA 4XWTA 4J5HA 2BG8B 5ACRA 4AWYB 2R2DA 3BK2A 2NXAA 4TYTA 4C1HA 1KO3A 3I11A 3ZNBA 3BC2A 4GCWA 5EH9A 4Z5YA 4UWOB 3RKKA 5ACVA 5EV8A 4AD9A 4NQ5A 5IQKA 2QJSA 1ZKPA 2ZWRA 4RAWA 2FU8A 2BG7A 5EWAA 2CFUA 3WXCA 2OHJA 2DOOA 2I7XA 4HL2A 4V0HA 5DPXA 4XUKA 2GCUA 5HIPA 3X2ZA 3SW3A 5AEBA 5HH4A 5LS3A 2FU6A 4EYFA 3I15A 2Y87A 4GYQA 2GFJA 4P62A 3JXPA 3IDZA 4C09A 1VMEA 3FAIA 2OHHA 2H6AA 4XWWA 3RKJA 3PY5A 2E7YA 4EXSA 1KO2A 2M5DA 2BG6A 5LLDA 5B15A 2FHXA 4YSBA 4DIKA 1A7TA 2FHXB 1QH3A 4UA4A 2AIOA 3SPUA 4EFZA 2GFKA 2ZNBA 4LE6A 2CFZA 2BFZA 2ZZIA 4BP0A 2YCBA 4Z60A 1WW1A 5K0WA 1BVTA 5AXRA 1Y44A 2BFZB 4YSLA 4AX0B 3I13A 1SMLA 4PVOA 4EYLA 1XTOA 5A0VA 1E5DA 5AYAA 3AJ3A 3VQZA 1DD6A 4JO0A 2Q42A 1WRAA 2Y8AA 5EV6A 1WUOA 4CHLA 1A8TA 5HH6A 2M5CA 2YNWA 4O98A 2WYMC 4ZEJA 2BG8A 3IE2A 4TZEA 4AWZA 5AHRA 2QEDA 2FU9A 1X8HA 2NZFA 4UBQA 2P18A 3IE1A 4UWPB 3FCZA 3I14A 5A87A 3QH8A 1MQOA 3SBLA 4D02A 5ACUA 1M2XA 1L9YA 1YCFA 5KIKA 3MD7A 1BC2A 3IOGA 4RL0A 3X30A 4J5FA 4NQ6A 5FQBA 1X8IA 3BK1A 5LCHA 4UWSB 3ZWFA 3PG4A 5LCAA 1HLKA 1K07A 3DH8A 3AF6A 4C1FA 3IELA 4RL2A 5FQCA 3ZR9A 2BFKA 4UAMA 4F6ZA 3X2XA 4TZ9A 4ZO2A 4U4LA 4NURA 2BC2A 2CBNA 5EVKA 4Z7RA 2CG2A 5EVDA 4FEKA 4Z6XA 4D1VA 4NQ4A 2YNTB 3T3NA 5LMCA 3L6NA 2FM6A 4EXYA 2YNUA 4PDXA 1ZTCA 2P97A 2WYLA 2I7TA 3DHCA 5ACTA 2WHGA 5LSCA 2FU7A 5LE1A 5HISA 4C1GA 1WUPA 2OHIA 3A4YA 3DHAA 5EW0A 3IEKA 3KNRA 2WYMA 2BGAA 3SD9A 1DDKA 1YCGA 3G1PA 4NQ2A 4Z5ZA 1KR3A 2BMIA 5LCFA 4D1WA 3IEMA 1XM8A 2VW8A 2DKFA 2P4ZA 5B1UA 5HIOA 4C1EA 4RAMA 5AHOA 2YNVB 4FSBA 5K4MA 2QINA 3SFPA 2WRSA 5A23A 4UWRB 2QDTA 2Q9UA 5K4NA 4BZ3A 5LM6A 4AXHA 2ZO4A 2Q0IA 2AZ4A 2BTNA 2HB9A 3KL7A 2Y8BA 4AX1B 5HIQA 4AV7A 1VJNA 5ACXA 4GYUA 2A7MA 2NZEA 1BMCA 5A0TA 4Z67A 2YZ3A 3S0ZA
chains in the Genus database with same CATH topology
