4Z77A

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Weak TCR binding to an unstable insulin epitope drives type 1 diabetes
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 75
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z77A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4z77A01
3FO1A 1NAMB 2ILLA 1YMHA 3MRNA 3PIQB 3L5XH 1L0YA 4IRZH 4O02H 4M61A 4HAGA 4JFXA 4ZXBB 1KCVH 1HHJB 2IADA 2AJXH 3DSFL 1PKQB 1B0RA 4EDXB 3HB3C 4JRXB 4K3JH 5C2BH 3HI1A 4LQFL 1OQOA 5D71H 1YEJH 4X83A 3ZYJA 4OD1H 4LSPH 4XCCH 4TNVK 4MAYB 1FSKC 4QHNB 2PR4L 4HX1A 4M62L 5DJXB 3WN5B 2WUBH 4G6FD 4DUVA 4PJ7A 3OG4B 4Y4FD 1V3LA 4I9WE 2DAVA 1HWGB 3G08A 2IANB 4OZHF 1RK0A 5IR1A 5TE7L 1CU4H 3K81A 1CFNA 1R5WA 4HUUA 4POZC 1I7RB 3BPLB 4PJBE 1QRND 1ZGLP 1A9EB 3I3DA 4PTUA 5HHVH 4PGBB 4Z7UB 2H9GB 4JO3L 4YDJB 3WUZA 2QKIA 3GKWH 2VJXA 4P9HC 3G6JF 4OBSA 32C2A 4JO4L 4DQOL 2YD9A 3L5HA 5CEXB 2EYSA 5CJQL 4FTVB 5CILL 1A4KA 5F7FA 3OGCA 3NH7H 4F9LA 3X13B 2BJML 3BJ91 4MXQD 1T1ZA 2YZ1A 1RURL 3D3VE 25C8H 4POYA 1W72H 3QEQB 4JRXD 4OM1H 5D2LF 3T0EB 2R4RH 4RX4D 3KPRB 3OKKA 2EDXA 4L3AA 5DD3L 5ITFA 1MFBH 1CICD 3LKQA 1N7MH 1VHPA 1IAOA 2Q6WB 4JKPL 4RMSA 1D9KB 5D7JC 3IJHA 3ZYZA 3MA7B 1UCTA 3BDYL 2NMSA 5I1EL 4OIBA 4IHOA 2BMKB 3I6GB 2QQQA 4IJ3C 4Y4HB 4Z7OE 2ADJA 1A9BB 3VFWB 3W0WB 5JXED 4YHMH 5IT2H 5D96C 2VE6A 3ULVL 4Z8FH 2EDOA 3MXVH 4LNRA 5EBLB 3VGDA 3W11C 3DI2B 3WUWB 1NLDH 3NCCB 2ITCA 3LQZA 4UILL 1PYWA 5EUKB 1NL0H 3BP4B 1I85C 2R69L 5H35A 3D18A 4HEME 1X44A 2YWZA 5F7EH 5GSVB 2MKWA 3GMPA 1CDCA 3GRWA 3SJVE 3BYTA 1LP9A 1WSST 4GRWE 1TZIA 3HNVL 1EV2E 3D85D 2BP3A 2E6QA 3BW9B 5FHAH 4PGEA 3KR3L 2CKBA 1CFSB 4LBEA 1FYTE 2BC4A 4XWGL 2AV1A 1R5IA 5I8EB 4F7MB 3RRQA 4LK4A 4R0LA 5HHMB 3QEQD 3QWQB 1NCCL 4LP4A 1FJ1B 1EFXA 2BSTB 1A14H 2P24A 1H3PL 3DMMA 4ODXA 1VSCA 1N64H 4RZCA 3DBXB 3B5GA 4QXGH 3RAJL 1MLBB 1MIML 1MRCH 2BSSA 5C2UB 5INDA 3O2VH 2AQ1A 2AV7B 1QQDA 3JWOC 4FQCL 4HT1H 3QO0A 1EXUA 4Y4HD 4NNPL 5JW3L 1CD8A 4G43A 3BEWA 1OTSD 4P59H 3O9WC 3RBGA 3TJEL 4F7EB 3IDNA 1AGFB 3MLWH 1WT5A 5ALBH 3TBYA 5KTEL 5EUOE 1EEZB 1DCLA 2BZDA 4MZ2A 5DTFA 1L6XA 1ORSA 2VITB 3EYQD 4DOHB 2QJDA 1RD6A 3GSNH 4HGKC 1FBIL 3Q5YA 1NGPL 5KS9F 4Q9RL 5T5NG 1PGRB 2X9XA 1ZVSA 2PYFB 4W6WB 3T04D 43C9B 1RIUL 5DD1H 1S7QA 1HSAA 4JDVB 1SM3L 1E27A 4MB3A 5MERB 2NZ9C 2DWEA 1M6OB 4XVJH 3BJLA 4FFVC 2GFBB 1AKJB 2ZUVA 2VXVL 4GAGL 5INCB 3QIWB 3DX8B 2DM4A 3QEHA 4G6JH 3WNPA 5I1LA 4N5ED 1KOAA 3KYKL 3LKRA 1UZ8A 2IAMB 1LILA 4PJ5E 4HMEA 3KAAA 1JGUH 4HUWB 4HG4K 4DKDC 3RZCC 1LE9B 5FK9B 3HR6A 4J6RH 1FZMB 4V3DB 4MSWB 3QZWG 2SEBB 3REWA 4NJ9L 5BS0A 1EHNA 4WI7A 4OAWB 4M7JH 3U7YH 3N1PC 2HVKB 1NGQL 1FO0L 1XR9A 5D6CA 4IS6B 1MCFA 3P11L 2I60H 2DLTA 1FNFA 4EXPX 3CFJB 1VACA 4TPRH 2YMXH 4J1UA 4RSVA 5A16B 2G9HB 4G5ZL 5F8RC 3DV6B 2EDYA 2HJFB 4F33A 1UVQB 1X3DA 5LCVL 2MWCA 2VLKD 2P48B 3ARBC 3B43A 4M5ZL 3T0DA 1UQSB 1FNGB 5IW1A 5T3ZE 2UV3A 4XB7A 1K5NA 1WIOA 5HYJA 1NCDL 3NCEB 4YUEH 4OCRL 2VXQL 4R4ND 3I3BA 3QIWD 4O5LL 2WK2A 4HJ0D 3NZ8A 4XVTL 4M9OA 4N9GA 3ARYA 4GRLA 4OM0H 1MJUH 3I2CL 3P9LA 1CYGA 2Y72A 4DZBA 3QDJE 4UIKL 3PWPD 3A6BL 4MJ5B 4RGOH 5A2KH 4KJQC 2IAMD 2EO9A 2Z35B 2V2XA 4Y19B 3UTOA 4ZFFA 3L7FB 4EBQH 1GZQB 5KSBE 2CXGA 4PGDA 2JCCB 4QYOA 3RNKB 3WXVH 4QTIL 1PG7L 4P3CL 5T1KB 1MCLA 3A6CL 2AQ3A 1NCBH 4ZUSB 4M5YH 2VLRE 3MJ8A 4OLZL 3MOAH 4NIKB 2WWMD 4JFHE 4OZGF 4XNQA 3W9DB 4XP6H 3KYOA 5DS8A 3D39B 5TDNA 3DV4B 4QRRE 2NLJB 3IFNH 1P84K 4G7VL 5FYJE 3RIAK 3TIDA 1JWSA 1YZZA 1EO5A 4Z5RB 1BJ1H 1ZT1A 3B6SB 3KPMB 4PP8C 4YHKH 3QQ3B 4ZFGH 5EBWB 3L3OB 4GBXA 4L4TB 3K1DA 4I3RL 1KB9J 3BH9B 1A6UL 1DLFH 4KQ4L 2R1YA 3X14B 1A64A 4KUZH 5CWSB 5IFHL 1T6WA 1PX4A 4GT7A 2GUOB 4S1DC 4RMTA 5KW9H 1JPTH 2VIRA 3VCLB 5AYUL 1T5WB 2LV4A 2HWZL 2V17L 3QXVA 4OF5A 4FFYL 4WO4A 5I66B 1GPOH 5EN2B 4R2GC 2CR3A 4I4WA 1A5FH 4RISL 4Y19D 4PRBA 1BHGA 1XF5B 2HTLD 5BCAA 3V6BR 2BVPA 2XWJA 1Y18B 1YPZA 5T1KD 1VCAA 1DEDA 5E2VL 1PW3A 1A6ZB 2BNQB 2D31B 3C2AL 3BP7B 3E1F1 4LPYA 4N0FA 3GI8L 1MLCA 5IOPB 1D6EB 1RZIB 3QG7H 2A74B 1TETH 4U1JB 2ICCA 1A21A 3SGDI 3F7QA 2YK1H 3D9AH 2FDBP 1NUGA 4EXKA 4ISVB 3D39D 4CMHB 3PHQA 1A22B 5DT1L 2JJTA 5E08L 3O41B 1OSZA 4NJAL 4G6KH 4RMUA 1BFVL 1U58B 1EGJA 3QULB 2YA2A 3ARUA 2F8XC 3BKCH 4RAHA 3PWNB 1J87A 3RWGB 1JGLH 2VDLH 3EJZD 5BXFB 3MYJB 1XF4B 4UV7H 3S96B 5FYKH 3VD4A 1YY8A 2P5WB 4G3YL 1NSNL 2CLVB 4JCMA 4E41B 4W4OA 4QKXB 5FIEA 3HZKB 1LO4L 4CUCA 4PS4L 4GW4A 4HWUA 2ZCLL 2HLFD 4X7TB 4H8WL 4CN6A 5BMFL 2YD1A 1CZ8H 1PLGH 4HS6B 2W60B 2WLYA 4L4VE 3LH2L 4OLEA 4NYLA 5F8QC 4YDKH 2XTJC 4IMKC 4WI8A 2UWEE 1T22A 5ADPH 2MNUA 2ORBL 5DHXB 3RP1A 3MLZL 3QDGD 2W1NA 1G9NL 3MLSL 4UNUA 4WWKA 1H8OA 1MY7A 3UBXB 5ACZB 2BY2A 2ZSWB 1W8NA 2D7MA 3DROB 4NSKB 2V5TA 3IDJA 4ZOEA 4QRSB 4O4YH 1KCSL 4P46B 5DJ6A 4ZFOL 2H8PA 5C0EA 5F6IB 1F97A 2E6PA 3NN8A 1KJVB 1SBSL 1P7KA 2Z8VC 1PSKH 3VXNA 2CIKB 4GKNB 1RZJC 2COQA 2EDEA 4GRMA 5D7KD 1MRFL 5ICZB 1OWRM 2QTEA 2PW2B 5KSAD 1C12B 1MFAL 3TFKD 2D03L 3MRQB 2PR4H 4BSWA 1ZLSL 2UYLA 1LD9A 1X4YA 2DICA 2G5BB 4P2CG 4EUPB 1RK1B 5CD3A 4UTAL 4PRNA 4E5XB 1N5AA 4D9RD 4X7SH 5TE7H 