4Z7JA

Structure of acetobacter aceti pure-s57a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVAAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Mutation of the conserved serine in two PurE classes
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 55
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4z7jA00
2ATEA 3OOWA 1U11A 2NSHA 4YCJA 5CVTA 5CLHA 2FWJA 4ZC8A 4ZK2A 1QCZA 5BORA 5CTJA 3KUUA 1D7AA 2NSJA 1XMPA 4GRDA 4AY3A 3OPQA 3ORSA 4Z7JA 2FW1A 3TRHA 5BOSB 2FW9A 4YCCA 4YCBA 2FW7A 3LP6A 2FW6A 1O4VA 4B4KA 2FWIA 3RGGA 3RG8A 5BOSA 5CLFA 2FWPA 2H31A 5CLGA 5C5DA 2FWBA 5CLIA 4ZJYA 5CLJA 4ZMBA 2FW8A 4JA0A 4YCDA 2FWAA 2NSLA 2YWXA 4AY4A
chains in the Genus database with same CATH superfamily
3NANA 5LOVF 3LCCA 1N2CA 2Z1DA 1DELA 5EWMA 4AJEA 1S4QA 3MW8A 3QXJA 3V8MA 2WI8A 1PZMA 4DR1B 1LCIA 3Q2OA 2VJYA 1E2QA 4E3WA 5L6MB 5F3WB 4OP2A 1I51A 1RE0A 3UJNA 1GVNB 5BXQC 3WK8A 2Z9CA 3MTBA 5HFNA 5BSMA 3DR3A 5ITZB 2EP5A 2E4VA 3U26A 3HB9A 1C3XA 1Y9ZA 2PGAA 2DHQA 3B7GA 2AE1A 3I01M 3N2GA 4X9XA 3RJ9A 4CMEC 2DPMA 6ADHA 2YHIA 4IFBA 4HNHA 1Y8AA 1ZICA 2FG7C 3JASB 4B33A 3ER9A 1GQYA 5LMNB 4KAAA 4QARA 2R65A 1JHRA 2G0TA 3K70B 1JHMA 2AEFA 1DT3A 3ND7A 3IKJA 4UQOA 4D46A 4LZJA 4M6WA 1GL6A 1E63A 1T24A 3GLGA 2JH9A 1XXLA 1II0A 2EKBA 4JR1A 4CV0A 3I5MA 4IY1A 4JAVC 3IKVA 2VH5R 3KZ1E 1DOHA 4JUFA 4CM8A 3G6KA 4JJKA 4G8JA 4O4JF 3WLNA 1QFSA 2OKCA 3DDUA 4X20B 4B4VA 3JV7A 2GTIA 2P0YA 2Q9AA 3WB1A 3ZX5A 1U3VA 3B3QA 4DLVA 1EZZA 4DRXB 5J4LA 3VJRA 1E2JA 3OEHA 4NP6A 4ZT4A 3DKVA 2I3DA 2CVOA 2Q3JA 3E23A 5FCDA 1A04A 2LKDA 2FUG6 1ZJWA 2C0QA 4LZWA 4MUIA 3GLIB 1KMMA 4E94A 4MB2A 4QYTA 1HT2E 3BE4A 2EYUA 1FNNA 2X8JB 2XYGA 3BWMA 4D2IA 5K09A 5K3OA 3UPTA 3FHTA 2PNFA 4IGAA 2D2IA 5JJKA 2J09A 3CCBA 3F74A 2WAXA 4OA8A 3D6MA 3IBGA 4PHTA 4DCOA 2JAUA 2HA3A 2QUAA 3C1OA 4REQA 3WGGA 4B7CA 4B0PA 3G2NA 3NFRA 2DSNA 4HH0A 3T7AA 2I03A 5CBPB 1JIIA 2EKDA 1JSXA 4U9HS 4JP1A 4CIBA 3LKVA 4HR7A 1RYNA 3W6OA 4B3DA 3Q2IA 2WIKA 3L6RA 4V0MA 1NLUA 3JYOA 3NBXX 1VHQA 1C3OA 3KR1A 2VDWB 3P32A 5DNYB 2XBLA 4RF2A 2HIHA 3NWOA 1RAGA 1EE9A 1MAAA 3GXOA 4MW2A 4RVDA 4HQNA 3DWEX 3NS7A 4I4IA 4CKEB 3GBPA 4IO0A 4WZBA 2YY7A 3C5HA 4OREX 4MZXA 1SA0A 4G63A 1X80B 2C9CA 4LC0A 1IHUA 5EWJA 3HI6A 4D57A 1ABFA 1MNAA 4OJNA 5JI2E 2JARA 4DG5A 3ZIAD 1V39A 2K2WA 4RZ2A 2OXTA 2PVSA 4EF6A 3JQAA 1WZCA 3NW9A 3R7AA 1AHNA 1XXHE 3MJCA 5HG0A 2C61A 3NC1C 4CEIB 4A36A 1TZCA 3ZLVA 2EJCA 1RBZA 2WE8A 4PHGA 5TGTA 1W4BA 4MIOA 2P1RA 3UJHA 2BGWA 1QR2A 3UFBA 3I9JA 3CN9A 4QBTA 2QMUA 4OAQA 4Q24A 4YQFA 1KJIA 1QWSA 4ES6A 1XVUA 5BYBA 1OB2A 4DM4A 2FLKA 1MKYA 4EARA 3G5TA 1B00A 1E6MA 2NOAA 3E9YA 3EHEA 3NHYA 3FFAA 1EVKA 1TM7E 3PPVA 5JANA 4QJBA 4PZEA 3GBVA 3H83A 4OIMA 1RABA 1ACLA 4CTKA 1CLUA 1RKXA 1WW3A 2EHJA 1DRVA 4MVJE 1FNSA 3LC7O 1N0IA 4FUTA 5KJ6A 3IERA 4TXLA 2AW5A 5HRAA 1FDRA 3OIFA 1DJNA 5L3QB 3X1JA 5HCNA 2AHRA 3FFBA 4MKGA 1EFLA 2DFTA 3B7PA 2X9GA 621PA 