2NYPA 1JT1A 2Q0JA 5EVBA 2XR1A 4C1DA 2UYXA 2P1EA 2I7VA 2BR6A 2YNTA 3ZQ4A 1DXKA 4RBSA 4FR7A 4YSKA 4C1CA 4F6HA 3RPCA 2QDSA 3IE0A 3PY6A 2FK6A 1X8GA 4PVTA 4ZO3A 1YCHA 3ADRA 4WD6A 3I0VA 4KEQA 3X2YA 5KILA 5EHTA 4EYBA 3KNSA 4EY2A 1JJTA 5ACSA 3F9OA 2GMNA 4B87A 3Q6VA 5B3RA 3TP9A 2BFLA 3VPEA 2XF4A 4TZBA 4ZNBA 4D1TA 4D1UA 3R2UA 4H0DA 5ACPA 5HH5A 5AXOA 5FQAA 2YNVA 5ACWA 3IOFA 2GKLA 4HL1A 5ACQA 1VGNA 1P9EA 1QH5A 3T3OA 4RM5A 1JJEA 5K4KA 3H3EA 4HKYA 4TYFA 2BIBA 3AF5A 3DHBA 3SRXA 3LVZA 3ESHA 2BG2A 5A5ZA 3P2UA 4DILA 1ZNBA 4TZFA 4KEPA 3BV6A 3T9MA 4XWTA 4J5HA 2BG8B 5ACRA 4AWYB 2R2DA 3BK2A 2NXAA 4TYTA 4C1HA 1KO3A 3I11A 3ZNBA 3BC2A 4GCWA 5EH9A 4Z5YA 4UWOB 3RKKA 5ACVA 5EV8A 4AD9A 4NQ5A 5IQKA 2QJSA 1ZKPA 2ZWRA 4RAWA 2FU8A 2BG7A 5EWAA 3WXCA 2OHJA 2DOOA 2I7XA 4HL2A 4V0HA 5DPXA 4XUKA 2GCUA 5HIPA 3X2ZA 3SW3A 5AEBA 5HH4A 5LS3A 2FU6A 4EYFA 3I15A 2Y87A 4GYQA 2GFJA 4P62A 3JXPA 3IDZA 4C09A 1VMEA 3FAIA 2OHHA 2H6AA 4XWWA 3RKJA 3PY5A 2E7YA 4EXSA 1KO2A 2M5DA 2BG6A 5LLDA 5B15A 2FHXA 4YSBA 4DIKA 1A7TA 2FHXB 1QH3A 4UA4A 2AIOA 3SPUA 4EFZA 2GFKA 2ZNBA 4LE6A 2BFZA 2ZZIA 4BP0A 2YCBA 4Z60A 1WW1A 5K0WA 1BVTA 5AXRA 1Y44A 2BFZB 4YSLA 4AX0B 3I13A 1SMLA 4PVOA 4EYLA 1XTOA 5A0VA 1E5DA 5AYAA 3AJ3A 3VQZA 1DD6A 4JO0A 2Q42A 1WRAA 2Y8AA 5EV6A 1WUOA 4CHLA 1A8TA 5HH6A 2M5CA 2YNWA 4O98A 2WYMC 4ZEJA 2BG8A 3IE2A 4TZEA 4AWZA 5AHRA 2QEDA 2FU9A 1X8HA 2NZFA 4UBQA 2P18A 3IE1A 4UWPB 3FCZA 3I14A 5A87A 3QH8A 1MQOA 3SBLA 4D02A 5ACUA 1M2XA 1L9YA 1YCFA 5KIKA 3MD7A 1BC2A 3IOGA 4RL0A 3X30A 4J5FA 4NQ6A 5FQBA 1X8IA 3BK1A 5LCHA 4UWSB 3ZWFA 3PG4A 5LCAA 1HLKA 1K07A 3DH8A 3AF6A 4C1FA 3IELA 4RL2A 5FQCA 3ZR9A 2BFKA 4UAMA 4F6ZA 3X2XA 4TZ9A 4ZO2A 4U4LA 2BC2A 2CBNA 5EVKA 4Z7RA 5EVDA 4FEKA 4Z6XA 4D1VA 4NQ4A 2YNTB 3T3NA 5LMCA 3L6NA 2FM6A 4EXYA 2YNUA 1ZTCA 2P97A 2WYLA 2I7TA 3DHCA 5ACTA 2WHGA 5LSCA 2FU7A 5LE1A 5HISA 4C1GA 1WUPA 2OHIA 3A4YA 3DHAA 5EW0A 3IEKA 3KNRA 2WYMA 2BGAA 3SD9A 1DDKA 1YCGA 3G1PA 4NQ2A 4Z5ZA 1KR3A 2BMIA 5LCFA 4D1WA 3IEMA 1XM8A 2VW8A 2DKFA 2P4ZA 5B1UA 5HIOA 4C1EA 4RAMA 5AHOA 2YNVB 4FSBA 5K4MA 2QINA 3SFPA 2WRSA 4UWRB 2QDTA 2Q9UA 5K4NA 4BZ3A 5LM6A 2ZO4A 2Q0IA 2AZ4A 2BTNA 2HB9A 3KL7A 2Y8BA 4AX1B 5HIQA 1VJNA 5ACXA 4GYUA 2A7MA 2NZEA 1BMCA 5A0TA 4Z67A 2YZ3A 3S0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYP A;  1JT1 A;  2Q0J A;  5EVB A;  2XR1 A;  