4Z76A

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 75
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z76A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4z76A01
1BMGA 3ZTJH 5IIEB 3L5XL 3JXAA 1C5CL 4NHUB 2ZOLA 2J88L 1VHPA 4JHAH 3VH8A 1NAML 3K8LA 4CMMB 1N8ZB 2APFA 3OXSB 2AJUL 1GXEA 3HI6H 1WWWX 4C4KT 3MLYH 1KIQA 2GW5A 2CQVA 5ESAA 3V5HA 3QEGL 4H5SB 2BVOB 5D1XB 5BXFB 4OF0A 4JM2C 2AI0H 2CRZA 3QCUH 3DRTA 4PJ5A 3KYNA 4OLVH 1F3DH 3VD4A 5EBMB 3VRJB 1BD2B 1MJJB 5HPMB 3AAZA 3MRIB 3ES6B 3L3GB 3AMKA 4NO2B 1MHEB 4G7VL 1GOHA 1R3KB 5IM7B 4CADA 3U6RB 4FFWC 4LSTL 5BS0B 1N64L 4JM2A 2IBZY 1AE6H 1KJ3L 5IK3A 4U49A 1S9XA 3I75A 3M1BA 4PJCE 2GEEA 1OL0A 2QR0B 1A7PH 1T7YA 1UGNA 5HDOA 4X4XB 1U3ZA 2VLME 3MC0A 4UDUB 3WD5L 3MA7A 3D2UD 5IWLC 1F02I 2YRLA 1PLGL 4N5EC 5F1SA 4DW2H 2E8YA 5K9JL 1U91B 4X4ZA 2JK5B 4RFOH 3KXFA 3RHWF 2D7MA 2KQMA 2GY7B 2J6EH 2RBLA 3NACH 1N5YH 2WNGA 3TBWB 5IMMA 1FZOA 2EDEA 4QHMB 2AV1B 1K4CB 4K7PH 2EH8L 3FQRB 3VJ6B 5IWLA 4Q74A 1CIDA 4D0BB 5IB3A 1QR4A 2EIZB 4R97B 3WE6B 1MCKA 5C0CA 1FAKT 4N5EA 4O9HH 4LFHD 3QDGB 4GJTB 3O6FA 3WHXA 1AGCA 4M61A 1I7TB 2X1OA 4ALAL 2JKXA 1EEYB 5B21A 4JZNB 2QHRL 3OBAA 4N1HB 1JZ3A 3NBNA 1KIQB 5IB1B 1IL1A 4NQEB 2NW3B 2VDLH 1WZKA 1BQSA 1S5HB 2HVKA 4JY5H 4Z18A 2OXGA 1C12B 2ZCHH 3MRFA 4LVOC 4JRYA 2L7UA 2BXZA 2ADGA 2NTFB 3BP4A 4MB4A 5CIPH 3QWRD 5C6TL 5E9DA 1S7SB 4F7TB 4PYGA 2DAVA 1RZ8A 3AU1A 4OB5L 1AO7D 5CGTA 5CAYB 1XR9A 2IADB 2DQCH 1FYTE 5DT1H 4MDJB 3QIBD 2Y25A 3QQNA 5F9DC 1VACA 5IHUH 5H35A 4JFYA 5CWSA 4R0LB 5IW3A 3KLHD 5E8EA 3UROR 1ADQH 3T4YB 3WIHH 2PKDA 4HKZA 4WUKL 5TH2B 4J8RA 1Y0LB 2XNAB 3QFJA 4BSJA 4ZO7A 3RVTC 4OT1H 3TT1H 4APQC 4HLZG 5DK0B 3SKOA 5DI8A 1OPGH 3PL6C 2ICES 4Y2OA 1QYGL 4O2FA 1T66D 2NY6B 2OR9L 1QBAA 1J1PH 4HH8A 3T2PA 4KGJA 3HI5H 2NY7H 4JFZH 1ZA6B 2H32A 3CFEB 2K1MA 2HT2C 4FTVE 3P9WB 3INUL 2EIEA 3ZT5A 3PL6A 3S4SG 5DUPL 4V1DA 5HJ3A 3QJFB 2A1WH 3MRBA 1KCKA 3SJVA 2MSPA 3ZDZF 1CD0A 1ITCA 4I4WA 4O00A 1S78D 1F4AA 1FZKB 1PKQA 2WY3A 4I9WE 4K3DL 1UM4L 4LAQH 3FFCD 5GIRA 2X4OA 3RIAF 2Z8WC 4X7DC 5FGBC 2AK4D 2VZVA 4OZHE 1DQML 4ONHA 4P9ML 2F5BL 3F7YA 4PJ9B 2W9LA 4L4TE 1KIRA 2A73A 3FO9B 1L0XA 3VU2A 4F9LC 3KPRD 5DJZB 1MCRA 5ADPL 2FX7L 2SEBB 4QCIA 4G42B 3UTQB 1RMFH 3PWPE 1NBYB 5FGBA 3DX6A 1I3RB 2XFXA 1FPTH 1ZT7A 2NQCA 1VA9A 4P59H 1J8HE 4DTGL 3IF1A 3K4ZA 1TVHB 3VG0H 3FOLA 2C3GA 3O2DL 1M71B 1M7DB 1UJTA 3S6CA 1DSFH 4F9LA 4R96B 5GRXG 2H6PB 3IDGB 4NBZB 2ZSWA 3HRZA 1VFAB 3BE1L 5SWSD 3MLRH 1HNFA 2UVFA 5HYJD 3D48R 1BJ8A 1T4KA 3SKNA 3X12A 5HGAB 4G8GA 2OTUB 1YY8A 2IGFL 2R1XA 4LLDA 3HCVA 2QKIB 3M45A 3PDOB 1Q94B 3BD3A 1W8NA 4APQB 1TENA 3P0GB 1T03L 1QSEE 3QUXB 4RBPK 5CLTA 4CU7A 2A83A 2F74A 4M6OL 2XZCH 1NC4D 2H26A 3H9SB 4JRXB 2VL5A 4U6HA 1KULA 1YPZB 5HYSG 4PJ8C 4JREC 3TM6A 3C5JA 4MNGA 2C9AA 5ACMA 3W9DB 2QTEA 1XZ0A 3C5SA 4OLZH 5JPNA 5T1MB 5DJDA 2CIIB 4BFEA 5I16A 4JE4B 3ZHKA 4PJ8A 3QB7C 2VXTH 4YGVA 3RWEA 4QXTB 2Q20A 3ZE2F 4M6NH 3WLBA 4DUWA 4H88L 2E8ZA 1ES0B 2LV4A 4RGNC 5D70L 1MLCA 1ACZA 1OTTD 1R5WA 3AFLA 3HI1B 3X3GL 3H7BA 4MJ6B 5ICZA 1W72B 1NFKA 3C8KB 4PGCB 1W0WA 2XTJC 2P7TA 3IF1B 3FOLB 2GJ6A 5JHLH 1B90A 1YPZF 5FKPA 4KDWA 2ZUSA 4LGRB 1A3LL 5ID1B 3NFNB 3IXAB 3G5YA 2IPKB 3S3PA 1WC7B 4GKNA 2W91A 4LEXL 1OB1A 3RVXC 5BW7C 3U0TB 3KPPA 1N6UA 3GI9H 3QO0B 1DL7H 2YD7A 3HNSL 2QQLH 1ZLWH 2JB6A 4MNQE 2YOCA 4YC2B 1TJHH 1LP9E 3MLTA 4Z8FH 4GAYB 5IEHB 5IT2H 2R0LH 4GBXD 1E4XH 4H26A 5ESVA 3AMLA 3P4MA 1JNNL 1EHNA 5L2KD 3DSFL 4FP8L 5BW7A 4EXKA 2Q7YB 3CNKA 5F7HA 1KIUA 2HLAB 1IGMH 1HHHB 4IIQB 1FV1B 3O2VH 3BKCH 3DURA 4M9PA 1C5BH 4HIXL 3QBTB 2CLZB 3LCYA 4QRSA 3E8UH 3MV8A 1KEGL 3KNBA 4LHJB 3WFBH 4WTZG 4ZPVA 3OHXA 4CVXB 1OARH 3TBSA 2ERJC 4QWWC 1CICC 1YQVL 1HZHH 1NGZB 1RUQL 4NPYB 3VXQB 4JREB 1ZLVH 4ELMB 3B9VA 1F4YL 1JYWA 5CEZE 3GJFK 4QGYA 4JY6B 4WEBH 3GO1L 4XBGA 4LCUB 3TLRA 3UTTD 1BAFL 4PV8A 3OKDB 1B0RA 2R4SL 1U3HA 3HMWL 3C6LD 3FQNA 1R5WB 1CICA 5BCAA 1Z6JT 4QOKD 1YNTA 5I1LB 4KK9C 5CIPB 4GAJL 3GSXB 5DC9B 2QV2A 5T3ZL 4ONFH 3CSGA 2ZUUA 2P7TB 1QRKA 1NFDE 4OLYH 1N6QH 3Q3GB 4RGNB 4BQ9A 1EIBA 4MJ4A 1DVFC 5C0NC 1E6OL 5JW5B 3O6LL 4NO0A 3OJDB 3MNWA 2FJGA 3D39A 4GRLB 4LP5A 4WW1B 1S9KC 4OF8A 2R4RL 4RMSA 3K7UA 3CC5A 4ZYKB 1AD0B 1KJ2H 1ZHKA 1DVFA 5B4MC 4CGTA 4FFZH 5FYKD 5D7JC 4ELMF 1A21A 1MFNA 2IMMA 2VYRE 3LVEA 4E41E 1DQJA 5F88A 4MMZC 3AROA 5BVJA 3B8YA 4I3SH 5B38A 1CCZA 1FFOB 4S1RH 3TP4A 4CN1A 2GITA 1MCWW 1NKOA 2XKNB 2EO1A 4POYA 5D7JA 3ET9F 4AH2A 1NUNB 4UTBL 2O5ZL 1JPST 2CDEA 5IMLB 3RNQB 5T33H 3KNBB 1MHPL 1EEZA 4OFYD 5E6ZA 1AGDB 4LIQL 1ZSDB 2VRAA 3BWAA 4G6FB 4MDIA 2P8PA 1ACYH 1D9KB 5EIQA 3RIFK 1NCTA 4MJIE 5DHVH 4B5EA 4PIRF 3P4OA 5BZWA 4DGVL 5C0FB 1BM3H 5TDOB 1PAMA 3BI9X 1XGYH 4PV8B 4NRYB 3HNVL 5JIKA 2R15A 2HKFH 5CEXA 4DKFL 3ULVL 1FO0H 3MGOA 2WQRA 1G6RA 1G7HB 4U6VH 1BREA 5E2VH 3WBDA 3MRGA 1DBBH 1GAFH 4L1HA 4LARH 4YHNB 5KOMC 1N3NB 4NQCD 4U1HA 2DJUA 1N4XL 2D31A 2Z92A 2NY1B 3L3DB 1XR8A 5TF0A 3IDYC 1KTKE 1ZT4B 2ORBH 3FO1A 4W6YB 3SDYL 3TYGL 3QJHB 3TESA 1QBBA 4Y16B 5L0QC 4PJEB 2VDRL 1WBZB 4U6YB 3MXWH 2JF1A 1Q9OB 