1P1BA 2VHZA 4IXMA 2DUNA 1H2RS 3OF5A 3TZCA 4DC0A 1TTTA 1LW6E 3K2BA 4MUXA 3DMDA 2JEOA 3ENWA 3CF0A 1CIJA 1D5CA 2F1OA 5JYDA 1J49A 4HLDA 5AW9A 5J5AA 4QKQA 1EWKA 3D3QA 3F9RA 3KE8A 3OZSA 1RXSA 2M9MA 1Z22A 1COZA 1BXZA 3KB6A 3ZQ6A 1M6VA 4GD3Q 1NRJB 3PPWA 3GOQA 2BR5A 4S1PA 4C0BA 4EY4A 5JQGB 3PLRA 4ZQIA 4YCNA 2CXHA 5DZSA 1S01A 3SZOA 3F6SA 4HNGA 3RUCA 5EHGA 2ZRDA 2PUVA 4RDXA 4DDUA 2V4ZA 1L5VA 1Q1QA 4IXTA 3W4IA 1E77A 1ESDA 4UAVA 1KKUA 2RGXA 2DC1A 3ILSA 1RR6A 1SD2A 2CBXA 4X85A 1ZD3A 2RHCA 3INRA 4P4NA 3RF6A 4B8YA 3RV3A 3WRXC 4L08A 3JQBA 2CD7A 4WBNB 2G7MC 1KHTA 4G36A 1A7UA 1M2NA 5D87A 3TD9A 5LN1A 1VRWA 2VJAA 4F71A 5ED0A 2E49A 3SF8B 1QB7A 3SYLA 3A9RA 1EUDA 4XFJA 3WLAA 2QX9A 4G41A 4OI2A 1CUJA 3VU3A 2N1BA 4ZVNA 4ARAA 5CLJA 1KOGA 5HFAA 5I7FA 1MAHA 3NP9A 3QEKA 5KTPA 4J0DA 2HXSA 3V32A 1YQEA 1LQUA 2NMVA 1L9KA 2CF6A 1YOVA 1ZW6A 2WSMA 4A73A 4DM7A 3MJSA 4JVMA 3KUXA 5CJPA 1G16A 2RBGA 5DNAA 4KW7A 3HH8A 3I28A 2PQ6A 1EG2A 4RZIA 2OHHA 1G5RA 3CLRC 3IQWA 3EYWA 3H5WA 1H8ED 1NNLA 1T0IA 4DSUA 1WO8A 4IG4A 4C6RA 5I9NA 2XLBA 2ORVA 2Q8QA 3EIOA 4UC0A 5BQOA 1E69A 3R3VA 2GR9A 1G9SA 4ZRNA 4GLFA 1DVRA 2YVKA 2YWFA 4WECA 1P9NA 2JJ2A 2DJ5A 1DIAA 2YMMA 1RJFA 4C7BA 1SCKA 3SZLA 5FBVB 4XCXA 2IUYA 1QU2A 2PZJA 3SE7A 3D5QA 1P2FA 3DUFA 2W11A 2CJYA 2COUA 3OQ1A 1EGMB 1MB0A 1AKTA 3OZGA 3IDSA 2HWXA 4YP0A 4LHEA 2H3HA 2C2BA 4Q7LA 4TM8A 1IMJA 5HHTA 4KQFA 1B2RA 3ZJUA 2M2IA 1EG7A 5GM2A 3VPHA 3MXTA 3FR7A 5CT8A 2BMJA 2RFLA 4MUAA 4R1UA 3FM9A 3PI7A 1YMVA 1IULA 1AXGA 4LHWA 5J4HA 2CFIA 3M1AA 5FADA 4C21A 4E03A 1XALA 2GJ8A 4A0FA 1BJTA 1NA5A 4ZCPA 4DRYA 4FM9A 1CWUA 2CVZA 3N8NA 3WIOA 4CLXA 1I4WA 1XFDA 1KO7A 1NF3A 4TWRA 5FPSA 3P2OA 4TYWA 3IT3A 2J7PA 3BAZA 3RS3A 3Q8XB 4FJ0A 1SO8A 3AXSA 3EOAI 5A4JA 2UYCA 1TKRA 5CPBA 1YIAA 3VSAA 1LA2A 3SSOA 3TEFA 1PTJA 4DV2B 1NT4A 2Q6KA 4ASUA 3NHPA 1BN6A 2ZJ3A 1ZNZA 3I6YA 4QOFA 5EP2A 3UW3A 4KB5A 2ECOA 5HE9A 1TKAA 4JU8A 4G5XA 3AR5A 1OTHA 1NBIA 2FZ4A 2IBSA 1I2BA 2PUTA 1VJRA 3VZPA 1QIJA 3FH0A 4YJGB 5L3SA 2FYTA 2P8JA 3T9BA 2B1RA 3EQ2A 2Y4OA 4W7IA 3W77A 1WXWA 3FNHA 1OFHA 4TKUB 3SNHA 4EHBA 3KZOA 2Y1CA 3IYLW 3ZVRA 4C01A 2POQX 2XQVA 4X0EA 4OJMX 3UGKA 5E1BA 1MEEA 1NBOA 1Q50A 1Y5LA 2IYVA 1RWKA 4RORA 4MR7B 3K8OE 4LYYA 1YZVA 4DA6A 4E5KA 5KTMA 3M9WA 1SHZA 5I9BA 2AFIB 1HZZA 5I4IA 1PO7A 4W1QA 2C8KA 3O8OA 4MQMA 3K94A 4KTVE 1O87A 3VX3A 4E07A 1K8RA 1ZUHA 4WRRA 3BBLA 1OBFO 4YP1A 2X8AA 3TLZA 2B94A 2IY8A 4U7PB 4Q3AA 3OQNA 2QZ9A 3M6XA 1BXKA 5HBRA 3WLEA 4F2DA 4Q9JA 3RFXA 3NP7A 4LJYA 1FVOA 1PWYE 2FOIA 2YKGA 5ALQA 4BB0A 2PT5A 4GU5A 1ZU5A 2EATA 2F55A 1EE1A 2E6KA 2CXRA 1DLJA 2C2KA 1U2SA 4PTZA 4TRJA 4QVKA 3PWZA 4WY2A 2P27A 1FS4A 4TYMA 3WRVA 1EZ4A 2NSLA 3PYXA 2XOXA 1I1OA 3A4YA 3T1QA 5MN4A 1WLYA 4S3MA 4LYHA 2XA2A 4YMIA 1C1YA 3W9BA 4LBZA 3H9BA 1SY7A 2VF7A 3NBFA 2H57A 5JMPA 3V8PA 1XRPA 4NYIQ 3N2ZB 1OWOA 4UTRA 4Z4CA 5JZMA 1W5AA 3IDFA 3NMUF 1XRRA 1Y4SA 3GLRA 1KJZA 1VHDA 3IOYA 1Z63A 1V3QE 