4C1D A;  2UYX A;  2P1E A;  2I7V A;  2BR6 A;  2YNT A;  3ZQ4 A;  1DXK A;  4RBS A;  4FR7 A;  4YSK A;  4C1C A;  4F6H A;  3RPC A;  2QDS A;  3IE0 A;  3PY6 A;  2FK6 A;  1X8G A;  4PVT A;  4ZO3 A;  1YCH A;  3ADR A;  4WD6 A;  3I0V A;  4KEQ A;  3X2Y A;  5KIL A;  5EHT A;  4EYB A;  3KNS A;  4EY2 A;  1JJT A;  5ACS A;  3F9O A;  2GMN A;  4B87 A;  3Q6V A;  5B3R A;  3TP9 A;  2BFL A;  3VPE A;  2XF4 A;  4TZB A;  4ZNB A;  4D1T A;  4D1U A;  3R2U A;  4H0D A;  5ACP A;  5HH5 A;  5AXO A;  5FQA A;  2YNV A;  5ACW A;  3IOF A;  2GKL A;  4HL1 A;  5ACQ A;  1VGN A;  1P9E A;  1QH5 A;  3T3O A;  4RM5 A;  1JJE A;  5K4K A;  3H3E A;  4HKY A;  4TYF A;  2BIB A;  3AF5 A;  3DHB A;  3SRX A;  3LVZ A;  3ESH A;  2BG2 A;  5A5Z A;  3P2U A;  4DIL A;  1ZNB A;  4TZF A;  4KEP A;  3BV6 A;  3T9M A;  4XWT A;  4J5H A;  2BG8 B;  5ACR A;  4AWY B;  2R2D A;  3BK2 A;  2NXA A;  4TYT A;  4C1H A;  1KO3 A;  3I11 A;  3ZNB A;  3BC2 A;  4GCW A;  5EH9 A;  4Z5Y A;  4UWO B;  3RKK A;  5ACV A;  5EV8 A;  4AD9 A;  4NQ5 A;  5IQK A;  2QJS A;  1ZKP A;  2ZWR A;  4RAW A;  2FU8 A;  2BG7 A;  5EWA A;  3WXC A;  2OHJ A;  2DOO A;  2I7X A;  4HL2 A;  4V0H A;  5DPX A;  4XUK A;  2GCU A;  5HIP A;  3X2Z A;  3SW3 A;  5AEB A;  5HH4 A;  5LS3 A;  2FU6 A;  4EYF A;  3I15 A;  2Y87 A;  4GYQ A;  2GFJ A;  4P62 A;  3JXP A;  3IDZ A;  4C09 A;  1VME A;  3FAI A;  2OHH A;  2H6A A;  4XWW A;  3RKJ A;  3PY5 A;  2E7Y A;  4EXS A;  1KO2 A;  2M5D A;  2BG6 A;  5LLD A;  5B15 A;  2FHX A;  4YSB A;  4DIK A;  1A7T A;  2FHX B;  1QH3 A;  4UA4 A;  2AIO A;  3SPU A;  4EFZ A;  2GFK A;  2ZNB A;  4LE6 A;  2BFZ A;  2ZZI A;  4BP0 A;  2YCB A;  4Z60 A;  1WW1 A;  5K0W A;  1BVT A;  5AXR A;  1Y44 A;  2BFZ B;  4YSL A;  4AX0 B;  3I13 A;  1SML A;  4PVO A;  4EYL A;  1XTO A;  5A0V A;  1E5D A;  5AYA A;  3AJ3 A;  3VQZ A;  1DD6 A;  4JO0 A;  2Q42 A;  1WRA A;  2Y8A A;  5EV6 A;  1WUO A;  4CHL A;  1A8T A;  5HH6 A;  2M5C A;  2YNW A;  4O98 A;  2WYM C;  4ZEJ A;  2BG8 A;  3IE2 A;  4TZE A;  4AWZ A;  5AHR A;  2QED A;  2FU9 A;  1X8H A;  2NZF A;  4UBQ A;  2P18 A;  3IE1 A;  4UWP