1V3MA 3BUTA 2Q87A 1OTSC 5KW9H 5ALCH 1JPSL 1MCEA 4E42A 1H0DA 3M8OL 4PRHB 4Z76B 4PRAB 2A6KA 4LNVA 3KPSA 4JFDB 4UV4H 3VGFA 3UJIL 1RAMA 2H2PC 5T1KA 3VFVB 1DTUA 4PJHB 5BO1L 4K2UH 3RL1A 1FL5A 1HI6A 1NLDH 4FG6D 1SY6A 1XGQB 2EYSB 1RIUH 3UYRL 1MRFL 3RUGB 3MV9A 2CDEB 3N1MC 2VAAA 5T1DL 3JV6B 1ZHLA 1EEZB 4FQJH 3GSOB 4QRPA 3TJHD 5D7LB 5DFWH 1JZ6A 4Y1AB 2ZUQC 3F7RA 1U6AL 5EORH 3LMJH 2X9YA 2XWBB 4GG8A 3RL2B 3HI6L 2ZNXA 3ARBB 4YHKL 4EI6A 3OWEA 4PJEF 4YDLC 3G5ZB 3VFNB 1IT9L 5KTEH 4UMGA 4TPRL 1M4KA 1H15B 2Y07H 3H0TB 3CVIH 1XF5B 2NY3C 4P2QB 3OF6D 4PJ7E 3TH4T 3TVMC 1P1ZB 2CMRL 1DZBA 1XGPA 2NR6D 2ZG1A 4OLUH 3PWJA 2JLLA 2EZ0D 4PJHF 3ULVE 2JTDA 4U1HB 4TUOA 5JXAH 4O4YL 5EZIL 3PNWB 5HHNA 1MI5B 2E6JA 2XWTA 1YNKH 5T3ZD 4XTRC 1ONQB 3RUGF 1RJCA 2FIRT 5KSBE 3TVMA 5CHNB 4I77L 5JHDB 5FGCB 4Z7UA 3MOAL 1SYSB 5L9DH 3BDYH 1A02N 1JYNA 1QR1A 4EJ1C 4JFQA 4XPHL 3GSNL 5INCB 1AKJD 1E27A 3IDYB 5DRWA 1NCAH 4HXAH 1CGXA 1J87A 3CZFA 3STBA 2X9WA 3U2SB 5L0QB 4FOMA 5FHBH 5E56A 3NIDE 1MJ7H 3O45B 2B5IC 1XF1A 2B0SH 2P8MB 3GI8H 2H9GB 1CE6B 2QEJA 3MXVH 5HHOD 1R3LB 1V3KA 2FL5A 4RZCA 4MAYA 4MB5A 5KSVB 1DN0B 1MWAH 1XGTA 3MV9B 1IRAY 1FZMB 3N1PC 2ADJB 4XBPA 4O9HL 2CUIA 1UYWL 4LDEB 3MRNB 2I07A 1YJDL 5FM5M 4KTDL 4HGWA 2IAMA 2FBOJ 5SWQA 2AW2A 3TZVC 2CK2A 3DROB 25C8H 5SX5H 2ID5A 5J9PA 4FABH 4KXZI 3TBVA 2BOBB 4Q9CA 4TULH 2F19H 1LDPH 4GQ9H 3WDJA 3WEXB 1G84A 4X98A 4M03A 3I02B 3L5WA 1J1OL 1A9BA 4HS8H 3TZVA 3AXLA 4CW1B 1RK0A 4NBYB 2B20A 5EU3A 1H3VA 3BGFB 3X14B 1S3KL 4K9EH 2DOCA 3MGAA 2X70B 3BISA 4Q6IB 15C8H 5KANI 4OZFH 4JR9H 1UZ6E 4EI5D 1FIGL 1Q8MA 3QIBC 3CFBB 1DCLA 2CO7B 4IS6B 3D69A 1BGXH 1QBMH 4U1NB 1ZS8B 3QO1B 2XZQL 4JDTL 4O02L 4HH9B 1NBVH 5I76A 1V05A 4XB7A 4PJCA 2Q1EA 1LILA 2APTA 4MLSA 3PGFH 2P24A 1IGJB 4OD2A 3G5XA 2NY2B 1AGBB 4GG6B 1N6VA 4NJ9L 4RAUA 2AXGB 1XF2A 3VRIA 1RFDH 1EAPA 2D7NA 4XNQB 3D2UB 2ARJQ 5T1LA 4ESKA 5IW1A 4NQDD 4XPTL 1LVEA 4AIXA 1OPGL 2DDQH 4NZTH 1ZV5A 1XCTA 3GHBL 3F58L 2XN9D 3DUUB 4M5YH 5E2WH 4M62L 1JFQL 4KAQH 3S37H 1HQRB 3UC0H 4U1SB 3MA9L 4HGMA 3EYFB 4HGWB 4UINH 2ED9A 4BSWA 2AJYH 3QXTA 4NZRL 4X6EA 3H9ZA 4K7PX 2VDMH 4U1JA 4XCNA 5BQ7B 1BEYH 2G2RA 3V52L 3VXSE 4M6ML 2Z93A 4YHOL 4MSWB 4NM8L 3ZE1E 4H20H 2PR4L 4P4RA 4TRPL 2LQRA 2G75A 5F6HI 1R24B 1NAMA 3MFFA 4X98B 1OAZH 1S9VA 4QXWA 5ICYA 2CIKA 4GG6F 1JZ5A 2ZJSL 1LK2A 3P4LA 2HTLD 5HVFB 5E5RB 1F13A 3H6JA 5H2BA 2VABA 3CDGA 5CBAA 4JQIL 4RFEB 3ZLQC 1OVZA 2ZPKL 3HPJA 4NRZB 4X7SL 2ATPA 4UU9B 5D1ZC 5D7SL 4I18C 2A74A 1Q9LB 1GSMA 3O2WL 4R9HA 1RMFL 1AO7B 2VOTA 1YEFH 4K3JH 4P59L 5E70A 4HAGA 1FYTA 5EZOH 5TDNB 1MRCL 3QISA 3QIBB 4OM1L 3BZFB 5EO1B 4YK4B 5D1ZA 4I18A 4OI9A 4QHNB 5EOCH 2ENSA 4RAUB 3UP1A 5I19L 2GSGB 1EO7A 4S0TD 1MCOL 2IH1B 4P2RD 2HLFC 4JFFE 5IV2A 5C09E 3DGGB 4GLRH 4P3CH 4WTWA 4YXLL 1JGDB 4HUWA 2J4WL 4YHZH 1HDMA 3PV7A 1KC5L 3B3IB 1QRNE 5EU7E 1U93A 1K8IB 3VXNA 3T08A 3MRHB 3BGMB 5BRZE 1G1CA 1P53A 2XY1A 4LASH 3NABH 5KG9B 1B6DA 3BP7B 2YD3A 1M7XA 4TNWK 3CK0H 5MENE 3GMQB 4Y5YB 4U1JB 3IAQA 3N1FC 4NKDB 3A6BH 4FQCL 4FTVA 1NC4A 4OZ4A 3RX5A 5K9QG 4G43B 4Y19E 3H2WA 4NKMB 3IFNH 4P4RB 6FABH 1MCWM 1NAMB 2WIMA 4Y4KB 4ETQB 2YWYA 1KJMB 3MJ8A 4H0HB 2H8PA 4DEPB 3DVIA 1K6QH 5B3JF 2BC4B 5F7YC 5FHAH 4GW5A 5HXMA 5KS9B 2FHBA 4M5ZH 5IW6B 4HMDA 3RPIA 4A6YL 3FFCB 5ANMB 5DRZB 4LHUD 2AK4B 3OJMB 3S35L 4URTB 4JGJA 3GKWL 4OZHA 3PHQA 4L4TA 3GMOB 1AD9B 3KPRB 3VMPA 4JM4L 3PWPA 1YEKL 2H3NB 5EA0L 3MR9A 3UTSD 3ZL4H 1J8HA 1A9EB 1OD9A 5FA4B 1P7QA 1BPVA 5DQ9A 1LE5B 35C8H 5BV7H 2IAND 3MV7D 5CJBA 2R39A 1WIOA 2AGJH 4WY7L 5SWSB 1MJ8H 3DARA 4Z7WE 3ILPA 5KS9F 4J6RH 3R8QA 3WO3B 5HYJB 5L8JB 4XP6H 3MLVL 4U1IA 4C58B 3F65A 3SCMD 1P69B 4OAWA 3CDFA 5GGSB 4ZTOH 1UCTA 5A3ID 1QSEA 3QZWG 4ZQKA 3QXDB 3W39A 1NC4B 2XKUA 3TJEL 4XPFH 3SDDD 1X5LA 4UNUA 4QRUA 3V6BR 4L3AA 1FG9C 3MBEC 4X6DE 2WK2A 2Y72A 4D8PB 3IJSA 4U31A 3GRWH 1FP5A 5DMGC 5IFAL 3IU3B 2R0WL 1WWAX 5FYJH 2VDOL 3WCYA 1NCUA 3GMMA 3MBEA 1OCWH 3N1GC 2NX5B 1INDL 4LQFH 3GNMH 2AEQL 2P5WD 4OTXH 5EUOB 1S7VA 5C0IA 1MSPA 4P48A 4PJDB 5J6GA 3UBXA 5IFJB 2O5XH 3UTTA 5GSRA 3PWNB 4DQOH 4ZSOE 3ZKND 3QRFM 1G7LA 3IFPB 5FAAA 5BOPA 3A6CH 3NOIA 3WS6C 1BOYA 4O2CB 3KS0H 1BOGB 4S2SA 4KVCH 4UUJA 4YX2L 1EGJL 43CAA 1CLCA 5HHME 2AABL 4POUB 1PX4A 4JZOA 1QKZL 1SJEB 1HWHB 4HAFA 3WS6A 1KJ2L 3Q5TA 2IH3A 3HR5B 3SDCD 1HINL 4GW4B 4G9FE 3ARYA 4PY7B 4OFIA 4U33A 1LP9A 5EUOF 3RI5K 4PJDF 1A1NB 1QNZH 3P4NA 4GBXB 1MIMH 3WJLC 4R2GC 3ARPA 1W8OA 5L2KB 3HZMA 5HDQH 2XWJA 2AJVH 4PLOB 2YSSA 2CLRA 5TE6H 5BOZG 4YXHL 3WSQL 3GMRA 1I9JH 4LAJH 5HHVH 2Q76B 1ZEAL 4HC1L 2FNBA 2C3VA 1IC4L 4JJ5B 3P77A 2HA1A 4G8IB 2GFBB 3IGAA 1KG0B 3V4VL 4PJAE 1CT8B 3FQTA 3KJ6H 3JZ7A 4OQTA 4O5LH 1B6UA 3EJZD 4X8JB 1JZ8A 1DBKH 1OGTA 3C6LB 2VL4A 1I9RL 4QOKB 1K3ZA 1R3IL 4FFVD 1KCGC 3T0BA 4OGZA 4XAWH 1QFWI 5GRUL 3UCRA 3EUUA 4MVBD 1NFDA 3FN0H 2OI9B 4M7JH 4YJZL 2VDKL 3MJGX 2XPGA 1RJZB 3QCVH 3T2NL 4NKIH 2A6IB 1FNGA 3WIFB 3DBXB 4XPAH 2E7LE 5E6IC 2ICWI 4HBQA 5LGHL 3ULUH 5TPWH 1O5DT 3OKLA 4FQXD 3O3EA 5IMOA 2QHLA 4OJFH 3T3PE 4E41A 1WFOA 3H7LA 2YPVH 2Q6WB 4CMHC 5E6IA 2I9TB 4NRXA 