2R96A 3GMIA 5IW8A 1DG1G 4EL5A 1DJPA 3D3JA 4YV0A 2R6ZA 3OHMA 2LE0A 3FZQA 5I9SA 4TT3A 1WHSA 2FLVA 3KX2A 1EXWA 2V54A 3CB2A 3F4LA 3OKFA 1PE0A 1HRKA 3T7TA 1LK5A 3OMWA 3LSYA 4AUNA 3BXXA 5TQJA 2BDTA 2D13A 5TT0A 2Q0QA 3FZEA 4QNNA 3CVXA 1CUIA 3N74A 1SG6A 3ZY6A 1QP4A 3I39X 2X41A 3D8UA 3C87A 1JVNA 3C74A 5JVDB 5BV2P 5AESA 3BSWA 3NJ8A 5JXJA 3QVGA 1D7AA 1CJSA 3MG9A 3X1KA 2PX4A 2XVXA 3HUFA 3SSMA 1X70A 1PJZA 2GHQA 3A3NA 3K8QA 2C5SA 1OX4A 1ZN7A 1Z36A 2OHIA 3P9YA 4N65A 2XB9A 3KXIA 4D9IA 3CHYA 5J9FA 2VDVE 3ELBA 1CR1A 2E85A 4XLLA 3GDOA 4EJMA 1AJEA 5E6UB 2ZIZA 1UBNA 1NOKA 4YA6A 1MO2A 3L7CA 4AVYA 1JFFA 2HLNA 3L6BA 2B5VA 3ABOB 3RTGA 2Q7OE 5KSOA 3SIXA 1E1RD 1I6MA 1OYYA 4L5JA 1E94E 4O5AA 2R6HA 3NTXA 2BL4A 2GOYA 3EA4A 3OTQA 5HF6A 5G0SA 2Q45A 2BFDB 5CLLA 4DCNA 1B0ZA 4IIXA 2F8LA 3N2EA 4OGFA 3RK1A 3KCQA 1W7AA 5JCJD 4HDNA 1C30A 4XLTA 3SOZA 2PUGA 4BOYA 1H2FA 1TJNA 1H9BA 4E32A 3AFOA 4YMLA 1KWKA 3K0CC 4JBYA 4L4XA 2BGUA 1M2VB 1YT5A 1YFJA 3FOAA 3NIDB 3MJDA 5GJWC 3GIDA 2HCFA 3LFHA 3V3TA 2ZRFA 1SQSA 2XUDA 4IJMA 3VZDA 3HNRA 4RY2A 5PGMA 3LTNC 1OAKA 5KVSA 4EUFA 1LBIA 1DXYA 1D0IA 1US8B 2C2OA 3FI0A 1AKUA 4NFSA 3Q72A 1ADBA 1TEHA 4XUGB 3V42A 3VOTA 1JPUA 3EGXA 1ZQ1A 1U0JA 3AFMA 2NGRA 3KBBA 1QHXA 4JQSA 5G2OA 3Q8KA 1NV9A 1JLLA 3G1WA 4YJKA 4TL7A 3DYIA 2HRDA 2CCKA 1QV9A 4OHOA 4QGFA 1Y37A 1ZAKA 2E9SA 4I36A 2VCYA 3PIRA 2SBTA 3FMPB 4JB2A 1RQPA 1Y7PA 4EJSC 5HXAA 1NF2A 1NMSA 2BZSA 3W5HA 4D3SA 2C5FA 5BR1A 3PIIA 1F48A 2R7KA 4RKQA 4ARCA 4US2R 1ZD5A 4JT9A 4G84A 1OJLA 1RI4A 2Q2OA 3Q9SA 1JPVA 2OV8A 4DR7B 3U3XA 2IOHA 2W2NA 4IBOA 4E2FA 3H65A 4U39A 1GGMA 1V35A 4IEIA 4CU2A 4QG3A 5BT9A 4BO5A 1XNJA 1J8DA 5EEHA 4P31A 3DDHA 3EEYA 3VPSA 3ECSA 4ZHSA 1NBWB 5C35A 2WUWE 6GPBA 1L8LA 2X3UA 3CE9A 5EMKA 1KZYC 2FMKA 4M0EA 4NDAA 9LDBA 3L6DA 4X00A 4OU5A 1YDFA 3ZGOA 1L1FA 2XAUA 3BDIA 2PFGA 5A62A 3ZEAA 3MBIA 2Q2VA 5ADUS 1T9BA 5KJFA 3PEYA 2X3FA 3AW8A 1KBOA 5SZJA 4OJQA 4ENUA 3VR3D 1WSWA 2UAGA 4LTDA 4MWBA 4KR7A 3G9XA 1IK6A 3OTGA 2VJNA 1EESA 3UHOA 1B0AA 1K5HA 1ZPDA 4GXTA 3OCYA 4J0KA 4NNOA 1Z18A 4M2LA 5FWXB 4JASB 3KETA 1H0KA 3P45A 3O8LA 3FPHA 2J3QA 4W7SA 5JAQA 1OX6A 4I55F 4HEHA 2X2EA 13PKA 3R09A 5F73A 3UWSA 1YR2A 2CYCA 2JLRA 1UJ2A 2RBKA 2W8ZA 1REQA 1JYFA 4K8OA 3T99A 3TRKA 3WQQA 1FQKA 3EZ2A 3NORA 4DCJA 5CEJA 2OHVA 4A10A 3LXMA 5EEGA 1FS6A 1LBEA 1Z74A 3H5AA 5BNFA 2WWYA 4IGFA 3E03A 5KYXA 5LIPA 4I5FA 1H1DA 4H15A 3RAGA 4ZU3A 3RLIA 2YMQA 4L8WB 4MSUA 5BN3A 4WVLA 1PP4A 3L49A 2WYHA 1Z38A 3LA6A 1F4VA 2NIPA 3VXKA 1KP3A 5LQRA 1JV2B 1SAYA 3F47A 2C2XA 1WZEA 4L8LA 4GWKA 1DBQA 3KOMA 1MC4A 4K1LA 1N7HA 3RTAA 1E7WA 1AQLA 1RHQA 2GBCA 2GN6A 2ON6A 2PX0A 4JLBA 1OGIA 3CUTA 5J5VA 3KQUA 4JLUA 2HBYA 1E0KA 1XR3A 4AQ7A 3PK0A 1P0CA 1QRUA 3LL4A 2C29D 5ESWA 4AJIA 4RQUA 3HYNA 4UEOA 2EKZA 4G0XA 4XFDA 3ZKWB 2H2FA 4UBJA 5JNWA 1XMJA 4RPCA 5IULC 2IEAA 2Y93A 1IUNA 4YO8A 3PUHA 2GYWA 4HXEB 5ALTA 4GQBA 3TTXA 2I8AA 2CHQA 2Q62A 1L5HB 4RFSB 