B;  3FCZ A;  3I14 A;  5A87 A;  3QH8 A;  1MQO A;  3SBL A;  4D02 A;  5ACU A;  1M2X A;  1L9Y A;  1YCF A;  5KIK A;  3MD7 A;  1BC2 A;  3IOG A;  4RL0 A;  3X30 A;  4J5F A;  4NQ6 A;  5FQB A;  1X8I A;  3BK1 A;  5LCH A;  4UWS B;  3ZWF A;  3PG4 A;  5LCA A;  1HLK A;  1K07 A;  3DH8 A;  3AF6 A;  4C1F A;  3IEL A;  4RL2 A;  5FQC A;  3ZR9 A;  2BFK A;  4UAM A;  4F6Z A;  3X2X A;  4TZ9 A;  4ZO2 A;  4U4L A;  2BC2 A;  2CBN A;  5EVK A;  4Z7R A;  5EVD A;  4FEK A;  4Z6X A;  4D1V A;  4NQ4 A;  2YNT B;  3T3N A;  5LMC A;  3L6N A;  2FM6 A;  4EXY A;  2YNU A;  1ZTC A;  2P97 A;  2WYL A;  2I7T A;  3DHC A;  5ACT A;  2WHG A;  5LSC A;  2FU7 A;  5LE1 A;  5HIS A;  4C1G A;  1WUP A;  2OHI A;  3A4Y A;  3DHA A;  5EW0 A;  3IEK A;  3KNR A;  2WYM A;  2BGA A;  3SD9 A;  1DDK A;  1YCG A;  3G1P A;  4NQ2 A;  4Z5Z A;  1KR3 A;  2BMI A;  5LCF A;  4D1W A;  3IEM A;  1XM8 A;  2VW8 A;  2DKF A;  2P4Z A;  5B1U A;  5HIO A;  4C1E A;  4RAM A;  5AHO A;  2YNV B;  4FSB A;  5K4M A;  2QIN A;  3SFP A;  2WRS A;  4UWR B;  2QDT A;  2Q9U A;  5K4N A;  4BZ3 A;  5LM6 A;  2ZO4 A;  2Q0I A;  2AZ4 A;  2BTN A;  2HB9 A;  3KL7 A;  2Y8B A;  4AX1 B;  5HIQ A;  1VJN A;  5ACX A;  4GYU A;  2A7M A;  2NZE A;  1BMC A;  5A0T A;  4Z67 A;  2YZ3 A;  3S0Z A; 
#chains in the Genus database with same CATH topology
 2NYP A;  1JT1 A;  2Q0J A;  5EVB A;  2XR1 A;  4C1D A;  2UYX A;  2P1E A;  2YHE A;  2I7V A;  2BR6 A;  2YNT A;  3ZQ4 A;  1DXK A;  4RBS A;  4FR7 A;  5AJL A;  4YSK A;  4C1C A;  4F6H A;  3RPC A;  2QDS A;  3IE0 A;  3PY6 A;  2FK6 A;  1X8G A;  4PVT A;  4ZO3 A;  1YCH A;  3ADR A;  4WD6 A;  3I0V A;  4KEQ A;  3X2Y A;  5KIL A;  5EHT A;  4EYB A;  3KNS A;  4EY2 A;  1JJT A;  5ACS A;  3F9O A;  2GMN A;  4B87 A;  5AIJ A;  3Q6V A;  5B3R A;  3TP9 A;  2BFL A;  3VPE A;  2XF4 A;  4TZB A;  4ZNB A;  4D1T A;  4D1U A;  3R2U A;  4H0D A;  5ACP A;  5HH5 A;  5AXO A;  2CG3 A;  5FQA A;  2YNV A;  5ACW A;  3IOF A;  2GKL A;  4HL1 A;  5ACQ A;  1VGN A;  1P9E A;  1QH5 A;  3T3O A;  4RM5 A;  1JJE A;  5K4K A;  3H3E A;  4HKY A;  4TYF A;  2BIB A;  3AF5 