4UQ2B 1EZVX 3G6JA 2EH8H 1CXHA 3MLYL 4EI5C 3HRZB 1IAIL 1G0YR 3HG1B 2QEJA 2PO6D 4AL8L 4GMSL 1QBMH 3AM8C 1ZLWH 4JO3H 1ERNA 3H9HB 3VGFA 5BO1L 4GW1B 3S37L 5ESVA 1F5WA 1QLFA 3OKMB 4JY5L 4C56E 1LGVA 4PV8B 1WQVT 1QFPA 1LEKB 4JO4H 2LTQB 4YGVA 5L8KB 5CJQH 5CILH 15C8L 1XF2B 3WCYA 4LKXA 2BJMH 1KPRB 1RURH 5K9KB 3QI9D 3QT2A 1MI5B 1U3YA 1HNFA 2B1AL 5CZVL 3RPIB 3L5IA 4IRJC 5DD3H 4YHIB 4K8RC 1IAII 3IXAA 1D5XA 1S7VA 4NHUB 3NGBC 2F5AL 5F71A 4L8CB 1ONQA 1A02N 5FO9B 1BGXH 4JKPH 5FV1L 4YDVB 1K8DB 2QSQA 1JVKA 1IC1A 3RWIB 3WLWD 3BH8B 3BDYH 1HHGB 3FZUC 3HUJA 1Q9KA 2C1OA 5E8NB 5I1EH 3R1GL 5SWZD 3M45A 1FP5A 5FF6A 2DKSA 4ETYA 1OGAA 3ULVH 1I3UA 5IBUG 2XKNB 2BCKB 3L3JA 4UILH 2DL2A 3FO1B 1YMHB 3IU3A 3MRNB 4F37F 1X5XA 2R69H 5D7LE 1PZUB 4XHJD 4HC1L 4U49A 1EO7A 2IADB 3B2VH 3MJ7A 2XRAL 1X5IA 3HS0A 4ONGH 3U4EB 1MCWM 3X11B 3QNYA 4Z7NF 3HNVH 4OCXL 3ZT7A 5IQ9A 2GKIA 3FAXA 3C09B 3ZE1E 3ORJA 3KR3H 4MLSA 1VGKB 5DJ2B 4JY4B 1M7IA 4AENA 4XWGH 2IBZY 2E27L 3LPWA 3F5WA 4CMMA 1YDPB 1NCCH 1JYWA 4PJ7B 3CUPA 1F3DJ 1H3PH 1RK0B 5GGTL 2IFGA 4L9DA 4X4XA 1YEDB 2J8UF 5GS0C 4MD0A 4JHWH 4HUUB 5C0JA 4ODSL 1CGUA 3VA2C 1F6FB 4L3EE 4FQCH 3U9PL 4HF5H 4EQ3A 4NZTL 4OSUL 5I16A 2EKSA 5JW3H 1P7QB 2RGSA 2AW2A 1RHHA 2QKIB 3QJFB 4XHQA 3TJEH 3TYFA 1VENA 4AY0A 1KTKE 5HVHB 1A1OB 1LMKA 3DVGB 4QXUL 1S9XB 32C2B 3H9YA 1NMCC 1JTOA 1I7UA 1TVDA 2EYSB 5HDBE 5A2FA 3MRMA 3OWEA 3OGCB 3VDCA 4UQ3B 4X8XA 4QF1B 3IRZA 1T1ZB 3RJDA 3MO1A 1H5BC 1FBIH 1B6UA 2DL9A 4Q9RH 4FMKA 1IKNA 1XGTB 2YEZA 1F02I 3MLUL 3UTTB 2WP3O 3OKKB 1RIUH 5ITFB 2ATKA 1HYSC 1SM3H 3LKQB 5CJXA 1T4KA 1IAOB 4K3DL 4FQLL 4ONFH 5BV7B 4YX2H 1BOYA 4QTHB 2VXVH 4GAGH 4UV4L 4M7KL 1RV6X 4HKXA 4NKMB 5I8CA 1J18A 4YXKL 2EH7H 2GTWA 4L1HA 5D1XC 3KYKH 4P3DB 4LNRB 4NC0B 3O2WH 3AFLA 3BKYL 3C5ZD 1PYWB 5D2NA 1FL6B 5FKAA 2AXGA 3HAEA 3D18B 5DMKA 4AIOA 2N1KA 3S88L 1U8IA 3ESUF 4N0CD 2DJUA 2J1KA 3GMPB 3VXPA 4NJ9H 5C07E 6FABL 4PY7A 4XBGA 3K3QA 3SKUD 2NX5B 1VEPA 1TZIB 3WJLA 4DUXA 2V2WA 1NGQH 4TTDD 4LCWA 1FO0H 5TE4H 2XICA 2DLFH 3O8XC 4PJCE 3QO1A 1F2QA 5JA8B 2A9NH 4G8IA 3UTTD 1EFXB 2EDJA 5LCVH 2GJ6A 4M5ZH 4Y16D 1NCDH 4OLVL 3BZ4A 2BSSB 2JB6A 4OCRH 5J8OA 5INDB 5TJWK 2NY1D 4XVTH 1EXUB 4OT1L 4LPWA 4G43B 3KXFE 1T80A 4XNXL 4UIKH 3IDNB 3QUZB 3QUXB 4OZGA 2C7UB 4FN0A 3RDTA 1M1SA 5IEKA 1ZA6A 3W39A 4MB4A 1PG7H 4FXKA 4P3CH 4X6CF 5IVXE 5DTFB 5EG6C 3QEUB 1ORSB 3A6CH 4PJDF 1FNLA 1E4WL 1N2RA 1OAUL 2DLHA 4ZTPL 2WUCL 2H2PD 1QHPA 4PREA 1BD2A 1T7WA 2NTSP 3EIFA 2NX5D 1MCOH 1EEYA 2OCFD 3SGKC 2PYEB 5BRZD 1PX3A 1S7QB 1D5IL 1HSAB 4YLQT 1E27B 3NPSB 4G7VH 1OF2A 2DWEB 5DZNA 3RVTC 4Y2OA 2C4FU 4KVCH 4PG9A 1WGOA 4PRHD 3MQIA 1AXTL 5EU6A 1I7TA 3ULUH 3QEHB 4D8PA 1A7OL 4I3RH 5I1LB 1FZJA 1A6UH 2EDQA 2KDGA 1CDUA 1UZ8B 3GKZA 3SDCA 5IFHH 4WFHE 3SGDH 3I75B 4C4KT 4YHYB 1KV3A 3U0PB 5C7XL 3BXNB 1VESA 3MV7E 4Z18A 5E8DL 2HWZH 4UIMB 2Q8BL 4HG4J 1CFQA 2I07B 4FFYH 4M7LL 1Z9OA 2JTDA 2DF3A 2P45B 3SKJL 2P43B 3QUZD 2JK5B 2YR3A 3VRIA 1A1MB 5TGBA 3NIDE 4JM2C 3SQOL 4HUMB 5E2VH 1XR9B 4NO0B 5D6CB 1KACB 3VXRA 1BF8A 3C2AH 5ALCL 1FVDA 4Y4KA 3GI8H 1UZ6F 2YS4A 2ICWI 1VACB 3CNKA 4NC1E 1EDQA 1GRWA 4F33B 4Y2DC 5EU7C 2YA0A 1Q9WA 5DT1H 2XZQL 5E08H 2FJFA 3CLEL 4NJAH 5D7IE 1K5NB 1JFQL 1CVRA 5HYJB 3BZEB 1BFVH 3IYLW 2ARJA 4LHJB 3MUGA 4MNGA 3AY4A 3GJFA 2OTUA 2QQLH 4FFWD 3P9LB 2BXZA 3GM0A 1FH5H 4DZBB 4LU5H 1R3KB 3SDAC 2Z31C 3GSVA 4ZFFB 2V2XB 2AKRA 4KK9D 4PGDB 4QYOB 1NSNH 4WI6A 4D3CL 5GJSL 5MEPA 2GAZA 5IB4A 1S9VB 3SDDB 4PS4H 1A7QL 3IJSA 2A73A 5DUBA 2ZCLH 5E9DE 4U1KA 5BMFH 1T7XA 4XNQB 3LH2H 5TDNB 4WU7A 3MBEB 4X6FA 5DYOA 3LD8B 1P84J 1VPOH 1JWSB 3TIDB 3V6FA 1NBZB 3JUZA 2ORBH 1ZT1B 3MLZH 5C0AD 3ULVE 2FB4L 3MLSH 1S78C 2APXA 4F8TA 5F44A 4O2CB 3H2WA 4X99A 1QFWL 2HFFB 4P4KD 3TPUA 4NCC2 5DRWB 5FUZL 5JZ7C 2PKDA 1TQCC 3GHEL 5CBEA 2Q8AL 1KCSH 4MVBC 5J12C 4X5WA 4GG6F 1TXKA 2NY2B 4NPYA 1U42A 4MA7H 3V8OA 4PRAA 1YEKL 1FNAA 1T2JA 4KMTH 1AE6L 4AJ0A 4I4WB 4PRBB 1QACA 4KRMB 5L88H 5MEND 2BVPB 4OF6A 1MCHA 2XWJB 1MRFH 3SCMB 1A0QL 1MFAH 4PP2B 3GMRA 3B9KD 4JFYB 2UZXB 4M93C 4N0FB 4K9EL 5D1QD 4R3SA 1KELL 1MLCB 1QFWI 1TQBC 4JQIL 4UTAH 3WHE0 1MJ7H 1PBYA 3IDXL 1RPQA 1NGWA 3K74B 3CDGA 3CFDA 3TBWA 1OSZB 1IAIH 4MNQE 3L9RA 3WXWL 5LGHL 2RHEA 4AL8H 1HYRC 4GMSH 4M6OH 2D2OA 3VD5A 1U3HA 4XPAL 5BO1H 4WNQA 2IPTL 3BESR 4LFHD 1A3LL 1MFEL 5GZNC 2VB5A 4JY5H 1DJSA 4XX1E 3N9GL 3F12A 2XKSA 4WUUD 4MDJA 2DIJA 3SPVA 15C8H 2Z92A 4X7CC 1YY8B 4KK8C 2W91A 2PO6A 3BIBX 4LSRL 1BQHA 1JMXA 1C7TA 2X1XR 4YPJA 1UB6A 5DVOA 4GW4B 2N7AA 4JFED 2F5AH 3TO4A 2IEPA 4MDIA 3UJJL 4LPUA 3G5ZA 4NBXB 4NO5A 4TULL 3L7EA 1YJDC 1ZKAA 1A7RL 3EO1A 4PJ9D 1BVKB 1QEWB 3V0VB 1DVFA 3LEXA 3WIFB 1T22B 4OF3A 3MRGB 5CEYB 4WWKB 1DQDL 4OCSH 2CH8A 3CDYA 4ZSOA 5CEZD 2C26A 4CU7A 1UJ3C 1CFBA 4FQIH 3N06B 3VI4E 2HMID 3DUSA 4OFKA 2OQJA 3NCYP 4OFVA 1BREA 5GRWA 3V5DB 2ATPB 4HC1H 4MJ4A 2M2DA 4X8JA 2V6HA 5SWZA 1PAMA 3BQUD 4FQXA 2B2XL 4ZUUA 3WDIA 1T89C 5DMIL 2X7LA 1OW0C 1P7KB 4OCXH 2A83A 1EEQA 4P2RE 4X6DE 4JN2A 3S3JA 2J8UA 5IBLC 3VG0L 2P1YA 3RKDC 3PL6A 1XGYL 3N85L 3C2SA 4PJFB 2E27H 4BSWB 1DBAL 2GITB 2UYLB 1LD9B 1URLA 2NY3D 