5DXAA 3LCJA 2IHBA 2GERA 4RWEA 2ONYA 1N2GA 3A28A 3EXG2 4KMMA 4V0RA 1I7QB 3P9SA 5BNIA 1GGFA 5CJJA 5HUQA 3NV9A 2EIHA 5IK2D 2IBTA 4ZREA 2ZRQA 1ZMBA 2HQRA 3LUHA 2VDJA 4JSYA 3R6LA 1VRVA 1VKRA 2VXOA 1U0RA 1M6NA 3BQNB 1V16B 2I6TA 3GEGA 1ZK3A 4L16A 1JEJA 4KVFA 1Z25A 3OIGA 4URFA 5AHKA 1VKOA 4Z99A 2ZBDA 2M98A 4MYRA 4Q6WA 1Z2PX 2IEBA 4IKOA 1L5FA 2H2IA 1ZC3A 3FYHA 2ZBQA 1Q91A 1VSUA 2D0IA 1Z4NA 3K09C 1NYTA 5KOHA 4KHPB 1RI1A 2WF9A 3PEWA 1XZAA 2HGSA 3PNLA 4R0NA 2O50A 4FCWA 3DVAA 4MVJH 1B26A 4FYMA 2M6KA 1AO0A 1Z08A 5BOSA 2JGDA 1VHWA 3DBHB 3IUSA 4RK5A 4X45A 4ZHQB 3RKRA 2GFQA 4JLNA 1IBLB 3I9V6 1SU8A 4MGYR 4GMXA 1OZ0A 3RAPR 1XSEA 1M1XB 3VYSB 4FW9A 5JY1A 5ECYA 4LPSA 3SC3A 3IRUA 4CM5A 4DGSA 3KAPA 3GROA 4WZ6A 5K3EA 3TGPA 4Z9YA 2OGSA 4ZALA 4AKGA 4QQKA 1KQPA 3CH7A 3D5TA 2AKAB 3OFND 5LBUA 3EK2A 4MJ7A 3I6IA 1HY3A 3OZAA 3DZBA 4OU4A 5CK4A 1YNOA 2VUUA 4HAOA 1S9HA 1WXQA 3QEAZ 4D3ZA 2FPRA 1FXSA 2P9EA 5K0TA 1BC5A 1EUQA 2FN8A 4XYLA 1V41E 4RU1A 2FB9A 4ARSA 1UUFA 4OHKA 4D43A 1L7XA 1XXHA 4B17A 4ZDKA 3AERA 4KFTA 1OT3A 2H06A 3G0BA 3IPRA 4G0QA 4JEUA 4Q4HA 4Z8YA 1CYEA 3FD8A 2QV0A 1UPUA 3Q8MA 1DI0A 2GZDA 1PKXA 2LGJA 2YCBA 2QN9A 3HJBA 3I1JA 2K6GA 2Q2WA 1QQBA 1I1QB 3NZEA 1QS0A 3LPDA 1NUUA 2BFMA 3ZGNA 4ALIA 1V1MB 2R44A 1LI5A 2OMEA 4FGKA 4OB6A 1M2KA 3ZCXA 1V0JA 1TZ2A 2GF0A 1C81A 1E2EA 1K98A 5DI3B 4YR9A 1EUZA 4GH5A 3KOXA 1Y5NA 2ZJ5A 1C4WA 4MVJA 2IPNA 4HB0A 4UEKA 2G71A 3C45A 1YE3A 4KRGA 4JS0A 5K0ZA 3MSCA 2Q3LA 5C2JB 4E70A 4AS1A 1ZOSA 3EMBA 2NO4A 5EWMB 1N2CB 3A1SA 1IQUA 4DMFA 1B14A 1EINA 3WS7A 5D1HA 3KSBC 4TUYF 1OILA 1Q0PA 2DQYA 2ZOSA 2WUEA 1OHHD 1ID8A 5AHRA 3W4KA 5HILA 4F2GA 1QCYA 1VCMA 1OLOA 3UM9A 2GBLA 1DCKA 3N2GB 3G9TA 3I72A 3O3MB 4LMPA 5FTWA 1Y7HA 2YHIB 3SX2A 1TMYA 3UG6A 2BGLA 5G53C 4NCAA 3ZZ1A 1A3CA 2WWHA 2DUJA 3V1YA 2RHWA 2I80A 4WWHA 1P7PA 3ZLBA 4M6WB 4B3MB 4MR9A 4M55A 2E4AA 3GLGB 3EX7C 1LV8A 4HXGA 1K27A 3HCNA 2B4TO 4CGZA 4RV9A 3CF2A 1KNXA 2GAOA 1I32A 3K0KA 3VZRA 1J33A 5AO9A 4EJ2A 2C5AA 1H93A 1BDHA 4DAEA 3FWKA 3DOCA 1T43A 1T9GR 1WKBA 2PH3A 1Q1BA 3LUFA 1GNPA 2VPPA 5DISB 4YECA 4TMXA 4PSDA 2OBXA 3L4JA 3MNFA 1EDDA 5EZYF 4I1RA 4AZVA 2AC2A 5DHPA 4OATA 3PXCX 4HWRA 3CZRA 3KVYA 3T38A 1FP7A 1XMXA 1Z5OA 4BLOA 3ND8A 5F1YA 3LWNA 4GNRA 1SUDA 2B8WA 2NPFA 2ZU6A 5BMVA 4K05A 1T5IA 5AKHA 1QE5A 1W96A 2JIZD 4KNWA 2XYPA 1S2LA 1I3CA 4M37A 2BTOA 3SBXA 2JAOA 3L7NA 3UB3A 4JFRA 4WKNA 1OZAA 4TRRA 2GWHA 2E2WA 3DV9A 3PUXA 2YXNA 1GAXA 5I7RA 1PT6A 3HHEA 1VKZA 2C7BA 3K9HA 1NVMB 5EYPA 1WY5A 3VSCA 4C20A 2N42A 5JJCA 1GCAA 2G76A 3AFHA 4J1TC 4F84A 4EK9A 2GGSA 4KUHA 3W5JA 1C3OB 4GI1A 1B2LA 4QLAA 5DTQA 4CR8A 4G65A 3II6X 3W3AH 2YWGA 5DBOA 3HCFA 3M3HA 2JRCA 4BFUA 4YJ3F 2ZZNA 2GYVA 1ZZGA 3VNQA 3QG1A 3RREA 3O4VA 2JFGA 4WZBB 5I9MA 1RS0A 1C8LA 3R7FA 1JEDA 1SA0B 1NHWA 3CC8A 4KWCA 5JWHA 1E4YA 3ABIA 1PSDA 4HK4A 3TE6A 4AAYA 2OO5A 5EWJB 1L4GA 4QU9A 1RXEA 1XKLA 1XQ9A 3KWLA 4P58A 3RFCA 4QXRA 3LLSA 1IEXA 