A;  3DHB A;  3SRX A;  3LVZ A;  3ESH A;  2BG2 A;  5A5Z A;  3P2U A;  4DIL A;  1ZNB A;  4TZF A;  4KEP A;  3BV6 A;  3T9M A;  4XWT A;  4J5H A;  2BG8 B;  5ACR A;  4AWY B;  2R2D A;  3BK2 A;  2NXA A;  4TYT A;  4C1H A;  1KO3 A;  3I11 A;  3ZNB A;  3BC2 A;  4GCW A;  5EH9 A;  4Z5Y A;  4UWO B;  3RKK A;  5ACV A;  5EV8 A;  4AD9 A;  4NQ5 A;  5IQK A;  2QJS A;  1ZKP A;  2ZWR A;  4RAW A;  2FU8 A;  2BG7 A;  5EWA A;  2CFU A;  3WXC A;  2OHJ A;  2DOO A;  2I7X A;  4HL2 A;  4V0H A;  5DPX A;  4XUK A;  2GCU A;  5HIP A;  3X2Z A;  3SW3 A;  5AEB A;  5HH4 A;  5LS3 A;  2FU6 A;  4EYF A;  3I15 A;  2Y87 A;  4GYQ A;  2GFJ A;  4P62 A;  3JXP A;  3IDZ A;  4C09 A;  1VME A;  3FAI A;  2OHH A;  2H6A A;  4XWW A;  3RKJ A;  3PY5 A;  2E7Y A;  4EXS A;  1KO2 A;  2M5D A;  2BG6 A;  5LLD A;  5B15 A;  2FHX A;  4YSB A;  4DIK A;  1A7T A;  2FHX B;  1QH3 A;  4UA4 A;  2AIO A;  3SPU A;  4EFZ A;  2GFK A;  2ZNB A;  4LE6 A;  2CFZ A;  2BFZ A;  2ZZI A;  4BP0 A;  2YCB A;  4Z60 A;  1WW1 A;  5K0W A;  1BVT A;  5AXR A;  1Y44 A;  2BFZ B;  4YSL A;  4AX0 B;  3I13 A;  1SML A;  4PVO A;  4EYL A;  1XTO A;  5A0V A;  1E5D A;  5AYA A;  3AJ3 A;  3VQZ A;  1DD6 A;  4JO0 A;  2Q42 A;  1WRA A;  2Y8A A;  5EV6 A;  1WUO A;  4CHL A;  1A8T A;  5HH6 A;  2M5C A;  2YNW A;  4O98 A;  2WYM C;  4ZEJ A;  2BG8 A;  3IE2 A;  4TZE A;  4AWZ A;  5AHR A;  2QED A;  2FU9 A;  1X8H A;  2NZF A;  4UBQ A;  2P18 A;  3IE1 A;  4UWP B;  3FCZ A;  3I14 A;  5A87 A;  3QH8 A;  1MQO A;  3SBL A;  4D02 A;  5ACU A;  1M2X A;  1L9Y A;  1YCF A;  5KIK A;  3MD7 A;  1BC2 A;  3IOG A;  4RL0 A;  3X30 A;  4J5F A;  4NQ6 A;  5FQB A;  1X8I A;  3BK1 A;  5LCH A;  4UWS B;  3ZWF A;  3PG4 A;  5LCA A;  1HLK A;  1K07 A;  3DH8 A;  3AF6 A;  4C1F A;  3IEL A;  4RL2 A;  5FQC A;  3ZR9 A;  2BFK A;  4UAM A;  4F6Z A;  3X2X A;  4TZ9 A;  4ZO2 A;  4U4L A;  4NUR A;  2BC2 A;  2CBN A;  5EVK A;  4Z7R A;  2CG2 A;  5EVD A;  4FEK A;  4Z6X A;  4D1V A;  4NQ4 A;  2YNT B;  3T3N A;  5LMC A;  3L6N A;  2FM6 A;  4EXY A;  2YNU A;  4PDX A;  1ZTC A;  2P97 A;  2WYL A;  2I7T A;  3DHC A;  5ACT A;  