1X5HA 1TMCA 4KJWD 1FNSL 5CD3B 4BSVA 2XPGA 5EBMB 1N5AB 4YXLL 2R39A 5GGTH 2R23A 2OP4L 4ODSH 5A43C 4NNYB 3DUHA 4BK5A 4JFQA 4NZTH 2OX5A 4OSUH 4PRPA 4YHPB 3MRLA 4XX1G 5ESVB 3RVVD 1NAML 2G75A 1KN2L 4QXUH 3LKPA 1T2XA 1RZKC 5SV3A 1LO0L 5IB3A 3P4LA 2OJZL 4QRPA 4TVSa 1FL3A 3D3VD 3MRRA 1MJ8L 2AK1L 3KDMA 2VAAA 4Z77B 4MJ6B 4GG8A 3MLUH 1CF8L 4YAQA 1B9ZA 3IXAB 1D5XB 2VLJA 5J13C 1U8KA 1XZ0B 3H7BA 5CSGA 2EXYC 1ONQB 2ZUQC 2GIYA 4K3DH 3HI5L 1RULL 4FQLH 4PJBF 5MHSE 3V0AC 2QADC 4HWNA 3GSOA 4PJHE 4UV4H 1XF3A 5ERWA 3HUJB 4M7KH 1D6VL 1Q9KB 2C1OB 5AZ2H 4LF3B 3ULUE 3PJSA 1I8LA 3G5YA 3B2UD 4JKKA 5FF6B 4YXKH 5JR1L 2DQEL 2V9RA 1OGAB 1C7SA 1Y0LB 4NC1C 4QGYA 1N59A 1K2DA 4JO1L 3L3JB 2IFFL 3V7AG 3H3PH 3BKYH 3ARTA 1JI1A 3MYZA 4W68A 4HIJA 2R2EA 2DQFA 4KY1L 2YPKA 3G6DL 4N9OB 3ARRA 2RJMA 3BRFA 2Y25A 3M07A 3UO1L 3MJ7B 3FB7B 3HS0B 5T5NF 4OD2A 3QNYB 4ZMAT 2YC1A 4L8SC 4HDIB 4AENB 1DANT 5E5UB 1VKXB 5IWLA 4Z7OF 4P99A 4RQQB 2ZNXA 3RVUD 4CMMB 2NQCA 1CLOL 1T21A 2JJVA 4KROC 1S7UA 1Y6NR 1TTFA 3CIQA 3VXOB 4X4XB 1NFDB 4BQ6A 3VXUE 3HE7D 4OLVH 2ZCHL 2OSLA 3TH4T 1IKFH 4DGYL 5ADOH 5HVFB 1HQ4A 4X6CA 2NXZB 3IAPA 3OKOA 4PJDA 4CU8A 5I16B 2NXYD 2EKSB 2NY4B 4OT1H 2O93L 1Z3GL 4KV5E 4GRWF 4XNXH 4NFCA 3TYFB 5KZCD 1WBYB 3BGFC 2WINA 2F53A 4ZG1A 5IMMA 1KCLA 3VRJA 5MEQA 3ZKXC 1LK2A 3MRMB 1WCQA 1E4WH 4E0RB 2WM0A 4PR5A 4M43L 2WUCH 1EVUA 5D1ZB 2DM2A 3PP4L 4L4JA 4L9LC 5DD6A 4LAJH 1VB9A 2ATKB 5DHVA 1I8MA 1D5IH 4I0PC 3VH8B 2BNRE 1RVFL 3UTQA 2VKWA 4LCCA 3H9SE 1KLFA 2C9AA 1UT9A 4HKXB 5D93B 2XWBA 1V7NH 1A7OH 4YBLB 1JL8A 1QLEL 2GTWB 2F5BL 4TOYL 1E0OB 5BRZA 4JY6A 4OLWL 5EUOF 5D72H 3NMEA 5IGXL 1CGSL 5C7XH 1I1AA 2P47B 4ORGA 3OHXB 4XMKH 4PYHA 5E8DH 4U2ZA 5FCUL 4M3KB 2AXGB 3HAEB 4KPHL 3KNBB 5FKAB 2Q8BH 5DMKB 5C0NC 3QFDB 1U8IB 5SWSA 3CSBA 4TSCH 5IMOA 3VXPB 4GS7C 4NQCB 4PY7B 4XBGB 2ESVD 3SKJH 3LKNB 2O5YL 4RFNC 3RUGA 1GSMA 1HILA 3VXTB 3WD5H 2J5LB 4NZJA 1U8LB 4Y5YB 3GBMH 2PTTA 4Z0BH 2V2WB 4YGAB 4LCWB 1F58L 3VWJC 4QLRA 2Q1EA 5HTSA 5ALCH 1IGIL 5D1ZD 2XN9A 2NR6D 1N6QL 3LSOA 2OZ4L 3QO1B 1OTUD 5TDOA 2YWYA 4H25A 1T20B 4G8IB 4HD9A 1QO3B 3IS1X 4YXHH 1IC7H 5T3ZD 2XZQH 3IAGC 4WV1C 5D7JA 3MV8B 1JFQH 1UH2A 1W2KT 3CX2A 5C0BE 3STZA 2JB6B 3VXMB 3D25A 4MA1C 4EJ1C 3DYOA 1LNUA 4ZQKA 4DEPC 3ARGD 5H37H 1A3RL 3MJ9L 1G7JA 3QDJD 1BZ7A 3WLBA 3VFRA 3AREC 3RDTB 4PLKC 5IEKB 1YC8A 1YEHH 1ZA6B 5I17A 4FXKB 1BQLL 4HWBA 3K4AA 3G04B 2VZVA 5GJSH 4WI9A 4RMQA 1A7QH 4I13B 4NQCD 4KKNA 5BOPA 1OCWH 3H42H 2CRZA 1EEYB 2AGJL 5HXMA 1QSED 2MKLC 2OXGA 2KKQA 5E6IC 5FYJD 1E4JA 3FQTA 4U0RB 2O61B 1IC5H 1OF2B 1TNMA 2QLVB 4LRNL 3GB7A 1G1CA 5C09E 2VDNL 4D94A 5C1MB 3EDDA 5EO1A 2AQ2A 2FB4H 3BI9X 5EU6B 4OUUA 1BX2A 3E6HA 5TDPB 2UUDK 2P44B 1NKOA 1RUML 3NVQA 5KSBF 4V2BA 2R0WL 4MS8D 3V0WL 2DLIA 3MV8D 5E94A 3MRIA 3QDME 3OKLA 5FUZH 3VXMD 4LGPB 3GHEH 3GMQA 2Q8AH 3HMWL 5FM5O 4O9HL 3P0YL 4LPVA 1CFQB 3O9WA 1YEKH 2OL3A 3G5XA 2ADIA 1P4BL 1UKSA 5B39G 4CN4A 3QUYC 1J10A 5C0CE 5TGBB 2H26A 5JPNA 2DKUA 1S9WB 4P4KA 4D0DB 1A0QH 3TT3H 4PJEE 2YD8A 2VR5A 1N4XL 4NKQB 4HH8A 4Y4KB 4QY8A 1FPTL 1KELH 3IDXH 3H0TB 4G9FA 4NBYB 2Y4SA 3QWOB 1OD7A 3KHOA 3DUUB 2P8LB 1SBBA 4LSTL 3I6KB 4L1DA 4PGCA 5MI0C 3WXWH 5LGHH 1JZ7A 4OV5A 2Q3AA 3S4SG 5DFTA 5C6WH 4MNGB 3ULUC 4XPAH 2OTUB 2IPTH 1TENA 1MFEH 2CDFB 1U91A 1W0WB 1UWEL 3JWDL 4MJIE 3GSVB 3TZVD 2AKRB 4X6BA 4WFEE 5GS2H 2QQNL 4KU1A 2ADGA 5T1DL 2VLLA 3K2UL 3RZCA 3WHXA 4XAWH 2EDNA 2P5EA 2GAZB 5IB4B 3TT1L 2E7LE 3EBAA 1AO7B 5JIIA 1ZWIB 4CDHA 2A73B 1P2CB 3KPPA 4JHZA 1VFBA 2UZIH 2L7UA 1RQ5A 3UJJH 3UEZA 4OF7A 4OZFA 4U33A 3LRHA 4WU7B 4PRIA 1QSFA 2NY0B 4TULH 1GOFA 1WBXB 1X6LA 2CMRL 3QXDB 4XAKE 4XVUD 1A1NA 2BSRA 4XCNB 2LU3A 1AP2A 1CT8B 4P23D 4WW2C 2VZ1A 1JF6A 2AEQL 4WTZA 3TC9A 3QUML 5I75B 1PG7W 3E6FA 1CDBA 3ARBA 5IFJB 4X99B 5F1KC 3PF2A 4G6AD 3VJ6A 3SHSA 4I1NB 2R2CA 3R0MA 4OI9A 5HHOE 2AJUL 2WSKA 1ITCA 1JK8A 4RAUA 2V7NA 1CDGA 3IKCB 2YHGA 4ALAL 2QR0B 5DMIH 1X9QA 5DA0B 4PRAB 3U9UA 5ANME 5IM7B 1Q94B 2XQBH 4KZDL 1EIBA 4QXWA 4X98A 3BWAA 1CGWA 4I0KA 3ARXA 4U7KA 4HIXL 3VG0H 2A6KA 3B5TA 1XGYH 3N85H 4K71B 1OHQA 2UWEF 4EZMA 2AP2A 4QO1A 1AO7D 4KGJA 3DRTB 2KH2B 1FNSH 1DUYB 2DS4A 2DI9A 1HI6A 2AXHA 4YXLH 2HJLA 4TUJA 4QNPE 4ELME 3GFUA 2FX9L 3RTQC 4RGNB 5SWQA 4K94L 4AQ1B 1CDYA 4I0CC 1UH3A 3DXAE 4KJPC 2OP4H 3CDGB 4Z76A 4NN5B 3CFDB 3CDCA 4WDIA 4UAOC 1DBML 5T1LD 3T0WA 3L9RB 2EDWA 1MAML 3MCKA 2GQHA 1FDLL 2CDGA 4EN3A 4NUJA 5E7BA 1SY6L 2HN7A 4WNQB 1NAMH 5J06A 1KN2H 2H32B 1LO0H 2IPUG 1XIWD 4U6YA 4R9HA 5MP6L 4MMXC 4J3SA 1G0XA 2Z92B 3FQNA 4FXGA 4PJBA 1EAPA 3KJ4B 4PP1D 3MODL 1BQHB 1MJ8H 1UACL 2AK1H 2YD5A 1UB6B 1ED3A 2EO1A 2XQYK 1CF8H 4U3CA 3UTPE 3TF7C 4KAQL 3TO4B 5EC1A 1WWWX 4U6HB 6CGTA 3HI5H 4NO5B 3UBXI 3ELAT 3GBNL 2UY7A 1KJ2B 3L7EB 1D6VH 5EZIL 3VGAB 4OZIE 4R97B 1DVFB 1FVEA 5JR1H 4XP9L 3PGCA 1YYML 4DGIH 3ES6A 4JM2F 4MQXC 4RGND 3RI5K 4JO1H 4V2CB 4ZSOB 5HPMB 2IFFH 2YN3A 3MNWA 3T3PE 2FHCA 1QR4A 4WEUD 4Z7WA 3BIKA 3S9DB 4KY1H 1F8TL 4IIQC 5IBTL 4YFDB 1P5VA 3VE0B 1I4FA 4X8JB 4J4PD 1P7HL 2X89A 2FIRT 4FQXB 4NZUL 4PJ8C 4N8VB 3MMEA 4OGAD 4RCAA 5GIRB 1FZKA 3ARFC 2ID5A 