2FKNA 4Y18A 2ODWA 3L1UA 4AC9A 3A70A 2CZCA 1N34B 4R9VA 4FN4A 3JQAB 4CDMA 4JI7B 1MOQA 1RYEA 5HDBB 3N28A 4ZCQA 2XCTB 1TL7C 1Q6ZA 1OYOA 1VL5A 2QD3A 4YAFA 3W78A 2QE7A 1IB6A 5TRTA 1KBQA 4JENA 2OFWA 5AW7A 2O4UX 2O59A 3SFTA 2H2DA 3B89A 3K0EA 3PHBE 2R2AA 2EX0A 4R1LA 2ZXEA 1ZW1A 2XD9A 3L1JA 4MI9A 3U81A 1N78A 2J9FB 3FJYA 4MJLA 4CTMA 3T3MB 3HNOA 1E9VA 3HDGA 2XB6A 1Z0IA 1U9CA 1VHLA 1KI9A 3K70C 3BN3A 3F2IA 3R0ZA 1F8YA 1A5TA 1F2TA 5FUYA 3D54D 4DLUA 2O2DA 3V33A 1O6BA 4J76A 4D6PA 5KTSA 2X0RA 1EA7A 1WQ1R 2D4HA 3KSDO 1TK2A 5HZKA 1GTSA 5IAJA 3OFSA 1NLFA 4FZVA 4MUHA 1Z0FA 5FTMA 4F3NA 3E9MA 3B5JA 3MAJA 3W3AA 1YR7A 4NNJA 5EJ4A 4L0DA 1YDMA 2XRZA 4G0OA 1XMOB 3K2IA 3GUZA 4KQKA 3BRWA 3F3SA 2QXYA 5CRIA 2WM8A 4HAIA 3WO0A 3U5ZB 7REQA 3BXPA 3KPJA 1PDVA 1P5ZB 1GKYA 5B58C 3FJOA 3KO8A 4F5YA 4Z1OA 1XJ0A 3ANYB 5T7BA 1MOSA 2P5YA 4G9BA 2YNMD 1JSRA 3C3DA 3KYJB 1UFVA 1G6KA 2PCJA 1COWA 2NU7B 4R41A 3JSXA 2X4DA 4L3WA 3RRFA 4PLYA 4ZA2A 1KOFA 2QUHA 3TLGA 2ZE6A 4R6XA 4K9QA 4AYXA 2ZROA 4OFXA 4C6TA 3ONWA 5DM1A 5KJ1A 2SECE 2NAPA 5IDQA 1G5TA 4FSXA 2BR3A 4N4AA 4WIAA 3T1OA 2X6RA 1TQ6A 5IYZF 2H4JA 2VIIA 3DFKA 2DJIA 2Y92A 3UKJA 5K8UA 4KZKA 1NF9A 2ACKA 3WIDA 2JK1A 4LDPA 4C0WA 2WK1A 3EZGA 3UYLA 1ULTA 2B8NA 3AKCA 1J0DA 1JKMA 1GPNA 1P4JA 3AV3A 1IEWA 2WFLA 1PVDA 1EFVA 4LG1A 2YMPA 2BHSA 2R47A 4CV1A 3ZJTA 1SQ0A 3SJ7A 3A1EA 4KAXA 2R6GA 2H17A 4X6YA 1SOMA 3VR5H 5IAGA 1KVSA 2NTEA 3FB1A 3HWWA 3KR2A 2IOYA 2FLWA 4HT3B 2A9OA 3DR5A 4C5CA 1AURA 5JZSA 3SEZA 3DZFA 3UYKA 1FTGA 2QJTA 4OAPA 2CXNA 3M4NA 3CT6A 3OKCA 5B3KA 2WWRA 3U62A 2O8NA 4GXNA 3SBDA 2W48A 3LT1A 4DRZA 3CRQA 3ER8A 3C6YA 3SG0A 5I9IA 1GZDA 4Q1FA 4Y98A 5CXXA 3SFZA 5LYJF 2H18A 3H8SA 1JDBB 4W4TA 4UHCA 4GVLA 2L17A 1J56A 1O95D 4OMUA 2K7FA 2C2MA 2NZYA 2Z58A 3LUPA 2Y9PB 1C7IA 3A1TA 3N2KA 5IXJA 4INZA 1EMDA 1OWLA 5FUXA 2FR8C 3ANMA 3DUFB 2GD2A 2IU6A 5CM8B 1XBTA 1OBHA 4KGVA 5JNLA 1WTCA 4X1KB 2FW8A 3EPKA 4Q4AA 4F8JA 3L7IA 2RMKA 5K9ZA 4GX2A 1RWBA 1P4AA 2XUAA 2ZB2A 4P92A 4Y2JA 4ZU1X 3W5VA 1HKHA 3T12A 1JEOA 2W58A 3Q7RA 4QA9A 2IXEA 2OOKA 1H6CA 1DPFA 3DKKA 5JZ9A 1VIYA 4DLSA 1QDUA 2F1HA 4OF4A 2PBRA 3MLAA 3LQQA 1B23P 3MWEA 1N5DA 3JQQA 2SHKA 4WKOA 3L7JA 4RQTA 4EYGA 3H17A 2RI0A 3BGOS 4RSRA 4TVKA 2JD1A 4GWGA 5T5QA 3WQBA 1F0KA 2XUIA 1J00A 4ARBA 3GFFA 2JLZA 4H7FA 3L8EA 1OA0A 2IP4A 2PA3A 2NP6A 1GNQA 1GAJA 1F20A 3O31A 4NAUA 5F2EA 4ZEOA 1CIPA 4CLRA 4XWYA 3RYIA 4POOA 1BMDA 5JNRA 2ZEJA 2VJMA 5K99A 1W9MA 3HJNA 3OWHA 5DGCA 4CM9A 3DDWA 3NXKA 4FBMA 4D92A 5JSQA 1P0IA 3ED5A 3NO4A 3O7MA 4NZYA 2O05A 2WIGA 2QQEA 3IQEA 1I14A 1Z0DA 2HPVA 3BHNA 3GUHA 3QH4A 4FDLA 1HM5A 2F1KA 3HVUA 1N7JA 4ZCRA 2ZZMA 3X43A 2OXRA 2Z2XA 5FLYA 1CQXA 1LFDB 5EIAA 1VHTA 3AP2A 2H59A 4IHJF 1NRXA 3OU7A 1EK1A 4X94A 2I1WA 1DBSA 1XTPA 1F06A 2O2EA 3DMTC 3EFHA 2AXQA 4RLHA 4HPXB 3W5IA 1PR0A 2XTZA 3WL3A 1V25A 2NNLD 1B0PA 2VCHA 4ZVLA 5J3JA 4DBLE 4RJTA 4GKVA 1RWQA 3GP8A 3MQ2A 2Y77A 3S3TA 3WY9A 5K8VA 