2WHG A;  5LSC A;  2FU7 A;  5LE1 A;  5HIS A;  4C1G A;  1WUP A;  2OHI A;  3A4Y A;  3DHA A;  5EW0 A;  3IEK A;  3KNR A;  2WYM A;  2BGA A;  3SD9 A;  1DDK A;  1YCG A;  3G1P A;  4NQ2 A;  4Z5Z A;  1KR3 A;  2BMI A;  5LCF A;  4D1W A;  3IEM A;  1XM8 A;  2VW8 A;  2DKF A;  2P4Z A;  5B1U A;  5HIO A;  4C1E A;  4RAM A;  5AHO A;  2YNV B;  4FSB A;  5K4M A;  2QIN A;  3SFP A;  2WRS A;  5A23 A;  4UWR B;  2QDT A;  2Q9U A;  5K4N A;  4BZ3 A;  5LM6 A;  4AXH A;  2ZO4 A;  2Q0I A;  2AZ4 A;  2BTN A;  2HB9 A;  3KL7 A;  2Y8B A;  4AX1 B;  5HIQ A;  4AV7 A;  1VJN A;  5ACX A;  4GYU A;  2A7M A;  2NZE A;  1BMC A;  5A0T A;  4Z67 A;  2YZ3 A;  3S0Z A; 
#chains in the Genus database with same CATH homology
 2NYP A;  1JT1 A;  2Q0J A;  5EVB A;  2XR1 A;  4C1D A;  2UYX A;  2P1E A;  2I7V A;  2BR6 A;  2YNT A;  3ZQ4 A;  1DXK A;  4RBS A;  4FR7 A;  4YSK A;  4C1C A;  4F6H A;  3RPC A;  2QDS A;  3IE0 A;  3PY6 A;  2FK6 A;  1X8G A;  4PVT A;  4ZO3 A;  1YCH A;  3ADR A;  4WD6 A;  3I0V A;  4KEQ A;  3X2Y A;  5KIL A;  5EHT A;  4EYB A;  3KNS A;  4EY2 A;  1JJT A;  5ACS A;  3F9O A;  2GMN A;  4B87 A;  3Q6V A;  5B3R A;  3TP9 A;  2BFL A;  3VPE A;  2XF4 A;  4TZB A;  4ZNB A;  4D1T A;  4D1U A;  3R2U A;  4H0D A;  5ACP A;  5HH5 A;  5AXO A;  5FQA A;  2YNV A;  5ACW A;  3IOF A;  2GKL A;  4HL1 A;  5ACQ A;  1VGN A;  1P9E A;  1QH5 A;  3T3O A;  4RM5 A;  1JJE A;  5K4K A;  3H3E A;  4HKY A;  4TYF A;  2BIB A;  3AF5 A;  3DHB A;  3SRX A;  3LVZ A;  3ESH A;  2BG2 A;  5A5Z A;  3P2U A;  4DIL A;  1ZNB A;  4TZF A;  4KEP A;  3BV6 A;  3T9M A;  4XWT A;  4J5H A;  2BG8 B;  5ACR A;  4AWY B;  2R2D A;  3BK2 A;  2NXA A;  4TYT A;  4C1H A;  1KO3 A;  3I11 A;  3ZNB A;  3BC2 A;  4GCW A;  5EH9 A;  4Z5Y A;  4UWO B;  3RKK A;  5ACV A;  5EV8 A;  4AD9 A;  4NQ5 A;  5IQK A;  2QJS A;  1ZKP A;  2ZWR A;  4RAW A;  2FU8 A;  2BG7 A;  5EWA A;  3WXC A;  2OHJ A;  2DOO A;  2I7X A;  4HL2 A;  4V0H A;  5DPX A;  4XUK A;  2GCU A;  5HIP A;  3X2Z A;  3SW3 A;  5AEB A;  5HH4 A;  5LS3 A;  2FU6 A;  4EYF A;  3I15 A;  2Y87 A;  4GYQ A;  2GFJ A;  4P62 A;  