1BQSA 5DJ8A 4JN2B 3S7GA 4HV8A 3WNNA 3ZKSD 2XOTA 1LDPH 1CR9L 3O3DA 1ZLUH 3EYUL 4MWFA 3U0TB 1XGRB 3SJVA 1SEBA 2VN7A 2Y7QA 1TMCB 1CLOH 4BSVB 2XPGB 1S5IL 1S7SB 1KBGL 1OAXL 2R23B 3TJHD 4HFWA 1L9NA 4FRWA 2ZCHH 1FYTA 2YUXA 4DGYH 2ZUWA 1SJHA 1ZVHA 5F70A 4IMKA 4JFQB 4TNVF 4PRDA 4KDWA 4PRPB 2VXSH 3FT4A 3PDOB 1Z3GH 3IDGA 2WANA 4HPOL 1P53A 2X9WA 1MQKL 2HT2D 1Z5LB 5EZJB 2G5RA 3RWCA 2G75B 3STLA 3ZE1F 1P4IL 5IESL 3FO2A 4UB0L 4Y1AD 3ZSTA 3ILPA 4JZNB 4N0UE 1J8HD 3KG5A 4KTYA 4JE4B 4M1DL 4M43H 5EWIH 3BPNC 2EC9U 5HYSB 3ZTJH 3PP4H 5ICXB 5L7XL 2VAAB 5DFVC 4QHKJ 4ZS7L 4GG8B 1WCBB 2EYRA 2YUZA 3VD7A 2D0GA 2ZUUA 5IEHB 3UTSE 5CLTA 5J89A 5EUOA 1U8KB 3H7BB 1M7DB 3FL7A 4OLXH 1U93A 4AEIL 5EOCL 1XF3B 3O4OC 4QHMA 2R1WA 4JDZA 1AJ7H 1IMHC 1QLEH 4TOYH 2F5BH 3ZKMD 2PXYB 2R9HC 4OLWH 1K2DB 4M4RA 5HDBF 2WP3T 1UENA 3QISA 5IGXH 1CGSH 1F4WL 1EVTC 2R2EB 3AM8A 5F3HB 2DQFB 4AIZA 2YPKB 4KPHH 3FONA 1RFDH 1A4JB 2X4QA 5L0QC 4GOSA 3HC3L 4DZ8A 5IB1B 2O5YH 1JPSL 3LB6C 5JOPE 4ENEC 5B3JE 5IHBA 4PJ5A 2ZUTA 1F58H 4GQPH 1OAKH 1IGIH 1N6QH 5FM8A 1CD0A 4QT5A 2OZ4H 3EOBB 3CMGA 4IRJA 4WEMB 1MHPL 1T21B 2CPCA 2ZZUT 2F15A 4OF8A 2AJ3A 5BV7L 4MD5A 3MJ6A 1UCBH 1YN6A 1C5BL 2F74B 5E00B 3UXFA 1FL5A 1AQKL 2X70A 3VGEA 5CBAA 1HQ4B 3MNVA 5F1OB 3CSGA 1J05B 2AEWA 1D5MB 3LN4A 3OKOB 1I3GL 1NUFA 3MRFA 4ZPVA 4HJJL 4XNYL 2E3VA 5FYKD 1XCTA 1JBJA 1QD0A 2WINB 4R0LC 1ACZA 2F53B 5IMMB 2DQHL 1AR2A 1LK2B 4HLZH 3TEUA 2W07A 4PJCF 5HDQL 3GRWL 1MCQA 1CK0H 1ZANL 2R1XA 2IGFL 4PR5B 3DMMC 5I6XC 4D9QD 3QUKA 2HT4C 3TBTB 3C8KA 3MRDA 4ZAKA 5H2BA 2AK4D 4CKVX 3QIBC 1FFNB 5DC9B 5DHVB 3MXWL 4CVXA 5KSBA 4DN4H 1NDMA 4YEEA 4GSDL 4F7PA 4LRNH 4OFYD 5ICYA 1FSKB 3UTQB 3QXAA 2OMNA 1H9VA 3HMXA 4OZHE 1WT5C 2ZPKL 3PQYA 2VLRA 1R0AL 3F8UB 1FZOA 2V5SA 2Q7YA 2X4RB 5IMLA 1RUMH 3H7LA 3B9VA 4JY6B 2R0WH 3EDKA 4K23L 3V0WH 1DN2A 1KTDA 4QRRA 5DA4A 4Z78A 5I1DA 5HYEA 3MREA 5CP3A 2DJ4A 3HMWH 3TNNB 1HDMB 4O9HH 4K7PX 1OM3L 3PUCA 5SWSB 4RFOL 5IMOB 4DKFL 3VFOB 1P4BH 1ZLVH 1YUHA 3RUGB 1HILB 3ZYIA 4LPCA 1KCUL 4YFEA 4LEOA 4JRYB 1T0NA 4LPTA 3I3EA 1RUQL 2H3NA 2A6IA 1IM3A 5D2LE 1N4XH 5E2TL 2Z4QA 2FGWL 2XN9B 1H5BA 1UEMA 3PP3H 3QAZC 1NCWL 3LSOB 3HB3D 3DIFA 1EEUA 4H25B 4P3WA 5T3XL 1A8JH 3Q2CA 1U8MB 1QRNE 3UMTA 4LSTH 5HHXH 5DJDA 4B0MM 1J1XL 2VDML 2Z91B 1N6VA 4NQEB 5D7JB 5DVKA 1NFIA 2C3VB 4UT9L 2FD6L 1T5XA 4I48A 1KC5H 1AGBA 4KKBC 3STZB 3D25B 4IJ3B 4E42A 1LNUB 4ZQKB 5D1XA 1NMBL 5D96B 4G42A 3FOMB 3WLBB 4OKVA 1UWEH 1G7MA 5J1AA 3JWDH 5EU5A 3NIDF 3HZVA 4GQ9H 1PKQE 2HFEA 3ZDZE 4JRXE 5T1DH 3K2UH 5IHZA 1S8DB 2FHBA 3K1KC 4Y7MA 1AQDA 3T0VA 3TT1H 3WNKA 3RA7L 5E9DD 2R4SL 3FQWA 5I8KL 4P9ML 1JNNL 4JKMA 3UZVB 2DM7A 4NUGL 5D7IF 3IKKA 3MUJA 4XZUA 1J8KA 1F3JB 3BPCA 4JRYD 1JZ3A 4GRLC 3R8QA 3FQTB 4NQSA 2CMRH 1G9ML 1AIFA 1W72A 4GKZA 3O8XA 3QNXA 5C3TA 3ULVD 2AVGA 5EO1B 1A3QA 1KLGB 2P46B 3QUMH 4I2XB 4OUUB 1BX2B 5E95B 1LEGA 3V4UH 3ALPA 3DGGA 4L4VA 3WFZA 4P5TA 2VUYA 4QGTA 8FABA 2AJUH 2YD2A 3GMQB 3SKOA 2FIKB 1IQDA 3RIAF 2UWEA 3EOYG 2I27N 4QWWD 4ALAH 3O9WB 3WS3A 2ADIB 4U1GC 4WCYL 1SJEA 5J3HC 4DFHA 3QEQE 3TYGL 4G6MH 2H26B 3Q6FA 1OTTD 4HQQH 5JPNB 1OB1B 3T0EE 3M17A 4GBXC 4TNWK 2IQ9H 4JZOA 1DSFH 2H2SC 3ULVF 2CUHA 3ESVF 4QY8B 3FO9B 2XXMB 1ACYL 4LKCB 2FX9H 4CADB 3W0WE 1BIIB 3P4MA 2XA8L 2HRPL 4WO4C 4OV5B 2DQJL 1FDLH 3THMH 1SY6H 3ZDXE 5D70L 3GM8A 1U91B 3TNMA 3K8LA 4XPBL 1LEIA 3S37X 1JGEB 3MX0A 4HBCL 5MEOA 4F9PC 4JPVH 3X3FL 4K2UH 4PBWD 2VLLB 3RZCB 3WHXB 3BGMA 3MODH 1UACH 2P5EB 2DQGH 4KTEL 1NGYA 1BQUA 4Z7VB 2Y5TA 3L5WA 4C56A 4KAQH 4PTTB 1U8PA 4JM2A 1XIWA 4ZYKA 4M8QB 1N6UA 1QSFB 4G8EA 4PRIB 2VTFA 5CIPB 3K46A 3K0WA 5CZXC 1NGZA 4EUPH 3GSNA 4DTGL 3AS2A 4ODBD 4GAYA 1AP2B 4XP9H 2ZP0T 5CEZL 1YYMH 4OBRA 3MV9A 5GS3A 3L6FA 4PFEA 3E6FB 1ETZB 4W4OC 3ARBB 3SE8H 3VJ6B 4WENB 3TA3D 3R8BB 1T7VA 4LL9A 2CKNA 1F8TH 4NRXA 5IBTH 4X4YA 1JK8B 1DBKL 4RAUB 1WUNT 3KLSA 3SOBH 4NZUH 1FIGL 3WHE1 5KANI 3SDAA 4DOHE 3VFSA 4I3SL 3FOLA 4KVNL 4ZFZA 4X98B 3BWAB 3OF6A 1HOCA 1KPUB 1OD9A 2A6KB 1E4KA 3C9NA 4LHUD 5D7LA 4BH7A 4MJ2A 1CR9H 2XIDA 5JDSA 1A7BA 3EYUH 2K7QA 2ZKHH 3E3QE 1U8HA 4C59B 4K3EL 1CDJA 4TRPL 2ICES 1T1WA 2FECL 1S5IH 1KBGH 2HJLB 1KTRL 2VZUA 3OB0K 3OR7A 2FBOJ 3VI4F 3QHFL 1MAKA 5J11C 4NBZB 3BKML 43CAB 4Z76B 1GGCL 5CJBA 4WDIB 4WHTB 3PWPE 4R26L 4Z7QF 3MCKB 2DBLL 2CDGB 4P2QD 2EE2A 1UEYA 1RHFA 1MQKH 1A6TA 4B7IA 3IDIA 3F62A 3IDUA 2V2TA 4U6YB 5IESH 2E7BA 2BVYA 2IJ0C 3G5VB 3DGCR 4L3EA 4MVBA 2FECI 5FO8A 4R6UA 1BM3L 1EAPB 4CRPA 5L7XH 4GAFB 3ILQC 1U8JB 4ZS7H 5JXAL 5DWUH 1S3KL 1ED3B 4NP4L 4KJQD 4R2GB 1FFPB 3VXSB 4I18C 3NZHH 1RJZA 5EC1B 1NCNA 1R3JA 4Q58C 3DYMA 4Y4FC 3MA9H 2J4WL 1KPVB 5EOCH 4AEIH 4B53A 2NY6D 5D5MA 3P9WB 5HHNA 4M6AA 5HGAB 3KLAA 3PGCB 3H8NA 5FXCH 1NQBA 5B38A 3ES6B 1NFKA 3BAEH 1DBJL 3MNWB 4C83A 1FIEA 1WEJL 1CE6B 5HGBB 4X5XB 4KUCD 4Z7WB 2F19L 4Y19E 2J88H 3VFUA 2VOTA 4HKBA 1PZ5A 2VN4A 2KBGA 1JPSH 2Z8WC 2ZNWA 1BZ9B 1TJHL 3U6RA 1IGTA 3DX9A 4HV8B 4G8FA 4G7YH 4JG1L 4PJHF 4LVOC 5F7NC 3NIGE 3O3DB 3RVWD 3OQ3B 3D39E 3U7WL 1CICC 4HS8H 5F7DB 4KRNA 1IC4H 5E2WL 5C07A 3KS0H 4XNUL 1SEBB 4JR9H 2OM5A 5DRXA 5DRZA 3QZWB 