4JJGA 5HUHA 3L1VA 3ISTA 1KYYA 1VE9A 2D00A 3IVAA 3IHKA 3PUYA 4PIMA 1UC5B 3CR7A 3GDHA 1G98A 3HDYA 5I4CA 3OY2A 1R0SA 4KQCA 4MZDA 4F3YA 1EIZA 1JGTA 3ENVA 2CCGA 4UDYX 3DAGA 4JBHA 4L6IA 4QBIA 4R2WA 5JW6A 3U3KA 3BG5A 1Q0RA 3MJTA 5BN1A 4UEQA 2B34A 1YB7A 1E5QA 1DKRA 2CYAA 1XVAA 821PA 3LFUA 3S4YA 4X95A 1FLDA 4KGZA 3QVTA 1IN8A 3ID6C 1BXRA 1LSUA 3K9LA 3VO2A 4B40A 3TPFA 4BBZA 3J80A 3C8DA 1IPFA 2OLJA 1FSGA 5C1OA 4Q9AA 3TVDA 1HORA 2WSYB 2V0CA 5FORA 3VNSA 1DJMA 1FLAA 1XO1A 1WHSB 4KYUA 3Q6MA 3B1XA 4D9JA 1ZDMA 1F8FA 1LTQA 3HABA 5CH5A 4ND1A 3FKJA 2PJZA 3NNDA 4J4HA 3GYGA 4TKZA 3M1YA 2AOTB 1Y7LA 2JLQA 3MRTA 1L5WA 1P19A 3E9NA 4CHTA 2GCGA 3A3KA 4PC2A 2FVYA 3TTUA 1X2EA 1Z5NA 4CCWA 4EB3A 1WA5A 4MRAA 1T8YA 1AVTA 2Q0SA 4ENSA 1GFSA 5A05A 2ZB7A 3PFKA 1XNRB 1VCNA 2EF0A 3QVGB 1SELA 1V47A 1TFRA 2E5WA 2OZEA 3K5HA 3LX8A 3HUUA 4GUAA 4JX8A 3ZV7A 4EGJA 1H2AS 2FPIA 2WIJA 3UV3A 3VOAA 3WSWA 2XOKA 3PV0A 1OX4B 2CWDA 4JGBA 2WJ3A 1CUGA 1N3IA 1T5TA 1EYZA 2WDZA 3KQSA 4RMIA 3TOZA 2XGGA 2C7RA 4A6EA 4RL4A 3OZEA 2BYTA 3B38A 2I71A 1XMVA 5DTIA 1EP1B 4W6QA 4XIIA 3A37A 5D84A 1JFFB 1AN0A 3FX2A 4JYCA 4CM4B 4YJ2A 3WGUA 3N6VA 5IXSA 2ODPA 3RRMA 2DFVA 1CHDA 2KWIA 5AIAA 2F8SA 1CZHA 1SHLA 4US1R 1TUGA 2XUPA 5BPHA 2WUFA 5ELXA 2ONCA 3Q5EA 1RPAA 5F1KA 1NQOA 1ZISA 2Q5FA 3H1AA 2CW5A 3AYXB 1C50A 3PITA 2PZEA 4JZKA 4MLDA 4JI0B 2IYSA 4AFNA 3T5PA 3O3CA 1AG9A 1C30B 4LKRA 1W85B 2DPLA 3T3GA 4OQNA 1E8DA 2YV4A 1PTKA 3AJ8A 1QDEA 2AQ8A 3QY0A 5AOVA 3RFTA 3VUFA 2AOUB 4D0NA 1A8IA 1UJCA 1Y8QA 1O08A 4KPYA 4B7ZA 2NO0A 1IQRA 1X1TA 2HTEA 1D03A 1P4RA 4LYAA 4YCCA 1RZVA 4KSYA 2EFYA 2FW6A 2PWPA 3OFVA 1S8OA 1YQ9A 4LZNA 1FFDA 4NHEA 1X87A 4XUDA 3T3PB 1MJGA 4I5DA 4HAZA 2G25A 4MKIA 1GQRA 4URWR 3EGXB 1TMKA 2REBA 3IPCA 2OOSA 1PZEA 2WUVA 1Z2EA 2ZRBA 1I7LA 3ISVA 4TZTA 5IJZA 1CUUA 1JLLB 3IDZA 4MPDA 3WYFA 3G5UA 5FYQA 3UXEA 4ITRC 3BXEA 3JQ7B 1IOLA 4LY3A 1G0NA 3BWEA 4AM8A 4R31A 1VJCA 4RVGA 4HDOB 2XDQB 1JXOA 2IPOA 2VJDA 2YFYA 1YRBA 2YWJA 1ENPA 2V7WA 1ML4A 2ZTSA 3HXTA 4H1HA 4MGZR 4O8CA 4RIHA 2BBSA 1TQDA 5BP7A 4E5YA 2XXJA 3KJXA 4J94A 1QP8A 1ZK1A 3C7TA 1MFZA 3AVYA 5ALJA 5GV7A 3S2ZA 4EKEA 2OEPA 1AK2A 3M89A 4OH1A 5B6PA 5EXEA 3UK1A 1TADA 3LRPA 3EIXA 4IIJF 3ZHTA 1Q6YA 2J4CA 5DLEA 1A8HA 3ETDA 4AB1A 3CZ4A 2CUKA 3W6ZA 3FVTA 2P1ZA 3GUVA 4G0MA 3RIYA 2PDAA 4R9SA 1H2WA 2R4QA 3PNYA 2KPOA 3OE7D 4G5OA 4QYMA 2Z56A 3HYCA 3ZC3A 1E2DA 2MHCA 2HMSA 4ENPA 2NUAA 4G4SO 3PHLA 5KYKA 3F7MA 3AHCA 1RLIA 1I2CA 1XMPA 2MINA 2Q29A 1TA4A 2YDYA 3FMFA 4OB8A 2ANCA 1W4RA 1JNYA 5C37A 1V11A 2GVDC 4IGEA 1K6IA 2IELA 3E6AA 3EXHB 2O1EA 1VA5A 3U56A 1CUHA 5JE8A 2WMOB 4KR6A 1Y6FA 3ESRA 1TVEA 1GZ3A 1N7GA 2ZUBA 2IU4A 1WBJB 4XD7D 3RABA 3R1IA 1E9EA 2ZDQA 4MJXA 4TS9A 3SDSA 4URXR 4RJKA 3TQSA 1DAKA 3KTDA 5TE9A 3VR1A 2W43A 1REQB 4KGXA 3URKA 1EE2A 2GHRA 2I9KA 4L3OA 4BS9A 4KQXA 1SBQA 2D8AA 3IAEA 4BGDA 5ITSA 4BQQA 5DW3A 1Z26A 4JP2A 4XEUA 2GD0A 5KYXB 3BB1A 4EHFA 4Y7DA 2P79A 