3JXP A;  3IDZ A;  4C09 A;  1VME A;  3FAI A;  2OHH A;  2H6A A;  4XWW A;  3RKJ A;  3PY5 A;  2E7Y A;  4EXS A;  1KO2 A;  2M5D A;  2BG6 A;  5LLD A;  5B15 A;  2FHX A;  4YSB A;  4DIK A;  1A7T A;  2FHX B;  1QH3 A;  4UA4 A;  2AIO A;  3SPU A;  4EFZ A;  2GFK A;  2ZNB A;  4LE6 A;  2BFZ A;  2ZZI A;  4BP0 A;  2YCB A;  4Z60 A;  1WW1 A;  5K0W A;  1BVT A;  5AXR A;  1Y44 A;  2BFZ B;  4YSL A;  4AX0 B;  3I13 A;  1SML A;  4PVO A;  4EYL A;  1XTO A;  5A0V A;  1E5D A;  5AYA A;  3AJ3 A;  3VQZ A;  1DD6 A;  4JO0 A;  2Q42 A;  1WRA A;  2Y8A A;  5EV6 A;  1WUO A;  4CHL A;  1A8T A;  5HH6 A;  2M5C A;  2YNW A;  4O98 A;  2WYM C;  4ZEJ A;  2BG8 A;  3IE2 A;  4TZE A;  4AWZ A;  5AHR A;  2QED A;  2FU9 A;  1X8H A;  2NZF A;  4UBQ A;  2P18 A;  3IE1 A;  4UWP B;  3FCZ A;  3I14 A;  5A87 A;  3QH8 A;  1MQO A;  3SBL A;  4D02 A;  5ACU A;  1M2X A;  1L9Y A;  1YCF A;  5KIK A;  3MD7 A;  1BC2 A;  3IOG A;  4RL0 A;  3X30 A;  4J5F A;  4NQ6 A;  5FQB A;  1X8I A;  3BK1 A;  5LCH A;  4UWS B;  3ZWF A;  3PG4 A;  5LCA A;  1HLK A;  1K07 A;  3DH8 A;  3AF6 A;  4C1F A;  3IEL A;  4RL2 A;  5FQC A;  3ZR9 A;  2BFK A;  4UAM A;  4F6Z A;  3X2X A;  4TZ9 A;  4ZO2 A;  4U4L A;  2BC2 A;  2CBN A;  5EVK A;  4Z7R A;  5EVD A;  4FEK A;  4Z6X A;  4D1V A;  4NQ4 A;  2YNT B;  3T3N A;  5LMC A;  3L6N A;  2FM6 A;  4EXY A;  2YNU A;  1ZTC A;  2P97 A;  2WYL A;  2I7T A;  3DHC A;  5ACT A;  2WHG A;  5LSC A;  2FU7 A;  5LE1 A;  5HIS A;  4C1G A;  1WUP A;  2OHI A;  3A4Y A;  3DHA A;  5EW0 A;  3IEK A;  3KNR A;  2WYM A;  2BGA A;  3SD9 A;  1DDK A;  1YCG A;  3G1P A;  4NQ2 A;  4Z5Z A;  1KR3 A;  2BMI A;  5LCF A;  4D1W A;  3IEM A;  1XM8 A;  2VW8 A;  2DKF A;  2P4Z A;  5B1U A;  5HIO A;  4C1E A;  4RAM A;  5AHO A;  2YNV B;  4FSB A;  5K4M A;  2QIN A;  3SFP A;  2WRS A;  4UWR B;  2QDT A;  2Q9U A;  5K4N A;  4BZ3 A;  5LM6 A;  2ZO4 A;  2Q0I A;  2AZ4 A;  2BTN A;  2HB9 A;  3KL7 A;  2Y8B A;  4AX1 B;  5HIQ A;  1VJN A;  5ACX A;  4GYU A;  2A7M A;  2NZE A;  1BMC A;  5A0T A;  4Z67 A;  2YZ3 A;  3S0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...