3GHBL 4D0CA 5BV7H 5KVGL 4ZO9A 1J88A 2DQDH 2OBGA 1C5BH 1KJMB 4KKLC 4L4TE 1FYTB 1AQKH 5ECJE 3I9GL 5JXEC 1U92B 4WTXA 2XTJB 4NN7C 4OTXL 1I3GH 3ROOA 1OP5H 3UTZA 3FT4B 3RWDA 4U2YA 1ES0B 3IDGB 4HJJH 4LCYB 3Q1SL 4XPHL 4UDTA 4XNYH 5GGVH 3RWCB 3FT3A 3BGAA 1UJ3A 3CVHB 5E5MA 1DFBL 2DQHH 2LFGA 5DHYA 3O4LD 5E6ZA 1FFQA 3FJTA 3NFNA 5HDQH 1I1FB 2MCG1 3ILPB 4S2SA 2IGFH 4JGJA 3ME0A 4FXLA 2XNAB 1ND0B 4HBQA 4X4ME 3S35X 1RJYA 3KXFA 3FB6A 5J56B 1OW0A 2E9JA 3KPSB 1K3ZA 1F2XK 4NN6C 3EUUA 1KXQE 2XFXA 3MXWH 2MQCA 4GSDH 3C6SA 3QDGE 5IVXA 1JF1A 4BQCA 4DVRL 2AJZA 4FOMA 3BP6B 2E9BA 1U93B 2XZCL 2ZPKH 4QHMB 5JPMA 2R1WB 3FMGH 4JDZB 4P5KA 3BP5B 1EK3A 1JWMA 4UT6L 2KUTA 2G60H 4K23H 3C6LA 4QOKD 3TO2B 1NCUA 3O11A 4KI5D 4EI5B 2MCPL 3CVIL 2XTJD 1IKNC 4AIZB 1OSPL 5CJ5A 3FONB 5C0GA 1OM3H 5CJXC 4R8WL 4RFOH 2P5WE 2NCMA 3L3DA 4U1NA 5ID0A 2ZJSL 5LXGL 3P30L 1R5VB 1HHKB 1KCUH 4AH2A 2VDQH 4PJ5B 3WFCL 5F9OL 1BOGA 5E2TH 3BT2L 3MV7A 4D9RE 3K4DA 4PB0L 3FCTB 4QT5B 1JI2A 5ISZB 3KPSD 3ROLB 5JQHC 1G7IB 1F4YL 4IRJB 3NGBB 4BKLA 4OGYL 2X2YA 5IROA 5D2NC 4CVUA 3O6FD 3VGHA 1J1XH 1CIUA 2VDMH 4JFPA 5F96L 4H0HB 5CCKH 4JGMA 4UT9H 2FD6H 4IRSD 1FL5B 1XEDA 5DURB 5FO7A 3RWEA 4N5EC 1DBBL 3MNVB 4K07A 3LN4B 5DD0L 1J1PL 3WJLC 1NDGA 3O45A 3MRFB 4LSDA 3QYCA 4ZPVB 4JDTL 1Z2KA 4NRZA 5C0DA 1DLHA 1XCTB 4EI5D 5FB8B 4HIHA 3RFZC 3GZKA 5TQ2L 1V3JA 4NQVA 3RX8A 2RCSL 3T1FB 4LIQL 5KSVA 1FLRH 2R1XB 5GPRA 1EMTL 1MF2L 3MNZB 3V6ZA 5J6HB 3QUKB 3RA7H 3MLRH 4OJFL 3C8KB 2R4SH 4NNXA 5I8KH 5DI8A 4P9MH 1JNNH 5CHNB 2CO6B 4NUGH 4CVXB 1WZ1H 1X7QB 4JPIB 4F7PB 1YYLL 4HJGA 1G9MH 4H26A 3BZFA 1FAIL 3QXAB 4YO0B 1NC4A 4CBPA 5A3ID 4N1EA 2A1WH 3VFTB 3E3QC 3O6KL 3PQYB 4NO3A 4XVSL 5EIIA 5ISZD 4HIEB 1RI8A 5K93A 4S0TD 1DQML 1FNHA 5E9DA 3CFEA 1MCJA 3LCYA 1GZPA 3ZL4L 4R4NC 4YR6A 4YJZL 3UJIL 1KTDB 1QFOA 4Z78B 5I1DB 1QNZL 5CSBA 3MREB 3GGWB 1UC6A 5EA0H 3PHOA 1H3TA 5JOEA 3PGFL 2FJHA 4IDJL 5IKCA 1YUHB 3TVMA 3C60D 1QVOA 1CVSC 5DLMH 1TJIL 1NMCB 5EC2A 3TYGH 2X1PA 3HN3A 1I9IL 1GGBL 5H94B 2W9LA 3CZFA 4WFGD 1T0NB 2H3NB 2A6IB 2WWMC 1IM3B 2Z4QB 2CK2A 5AZEL 5LAXB 1H5BB 1HINL 3SDCC 4DAGL 1KT2A 3DIFB 2X41A 3O6LH 2C1PA 2GEEA 2X1QA 4LOUD 4PD4K 1MJJA 5IB5A 4XGZA 1NFIB 2XA8H 2HRPH 4S0SD 4KRPC 1T5XB 3RZWA 1J0JA 3IFOB 5ITBH 2BHUA 3C5SB 2XY2A 5JORA 3DX6B 5D1XB 4G42B 1A6WH 4XPBH 4YQXL 3JZ7A 1G7MB 4HBCH 2VXUL 3GO1L 4ZTOL 3X3FH 2EDTA 2LVCA 2FL5A 4WFED 5D8JL 4PJEF 4OI8A 4GUPB 4MNQA 2HFEB 1GC1L 2MHAA 5K9JL 1YNTB 1BFTA 3S36L 4PLNC 5A2JH 3KYAA 1JRHH 4L8DA 4LVHC 2HTLC 3FFDA 4KTEH 4M48H 4OLUL 2WY3A 4NQDD 4U3HA 4KWUA 4YE4L 2NTFA 4L29B 5JLZA 4XZUB 4ZODA 3VWJA 1FRGL 2VR9A 4NQSB 4XAKD 4DTGH 3WE6A 2N7BA 4JQXC 4RFEA 5EB9A 3O8XB 3GMOB 3QRGH 2W0PA 3W81A 3WSQL 2YBRB 5CEZH 5HGHA 1HQRA 2YPVL 4RMWA 2A0LD 3DGGB 1CL7H 5KAQF 4L4VB 3VFGL 3QEGL 5EO9A 3INUL 5F7KC 1E4XH 3SKOB 1IQDB 3EJZC 1DBKH 2GI7A 4QRQB 1FIGH 2DKMA 1KSRA 1TTGA 4H5SB 3BUYA 1BP3B 4I3SH 5C08D 3AB0C 2VR4A 1SJEB 1U95A 3AREA 4KVNH 2P7TA 4ODVL 4RBPK 1R3HA 5DMGD 5IBUB 1B2WL 2FBJL 5FUCE 2DQIL 2CSPA 2OI9A 1MREL 3UTTE 3N1MC 3M17B 1ZHBB 2IPKA 2CLRB 1VEMA 2HLFC 2ITDA 4LVNC 1OL0A 3RY6A 4WW1A 4TRPH 5IHUL 5GGSA 2L7JA 1QR1A 3BD3A 4P2RA 4LLMA 1FO0A 3QHFH 3DXAD 4X6DA 3RQ3A 3CC5B 3BKMH 1GGCH 3FQUA 5FGSA 3P4MB 4LHUA 3GK8L 4AT6A 3RWFA 1OAQL 2E9WA 4J3TA 5GRJL 1AY1H 3TNMB 3LHPL 4U1HA 2B1HL 1NGXA 4YDLC 2NY7L 5MEOB 4U1IB 3QQNA 2NX5E 1IBGH 5EU3A 3TN0A 3MRBA 4OB5L 1HSBA 2C4FT 3NCBB 4U1LA 3BFOA 3RIFF 3LEYL 3OJDA 1CD1B 5JXAH 1S3KH 4QNPF 4E9LA 3BE1L 4NP4H 4ELMF 1NGYB 1B4JH 3QUYA 2KZ1B 2Y5TB 3L5WB 3UTPD 1AXSA 5KSAC 3TFKC 1U8PB 1UXWA 3QIUA 4JM2B 4AK1A 1KULA 3DETC 4ZYKB 4PRHE 2ARWA 1U3HC 4AEFA 4DJMA 1BEYL 4G8EB 1YMMD 4YNYA 1W0VA 1X4ZA 1NGZB 2J4WH 2X4NA 4MCZA 4GAYB 2AEPL 2ZUSA 3MROA 4OD3H 3OAYK 4APQD 3MV9B 1FVCA 3VRLE 4Y2DB 5C9KA 3SKMA 2PO6C 1VEOA 2R2HB 1U6AL 1DBJH 1A47A 1NUNB 1WEJH 1I3VA 3ZZ1A 5I15L 2BVOB 4WHYG 2D7TL 2Z93B 4J8RA 4JFDD 4PJHA 4NRXB 1IGMH 4X4YB 3S5LA 2LAGB 3LRSB 3WO4C 3SDAB 2Z31B 3QFJB 3AAZA 3FOLB 5GGRA 3VGAC 2IBZX 4PBVC 3QI9C 5EO0B 1J0KA 4JG1H 1HOCB 5EH1A 3C9NB 5D7LB 2PYEE 4OZIF 4BH7B 5JDSB 3IDYC 5E2WH 4XNUH 4JAMB 1T1WB 2EKJA 1A7PL 1XH3A 2E5EA 1F13A 5KVGH 1KJ2L 3T3PF 1PQZB 3OR7B 4JRWA 5JO5B 1MNUH 1TZGL 3UPAA 3MRHB 2OLDA 2V5YA 5K33A 3QH3A 1G7LA 3PV6A 3QWRA 3BO8A 1AGDA 1KN4L 4Y2DD 3I50L 3PL6C 3F65A 2GTZA 3FFCD 3EOAB 1DFBH 2MTPA 3Q0HA 3VXUA 1KF9B 1N8ZB 3EFDL 3VMOA 3ARDD 1TQCB 1UB5A 3T1WA 1OLZA 4FMFA 5J12B 5FO8B 5EZLA 2WAHA 4NKDA 2E7CA 1I9EA 1CDHA 1KIPB 5GGQL 1H15A 4HHAA 1RIVL 4LRIA 2Z31D 3QFJD 1IAIM 3CCHA 4XRCA 5IMKA 4KDTA 3OKDA 5C0AE 1R3JB 3ZE2E 3ARSA 3W2DL 4M93B 1CFTB 3UDWC 4TN9A 1F90L 1TQBB 5D5MB 1IM9A 1G7PB 4Y5VA 3KLAB 5HI4D 1XMWA 5JOFB 3RTQA 4UT6H 2IALB 4J12A 2BNRA 2MCPH 4ZO7A 2OJEA 3P77A 5JUEL 1VADA 3VXQB 3IXTA 3H9SA 3U1SL 4F15C 1OSPH 4C58B 5L6YL 4MQSB 3PNWA 2V5MA 5C0IA 5DJCB 1KEGL 4R8WH 3VFUB 1S78D 5MENE 3GJFK 1BJMA 3DYPA 4HKBB 3OX8A 5LXGH 3P30H 4CGTA 1LK3L 5F7MC 3TH3T 3WFCH 5JZ7D 1S7TA 1IGTB 1K4CA 3DX9B 5F9OH 3KGRA 4G8FB 3BT2H 3NFPA 4ZFOA 4FQHB 3VWKD 4BFGA 2X4OA 5LGJA 3HC4L 5IK3B 4FA8A 2YUWA 4G8GB 