4KAFA 5CBKA 5COBA 5BN3B 5IKXA 5T8KC 1RBQA 2EQ5A 1BSVA 3BCHA 3TDMA 3EC2A 2WYWA 4ZKDA 2F4VB 4CDRA 3CG0A 4H3HB 3OU2A 1SXIA 1KDOA 5DW0A 5GIPE 3MTGA 2DCMA 1VL6A 1QIIA 1NJ5A 1OBVA 1D9XA 1Z7EA 2AWOA 2FUEA 2P9GA 3TKYA 3T1HB 3AVQA 3EIHA 2ZJAA 3PJFA 5DYTA 5FPTA 4C7OB 4M9UA 1CSEE 3D6VA 3PTAA 1W76A 4AF6A 2VTDA 3FNQA 2E4ZA 1M2WA 1UCFA 4J29A 3RQSA 5FTKA 1OC2A 2PK3A 4C0KA 4GEKA 2G1PA 2JIDA 1A97A 5DV9A 4DMMA 1SFRA 4ZQEA 1OI7A 4F9EA 4FGZA 4PSVA 1AUQA 1KK0A 3TVTA 2AWNA 1GRNA 3E27A 3KSZO 3V9AA 2WBLC 4ISCA 1A2KC 1JB1A 2C04A 1G66A 3D8BA 5CNJA 5FULA 4L78A 5T57A 5TMPA 2C5HA 2GZAA 3ZWVA 4B85A 1EVEA 1X7YA 1G18A 3HB5X 1ZLXA 2AD1A 2DMRA 4N40A 3SHOA 3M5WA 1PNTA 5IZ4A 1SBYA 2DZDA 2PPLA 4IIBA 2TMGA 4Y0VA 1W59A 1PJ4A 2M1XA 2PM8A 2QR2A 1AMUA 1GT6A 4QHTA 5FOWA 3D64A 1NF8A 3GIWA 1KMHB 1ZI6A 4M0UA 4M1WA 4PO9A 5IUNC 5KOHB 2BEKA 2W6NA 3F6EX 2OA0A 4PO1A 4CUKA 4HQFA 5DSZA 1UPCA 3C15C 4E5DA 5JEDA 5HM6A 4ONEA 3FTPA 3PXEA 4P82A 3D7LA 3DVAB 1R0WA 4TYPA 3IAHA 4FFRA 4EF4A 5JRZA 1R50A 2JGDB 4DY4A 1FNDA 1VLJA 3P9ZA 4U5XA 5BOSB 3W6NA 7MHTA 1OKKA 1P0QA 1PFUA 1L7RA 3MMXA 1Y4UA 3RJZA 3WLFA 4EG1A 1QFYA 3B2NA 2RCYA 1C7FA 1EHCA 1G2PA 4WKGA 1P7YA 1QPGA 1W75A 2YS7A 4X90A 3WHLA 4AUEA 2A57A 2JVJA 3C5EA 5EUCA 5JSHA 3DVSX 4R2JA 3RVBA 3AJRA 4RKFA 1P44A 1VSBA 4QOJA 4X64B 3CMCO 2C94A 4LRYA 5ICSA 4XM1A 3S68A 5AJXA 3BFJA 3B3FA 1N4AA 4KLZA 4AT1A 2QR5A 4LY9A 4X61A 2B7CA 1VI6A 1KC1A 4JZYA 5TGDA 3TYXA 2Y0BA 2H1CA 4BEJA 5JC8A 3VPGA 4RIFA 4JI5B 3OJEA 1XXHB 1J2TA 3B1FA 3K6KA 4G2NA 4KI7A 4N3CA 3C41J 2FW9A 3TINA 3UJCA 5ADWA 5JNVA 1BZYA 3AERB 2XYRA 3FWPA 4MXDA 4Q4HB 1XKQA 3JAMA 1P77A 2CLSA 2R79A 1V7PC 2DQSA 2BFPA 2B78A 5EQJB 3RC9A 5BUZA 1TM1E 1XG5A 3R7LA 2HK9A 4ICIA 5AXBA 2HV9A 5JPDA 2P7IA 3PXXA 2B1GA 3Q3VA 3QKSA 1E4EA 3V3KA 1QHGA 1V9CA 3VC7A 1F6DA 3M81A 3X44A 1HG1A 2YY6A 4O25A 1UDRA 2OORC 2XECA 3AF2A 4KJXA 3DKIA 3WAKA 4ZQFA 3ZNQA 2I2BA 5F9FA 5TVGA 1ZIOA 2QRNA 1E7QA 2VRCA 4HZUA 3OG9A 3THSA 1UXOA 2WSIA 4RC9A 3UH1A 4ND6A 4DQ0A 1Y3AA 2QZSA 4M22A 1JHVA 3WMRA 1A1VA 2C1XA 2YDXA 3HB0A 4Q7EA 4RD4A 1PBNA 1WB5A 4JVSB 4F12A 2L19A 3EEQA 4KACA 4NSNA 2ZUFA 3I8SA 5SYMA 3DM5A 2C42A 3EEOA 1VBFA 4PYMA 1KIAA 1GG5A 3AM3A 1UM9A 3BMCB 5GINE 4NECA 1PLKA 3HDHA 2HA0A 1KEZA 4QDZA 5F21A 2LCQA 1NQXA 2I4IA 4QGGA 2PBFA 3T4EA 1TUIA 2GHTA 3DUWA 2AMLA 3H5RA 5CLQA 3TN7A 3TBKA 3KFVA 1SCQA 2C59A 4Z6KA 4ND2A 4L5BA 1MTZA 3FY4A 2AX4A 3SR0A 3O3OB 4CLHA 2IZZA 5AW0A 4LTMA 4GICA 2XQIA 1Z3CA 4MGKR 5A4IS 5JMWA 3QF4A 2XKBA 4RY9A 1UC8A 4II2A 3MMSA 4LXXA 4MR9B 1Z35A 2GWRA 3RG2A 2PKCA 4NI5A 5TPWA 4KQ6A 1X8XA 3BS4A 2XAAA 2SKCA 1C2TA 2OV2A 4IVPA 3TNYA 4BKRA 4MQUA 4C2BA 5J2UF 1MC8A 3F90A 5ALXA 1ZJ5A 1XTIA 5KNCH 4I1VA 2PRSA 3A1DA 4K9SA 4DHEA 1ONBA 4QODA 3HZRA 5CFNA 2ZM6B 1QXSA 1KP9A 4GGOA 4RHTA 4WJKB 1ZVJA 3K5WA 3VNBA 1T25A 1KRHA 2IT1A 3PG5A 4B5LA 1QIEA 2CL7X 3IO3A 1TTQB 3ZNOA 3T3OA 2KM1A 2CNLA 5LVAA 2GMWA 3O2SB 3RC8A 2IIVA 3SS7X 3ZWCA 