2YD8A 3HC4H 3F12A 3S97C 4PP8C 1D6VH 2CLRB 2CXKA 1CFTA 2QSTA 4X5LA 2NXZD 4JPIA 4RQQA 2CUMA 3FONB 1A1OA 4YDIL 1F11A 5DUML 1I1FA 1OLLA 2EE9A 3EO0B 4PRDB 3MJ9L 1RZ7H 3MRMA 3QULA 4MMXC 3CDYA 2BNUA 3D3VD 3MLSL 1VKXB 3GBLA 4XWOD 4XB8A 4PG9B 4MJIA 3VXRE 5AUMA 1UWEL 4QHUA 2Y07L 2DLEA 4CDGC 3LKRA 4KROD 3VGBA 1MPAH 4CUCA 5CFHA 5KSUB 1T0PB 4HPYL 3ZE0F 1CTNA 4G59A 4AEFA 3LQAC 4KPHL 3QDJD 4YBHA 3OF6A 1NGWB 1H3PH 1IGCH 2I9LA 4ODTH 2YUXA 1PQZA 3HC0B 3KS0J 3FT4A 4NQCB 4S1QH 3HG1E 3BX7C 3IT8D 3VFSB 4JDZA 5L88H 3BKJL 4NO5A 3JWDH 1VGEL 1Z5LB 4GAGH 5AG8A 1QO3B 1KJVA 1KCSL 2VXVL 5FK9B 5INDA 4IRJD 1NEZA 5JDSB 1OOAA 4XVSL 3MYJA 4NC2B 4WFED 4HXAL 5C0JA 1IAKA 2G60H 3G6DH 2EDFA 5FHBL 5K59F 1YC7A 3GGWA 3QXUA 3GI8L 5JMRA 1VGKB 5DSCA 4HKXB 1BQHB 3TPUE 1FGVH 3ETBF 4OZGE 4RQQB 3MLXL 1F11B 4Z7OF 1F45A 5DC0A 5CUSH 1CDGA 1RI8A 1GGBH 5JOPD 4YIQB 3GMLA 3W11D 5E00B 5E7FA 1C08A 3FB7B 3U36A 5AD0B 2DYPD 5T5NG 1MCPL 2YMXH 4MJ5A 4D0CA 2FEEI 2DM4A 3T0EE 5I8CB 1IGTA 5DTFB 3TO2A 4P4KC 4XX1G 1XF4A 1ZWIA 4L29A 4P23C 5D71H 1RZJL 3ULVC 3LIZH 3FMGL 5GGVH 4K94H 3RZWA 4U3CA 3RAJH 4PJ7A 3E6HA 5EWIH 1HHGB 3O4LE 1MH5A 2X09A 4P4KA 2GJZA 2YEZB 4P23A 3H9HB 2V9RA 1UXSA 2P8LA 2AERT 3LHPL 3QG6B 3Q0HA 3NA9H 3QUYD 3B9AA 4CVWA 5KSBA 1UACL 4JPVL 5D9SB 1GGUA 1RD6A 1C7TA 1S7QA 5FDWB 3VFMB 1BLNB 2Q3ZA 1AKJB 3HE7D 4TUKL 3OAZK 4ODBD 1J0ZA 3LV3A 1T0MA 4LSVH 1PG7L 1LD9B 1T5XB 5TE4L 1DUYB 1I1AC 1UKQA 3P30H 4NZTL 3JTSA 1P4BL 2FO4A 3TV3H 4R7DA 3TT3L 5HHOB 5DD1L 2AJXH 1TMCB 1ZHNA 2XN9A 3RWIB 1MFEL 3CSBA 1G1YA 1NCCL 1I1AA 4AENA 3LH2L 3KWWB 1OAXL 4MQTB 3S98A 1E0OB 1UM6L 4DGYH 5JW4N 1PD6A 3V6OE 5FYLH 2MCPL 1NGPL 3BZEA 2F8XC 4IHOB 3GJFB 5DMIL 5I1AB 3MCKA 1FFPB 3SDXE 3ZKSD 3B6SA 4OLEA 2VXSH 3FL7A 5D4QA 4GW1B 5DJCB 4HUKB 1G9MH 1VSCA 3CXDL 1J9CT 3STZA 1ZGLM 5D72H 1OF2A 3HB3D 1A7NH 1RZFL 5D6CB 3CX2A 4WDIB 1J5OL 3O4LD 1OLZA 4K07A 3FB5B 3MOBL 3P9LB 4RSVA 2P5ED 1MIEL 1UKTA 3U30B 1BIIA 3OB0K 2VH5H 4KHTL 4CU6A 4EI5B 4U2ZA 4H25B 2ZCKH 2ZUXA 5BMFH 3L1OL 2PXYA 5EZLA 4Z7NF 1GHFH 3VXOB 1EEUA 4OCWL 1B9ZA 3VWKD 4DFIA 3J7HA 3V0VB 2ADIA 4HPOL 4FQIH 1GOGA 1IM3B 3QNXA 1FORL 3UJJH 1QSFE 4YHLH 1PG7W 3ARTA 1A1MB 3NFPB 4HS6A 1V5JA 3MRRA 4KVNL 4F58H 1KEMH 5DHXB 3RPKA 4QEGA 1DFBL 1BWWA 5IF0B 3GSNA 5CZXD 2V6HA 2J12B 4L8SB 3HNTH 2ZG3A 2FO4B 4NQDB 1DR9A 1L7TH 3QPXH 4NNPL 1YYLL 3ZT7A 1KGCD 1ZHNB 4J3SA 1U8QA 2XN9B 5J1AB 2D0FA 5KVFH 4Y4HD 3CJJA 5IR1A 1G9EA 4GT7A 1YJDC 2F54B 5CMAA 1HSBA 1TITA 3CK0L 3W9EB 1TTUA 2EE6A 2XYCA 4GFTB 1PBYA 5K9KA 2FX9H 2RCSL 3S37X 1I7RA 1JN6A 1G6VK 3MRPA 5IQ9A 2NZ9C 4HJ0D 3RWCB 4PGJA 4YHML 4NN5C 4TTDD 5H94A 4ODSL 4WGVB 3RWGB 1SJHA 3SDAD 2HRLA 4NUJA 2D4DA 2WBJC 3HA0A 5K9QI 1SEBB 4L4VD 3STZB 2AJSH 3VA6A 1LO3H 3IKKA 4NJAL 2XV6B 1CFSA 1QLRA 4Q97A 3VW3H 1BVKB 3LQZB 4KQ3L 4OD3H 3OX8B 2M2DA 4HWBL 5AEAA 1NGXA 2YA1A 3OKEA 3D25B 4PS4L 2WBJA 2FGWL 1GPOH 3QA3A 2D7TL 1UEYA 2MKLC 1HK6A 5FXCH 5LXGH 5IJVA 1TCMA 3BZ4B 1J05A 4NNYA 5D2LE 3NCYP 2VERN 4HDIB 4EUPA 4QXGL 1BBDH 3RIFF 4RMWA 4XVUD 3BIAX 3KHOA 2Q8BH 3HE6D 1QSFD 2IPTH 2FJHA 3TNMB 5EU7C 1IC5L 4RWYH 4ZS7H 5C0EB 4P2RB 4JFFA 2WWKT 4YR6A 4MA3B 4UAOB 3V0WH 1INQB 3SCMC 1HH6A 2BK8A 3WIHA 5IBTL 5KJRL 2FECL 1CK0H 1AC6A 1QRNA 4JZJC 4TVPH 4BUGA 4MQXD 1IVLA 1BZQK 2VLKD 1G7PB 4D94A 4WHDA 5CCKH 4Q9QH 5BRZA 2CKBL 2OJEA 4HFUH 4ZTOL 2VMFA 3CMOH 3EO1B 3SCMA 3GUTB 2E27L 3TBYB 4XPFL 1TZHA 5MENA 3D0LA 4S1SL 4HT1H 4MXQD 5C07E 1UJ3A 4KJYA 4B53A 4HG4K 3LKQA 4P9HL 5EU6B 5FUOL 4Y19A 4NCC1 4P3DA 3CSYB 4F2MA 1I1RA 1WBYB 5KVEL 4WW2C 1T7WA 1H3XA 3FT2B 1KLGA 3GNML 1U58B 1VADB 4XCFL 3ZKNC 3MSPA 4YPGA 1P6AB 4LHUB 4ZUUA 1NGQH 4WW2A 4HCRL 1GGIL 4KGLA 5FYKU 4NDMB 1NC2D 4L9LA 3IU4L 1XF3A 4TSBL 4HFWA 3NCJH 3LKPA 5I1CH 4EUPB 4WFGE 4X80L 4N9GB 5DRNA 32C2A 2IALB 2GI7A 1CXLA 2NYYC 5EUKA 3EFDL 3GB7B 3UTSB 1ED3A 1RK1B 4LSPL 4AMKH 3EO9L 4AM0B 3DNKA 3EZ8A 2IANB 3MV7B 4OFKA 4LCIH 3MUGA 1J10A 1IQDB 1KENL 5IB5B 1QTYT 4NBXB 4NYLB 3VXPA 3QUKB 4ODWB 4Z7WA 2GTZB 3EYSH 4V3DB 4UIMA 1MHHB 1UWGH 3WNLA 3BXNA 5DUBB 5C08E 5JOEA 3CZJA 3B9DA 1ZLUK 4XNZC 3SCMB 3QIWD 4M3JA 1EHLH 4F8QA 4WHTB 4KUZL 3GHEH 1X4YA 2AJVL 3PGCB 1SYVB 1KTLB 4JZJB 5C3TA 1CZ8H 2D4FA 5IJKC 3SDDB 3ARDC 2B8OT 1YEDA 1HXMB 1J0HA 4F2MB 5C9JA 4X6DA 5FUCC 1KFAL 4XP1H 3U46B 5ITFB 4HKJB 1A5FL 1F6LL 5F44A 5JQHC 2X4SB 4MNHA 5GS1C 3T1FB 5E0QA 2B2XL 4PTUB 3EJZC 2VLJE 2X4TA 5FYJE 5IJKA 1CLYL 2BNQE 3ARDA 3KJ6L 3MNVB 1YEIH 5IBUB 5F1KC 3L5HA 3WUWA 1ZGLA 3NA4A 3ALXA 1K4DB 3MLWH 2P5WB 3MMEB 4FFVC 5J1SC 5I1DA 1DBKL 5GS1A 5J11C 4NQVA 3LZFL 4S11A 2A77H 4A6YA 2DMKA 2GAZA 3LKPB 4LVHC 2E9JA 2OZ4H 2OR7A 2IBBA 5I1EH 4ZSOA 2EDWA 3ARVA 3ARRA 4OM0H 3N50A 2L0DA 4L5FH 3THML 5J4MA 3IVKB 4BH7A 3SGDI 1NDMA 4L3CA 4QTHB 1DQDL 2WIIB 4YEFA 4KXZH 5F6IC 3MRDA 5HHMA 1WEJH 1T3FA 3L6FA 5HHPB 4FQXC 5ADOL 1JMXA 4L3ED 1UB5B 3BHBB 3IFOA 5LQBL 5A1AA 3ULUL 3TF7C 1DP0A 5KVDH 1A6WH 5IFHH 2BRRH 1E28B 3SDCB 4LHQB 3BXNB 1QLFA 4G9FA 5CINH 3VFWB 1AR2A 1I85C 5JW4Q 2RB8A 2NXZC 3MNZA 3GBNH 4HHAA 3GMPB 1KT2A 4XVJH 2DWEB 1NCNA 3MRCB 1JPFB 5F8QC 4NSKB 1TQCC 4HJGA 1AR1D 