1F4YH 3TF7A 1FNEA 3BD5A 5HSFA 4OGYH 3SDXF 4D0CB 5I2IB 4JM4L 3B9AA 2JIXD 1KTLA 4YHLL 3VFNA 3DHMA 2W0FA 4DFIA 1DBBH 4LLYA 1I9JL 1YQVH 4LGRB 1J1PH 1HEZA 4XCYA 4WUUE 3SN6N 3RWDB 3VDBA 3PWVB 4JDTH 2VABB 3C5ZC 4UDTB 1TPXC 5B3JF 4F58L 1T2QL 3FT3B 5IWLC 1UJ3B 5DHYB 4N0CC 5TQ2H 4IRSA 5C0BA 4IIQA 3AS1A 2RCSH 4MQ7B 4LIQH 4JFEE 4M9PA 5ACMA 3BVNA 4NRYB 5DR5L 4PJAB 4OJFH 5GZND 2YPLD 1RJYB 3FB6B 3IFPA 3GMMA 3ARFA 2XFXB 1JPGA 3UC0L 1N26A 1RUKL 4JREC 4KK8D 5JW4Q 5KVFL 1YYLH 5IVXB 1JF1B 4KDVA 4F57L 1EUTA 1FAIH 2AJZB 2G2RB 5CEZE 4ODUA 3O6KH 4Y16C 4XVSH 2NY5L 3MACL 4G8GD 4P5KB 1DQMH 1IGFH 2EZ0C 4TUKL 4Y5XA 2P8MA 4JVWA 1E28A 5F1NA 3C6LB 2NY1C 3UJIH 2F8VA 3DVNB 3O11B 2EIDA 4OLYH 1QNZH 3I6LD 4L3CB 4RDQF 2QSCL 5HY9B 3HZMA 3L95A 5C09A 3ZDYF 1RZGB 4RWYL 1EHAA 4S1QL 3LKOA 1EH9A 1KIQB 3JTSB 3L3DB 3PGFH 4P2OA 1I1YA 4U1NB 4IDJH 1EJ6A 3V95A 4LCCC 1TJIH 4JG0H 2X10A 5FYLD 2CXKA 3GSQA 1WJ3A 1GGBH 2H2PC 3QDMA 4HC1A 2EEDA 4W6YB 2X42A 1BOGB 4TSBL 4Z0XA 1YNLL 5I30L 5J6GB 5AZEH 2K3TA 4OI7A 1HINH 1ZS8B 5KSUA 3WKNA 4DAGH 3D2UB 2V9TA 4I5BA 4BZYA 3AXLB 5BVJA 1KB5L 4OCWL 3GNML 4XC1L 2CK0H 1I1AC 2AXFA 2FNBA 3HE6D 4J3UA 4P49A 4BKLB 5J13B 5C0CA 2ZUQB 4LFHG 1D5BA 3RWJA 4HZLA 3TCLA 4JFPB 5DQJB 1CG9B 4S0UC 4YHNB 2QADB 1QPXA 3GMLA 3WEXA 5FO7B 3RWEB 1P4LB 4OZFG 1MUJA 4U6VL 4F37K 1IAKB 3O45B 3CSYA 5KJRL 1RJLA 5C0FA 3U4AA 4YQXH 4ZXBD 5FCSH 3VGBA 1IGYA 4NRZB 5C0DB 5GJTL 1HK6A 1UWXH 2VXTH 1DLHB 4WTZG 4GXVL 2Q20A 4ZTOH 3QJHA 1YN7A 3SQBA 3QCTL 4JB9L 4HIHB 5JHDB 3EHBD 5K9JH 4NQVB 4P9HL 2MPAL 1IGJA 4U1SB 3V6ZB 2HH0H 4O2EB 4MAYD 4OLUH 3C08L 2DMBA 3MGOA 4CU6A 4MJIA 4PJFE 4L8SB 4YE4H 2R0ZL 5E70A 5IW6B 1Q0XL 1FRGH 2IAND 2FH6A 5CSZB 5AEAA 4HJGB 4H26B 3WS6A 1HXMA 1HKLL 3BZFB 1EA9C 3WSQH 1NC4B 3KJ6H 4JANB 1CLYL 4D2NA 3BOVA 1KJ3L 3T8XA 2E7LA 3MFGB 4NO3B 1O7SA 4UOJA 5EIIB 1VFUA 4KROB 2YPVH 5ESAA 1JUFA 5IUSA 1CFVL 4X80L 3MV01 3U46A 3UZEA 5L2KB 3VFGH 1FLTX 3ZDZF 3QEGH 3SGEH 1HWHB 3MGTA 5BVPL 1BBDL 4FFWC 5BQ7A 1I3RA 4ZOCA 2MMXA 3BRDA 3V4VL 1MEXL 3U36B 1QA9A 4FTVD 4N5UA 1BBJB 1FC2D 3RGVA 4W81A 4KK9C 5EFIA 3TGXA 3LN9A 1VFAB 2FJHB 3WV0A 3ARPA 3BGFB 4M00A 1QVOB 4ODVH 3U9PH 4HWBL 2FBJH 3OTTA 2IMNA 5EC2B 2D7NA 2NW2A 4MCYA 3T0ED 3ZKXB 3KPRD 1MREH 2DI7A 5HHOA 5IG7A 4Q2ZB 4XCEA 5F89B 5DMYA 2M1KA 1GGIL 1K4DA 5IHUH 1A6AA 1D9KD 2QQKL 4C54A 4L9LB 3QIBA 1KT2B 2WQ8A 4NC2B 4NQTA 5ANMA 2C1PB 4Z7UF 3HUJE 4I0PB 5F1IA 3OAZH 1LVEA 3W0WD 4QEGA 4PD4J 2Y23A 2WQRA 3GK8H 3WKML 4ZDHB 1JGVL 2XXCB 1WAAE 5HI3D 3UAJC 3LY6A 5IJVA 5GRJH 4NFBA 4P4KC 3NACL 2VZTA 3QNZA 4ELMA 5L2KD 2NY7H 3JWOL 5SX5K 2WBJA 4ERSL 2GW5A 2FL5B 1DZBA 4MNQB 1H8SA 4OB5H 5E03A 2N56A 4YK4C 3RX5A 4L8DB 4GS7B 3HNTL 3BE1H 5B21A 4RFNB 3CXDL 4WWID 4LEXL 1HZHL 4KC3B 4MA3A 3ZLQC 2J2ZA 5HHMD 3B9KC 1AD9A 5FHBL 1BEYH 3C8DA 5D1QC 3VWJB 1EHLL 1ZV5A 2AABL 4M1CD 4Q7DA 4PPTA 5GRUH 4XXDB 3X12A 4RFEB 2VDKL 3FQXA 4IOFC 3ZDXF 1NFDE 4JLRA 5CP7B 1TVBA 5DDHA 4P4RA 5HGHB 1G9EA 1EX0A 4I0PD 3P4OA 1U6AH 5I1HL 3BEVA 4WV1B 2P8PA 4NWUL 2DB8A 5I15H 5EO9B 7FABH 1L9MA 2D7TH 5CJ8A 1ZA3A 2ESVE 1TZHA 4HKJA 4MA1B 4OZIA 4UDUA 4DEPB 4KRLB 1G7HA 2H32H 4L8BB 4K7FA 1F3DH 4QHUA 2ICWA 1GIGL 4XH2A 2B4CC 4IBLT 4V1DB 4ZPTA 5F88A 3AREB 2P7TB 1OGTA 5GZOD 3CH8A 5DJ0A 2X4SB 1RIHL 3G6AA 4EIZC 4PJGB 4BSJA 2IPKB 1UM5H 2GK2A 2ITDB 3V9FA 5D9SB 1N3NA 5C6TH 1L0QA 4WW1B 4M1GL 4HZAA 1U8OA 5GGSB 1KIRA 5I9QC 1AKJD 3QRFM 1ZK9A 1AC6A 1KJ2H 3IS0X 4PJ9C 3W5MA 4AM0A 2VZSA 4LLMB 5FUOL 3DHJA 5E6IB 4X6DB 1G7QA 1T1YA 2FR4B 2F58L 3P4NA 2DN7A 1DEEA 1BECA 1GGYA 3GSUA 4AT6B 2XV6B 3T65A 2PCPA 4IM8A 5DSCA 5L8LB 1KN4H 1UGNA 2HMIC 4WHCA 3I50H 2XWTA 4U1HB 12E8H 3CH1A 1KEML 3BDXA 5F7HA 1DQLL 2Y06H 3O3BB 2GYSA 3EFDH 4NQCE 3BQUC 1P9MA 4LIQE 1OP9A 2BNUA 4F7TA 4ZO8A 3KHQA 4FQJL 3MRBB 1QSEE 4JQVA 3NOIA 1ADQL 3QPXL 1ZHNA 5JW4R 5GGQH 1RIVH 2XI9A 4GW5A 3OJDB 5T1MB 4V1DD 3QUYB 3KVQA 4PGJA 2FYYA 4Q97A 4PLKD 2JKXA 4EN3C 2NY3C 3DRQA 5E8EB 4KJWC 4YFLI 3ARDA 3WFDL 1W0VB 4N0UA 4R96A 3W2DH 4CAGA 5FM4A 2HG5B 1NC2A 1MQ8A 1F90H 3AU1A 3MV8E 1DL7H 3MROB 4K7PL 4LSUL 3VXME 3ARZA 5CAYB 3FN0L 5E6ID 3SKMB 1C08B 4P57A 3UTSA 3EO0A 4S1SH 3DWTA 1OAZL 5MI0B 3FN3A 5AG8A 1FORH 3U1SH 5FEBA 1KCRL 1WK0A 1Q9OA 4J8RB 4PJHB 9CGTA 3EZ8A 4B50A 1VDGA 3NA4A 1K9TA 1QYGL 4NGHL 1KEGH 2EYTA 2X4TB 4QCIA 4ZD3L 4F9PA 4RGMC 5IJKA 3AAZB 5GGRB 2AJVL 1AXIB 2BHZA 2BXYA 4DN3L 1XGPA 5I73C 2DM3A 4IOSD 4FABL 4KTDL 3QDHA 2YRLA 1F3RB 2CGRL 4M7ZC 3BSZL 1MHHB 1WC7A 4TVPD 1HIML 4JM4H 1ZGLM 3WL9A 2VLMD 4L4TD 1FGNL 2HLAB 3B2UC 2GSGA 4CVZA 5I74C 5I8OL 3W82A 5EOTA 4WW2B 3D69A 4PJIB 2A6DA 3JV4A 4XPTL 3W5NA 4KFZC 3BO8B 2PUQT 2ZOKA 1AGDB 1T04A 3W9EB 2AJYL 4OKDA 3WNLA 1T2QH 2CR6A 4I77L 4N68A 2GTZB 2XACC 4DVBA 3RL1A 4MLIA 3NIGF 1IEBA 2VQ1A 1S7XA 3PWLB 3FB8A 3LEVH 5EZLB 4PGZA 5K9QI 3HZYA 4M7LT 4NKDB 1H15B 5KVEH 2BNQD 4XP4H 5DD5L 2GCYB 3SE9L 3SGJC 4XRCB 4U3XA 3IRPX 5KVFH 2FEDC 1GJIA 3BZDA 4MZ3A 3VA6A 1Q0YL 2QL1A 1J11A 4FHBD 4WU5A 1FG2A 2NY5H 3MACH 3MLXL 3PABA 2RB8A 1IM9B 1KNOA 5DUPL 1R24B 4TUKH 3HE7C 1SHMA 3T2OA 3RTQB 3DSFH 1MH5A 5DK0A 3GI9L 2Y5EA 3RNQB 4UAOB 2NXYC 3CJJA 4AYFA 