3KYOA 4XWOC 5EC1B 4BJLA 1I85A 3IJYA 3U83A 1RZ7L 4D9LH 4KROC 2DLIA 4XPGH 2EYTB 1GZQB 1FAIL 2R0KL 2GTWB 2EDNA 5F8RC 4FQLL 3I2CL 1KCVL 5B39B 2VLJD 2BNQD 2VLRE 2H41A 2AKRA 3K4AA 4S10A 2EO9A 4XH2B 2G5BB 1RZKL 2OQJB 3BSZL 3DVFA 2PO6D 4PJAA 2VQ1A 3SGJA 4X8XA 3RDTD 1XCQA 2FBJH 1TIUA 3PUCA 1FZJA 4OZIB 4A6YB 4HLZH 5GGTL 3L9RA 2XRAL 4FXGB 2EDXA 3EDJA 3IYLW 2YC1B 3BN9D 5JQ6L 1ETZB 1OQXA 2P46B 4UT7L 1Q9WA 1Z9MA 2Y5TA 5IVZB 1BZ9A 4X9FA 1FL3B 1F6AB 1TCRB 1QLEL 2E7LC 1JF1B 2QSQA 4YNYB 3VGAC 1OWWA 3U9PL 1UB6A 2HJFA 1N5AB 5FECA 1FFNB 3MO1A 3SEPA 5EU4B 4F7MA 4LLVB 2FYYB 5HD8D 2D03H 4RMRA 1YZZA 2E7LA 2V5YA 1U8KB 1HOCA 5CSGA 5E99L 4UBDD 3RNKB 4U1KB 1S7XB 4G8EB 4Y8DC 5F6IB 4OI8A 1AQDA 2NZIA 2OK0H 2UYLB 3ULUE 4Z78B 3WN5B 4FQXB 1KJ2A 5EC2B 3ZKMD 4LFHG 4LCWD 3G6JB 2Y1VA 4OZIF 1UCBL 1Y18B 1TPXB 3W11C 4DJMA 5DWUL 3Q6FA 3PE9A 1IQWH 2BP3A 3WFDL 3F7VA 2WUBH 1NCDL 5TE7L 2DQEL 3B5TA 1IEHA 4LRNL 2CH8A 4EDWL 3G04A 2EDQA 4NO3B 3CFIC 4YHPA 3X11A 3OG4B 5J12B 4ZUSA 1TQCB 3QXAA 3D3VB 3QQ9D 4PP2B 1GIGH 4KV5E 5TF1L 5DK2A 4GRWH 3VCLA 3VXRA 5DHVA 1XCQB 3Q1SH 4HKBB 1AGFB 4KROB 1EO8H 5T5FH 1KSRA 4A2LA 1X5AA 1FZJB 3Q6GL 3L95B 3EYUH 3K4DA 5HYQA 1JFMA 1XMWA 4TNWF 3QDJB 4HJJH 1YEEH 3G6JF 1A4KB 5FKAA 1FO0A 4CNIB 5HHXH 2C4XA 4LBEB 3HZKA 5DRXB 5C0RH 3VWJD 1C8PA 3CLFL 2B1AL 4ZFZB 4MD5B 3O11A 3HE7C 4EOWL 2ATKA 4YAQB 3TH3T 3L3JB 5J3HC 3CH8A 1IGYA 3RTQD 4IRJB 5HHQA 4XBEH 1LO4L 1GRWA 2FATH 4YLQT 2LFGA 2PW1A 1CQYA 1D5XA 3MJ7B 4MA7H 4N0UE 1WLHA 5FCUL 1VEPA 5F9WC 1D5ZA 4HX1A 5F3HB 1AQDB 3HE7A 2W60B 2VR4A 1GC1H 5I17B 5FA3B 3O4OB 1E4WH 2WP3T 4QHKI 5A2JH 1X5JA 4I0PD 1JZ7A 2DQFB 3F7VB 3TPUA 4XGZA 2K7QA 4OZGA 3EAKA 1NLBL 1OY3B 1OAKL 1QSZA 5E2JA 1RU9H 3ARWA 3CU1A 4RISL 5C0BD 2BSRB 1T1XA 4YO0B 4BKLB 4HWEL 2X7LB 4XMKH 4J23A 4JFXB 2DYPB 3BVNB 2FO1A 4OBRA 1IMHC 2JCCE 2Z91B 1F4HA 5AWNH 3T0EA 5MEOA 3DXAE 3LKOA 3WXVL 1F3JB 4N90D 3FQUB 4HQQH 5EO0B 4KMLB 3PQYD 1C1EL 5IESL 5FGSA 4HULB 4DN3L 2FZ3B 1D7FA 4QRTA 3NCFB 3O4LA 5A2LH 3P2TA 1G7MA 1IKNC 2JJTC 2VITA 5DJ6B 5ICXA 4I48A 1D3CA 4JLRB 1LO0H 5JA8B 1NGYA 3GIZL 1P2CA 3MRJB 4AEHL 2R29L 3QDMD 4ISVB 3OAZH 4HXBL 4MQ7B 5F6HJ 3QUYB 4IOSD 4POZD 4BZ1H 2JJTA 4Y5VA 2BNRD 1ZMYA 3UAJC 4JFPA 2EDDA 2R56H 2A6JB 4OD1H 3NIGF 1QP1A 3QG7H 4ZXBC 4F58L 3HE7B 1MCCA 1IGFL 2BOCA 3Q2CA 1SJVA 4NP4H 1JF6A 3TWCH 1IZJA 4Y4HC 2J2ZA 3DVNA 4MAUL 3PWVA 5HY9B 3VFPB 5E94A 5LWYH 2BVUA 3M17B 3NZ8A 3VGEA 3MBXH 5DEFA 4C56E 4ZXBA 1X4XA 3IDMA 3OKKA 2N4IA 5SWZE 3V6OC 5C0AD 2VTFA 2V2TB 2FD6L 3LAFA 3CGTA 5L6YL 5E8OB 1NPUA 1OW0C 4Y4HA 1MWAA 3OAUL 3VI3E 3I84A 5ID0B 1HSAA 4LVNB 1FE8L 4NOFA 3V2AR 3CH1A 1BQUA 3V6OA 1H3WM 5E1AA 3FO2B 4S1DD 5J1TC 1HILB 1RZJC 5HGHB 1OW0A 4HIJA 5IVNA 3S36L 3SE9L 2I5YH 3SDXA 5I0ZA 3BESR 4PJBB 2B4CH 2ICEA 4K9EC 1L7IH 1Q9KA 2BY1A 4DGIH 3WNMA 2XA8H 4F33B 4NHCH 1X5GA 1X5YA 3QRGH 3RI5F 2ZKHH 5DMKB 4ZMAT 1JGEB 2IQ9L 2XA3A 2VUYA 2P5EB 4HMEA 4KRLB 1XIWC 4DN4L 4K71B 1ROWA 4HZLB 5D8JL 1ORSA 5H8DA 2C4FU 3D1MC 4LGSB 3LPGA 4OZFA 1FBIL 1YDPB 3REWA 3F6LA 3MLPA 4PB9H 4WFFE 3DO3A 4DZ8A 4FFYL 2VDNL 5IB2A 4XNYH 4JANA 3VWKB 1HKLL 1XIWA 5C7XH 3HR6A 1RIVH 1JCKA 4K3EH 3LRGA 5JLZA 3QNZA 3S4SB 4IOIA 5AZ2L 1UXWA 1X5KA 1QSFA 4RWYL 3A0OA 2IJ0C 3DX8A 5IUSA 2AP2A 4MQXC 1N59A 4PJBF 1FYHB 1CK0L 4KKLD 2ZSVA 4M02A 4TVPL 2OJZL 2R23B 5C8JB 4JVPA 4N0YH 1G7QA 1VFBA 2NLJB 4LLMB 1QFWH 5GRJH 4L8CA 2VZTA 5DEGB 3DTXB 4PRPD 2MKWA 1T1ZA 4HUXA 1KXVC 2KZ1B 3AS2A 4O58H 2MPAH 3RWJA 1NBZB 3NN8B 4M93B 1EVUA 1CG9B 3RWFA 4DZBA 1HYSC 1U8NB 2VJXA 3G08B 5CGYC 5HDLA 1SHMA 5F7WC 3OR6A 1A14L 1U8LA 3SDAB 2ICEB 4L4VB 1QA9A 1CXHA 5EIIA 4N1EA 2OMBA 1PEZA 4GRWB 4HWZA 4G7YH 4WHYG 3HMXL 3OR7A 1BFOA 5ALBH 3CX5K 1Z0NA 1Z9LA 2ARWA 3S36X 5GS2H 5IP4A 5TFSH 2DRUA 4EBQH 3LS4L 3QWOB 1R0AH 1RUKL 4OGAC 1QQDB 3RA7H 4ODXB 3GSQB 3NTCH 5GJTL 4QY8A 1NC2A 2E7CA 4KK8D 5D2LA 1QBLH 5DDHA 1X6NA 3R06B 2DIJA 5HI5D 2DMBA 3JWOL 1TJGH 2HH0H 5F93C 4P5KA 2BJMH 2AEIT 4KUCD 1UT9A 3WLWD 4AMKL 1BVZA 4OF7A 3HE6B 3STLB 3V4UL 1IGIH 5DVMA 4MXWH 1YMHB 1CBVH 4Z95L 1EJ6A 1XGUB 5E8DH 2IG2L 2YPLE 1MEXH 3FFDB 1JZ2A 2H2SD 1WIUA 2ESVB 4GRWF 1SVZA 4L8BB 1FVEB 3OPZL 3HZVA 2IFFH 4U6XB 4PGEA 4UQ2A 4PV9A 2VLKB 4TVPE 3SGKC 1HH9B 1DANT 3S3JA 2ZWLT 3T65A 3UMTA 2FB4H 3EHBC 3C08L 2PTTB 4YZFE 5LCVL 5C07A 2R2HB 2X1PA 3SGKA 5F9OH 1U8LB 4JVUA 3SOBH 4YFDB 4Z7QF 4YHIA 1JGVL 4UIKH 2W65A 4FMFA 4ZODA 3FB8A 5D7IE 1DQQB 1RIHL 2NPLX 3DSNA 2Z31D 1F97A 1CI5A 2Z4QA 3CVHH 2N7AA 1CFNB 2NXYC 5DZLA 1MFDH 1OSZA 1RY7B 2R0ZH 4G9DA 2NY0D 2EE2A 3BMWA 4PBWD 4HWBA 3BH8B 1JNLH 1KBGH 4YBQD 5L2JB 1NC2B 2C5DC 4W81A 3LEXB 1RUAH 4LSRH 1A6AB 3BP5A 4G80B 4WEMB 5E2TL 5I74B 1BJ1H 1KCUL 2YBRB 3L3OA 1S7UA 3VDCA 3VFUA 4JKPH 1IKFH 2VR5A 4XPBL 1II4E 3ARED 1WEJL 4RA0C 1RURH 4X9BA 4XP9L 2NCMA 1BQHG 4Y8AA 2UWEE 2YPKA 1T5WA 3ARQA 4JY4A 4XI5D 3O41B 2YPLD 4WWKC 4DFHA 3VE0A 2C1PA 1Q72L 3SY0A 4LP4A 4YWGL 4Y4FC 2M8XA 3ABZA 3E6FB 3FAXA 1URLA 1HHJB 2WWMD 3PGDB 4PRBA 1PDKA 4ZUWA 5C08A 4WWKA 1QFHA 3QIWB 5EOTB 2DM7A 4ORGB 1OP3K 3QI9C 2DD8L 1IAIL 5I1HL 2HN7B 4XCEB 4JO3H 4P9HC 1J1XH 3H3KA 3DUSB 