2QSCH 3P77B 2RAMA 1VADB 4LQFH 2IQAB 3H9SB 4OZHA 3BYYA 3ZHLA 5FA3B 1L6ZA 2P5WD 4S1QH 1C5DA 3CVHL 1HXYA 4WTWA 4A2LA 4E41D 1UYWL 3IAQA 3DTXA 1DANU 3FRUB 3K80A 4M62H 4CN1A 2IG2L 5FA4A 1MCPL 4LDLB 1AO7E 1V7ML 1ZGLA 1B0GA 1JNHA 4JFFB 1K4CB 4TSBH 3CDFA 4R4BB 3NFPB 5I30H 1AHWC 2X4OB 5C0RL 1WVZA 5LGJB 2RQ8A 5DHVH 5I1AA 1RZJL 1WZLA 1KB5H 3GNMH 4XC1H 1NMAL 2Q86A 4I18A 1FNEB 5DXWA 5B39B 3L3GB 2F54B 2X4UA 1K8IB 4ONHA 1ROWA 4EQ2A 2H6PB 4Y4FA 3VFNB 5D2LA 4I8DA 4U6VH 1KG0A 4DQOH 1D5ZA 3UYRL 1RMFL 1T0MB 2CDEB 3QPQC 5JIKA 5IB2A 1Z9LA 1QRNA 1GXEA 3MFFB 4P46D 2GJZA 5GJTH 5T33L 1Z0MA 3DARA 2HTKC 2GSIA 3L3IA 2W9DL 3QCTH 4JB9H 4C55A 1NBVL 1IAMA 5C0BB 4IIQB 2MPAH 1NAMA 3EFFA 3O81A 1CN4A 3S4SB 4PJ8B 1DN0A 3HPJB 4PLJD 1PDKA 5C92A 3IFPB 4MXQA 3ARFB 2R0ZH 3L3HB 1PKQA 1JPGB 4EDXA 4OFDA 2NR6C 1Q0XH 4JFFD 4LAQL 1OTUC 4JRXA 4RX4A 1JV5A 3QQ9D 1F6AB 2DYPB 1CICA 4RGNE 4K8RL 1CLYH 1KJ3H 3HG1D 2O5ZL 3IETA 4QHNA 1P1ZA 3RY5A 4M61B 1CFVH 4X80H 4JFXB 5DJZA 2F54D 1E28B 5F1NB 1NANI 1B0RB 5BVPH 2LU7A 1BBDH 5JXEA 3ARGC 1PD6A 4ZAKC 3HZMB 3HI1B 1MEXH 5C09B 4Y8DC 4NZRL 1IQWL 2X09A 3C8HA 1DR9A 4OGXL 4MQXD 1I1YB 5I1GL 4LLDA 2OYPA 2FX8L 1IEHA 1MI5D 4HX1B 3BWUC 1E6OL 5JDJA 2D7PA 3GSQB 1S9YA 3QDMB 5FAAA 4BFIA 3G08B 4Z0XB 4BELD 5IR1B 3BPNB 1GGIH 3D85A 3Q6GL 3RAJH 5CEXA 2VL4A 1RUAL 1MIMH 4OIIL 5KSUB 1CFNB 4PJ8D 1R5WB 1I8IA 5F72S 4I5BB 3X13A 3P73A 3A0OA 1CGTA 5BVJB 2AXFB 4PTUB 4NNPH 1BLNA 3QEQA 5C0CB 3HMXL 3RWJB 4HZLB 3TCLB 4H20L 3T0EA 1G6RL 5KS9A 2DYPD 4N90D 1JGVH 3O4OB 4ZSOE 1MUJB 5KVDL 1K3IA 5KTEH 1AD0A 3EO9L 4MS8C 3CSYB 5GS0L 1A4KB 2E7HA 3NACH 3KLHC 2D7OA 4ACPA 4Y1AE 4FFZL 1J8HE 3JWOH 1IGYB 3ABZA 2BMKA 3I6GA 1H3XA 4Y4HA 4Y88A 1A9BA 3VFWA 3HRPA 1NGPH 4BJLA 4ERSH 3W0WA 1YN7B 4QRTA 3CZJA 3VG9C 5EBLA 5L0QB 3HNTH 3OL2A 3FHAA 3IJHB 3CXDH 1HZHH 3MGOB 4MJIB 4IHOB 3AROA 3TM6A 2ADJB 3JV5A 5D7SL 2X1OA 1EHLH 1MCWW 2AABH 5LG1A 1FC1A 2VE6B 4WY7L 1J86A 1SYSA 2JF1A 3SE3C 3EZJB 1CFSA 4Y0GA 4KXZI 4XCCL 2X1WL 2ITCB 3LQZB 1SQ2N 4RMRA 5I8EA 5H35B 3QHTC 5I1HH 1P7QD 3U46B 1BIHA 1GVIA 3MGTB 2AI0L 1QHOA 4N5EA 1JHLL 4XPFL 1LP9B 1OT2A 5BQ7B 2O5XL 5L2JA 5ILTL 1MELA 4PGEB 2CKBB 3RHWF 5A40E 4NM8L 4LBEB 3P11H 3TZVC 5KOMC 2BC4B 3L5JA 1IL1A 1R5IB 2AV1B 3NCFB 1LHZA 3K7UA 3RVXD 4ETQA 4R0LB 2DD8L 3X17A 1RIHH 2NW2B 4G5ZH 2YUVA 3KPQA 4FQ1L 4MCYB 4F7EA 5F9DC 5I6XB 2P24B 4J7RA 1HHHA 2ERJC 3DMMB 4ODXB 5IG7B 4RZCB 5I19L 4MQTB 1K4DB 1EEZA 4P5TC 4M1GH 4LARL 1IGCL 2VITA 5K59E 3QIBB 5DZOA 5CIPH 2VXQH 3MCG1 1CGYA 1QQDB 4O5LH 5ABDE 3QO0B 4XVUC 5FUOH 3VMPA 3F58L 1PY4A 5J1SC 2EC8A 5F1IB 3T2NL 3I2CH 4P23C 2F58H 4PJXE 3BEWB 3A6BH 4Q74A 2VLKA 5FYKE 3E3QA 3GSXA 5MERA 4GFTB 3TBYB 1F6LL 4QTIH 5IJVB 1M6OA 4G6AC 1I7ZA 2GK0A 3S35L 4ELMB 1KEMH 3QIWA 1DQLH 1L7IL 4OLZH 4D9QE 5AAWA 3KWWA 5B38G 2VWEE 3O2DL 5GSRA 1KCGC 1ZVSB 2AK4E 4Z8FL 4FQJH 3PWPA 2BY1A 2IAMA 1ADQH 3QPXH 4POUB 1NLDL 2VC2L 3NABL 1NL0L 2P49B 1R6VA 1LE9A 4J3OC 5FK9A 2JELL 4MSWA 1AD9B 4R4FL 2X6MA 2SEBA 4J23A 1EFXD 1OVZA 3I85A 5CMAA 3WFDH 5LBSL 1L4IA 4KQ4H 4BYHA 2HT4D 3LKRB 4XTRD 3QAZB 3FQXB 2HVKA 4JLRB 7CGTA 5DDHB 1GHFL 2PTUA 4IS6A 4K7PH 5AYUH 2BDNL 5GGSY 3FN0H 2LE9A 1U8QA 2V17H 1J12A 1OAZH 5A16A 2G9HA 3REWB 3DV6A 4KK6D 2WMPA 1BVLA 2HJFA 2IC2A 1UVQA 1KCRH 1ZA3B 4RISH 5BS0B 3QUXD 5I71C 3D87B 1UQSA 2DOCA 1XIWC 1G7HB 1OP3K 5HGDA 3QG6A 2VDPL 4QHUB 5HYSG 4XH2B 2W92A 4ZD3H 4ZPTB 1EAJA 3J7HA 5F88B 5TFSL 2AJVH 4MHHG 4J1UB 1YEIL 1KYOK 3G6AB 2PYED 2VERN 3QQ4A 4MJ5A 5AG9A 2Z35A 4Y19A 4FABH 1OPGL 4JZJC 5T3XD 3SO3C 4KTDH 5IW1B 3RNKA 2B5IC 3SE4C 3VRLF 2CGRH 1U8OB 5T1KA 1KIRB 1FCGA 4ZUSA 1U9KA 4AM0B 5M7QA 3NZ8B 4N9GB 3MLTA 4GLRI 4GRLB 1T1YB 3LPGA 2APFA 3P4NB 1DEEB 4JQXA 3D39A 4XPTH 2NLJA 2XZAL 3T65B 2PCPB 4G3YH 5DSCB 1KFAL 1RZFL 4XVJL 2AJYH 1E4KC 2XWTB 3CH1B 3DO7A 1LO4H 2ZG3A 1OQXA 3MJ8B 4RRPG 5EBWA 4J4PC 3ARWA 4L4TA 2XTLA 2BNUB 4H8WH 3NAAL 3X14A 4OGAC 3KYOB 5DS8B 4W4NA 2BOCA 4JRYE 4NO0D 2GUOA 1FFOA 1U2CA 5DD5H 5GS1C 5JA9A 3VCLA 4U1GB 1NH6A 1JGUL 3M8OL 1T5WA 3SE9H 4J6RL 2VRAA 1G9NH 5I66A 4QHKI 5GGRY 4GBXB 2FX7L 4N0UB 4R96B 1Q0YH 4B5EA 2R1YB 4X4MA 3U7YL 4NQEE 2RIKA 3AU1B 4JN1L 3TJHC 5HYJD 1LWRA 2VIRB 2D31A 1JCKA 1Q72L 3UTSB 4P57B 3GI9H 1D6EA 1RZIA 3EO0B 4GRLD 5IOPA 3QDGA 3KLDA 1SBSH 4WI5A 4WO4B 4ISVA 3DPBA 4EIGB 3WDJA 3QUMA 2A2QT 4F3FA 3CVHH 2EYTB 1Z9MA 1YPZB 1UYWH 3HC0A 2D03H 1ZLSH 4G80A 1RSFA 2IG2H 3SDDD 1MCPH 5GQBA 1V7MH 3ZE2F 4JKWA 3MRPA 3RWGA 2D9QB 1XGPB 3GJEA 1XF4A 5C0RH 3PHQB 3MBED 3MLYH 2FSEA 1YY9D 3WXVL 4F2MA 2CLVA 1NMAH 2CUMA 5KSAA 3TFKA 3HZKA 4Z9KB 3S37H 3LAFA 3MOAL 4I2XE 4ELKA 4M03A 2H2SD 3ZKMC 1II4E 4HS6A 1CXFA 3JV4B 3U83A 3IFNL 5IP4A 2ZOKB 1OWWA 2Y9RT 5D6DC 3SBWC 3S8WA 1QSZA 5T33H 1IZKA 4M02A 1BJ8A 1UA6L 2NY2D 4DVBB 2W9DH 2W38A 2B1AH 5CZVH 2LVEA 2YRZA 1YC7A 4WO4D 4ODTL 5ACZA 1S7XB 3FB8B 2ZSWA 3SY0A 5TE6L 1NANH 3NTCL 3E2HC 3HZYB 4KUZL 4NSKA 3SCMD 4WFFD 4NYLB 4QRSA 5KW9L 3OKYA 1MWAA 1CBVL 3R1GH 2L4OA 5CD5D 3QI9A 2HKHL 5F7WC 2NW3A 2HT3D 1KJVA 1UWGL 1GPOL 2CIKA 5ID1A 4UU9A 4WU5B 1FG2B 3CAFA 1VA9A 5ICZA 2O5ZH 3IDJB 1KNOB 2OR8A 2PW2A 1UG9A 1YJDL 