3RU8L 4Y4FA 4K23L 1T1WB 1FNAA 3KPQB 2BSSB 2ICWJ 2V2XA 3FCTB 1OGAE 4QXUL 2RR3A 4KJQD 5HSFA 2F58H 3LS5H 1AXIB 5CP7A 1MFAH 5DFVC 3RDTC 3O6KH 3QI9A 4XCYA 1I8IB 3DRQA 3GRWA 3F62A 3LN5B 3ALWA 4X7TB 2VLJA 5JORB 2BNQA 2GCYA 1RUMH 4D9RD 1INEH 5DQJA 2V7NB 2C1OA 1H3TA 1U8HA 2DKMA 3RDTA 5JIIA 5CSZB 1JTPA 5DJXB 1P7KA 4M1GH 4PGZA 3UZQA 5I8EB 3I6GB 2CDFB 4U1MB 4KK6D 4Z0BH 1MLBA 2YS4A 1N0XH 4M48H 4CJ0A 3LSOB 3WNPA 5E2UH 2HRPL 1CL7H 4F37K 3QDHA 3VFGH 3I6LD 3FRPG 4GKSA 3B5HA 4PYHA 3WIIH 5CBEA 2P44B 3G6AA 2NY5H 3PV6B 4DOHB 3C5ZC 3BT2H 5DD3H 1CDUA 1MAJA 1FLRL 2LVCA 1T5WB 4I3RH 2X9XA 3D0VB 1MAKA 2CGRL 2OX5A 3QUZC 5HVGB 1FCGA 1D5BA 1RJYA 2DQGH 2EDTA 4PJ5D 5IVXA 3I6KA 4L3EB 4LCYA 1H5BC 1NCWH 1T1YA 1NFIA 4CDHA 4KDTA 4NQTA 4IJ3C 4HG4J 3C5ZA 1S9WA 3LN4B 1NMAL 1EMTH 3HAEH 3PG2A 8FABB 2OL3H 2BHZA 8CGTA 2W9DL 1Q0XL 4U1GC 2F53E 3WXWL 4JM2D 1MY7A 3QUZA 1S7TB 2FIKA 4LOUD 5I15L 1T0NB 4ELKB 2W0LA 1JWMB 1WSST 2D7PA 1H5BA 1F4WL 2X5PA 3PIQB 2CKBB 3VFOB 3FQWB 5A2FA 1FIEA 1JK8A 7FABL 1MREL 1A6ZB 1QVOB 2NMSA 4NUGL 1HEZB 3NIFE 4FFWD 3C9NB 1VPOL 1AI1H 5EBLA 3PABA 4WIQA 1PFCA 1N2RB 2DI7A 1FNEA 1DDHA 1KPUA 4P3WA 1CFVL 4IDJL 3SE8H 2MQCA 4N8CH 2V2WA 3HLAB 4FQ1H 3PWUA 4N0CC 2VLRA 1FJ1A 1ZK9A 5GSVB 3GSVB 2VIRA 1QFUL 2PO6B 2PF6A 1PY9A 1TETH 4FHBD 4WENB 5F7EH 1P7KB 3IDJB 5C0CD 4OLXH 3V9FA 4N5ED 2DMCA 1C7SA 3DIFB 4UNTA 2AXFB 3SKMA 1UC6A 5FO8B 5I1IH 3O6FD 3VWJC 2X89A 1TZGL 4QRQB 4N0CA 1OSPL 5CKGA 5JW3H 1KOAA 2VISA 4PREB 4ZUTA 5IOPB 5CBEB 5ILTL 2CO6B 1CDYA 4ZOEA 5JPMA 3NPZB 4LSUH 2CJUL 2IQAB 3C6SA 4PPTA 4H1LB 3S5LA 5GXBB 2K7PA 3QUMB 1NMBL 5CILL 3ULUC 5IVXB 4MA7L 3JUYA 2V7HB 2O26U 4MD0A 4OIAA 4JRYD 2VXUL 1T1YB 3RWDB 5CJQH 5ACZB 1IAOB 5E9DD 4XVTH 4WCYH 4I0PC 1FN4A 5F7DA 2O5YH 4F3FA 1CU4L 5GGUA 4PBXA 3QEHA 4Z5RB 4LCWB 5K9OA 2JELL 3LRSA 2HT3C 3EBAA 5L7XH 4NZUH 3VMNA 2EH7H 4TSAH 3TH2T 4I0PA 5GJSH 1KPVA 1WFNA 2FX8L 4HUUA 4N8VA 1YN6A 1Z3GH 1I3GH 2GYSA 5C2BH 4EVNA 2BVQA 4NKQB 5TQ0H 1CE1L 4QF1B 5J57B 1T20B 4G6MH 4Z9KB 3QFJD 5HVHC 3QCTL 2MWCA 1ORQA 3QSKB 5CP3A 1YNLH 3HC3L 2VQUA 3LRHA 5IVXF 4X7CC 2FSEB 3HPLA 5C86A 1X44A 1AIFB 1XFPA 4GRWE 4KFZC 3P11L 1U9KA 1AY1L 2DQIH 3VFTB 4AT6A 4D0DA 3RVTD 4ZDHA 3NFSH 1K8DA 1C5DB 3BOVA 2Y06L 4QT5A 5GRVL 4KC3B 1KN2H 3CFDA 3GEWB 1JRHI 5MP6L 3PL6D 1SM3L 3JWDC 4V1DD 4D9QE 2RFXB 2DTSA 5D93C 5ISZE 3VG9C 4Q9RH 1OM3L 3H9YA 1CD1B 4HUNB 2PW2A 4OKDA 1YUHB 4KMTL 4NQSB 3IKCA 2MHAB 3VWJB 4JO1L 4L8DB 3QDMA 3QQ3A 3R1GL 4BZ2H 1CN4A 4JPWH 1YEGL 2E9IA 5IHBA 1DBAL 2R2BB 2VN7A 3RTQB 3K80A 3NCBB 5I30L 4N0UA 1I3UA 4LNRB 1MQ8A 5IVOA 2CRYA 3TWCL 1FH5L 1IAMA 1A7RH 3OAYK 1MFBL 4K3GA 5K9OB 4NWUL 1FHGA 1X5ZA 5DURD 4JDVB 2DQTL 5EO9A 1NL0H 12E8L 1WCBB 4JPKL 3UJTH 1KPVB 1L0YA 3C2AL 3MCLH 4NKOA 1YEHL 3VXME 2WBKA 4JAMA 4F7EB 1GGYA 1XAUA 5C0GA 4R6UA 1ZA3A 4GQPH 2Z0BA 3V6FA 4C83A 1G7JB 4RX4A 2ITCA 1WAAE 4LKCA 4PJXB 3R0NA 4UILH 5C0BB 1B0WA 3BW9A 4R4ND 1G9NL 1E6JH 5CGMA 5GGRA 4K94C 4YXKH 2JCCA 4LHUG 4JO4L 5GPRA 3ZTNL 5CZVL 1HYRC 2J1KA 3DXAA 3UO1L 1FNLA 4G8GD 2VR9A 3FOMA 1RZIB 5GQBA 5MERA 4YGAB 3PQYB 3V5DA 4EUPG 1UADC 5B3NA 2J5LC 4QT5B 1TNMA 3L3IA 3GSRA 4UQ3B 4YDJB 5MEQB 4GXUN 2DLFL 3SKJL 3EKCA 4IEFB 4FFEX 1KYOK 4D9QD 5I9QB 1YECH 3QAZC 4JN1H 4P5TC 1UQSA 4LLUA 2DN7A 4OF6A 4ZFOA 2GUOA 3A6OA 3BUYB 3D5OF 4PB9L 5E24E 4FZ8H 2YK1H 3IXTA 4LF3B 4UV7H 3LDBC 3BJ91 5I8OL 2E7MA 3B83A 4OKVB 4PJ8D 3W0WE 4XXCC 4P5TA 4K3EL 3QP3A 4PJXF 2BNRB 4PTTB 3S3SA 3V6ZB 2BVPB 5ESQB 1G0XA 1SBBA 4GS7B 5F72S 3U1SH 3EOAA 5F9JA 4PJFB 4G6KH 4OGXH 2CK0H 1C16A 1BBJA 3MFGB 5JR1H 1I7UB 4FA8A 2NW2A 4GKOA 3GJEA 4ODUB 1SEQL 2DLTA 4XXCA 1PYWA 4R7NA 4FNLH 3SPVB 1DEEB 1BVLA 4N0YL 3U0WL 2Y7QA 4C56A 2QLVB 5GS0L 4N0FA 2FWOB 2GJ6D 4RWHA 5C0AB 5SWZA 3VI4E 1BQLL 5C6WH 1J88A 3S34H 4XWGL 4MA8L 4XHQA 5BVPL 5DLMH 2FRGP 3SGDH 3UPRB 4R3SA 2XTJD 5IBUG 1G9MC 4Z77A 3DX9B 3QQ4B 5BJTB 1RJLA 4XNUH 4YDKL 1I4FA 4BK5A 3EDDA 4WU7B 3UPCA 3O0RH 4X4YA 4X7EC 5I1GL 4GMSH 4TSCH 1I8MA 1UZ8A 3ROOB 1SY6L 1KNOB 2XIDA 2ZCLH 4PJFF 1A6VL 5GISL 3L3IB 5JUEL 1IEAB 3RVXD 1F8TH 3KYKH 3FO0L 4JEGB 3WFHA 2EKSA 4XRCB 4EDXA 1UQSB 5I71C 3RA7L 1MQKH 1KLUA 5J6HB 1SBSH 4HF5L 3U0PB 2V17H 3IDNA 3I9GL 5SV4A 4KQ4H 4O51B 3O6ML 2ED7A 2EC8A 4XP5H 4X0KA 2Q86A 3QHZH 4HBCL 3IDXH 5F1NA 4TQEH 2Q7NA 5IQ7L 2PNDA 3QT2A 2YD1A 1M7IA 1P84K 4GSDL 5EULV 1F58H 2H2SC 3KDMA 2DJSA 4YDVB 4DCQA 3U48A 3LDBB 1U3HD 3LEYH 1CICD 3OZ9L 1WISA 5D7KD 2J8UE 2HFGH 4GUPA 2VE6A 4PJIE 5IB4B 1GZPB 4ODVH 3OKMA 1FL6B 1TVDA 3SGEH 3TO4A 3VXTB 3MRKA 5BZDA 3QIUC 1SJXA 4NO0D 4R3SB 4P46C 1FVCB 4ZUVA 3OSKA 5B39G 4PRPB 3D39D 4DK3A 3DO7B 5IMKB 1IAIM 2JIXA 4XMLH 4OUUB 2VC2L 2ZUVA 5T3XH 1A7OL 4KHXH 1LEGA 4X4YB 1DVFD 5C0ND 3QIUA 3CIQA 3S96A 1K85A 4XNXH 4UIKL 4I5BB 4HLJA 4P46A 5I66A 5CD3A 5IG7B 4WWID 3PP4H 4LU5L 5IHZA 2NY0C 2C7UA 2UZIL 4IRZL 1A2YB 1Q1JH 1T22B 2YXMA 3CFJB 4YBQC 3ZKXC 2BVEA 2PYFA 5D7JD 2FHCA 1AHWC 4ERSL 1UM5L 3KVQA 3L7FA 1BX2B 1W0VB 5MI0B 3KPMA 4LSSH 3FT3B 1CGVA 4TOYL 1FFRA 1NMCB 4X6BB 5DJ0B 1YYML 4HK0A 1JP5A 1G0YR 4NQXA 3EOBA 3T3ME 3MRQA 4MXVE 6CGTA 3SQOL 3UTPD 1NJ9B 2ITDA 3A67L 1U8JA 4WI9A 3IETA 1YA5A 1K5NA 3MLZL 1HQ4B 3D85D 3PWLA 4Z7VB 4PRIE 1YN7B 3MACL 3BEWA 1N7ML 2BX5A 5FO7A 4RRPA 1BFVL 2YPLA 2IWGA 3HS0B 5JW4R 1TJIL 3LEVL 1D5MA 1A7BA 3FTGB 1A7QH 4LEOA 4AL8H 1S7RB 1DLFH 1JE6A 4KI5D 3EOTL 5GS0D 3VRLF 1DEDA 4LLQA 2X1XR 1LQVA 1LK3H 3VA2C 5D2NB 4XNMA 1KIPB 4KJQC 2P43B 4Z0XA 2CDGA 2DWDA 4LPYA 4YHYC 1YEJL 2BSED 4NGHH 1CF8L 2R8SL 5ENWA 4KZDL 2X4PA 5HGBB 1CR9L 1KELL 3WFEL 3KPSD 4C54A 1FVDB 5F21B 5E08L 3CFCH 1FNSL 3U7YL 1GCFA 3DV4A 4KUCF 5T1KD 2RHEA 5MEPB 4CJ1A 1OTSD 2R2EB 2B1HH 4F57L 5D7IA 2R1YB 4Z7VF 3BRDA 3RGVC 4DKEL 1FCCA 3C60C 2Z31B 2P47B 2AJ3A 4L1DA 5DD6A 5KBNC 4QRPD 4M7ZC 5ETUB 2I60L 1N0XL 4QLRA 1U92A 2NY0B 1JPTH 1T89C 3GDBA 4HK0B 5I1KH 1J8KA 3KLAA 2QSCH 3RGVA 1NANI 1B4JH 3C60A 1AHWB 3ALPA 3O9WC 5DHYB 2HFFA 1IFHH 4ZTPL 4Q2ZB 4NT6B 4X99A 1U8JB 3LD8B 3IRPX 4I3GA 1K5NB 3BMVA 4BYHA 3EGSA 1T89A 2UZXB 4I2XA 4R90L 1KB5B 2QQNL 3AREB 3P9MB 1X5FA 4JG1H 5D96B 1U8IB 3O9WA 2JJUA 1JGUH 2UWEA 1SVCP 2AK1H 5I6XB 1RZGB 1DBJH 1HIMH 4TUJA 3ZKQD 3JTTA 4LOUC 2A2QT 5TQ2L 4GKZB 4LEOB 2NY3D 4YH6A 5AZEH 1QPXA 2EDLA 1W72H 4RDQG 3ZDXE 5KVGL 1KTDA 3TVMD 2VN4A 3SO3C 5E4EB 3EW3B 4M8QA 3BKML 2PYEE 1LO2H 2X42A 4PGDB 1F5WA 3GSWB 5DJ8A 3KPOB 3NGBC 3MGTB 3CX5J 1RHHA 2W9EH 2KKQA 4XTRD 3SE3C 4WFHE 3GMNA 3L5IA 1BZ7B 4EN3C 2I27N 2VO5A 1OGAA 4PGBA 4CVZB 5CEYA 1AP2B 5DQDH 3RP1A 4LMQI 1IM9D 1EBPA 3UTZA 4ZD3L 4HK3N 4ZFFA 3NH7H 2OCFD 3E2HC 3SE3A 4MAYD 4LKXB 3TIDA 4O2EB 2ARJB 1MRDL 3O6FC 1LGVA 1YMME 2XOTA 4X5WA 4EN3A 2X4QA 4R4FL 4ZPTA 3ROLB 1UA6H 3CSPA 5LGJB 2FJFA 4X6CB 3CUPB 5FOBB 3GK8H 1A6UL 2IAMD 3P3YA 4YQXH 3E2HA 3Q5YA 2ZOLB 3KGRA 4JQXC 4ZFGL 3N9GH 3VH8B 3V0AC 1MAML 3MRLA 4QNPE 2OZ4A 2EEBA 5CJOH 3MZTA 2Z8RA 4MHHG 2Z9TA 4RIRA 1QFPA 3K2UH 3C09C 2WP3O 4G8FA 5KSAA 5ESAB 3MTRA 5FF6A 3V5HB 3TZVD 1JGLL 4JQXA 4PY8J 3O3BA 3L7EA 3WHE0 3QEQE 5C0DA 3HFMH 3DRTB 4HV8A 4PJ5B 3KYNB 5HI3C 4G5ZH 3WFCH 3AAZB 4OFVA 4Q0XH 5DD0H 4CL7A 1CGSH 2QQKL 1U8OA 1GGCL 1CXFA 3BD5A 3CPLA 3T8XA 1F90L 4XAKE 4CADB 1I9EA 2XZAL 2F53A 4JM2B 4OCRL 3LPFA 3U4BL 1CLZH 2VLLA 4JQVC 5IK3B 4X6CF 5I18L 3V5KA 1S9XB 3I75B 3M1BB 5ERWA 5GHWL 3VDAA 3VFRA 2FR4A 2R69L 2OP4L 4OCYH 4WUUE 4WFHD 3ZYZA 5HDBF 5DD5H 2VLMD 5LGKA 4BFGA 2X4NA 3MA7B 2FLBT 4JQVA 3MLUH 2V9QA 1S5IL 5T1LD 3BWUC 3NGBB 4QRRE 4UT9H 4F7PA 3KYMA 4PR5A 4BH8A 4H8WH 3KXFB 4QHKJ 1AFVH 4HIEA 2X4QB 3SKUD 5IMMB 1A0QL 1FZOB 3SBWC 4R26L 1EBAA 2D2OA 3MROA 1RQ5A 3ARGA 5IB3B 2WINA 3EYOA 5C0CB 4LLAA 2A9NL 3CLEL 4ZAKC 1CFQA 3O6FB 4TVSa 4YFLF 4JM2F 3WHXB 1AGCB 4M61B 1AXTL 3U7WL 3SBWA 4MGXA 4WRLA 1MF2L 4BELD 1ZOXA 3EDFA 1NAKL 3NZHH 1IL1B 4ZAKA 1IEBA 2HVKB 4W4NA 1KLFA 1JPGA 3MRFB 3ZDYF 4JRYB 5IGXL 3ZSTA 2ADGB 1U8OB 1T2QL 3BP4B 4J1UA 4OSUL 4D3CL 5B8CC 2E7BA 1P7HL 3QHFH 3ORJA 5E9DB 1R3JA 4N68A 1RZ8B 3AU1B 5CS7A 2YA0A 1XR9B 1ZANL 1TVBA 4LVOB 5EFIA 1X7QA 3WS3A 1VESA 1FYTD 3UTOA 5B8CA 4R4NC 5D1ZD 1VACB 5H35B 4JFYB 2E6QA 3WHE1 4PFEA 5CWSB 4MQSB 4UOW1 5E8EB 1TNNA 4HKZB 4J8RB 2P1YA 4WGWB 1HHIA 3QFJB 1JV5A 3EYQD 43C9A 3EFFA 3SKOB 5DI8B 4BH8B 9CGTA 1QD0A 4HIEB 3RQ3A 4UB0H 5D5ME 3WL9A 2WUCH 1ZVSA 4O2FB 2HLFD 4J3TA 4OV6F 2N1KA 4R8WL 5T5NF 4IMLA 3RWHA 2XQYK 2ZOKA 4Y0GA 1S7WA 3DHMA 2H32B 1EDQA 2F8OA 5I8KL 3NPSC 4FTVD 4DAGL 1UWXK 2E7HA 3PL6B 1FSKC 2AQ1A 4V1DB 5HJ3B 4MZ2A 3BPLC 5DJAA 2HVJA 3MRBB 5ISZA 4AJ0A 3SJVB 3MCG1 3V4PL 4FZEH 4MCZA 4I4WB 2DBLL 4WNQA 4AG4H 4MX7A 4QHLA 1PKQB 5CEZL 4OQTL 4I9WD 5TGBA 1S8DA 3JV4A 5I2IA 4LPWA 1I1YA 5GIRB 2DQJH 2X4OB 1GC1C 5HYSA 1G6RH 4Q58C 1B0GA 1BF2A 4FXKA 4OCSH 4YE4H 4ONHB 1FGNH 3F7YB 1TXKA 1KIRB 4PJGE 2A73B 4L4TD 3TPKA 3HUJE 2EE3A 1Q38A 2WAHA 3OKNA 1MNUH 4YBLC 4QCIB 4ONGH 3PWPD 3DX6B 5DURB 1U95A 2XFXB 1ZT7B 2ADFL 2Q8AH 1J8HD 1P7QD 2ED8A 1H3UA 3VXMA 2GJJA 3OB8A 4K8RL 1HHKA 1MFCH 1U8MA 3B9KC 1OAYH 2ZSWB 3HRZB 1FDLH 1WBXA 1WAAA 4XNUL 4NC1E 3AVEA 5KN5A 4JFEE 3IS0X 5D1QD 5LBSL 1DLHA 3WL9B 4WO4A 1NH6A 3GBML 1T4KB 5E8PA 3SKNB 1KPRA 3X12B 4JKLA 4G8GB 4LLDB 1YY8B 2R1XB 3B9KA 4ODHH 3HCVB 3TCLA 3BAEL 3L3KA 3VXUE 1QSED 1ZHBA 1B2WH 2A83B 2F74B 5JO5A 3I50L 1JL8A 2H26B 1PZ5A 2VL5B 4U6HB 3JV5A 2A9MH 5GS3A 1AQKL 4KQ4L 3OXRA 2JB5H 4H0GA 3C5JB 4NHUE 4MNGB 1JYXA 3QHZL 1XZ0B 3LN9A 2VDPH 3G5VA 3C5SB 3ULSA 5JPNB 2AEPL 4PUBL 3JTCA 3BIKA 4HS3A 5DJDB 1U3HC 4XMPL 5I16B 5GGSY 3BPLB 3MBED 1V3JA 4OCXL 3LOWA 4PJ8B 4OCNC 4J7RA 3W0WA 4YGVB 3RWEB 4WJ5A 2DQHL 3WLBB 1WJ3A 5DMGD 3EYVA 3WO4C 1ND0A 4OIIH 4WTZA 1DQLH 2DF3A 3BEVA 5AYUH 1JHKH 1MHCA 1MLCB 1OAQH 1BD2E 1IC7H 3DYMA 3H7BB 3H3PH 5JOFA 4UDTA 3LQAL 5ICZB 2YN5A 4M43L 4F37F 1W0WB 2VSCA 3X13A 3MODL 2XZZA 1ZKAA 2GJ6B 5BS0E 2VXQL 5LAXA 1KCRL 5FKPB 1HXYA 1G9NC 3P0YL 5F1IA 4GXVH 2X6MA 2YA2A 4LPUA 3G5YB 1OP9A 3JWNC 2XTJB 4GKNB 1V7MH 4JFED 1OB1B 2B4CC 3KPPB 4XNXL 5DR5H 4KY1H 1JHTA 2JB6B 3WKML 4MNQD 3MLTB 3QEUA 1R5IA 4DUXA 3UX9B 4H26B 5ESVB 3P4MB 1MUJA 4J4PD 3DETD 1UH2A 1PSKL 4OCMC 3RY5A 5DYOA 1EA9C 2UY7A 3DURB 1IBGL 3QYCA 1PKOA 4QRSB 3OXRB 3K74B 3CXHK 2WQ8A 4XCCL 2NY4C 3QDGE 3MV8B 1FFQA 3KLDA 5DGRA 4BSVA 1DBML 4R2GD 4ZPVB 3OHXB 1RVFH 5GZOC 3EJJX 1HKFA 4XP4H 