2D9CA 5F9JA 1JTTA 5A2LH 5J11B 4Z7QE 2XT1B 5DJ6B 1MH5B 5DK0B 2H8PB 2XRAH 4UBDD 4EUPA 1WIPA 5C0EB 1OP3H 3NN8B 3STBA 3VXNB 4Y89A 4OZHB 4JJHA 4NZRH 1IQWH 1QBLL 3VFPA 3AS3A 4GRMB 4JJ5A 5H8DA 4OGXH 5FYLL 5I1GH 3TBVA 2FX8H 1WV7T 1UXSA 1E6OH 5FA4B 3T0XA 4Y8AA 1T1XA 1KIUA 4Z7VE 1ZGLB 4PRNB 4WIQA 4PV8A 3DNKA 1CXEA 3G6JB 2Y07L 1NCAL 3Q6GH 4YH6A 1RUAH 3C6LC 4OIIH 4MGXA 2JJSC 5I1AB 1XF2A 3F7YA 4PB9L 1CCZA 1KPRA 4I18B 5ACLA 5K9KA 1CQKA 4P2QE 4H20H 2X4UB 4G6FB 4ONHB 1G6RH 4AG4L 4Y4FB 4WWKD 4HK3N 4YHIA 1QLFB 5D2LB 3WJJA 3UDWA 4GKSA 5KVDH 3GSWA 3DVIA 1KG0B 3D6GA 4YGVB 1FGVL 4YIQA 4YDVA 2UZYB 1D5ZB 3GMNA 1HHGA 4X7DC 4FFZH 4LKXB 3JV6A 1QRNB 4KXZH 1OY3B 2MQ0A 1SMOA 3L3IB 5DFWH 2CLZA 2BCKA 3VGGA 3ZYOA 1S7VB 2BVEA 5IROC 4DUWA 1RZKL 1WWBX 3EFFB 1KGCD 2DQTL 1DN0B 3S36X 1V3KA 2NYYD 4O4YL 4K3HA 1JYNA 3HHRB 2L0DA 4TQEL 5D7SH 5DK3A 3U4EA 4LVOB 3X11A 4WY7H 4XT1C 1PSKL 1JV5B 1CICB 1AI1L 3DURA 3ILQD 1VGKA 5DJ2A 4JY4A 1H0DA 3IU3B 3BN3B 3IETB 4OV6F 1NBQA 1P1ZB 3S88H 1RU9L 3IU4L 5DJZB 1YDPA 2XKUA 1QBAA 6FABH 2AI0H 1JHLH 3N50A 4XPFH 4H1LH 2IBBA 4NN7B 4X7SL 2O5XH 5IQ9B 3TIEA 4YWGL 1YEDA 5ILTH 2EH8L 1MVFA 4NM8H 4LHUG 3C5ZA 1M7IB 4PJFF 5BW7A 4LLDB 1QBML 4DK6A 2DD8H 1P7QA 2P4AB 3F5WB 4N0CA 2WIIA 3QJFA 4FQ1H 1S9YB 3CUPB 1A1OA 2WWKO 3QXUA 3VXSE 3DVGA 4BFIB 4AMKL 1DQTA 1HH9A 1S9XA 1ZMYA 1JZ4A 3MUY1 5I19H 3D85B 4MD0B 4LARH 1IGCH 1I8IB 5E99L 4NN6B 5C0JB 3O0RL 3P73B 4CJ0A 4UQ3A 5ELIA 2EIBA 4QF1A 1T6VN 1TFHA 2QHLA 3MLVL 3F58H 5F9WC 2ENYA 4LNVA 1BLNB 3T2NH 2EDHA 3EDEA 3ULVC 1XGTA 1OGAD 1RHHB 1QTYT 3UTTA 3RWHA 5KS9B 4M6NL 2AS5M 3TVMC 4Y16A 1AD0B 3B5HA 1BGXL 2Q87A 1I7UB 2FEEL 2GY7B 2YZ8A 2ARJQ 4QTHA 3S35H 4Z7WE 3O4LE 1OAUH 4PYGA 4ZTPH 4NKMA 1L7IH 5KOVC 3MO1B 4KKLD 1M7XA 3AUVA 4QWWC 5K9OA 2ED7A 3O2DH 3PXHA 4QRTB 2YEZB 1LO2L 4P3DA 2Z8RA 2Y6SD 3D0VA 3OB8A 1INQA 1T4KB 2VC2H 2OR7A 1OTTC 3NABH 3HUJF 4XI5D 1WWCA 1FL6A 3S5LG 2FHFA 2JELH 2DTML 5I8CB 4R4FH 1AXTH 3ZHKA 3B2VL 2YRPA 4HULB 4B41A 2NX5A 4DWHA 3T3MF 4ONGL 2FEEI 5LBSH 1WAAF 1SYSB 4QOKE 2X05A 1GHFH 4KI5E 5FGCB 1D7FA 1A6VL 3TBSA 4HAFA 4LPXA 2XTJE 2NXZD 2BDNH 1TCRA 5D2NB 4LLWA 2NY4D 4S11A 2EXWC 4PRHA 4M7LH 1U3JA 4O51A 4GLRH 5GRZA 5L2JB 3SQOH 4JHWL 1CS6A 2VDPH 2VYRE 1IL1B 4HF5L 1WFNA 5TFSH 4ETQB 1AR1D 1YEIH 3KPSE 3ZHDA 3KPQB 5JTWA 5LJYH 3QUZA 2GJ6B 3QUXA 4UNTA 1OPGH 2C7UA 1NFDF 5CFHA 1HHHB 5K9QG 4KKAD 1ZAGA 1OARL 3CLEH 5FYJU 3QEUA 4NQXA 1ITBB 3BZ4B 4JPKL 1X6NA 4R7DA 5E6YA 5EOQL 1F45A 1QKZL 4HCRL 1FE8L 2PYEA 4CDGC 1JPFA 5IIEA 2N4IA 4OZGB 2VLKB 2XZAH 3GSXB 2FO1A 3W39B 2OI9C 1KFAH 3EJYD 1RZFH 4ONFL 4D3CH 1I7ZB 3TA3C 4YX2L 2GK0B 1N2RB 4PBXA 5EULV 2EDRA 3RY6C 3UYOD 3KWWB 1BD2B 4PREB 2EH7L 1G6VK 3NAAH 5GSRB 4XWOD 2VQUA 3PWPB 3EKCA 4KGLA 4P0DA 3O2WL 4LCWD 2FZ3A 3I75A 2PETA 4W6XB 5DF0A 3U0PA 1JPST 3BXNA 1WFOA 3M8OH 1NKRA 4UIMA 4PG9B 4GG6A 5ISZE 2I07A 1I7TB 2FX7H 4D8PB 2GJ6D 1FZJB 2JK5A 3V5KA 5CMAB 1A1MA 1QFWH 1T3FA 4S1RL 3SDCB 5DJAA 4HGMA 3QBTB 4JN1H 4BFEA 4NO0A 3T2QA 3IDMA 5TE4L 5HI5D 4MXWL 3TN0C 2DLFL 1Q72H 4Q9BA 1U8QB 3D0LA 5C0AA 2A9NL 4ODHL 2I26N 1AE6H 1BVLB 4KRPB 2CRMA 4J3XA 3VRIB 3RDTD 1CDIA 3QIUC 1FQ9C 2J6EL 5HGDB 5IVZA 2JLLA 3QG6B 3BZEA 4WFGE 3VXRB 1BMGA 1FVDB 1IRAY 4K9EH 1BD2D 4JQIH 3Q5OA 4X7EC 4TTGA 2CIIA 3QQ4B 4LLQA 1JE6A 1R3KA 2BSED 3WIHL 1KYOJ 4LVHB 1ZLWK 1Q9WB 4HIIA 1X5GA 3TP4A 5MENA 2PN5A 1OT1A 2FJFB 4ONOA 4TVPL 1EJOL 2ARJB 4BFBD 3O3EA 3B9KA 3MUGB 3GJFB 1S9VA 4P5MA 2R0KL 3PQYE 3SDDA 2F9BT 5D1QA 3MLTB 5EU6D 2NY6C 1A3LH 1MCOL 3N9GH 4YZFE 1IE5A 3SDCD 4TYUA 1U8NA 2BRQA 4EVNA 1U3ZA 4HKZA 3MBEA 5FGBC 3GIZL 1KLUA 3FB5A 4LSRH 1NBZA 3EW3B 5MEPB 1UA6H 3DO7B 4KVCL 4HK0A 2QBWA 3IJSB 4LSSL 3ULUL 1Z6JT 5DUBB 4O2CA 4KRPD 1NJ9A 4JO2L 4ODTH 1UM6L 4U1KB 4NQDE 1JN6A 5TE6H 2YXMA 3NTCH 2HFFA 3T0AA 1FFRA 4WUUA 2BOCB 2D3VA 4X6FB 5DYOB 5DRWA 3QCUL 1A7RH 2ZUXA 3VXRD 1FFOB 2FWOA 3V6FB 1CBVH 3AB0B 4RA0C 4Y4KD 2HRLA 3RVWC 2HKHH 1UWGH 3IGAA 1FG9C 1DQDH 2BVQA 1TDQA 4JFEA 1GH7A 5C9JA 4LVNB 3WIIL 1B3JA 3DSNA 3TPUB 3SCMA 2VAJA 4PP2A 3P40A 4PJ9A 4D9LL 1YJDH 2V9QA 3MOBL 4JFYA 5CBEB 4RIRA 1MCRA 4NT6A 1TITA 4X5WB 2B2XH 1IARB 4NPYB 3QDGB 4U31A 3TESA 3O3AA 4LRIC 5LKNA 5C08E 5IHLB 1LE5A 1QBLH 4KDTC 4L5FL 3QUMB 1TTUA 4F3FB 4XP5L 5FYLH 3HC0B 3GMRB 1DBAH 4YDLB 1BVZA 3LOWA 4G80B 1BZQK 2VISA 1J0HA 2Z0BA 3BQUA 4N0RA 4R3SB 2QQLL 4H8WC 3MRPB 4Y5VC 3KPTA 4LP5A 1FH5L 2IWGA 4LU5L 3GJEB 2Y07H 1NCAH 1NGWB 4YHZL 2NY0D 3BKJL 1JMZA 4NKIL 2FSEB 3TBWB 4PB9H 4F2MB 4FG6D 5KSAB 1I8KA 2BVTA 4N1HB 2DIBA 3BPOC 1G9NC 1U3HB 3IFLL 4AG4H 1M71A 4ELKB 5FFLA 1TIUA 3F12B 5KAQG 2GT9A 1FGVH 2BY3A 1CE1L 2OJZH 4MDJB 2Y36L 3SPVB 4KI5C 4NM4L 1VPOL 1BVKA 1QEWA 2PO6B 3V0VA 1FAKT 2AXJA 3WIFA 4M6ML 3MRGA 2VSDA 5CEYA 5C70A 4MYWB 3SY0B 4MDIB 1RZKH 4BQ9A 5AD0A 3G5ZB 1RULH 2DQTH 5GRXG 3PXJA 4BZ1L 3WO4B 3QSKB 1YMME 3EO1B 3V5DA 2ATPA 2UUDH 3X3GL 1MWAB 5FOBA 3D3VA 3PGDA 4TQEH 3LEXB 3QI9B 1QLRA 3ZTNL 5CGMA 2DQEH 1AC0A 4NFDA 4MA7L 2NW3B 4KMTL 1XAUA 4IDLA 2V7HA 2C3HA 1C16A 1AI1H 3S3SA 5ID1B 3IDYB 4ZUVA 1T66D 5L88L 4UU9B 3RKPA 3O6FC 2I5YL 3DUSB 4XBEL 2OQJB 1CTNA 1F4HA 3G6DH 4IRSC