3TBSB 1NKRA 3IFLL 3BKYH 2W07A 4UNVA 1NUDA 2G9HA 1JHLH 3DI2B 1RUPH 3FHAA 4OV5A 4NQEE 5CEZD 2HKHH 2HG5A 1EJOL 4XBGB 1ZLSH 1T21A 2YKLH 3TYFA 1B0RB 1U3HB 2ERJB 3D9AH 3FQNB 1CICB 3D85A 3V7AG 4JHWL 1I9IL 4KI5C 2GSIA 3P0VH 1YNTB 1F2QA 1V7NL 5GS0C 4MWFA 4Y2DC 2J8UA 1UH4A 3WO4B 1U8PA 1SMAA 4AL8L 4PJIA 1P4IH 5IKCA 1CLOL 4MCYA 5BS0D 2AQ3A 2BY3A 5DJYA 1EXUA 4NO0B 3MNWB 4Y2DA 2FJGB 2AJZA 4XC1L 3ZDZE 3D39B 4NM4H 1JNJA 4K8RD 1TFHA 4M7KH 4OLWL 1JI1A 3IRZA 2HFTA 1Z9OA 4LLWA 1KYOJ 2FGZA 3CC5B 1ZHKB 1DVFB 5T3XE 2HJKA 4G3YL 1ZTXH 3H42H 1R5IB 1DQJB 5F88B 4E41D 3BP6A 4QTIH 5DF0A 2BMKA 5FGRA 2DQUH 5BVJB 5DS8A 5EOQL 1KACB 2F5AH 1DE4A 2ICWA 5B38B 5E6ID 3ZHLA 4X5XA 4JVWA 2GITB 5DYOB 4YUEH 5ABDE 4MD4A 5D7JB 4M7LH 4AH2B 1MCIA 3R4DA 1REIA 1I7ZA 4H1LG 3X3FH 2BCKA 3QFDA 3L5XH 5DVKA 2XG4A 3BWAB 4MDIB 1C5CH 2P8PB 4JHAL 2J88H 4G6AC 5DC4B 1NAMH 4MJID 2AJUH 5BZWB 3P4OB 2X4RA 5D6DC 1ZE3C 5HGDA 4KKBC 3FRUA 3MLYL 5GZND 4N8PA 2O61A 3S9DB 3HN3A 3QEGH 4U1LA 3D85B 5CEXB 2AI0L 4IRSC 3MGOB 3QCUL 1G6RB 4PRIA 3KPLA 4OLVL 1GVIA 5D6DA 1I8KA 3MRGB 1LNUA 1TZIA 1U36A 4WI8A 1JRHH 2D31B 1L6ZA 2Z92B 1OP5H 4FQHA 1XR8B 5DJ2A 1AE6L 3FO1B 1N64H 4IRSA 5I1JH 1KJ3H 3TC9A 5E7BA 4Y5XA 2Y23A 5DK3A 2QBWA 3UXFA 2AQ2A 4JO2H 1A7PL 2A0LC 3RVUC 2DM3A 4LLWB 1A3QA 2AXJA 4E42B 1H0DB 5DEZA 4E0RA 3K0WA 1ITBB 1M05A 3TIEA 2BFVH 4MAYC 1PEWA 2A6KB 1JUFA 3KPSB 4EXPX 1A3RH 3TA3C 3ZE2E 2GT9A 5T1KB 1PLGH 4RGMC 4DW2L 1IM9A 1F6FB 5K9JH 3RL1B 1FL5B 1HI6B 4RFOL 4HUVA 2J6EL 3NACL 2IAMC 3T0DA 1N5YL 2IMNA 3GM0A 5FO9A 2MOVA 4I1NB 2EC9U 4Z6AT 4K7PL 1P84J 2VAAB 3PP3K 3TA3A 2EH8H 3ERYA 1ZHLB 3CVHA 4NNXA 4QRPB 2X4UA 4Y88A 3H9SE 4JRXE 3EJYC 4JFHE 1CTOA 1YPZE 4GG8B 3UDWC 2X4RB 4ALAH 4EI6B 2QHRH 3BPOC 5HGDB 4BUHA 1I75A 4U0RC 5E8NA 2LU7A 2VDLL 2ZUQB 4JY5L 3UDWA 2ZCHL 5CJXC 1MVUA 4YDLB 1XGPB 3WFCL 3PWJB 1CS6A 4P4KD 3HZYA 4P23D 1K2DA 4N8VG 3ULVD 2W0PA 4TUOB 1P4LA 5C6TH 5HHNB 2XWTB 2NY3B 3F7PC 4F7CA 3KPNA 4OB5H 3TVMB 5CJXA 1UH3A 2DQCL 3F5WA 5DT1L 4Z7UB 2PYEA 1QR1B 4JFQB 1J7VR 2B39A 3GIVA 5IHUL 1E27B 1RSFA 5DRWB 3CZFB 2ZG2A 1EFXD 1A6TA 1ADQL 5E1HB 3WIHL 5JNYA 4WUKH 2VZ3A 1M1SA 1IM9B 4OT1L 3TT1L 1J0JA 4HUVB 1AFVL 2FL5B 4RZCB 5E5MA 4MAYB 5ITBH 1XGTB 1QYGH 1J1PL 1YMMA 1DUZA 2OR9H 2FDBP 1R5VA 3HI5L 2NY7L 1LO5A 4JFZL 4XBPB 1I1AD 2B5IB 4HIIA 2I07B 3QH3A 1XH3A 3TBTA 1P9MC 3ARFC 2IAMB 3INUH 5SWQB 5DUPH 4HD9A 3FB6A 2A1WL 4Z7UF 5J9PB 3TBVB 1MOEA 1P9MA 3ARFA 3ARSA 3L5WB 4ELME 1A9BB 3TZVB 3AXLB 4K3DH 1RK0B 4LAQL 5EU3B 1TQBC 3QEQA 4QYOA 1YQ2A 1PVHA 4LLYA 1DQMH 2E3VA 4R4BA 4WHYH 3D69B 2LAAA 2PXYD 3HAEA 4K7FA 5ADPH 2FX7H 2OL3A 4RAVA 1HCFX 4RGNE 5I76B 1FPTL 5EBWA 4PJCB 4DTGH 3T77A 3VG0L 2P24B 1H8NA 3EYQC 4OD2B 3G5XB 3O2DH 4WUUA 1DSFL 3AB0C 2DI8A 1XF2B 3VRIB 5DA0B 3P73A 4P57A 1EAPB 3PJSA 3AY4C 5T1LB 5IW1B 3BE1H 3KYAA 2F8VA 3N85H 5FYKH 3MLRL 4QRRA 1OAUH 1AGEA 4U05A 1XCTB 4AIOA 4M1CD 5JDJA 2QADC 2IGFH 2W92A 3AY4A 2EICA 3B9EA 1T03H 3RRQA 4QGTA 2XZCL 4M6OH 4XZUA 1ZLWK 4BSWB 4X6EB 1L8JA 4XCNB 3CFKA 2G2RB 1JTTA 1WT5C 2Z93B 3TNNA 2HFEA 3VXSD 2VDQH 3ECBA 3CDCA 4PJCF 3MOQA 5EPMA 2G75B 3MFFB 5A40E 1S9VB 5ICYB 2NZ9D 4OLZL 2CIKB 5C6PB 4PP1D 1LK2B 2CKNA 2VXTL 3OKOA 1WT5A 5H2BB 2VABB 3CDGB 5CBAB 4M6NL 4KRPC 2FH6A 2WBJD 3DVGA 3HPJB 4H88H 4G6JH 4ZNEE 2ATPB 2A74B 5D70H 5EN2A 4KU1A 3PDDA 1TQBB 4LPXA 5EH1A 4AIZA 4WV1C 2EKJA 1FYTB 3T77B 2VKWA 5JHLL 5FB8A 5D1ZB 4I18B 5D1QC 4PJEE 1RHFA 1MFCL 4JRWA 3V8CA 1EX0A 2YD2A 5IV2B 1A3LH 2V5MA 4JFFD 5C09D 1FG2A 1F42A 4HUWB 1HDMB 4WV1A 4PRHE 5F3BA 2VWEE 2DM2A 3GI9L 4X6FA 4RBPH 1DL7L 4JFDE 3AB0B 2QQLL 1QRND 1U93B 1UWXH 3HNSH 5D1QA 1TJHL 3VXNB 5D5MA 2CLVA 3PHOA 4Z8FL 4PJHE 5BRZD 3REVA 5IT2L 2R0LL 1E4XL 2R9HC 4EQ2A 1JNNH 3TEUA 4FP8H 5MEND 3RUGE 1JNHA 1IGML 3O2VL 3BKCL 4FTVB 4IDLA 1C5BL 3BPCA 4OZ4B 4HIXH 4P5MA 4IOFC 5A16A 2AV7A 4Y19D 3E8UL 5D7LE 1R3HA 1J0IA 3FQXA 3WFBL 3GFUA 4Y1AE 1KEGH 4LCCC 3MJ8B 1OARL 2H8PB 3CCHA 4LSDA 2MCG1 1HZHL 4GW5B 3QZWA 1XGRA 1RUQH 1YQVH 4S0SD 1H9VA 3RPIB 1T04A 1F4YH 4KMQA 4P2QE 4WEBL 1ZT1A 3GO1H 4LCCA 4OZHB 1BAFH 5GGRY 3U9UA 2R4SH 3PHQB 3HMWH 3LB6C 4L4TB 5KAQG 4PJGA 3T1WA 3T4AA 2BHUA 3HUJA 1FNHA 3GSUA 3O3AA 4GAJH 4ONFL 3O3DA 3V79C 5T3ZH 2OM5A 4AIZB 1MI5E 2A6DA 2NY1D 3PWPB 4OLYL 1NANH 3JBG7 1N6QL 1AXSA 5FB8B 3MR9B 4NC1C 5GGVY 1D5IH 1J8HB 1M6OA 1E6OH 1P7QB 1UVQA 5DQ9B 5JHDE 5FGCE 4RMUA 3O6LH 2PCPA 2NYYD 4HW6A 2R4RH 5TDPA 4RA3A 3AS1A 5EZJA 4KY1L 4JFDD 4RFNC 5D1QB 4J4PC 4JFEA 3DETC 4FFZL 3ILPB 5IEKA 2CPCA 4GO6B 4U1IB 1NDGA 4MNQA 5LG1A 4I3SL 2W0FA 1A4JA 1VERA 4KJPD 4S1RL 4OZHF 2OS7A 4OAWB 3MV9E 1QSEB 4ZQKB 3VXUA 4J4PA 3W39B 3WYRA 4QRUB 4UTBH 2O5ZH 1T7VA 5T33L 3IJSB 3QPQC 1MHPH 3PHSA 5IIEA 4LIQH 3GJFH 4NHUA 1ACYL 4RRPG 4CMMA 5D1XC 1N8ZA 3OXSA 3ESVF 3ARDD 4DGVH 3GMMB 2WM0A 1BM3L 3MBEB 2VZSA 1XGYL 1S7VB 5C0IB 2DI9A 5J6GB 3HNVH 4UTAH 3UBXB 4H5SA 3UTTB 2BVOA 2HKFL 5D1XA 5GSRB 1FO0L 5BXFA 4DKFH 4U6VL 5E2VL 5EBMA 3VRJA 1DBBL 1BD2A 1GAFL 1G7LB 1MJJA 1ULVA 3MRIA 4PBVC 5HPMA 3ES6A 3L3GA 4LARL 1AXSB 4NO2A 1MHEA 3BYTA 3C8HA 4S2SB 1R3KA 4K8RC 3U6RA 5IM7A 4UUJB 4M6AA 4JN2A 2ORBL 5JHDD 5BS0A 43CAB 3TYGH 3SDYH 3AGVA 5HHMD 4JZOB 3MXWL 2VDRH 4IMKC 2QR0A 5KW9L 5TDPB 3RZCD 5ALCL 3L5JA 1JPSH 3B2UD 4GG6E 4X4XA 3M8OH 3K2MC 2IH3B 1JBJA 4UV4L 4UDUA 4G9FD 3RY4A 3SQBA 4MNQB 3UJIH 1O7SA 1P5VA 1WGOA 1LP9B 4IMKA 4R97C 4DVBA 1RV6X 3IB4A 3FJTA 3P4NB 4K2UL 1U91A 5BO1H 4FRWA 3VH8G 1NLDL 4F9PA 2JK5A 3TFKC 3HZMB 1RIUL 3LY6A 2D0HA 2XWJB 1MRFH 3TBWA 2YSSB 3UYRH 4QHMA 2AV1A 1K4CA 3FQRA 4FQJL 3VJ6A 5T1DH 4D0BA 3GMRB 2EIZA 3WE6A 4FQ2H 3QDGA 4HIHA 2C3VB 4R2GB 5EORL 5GZNC 3LMJL 3P77B 1U6AH 3TFKA 1I7TA 1EEYA 1EZVX 4YHKH 4JZNA 3IGAB 5KTEL 1IT9H 2FHFA 4HWNA 3FQTB 4TPRH 5DVLA 5IB1A 3CVIL 4NQEA 2NW3A 1S5HA 4DWHA 5SX5K 3KPTA 1C12A 5M95B 2CMRH 1KCLA 1OGTB 2WZPD 4OLUL 4J3WA 1LP9F 2NTFA 1JRHL 2A38A 2COQA 5JXAL 4O4YH 5EZIH 1S7SA 4F7TA 1B4RA 1YNKL 4ZO9A 3K81A 4JN2B 1NFDB 5I1JL 1AO7E 4R0LC 1J18A 2IADA 3WJJC 3S88H 4I77H 1UFUA 4MDJA 5L9DL 3BDYL 2XPGB 3MOAH 4JO2L 2FCBA 1PZUB 2NY2D 1FNGB 4XPHH 3GSNH 5B3JE 4X7FC 3MV01 2BFVL 3OGCA 1NCAL 4CU8A 1A3RL 4R0LA 2NY6C 3OKLB 3T4YA 3RBGA 5TH2A 3WJJA 1MJ7L 1Y0LA 2XNAA 3O3EB 1H8OA 4DVBB 5IMOB 4E41B 2AAVA 2B0SL 5DK0A 3MXVL 1U42A 5E6IB 1MWAL 4NRXB 3F12B 1CWVA 4MYWB 1CFTB 4CRPA 1Y6NR 1BFTA 4JPIB 1U41A 4L4JA 5DFTA 1A1OB 1QSVA 3LPWA 1ZA6A 4AK1A 1I1FB 2GHWB 3PXJA 4X83A 1UYWH 4HIHB 5LKNA 3BRGC 3CFEA 1YJDH 3MRMB 3QULB 4CMHB 1NFDF 4KTDH 4RMTA 1MVFA 5LJYH 2BNUB 5E03A 25C8L 3QJFA 4MJIB 4FABL 5AUMB 3VXRD 4QHUB 3LKRB 4PB0H 4TULL 2F19L 2IBGA 1LDPL 4GQ9L 4PJ9C 3IDUA 1FZKA 3AC0A 5KS9E 1QACA 4HS8L 1J1OH 5KANG 3FZUC 3VGHA 3FFCE 5ANME 1Y6MR 1WV7T 4K9EL 4BFBD 1S3KH 2AK4E 4KKAC 2I9LB 15C8L 1WIPA 5GRWA 3AS3A 4JR9L 1PQZB 4PJ9A 4EUPH 2E6PA 1FIGH 3FO9A 3FT4B 4U7KA 3HG1D 3KPRE 4JDZB 4NO5B 5DJZA 5DXWA 1BGXL 2SEBA 1KJVB 1QBML 2YUVA 4G42A 3UTQA 1NBYA 2XZQH 4JDTH 1I3RA 1NBVL 4O02H 5INDB 2EYRA 1NEZB 2LU4A 2YZ8A 3FKUS 3PGFL 3MYJB 1TVHA 3OGCB 5C0JB 3QWQB 1M71A 1M7DA 1IAKB 4R96A 2Y36H 1LEIA 4NJ9H 1RFDL 2H6PA 3IDGA 3CXHJ 1F00I 5J3HD 3GGWB 3PP3H 1EFXA 1VFAA 5SWSE 3QUXC 5DSCB 4XPTH 1QUNA 2DDQL 5JXEC 5HYJE 5ITBL 3GHBH 3F58H 4M5YL 5E2WL 4KAQL 4M62H 1JFQH 5F96H 5HGAA 3S37L 3UC0L 2OTUA 2QKIA 3MA9H 3PDOA 1U2CA 1Q94A 3OGOE 4APQA 3QUXA 2WBWB 3GMLB 4UINL 1CL7I 2AJYL 4LL9A 5JXEA 1C08B 4NZRH 4AQOA 5J06A 3H9SA 4JRXA 2VDML 3U36B 1BEYL 1YPZA 4MJ5B 4D0CB 1N0LA 3V52H 4M6MH 1IGTB 3T0ED 4Y4KD 4YHOH 4H20L 4NM8H 3TO2B 2UZYB 1XF4B 1ZWIB 2PR4H 4TRPH 4L29B 3W9DA 2XXMB 1D6EA 1OAZL 5T1MA 2CXGA 2ZJSH 4IM8A 2CIIA 1F3DJ 3SO5A 2NX5E 4PJ7B 3E6HB 1MH5B 2PXYC 5EUOE 4QXTA 4PJDE 4JQIH 4P4KB 2GJZB 3LKNA 4P23B 2ICCA 2ZPKH 4X7SH 1ES0A 5D7SH 4L9DA 1UXSB 2P8LB 3O2WH 3HI1A 5KSBB 4MJ6A 1YEFL 1EUUA 1W72A 2EYRB 2EDKA 4K3JL 2X1QA 3C8KA 4PGCA 2DL9A 5EZOL 2EXWD 1MRCH 4OM1H 1S7QB 3PF2A 5EOCL 1N26A 3DI3B 1LEIB 5I19H 2X1WL 4YC2C 1MCBA 1MCOH 1K3IA 1J86A 3LV3B 5ID1A 1EFXB 3IXAA 1T0MB 2Y9RT 3NFNA 3MJ6A 3N06B 4M1CC 4P3CL 2IPKA 4M4PA 2CR3A 3N85L 5FYKL 4YHZL 4YXLH 4KKCD 2J4WH 1OAUL 1WC7A 3UAJD 3JTSB 3U0TA 4ZXBD 3QO0A 4R7DB 1A22B 1KC5H 4IIQC 4PJ7F 4MJ2A 4LASL 4PDCE 4GAYA 5IEHA 3NABL 3U82B 1I1AB 4AENB 3ULVF 5L2KE 2J6EA 2P49B 3ESUF 2Q7YA 1EV2E 2HLAA 3A6BL 1HHHA 4IIQA 1FV1A 4FQCH 5KSBF 4PP1C 2CLZA 2VDQL 3BZEB 3IFNL 4KJWD 6FABL 3MCKB 4WI6A 3VXSA 1D6EB 3B6SB 1L0QA 3O81A 4CVXA 3GKZA 3BO8A 3KAAA 1K6QL 2MQ0A 1S9YA 1OF2B 2Z35A 3DECA 5FHAL 1CVRA 1NGZA 2NX5D 4PD4K 4NPYA 5DO2D 1NEUA 3VXQA 4M5ZL 4ELMA 5MHSE 1TLKA 4KTEH 4A6YH 2BRQA 3NIDF 3LKNB 4FMKA 3RX7A 1BIIB 3UTTE 4JY6A 1WTLA 4G6JL 4LCUA 2UVEA 4LDLB 3S35H 3OKDA 2BSTA 3GKWH 2W38A 4QOKE 3JV0A 5I1LA 2PXYB 5CIPA 5EZLB 3GSXA 2EEDA 5HI4C 5JMOC 4GRLC 4JM4H 1XIWD 1YEKH 2ADIB 3Q3GA 5EA0H 3KJ4C 3ZL4L 3QNXB 5JW5A 35C8L 5BV7L 4HS6B 3EZJB 3OJDA 3MRRB 5AG9A 4RCAA 4C57C 5F9AC 3GSNB 2AGJL 4GRLA 4H8WC 3MYZA 4WY7H 4WW1A 1UKSA 3ZE0E 4IBLT 4NOBA 5C09A 4KKNA 1WTGT 1MJ8L 4ZYKA 1AD0A 1ADQA 5FYKE 4J6RL 3QNYA 1U8QB 4XP6L 3DX7A 5IR1B 3MLVH 1UJ3C 4P2CG 4KZEH 5CMAB 1HSBB 1X6LA 1FFOA 4NN6C 1UZ6F 5K9KB 4S0UC 1D9KC 3B2VH 1I7RB 1JN6B 3MRPB 5IQ9B 2WMPA 4BQCA 2XKNA 3TJEH 2KH2B 5IMLA 2C3HA 3K8MA 3RNQA 5H94B 3VXSB 3GRWL 4I13B 2HYMA 5H37G 1AGDA 1SJHB 4GOSA 4NUJB 1ZSDA 4TTGA 3BO8B 1S9YB 5IFAH 4B0MM 2Z35B 1D9KA 2R0WH 5FYJL 3HKFA 2BDNH 5K59E 2Y6SC 2VDOH 1CFSB 1QLRB 1HYSD 5MHSD 4L9LC 5CGYD 5C0FA 1OCWL 5TDOA 1U0QA 1QHOA 4NN5B 4LQFL 1INDH 4OTXL 4OFPA 1NGXB 2AEQH 3OKEB 4ETYA 2EXYC 2BSTB 4NRYA 2WBJB 1RULH 1LDSA 2NY1C 2O5XL 2YUZA 3QA3B 4XHJC 4DKDC 4ZNEA 5IJVB 1G7HA 4DQOL 4U2YA 1J05B 4NNYB 4Y16C 4Z7OE 4YHNA 4NQCE 1N3NA 4OGAD 3A6CL 4UT6H 5CJ5A 1D5IL 1L9MA 4KVCL 3L3DA 2VWEC 4YX2H 2J8HA 1EGJH 1ZT4A 2FJHB 3NVQA 3QJHA 5HBBA 2AABH 4Y16A 4PJEA 5B38G 1WBZA 4U6YA 1Q9OA 1QKZH 3ZE1F 4JFFB 3ELAT 5C09B 4YR6B 3KJ4B 2KQNA 2DB8A 1HH6B 4PRHA 4KJPC 1EH9A 4Z76A 3QNYB 4NFCA 4PRAA 1HINH 4JFDA 1QRNB 3DX7B 4WI3A 2N7BA 3BRFA 3VFVA 4HWUA 5I75C 5BRZB 1QNZL 4PJHA 2OJEB 1MIML 5F97E 2EECA 1XGQA 2EYSA 1TZHB 5HDQL 5MENB 3ARBC 3D0LB 1WCQA 4AEEA 3RUGA 5TE6L 2UY6A 5C07D 1UJ3B 4KJYB 3JV6A 3LKQB 3W2DH 3GSOA 4YXHH 3WSQH 4B7LA 4Y19B 2YD4A 1I9JL 4P3DB 5HHVL 4FXLA 5D7LA 1ZEAH 4NN6B <