2NM0A 3DB1A 3K1AA 1Y34E 3L0CA 3BREA 4ENRA 5BMVB 2P9JA 2JGJA 3MT8A 3Q15C 2FW7A 4P38A 1U4OA 4YAEA 2ICAA 4Z8XA 1E89A 1QF9A 1VJGA 5GADl 1KJ9A 4X66B 1C9EA 3N1UA 1VTKA 3HY4A 4OJKA 4X1IA 4U7GA 1YVDA 3PX2A 2AD5A 4TVBA 5EYPB 1KDZA 1I7DA 4W5TA 2IVZA 1DWOA 3NBAA 5TQ0B 4ZEMA 3OFKA 4Y2VA 4MCHA 3I2GA 1YCFA 1QC5A 3CKMA 2FCAA 4B5KA 2V7BA 4GAEA 4YCJA 1UC4B 3T34A 3CH5A 3CO0S 1SZPA 3CRVA 3PUWA 2GCPA 3IBYA 4QM6A 1LZLA 2JC3A 2NO9A 2HA2A 2YRWA 2E48A 3AOEC 4RVFA 3QPCA 1OD6A 1TJ3A 4PZ9A 2KBFA 3HGQA 2FKAA 4OHCA 2DEUA 2FUNB 2W2MA 1V7ZA 1FMTA 1N92A 2BBOA 1XRMA 4KQHA 5SZKB 3RU3A 1ECLA 1HDGO 3E8MA 2BI8A 1V8OA 2XVAA 3HCCA 1JE0A 4OGKA 1JG2A 3GP3A 4YDSA 5KNCA 3VC3A 5HK9A 2X9QA 2FWNA 4EPTA 3ETJA 1AV7A 4F91B 4EPVA 2H00A 1ZNYA 4NENA 5CPFA 4N5NA 1FJGB 2DHRA 1DX9A 1RPNA 2YV1A 1FIUA 5BQ3A 1FPQA 2GA8A 3LDGA 4YCAA 1YR3A 5JR3A 4I66A 3WKAA 4CM7A 1Y48E 3BERA 3R3WA 4TGLA 5NLLA 4A82A 4NESA 5MGNA 2QVBA 1FF9A 3ORSA 4MV8A 4MB0A 5DYWA 2X4IA 2FUKA 2IPXA 3GEPA 1F2TB 4ZCTA 4BXOA 1JSLA 1CJKC 3DLIA 3UMBA 5GY7A 1YL7A 1LRLA 3LCVB 3R3YA 4FZJA 3AW9A 4KXNA 4M0KA 1DZIA 3VMFA 2M32A 1TB4A 4QGBA 3GD5A 3P4UA 4AX8A 4IDAA 1IUKA 2EZ8A 1BNCA 3I9MA 3AY3A 4EI8A 3IODA 5EPEA 2R8YA 3TTWA 2YYYA 1RM4A 5JPIA 2PO5A 4B4OA 1DWUA 3FAZA 3LZCA 3OOWA 2HUPA 4LPKA 2IYZA 1RLTA 2I6FA 7REQB 3O73A 3P5BA 3AIIA 1QORA 1ZG3A 2BSXA 1RP1A 2KSQA 3T7DA 1KSHA 4DQDA 4KUGA 5JAOA 1ISIA 4BMZA 2WE7A 5C5CA 3U49A 1B76A 1HI9A 2G1JA 1JL3A 4H08A 2WC1A 3Q7SA 3HXMA 4BE4A 3A1FA 2IRWA 3F8WA 4AI6A 4H6PA 2K7ZA 1T4DA 3TLGB 4B3XA 1BRMA 2PUFA 2GX6A 4FYVA 2ZYSA 1O0SA 2QAGB 2VQDA 1WPQA 2HO4A 1L1QA 4C6TB 3SBOA 4HYQA 1EPUA 4UOZA 1KE1A 1ONOA 1JMVA 1LU9A 3Q3EA 3RNOA 2JZOA 2DPYA 1C3LA 1E2NA 5EINA 4KX5A 3UMJA 1QOZA 3FAKA 3PQEA 2GPSA 1LPBB 4PZUA 2SCUB 1FVHA 3IIEA 4QYIB 3QEOA 3WYAA 1GZ7A 1SWVA 1UDXA 1U2RA 5C18A 1T5BA 6YASA 1E58A 3RF7A 4UULA 5JWOA 2XVMA 4ZOBA 1K7XB 1KZGB 2WFLB 4R05A 1EFVB 2VUSA 4RV5A 2YWDA 4MMYB 4PCUA 4YASA 4FQ7A 4MLCA 1Z06A 1Z56C 3L8GA 5EJMA 2J9ZB 1MLDA 4PNHA 3TLBA 3AHJA 4YRDA 3VU8A 2O8DA 2N47A 2BFCB 4NV0A 5FBZA 2DXIA 1OFUA 4TTSA 4XDYA 1A96A 2YVLA 3G0CA 4J1QA 3RROA 3W05A 3BK2A 4DAOA 3L8MA 4ZO6A 4FBGA 5EP1A 4EYQA 4FFBA 3BMOA 4X7MA 4MV3A 1A82A 3ZJ4A 4HKTA 2BFBB 2UVPA 2KLHA 2J85A 4HY3A 3A4MA 4U2CA 5DYGA 1C0LA 4MWOA 2Q7DA 3R6DA 3QIAA 1HEYA 1XI2A 3KPUA 4N49A 1ZKMA 4ND4A 4QDOA 1BGVA 2D2VA 3AB8A 2H16A 1T8UA 4BDTA 2G09A 4IOKA 4KKXB 4MVJM 1ZI8A 4MYTA 1G5HA 3LAWA 3BDAA 4Y0AA 3GUUA 1QO9A 2EGUA 1C0PA 3T7JA 2IH5A 1FMLA 1NBMD 1R6UA 4BU1A 1L5QA 3AINA 3TSAA 5J2TA 4IMPA 4KHZA 9MHTA 4P7KA 1RQGA 2IXAA 3N2KB 4JOBA 3HRKA 5LU8A 2O5CA 2EC5A 2GK4A 2QRVA 1M2JA 3Q41A 2PUDA 3JALA 4IW3B 5L4SA 1QIGA 3L7LA 1JKIA 3QSGA 5AHXA 3T5GA 3D0KA 1F0YA 1YK0A 3BYZA 1VPEA 3GGCA 3OBIA 3R5TA 4GZ5A 4GVPA 4Q1AA 4Q4AB 2W42A 1T9AA 3JARA 3KOWA 3L0DA 3Q9LA 4WOKA 3MINA 3UPDA 1FVFA 4RL6A 4OK3A 1YL6A 3MTAA 1H2BA 1P1KA 2EFGA 2OGUA 1I4OA 4YV2A 1P3JA 2ZVDA 5IT9A 3JTEA 1YR1A 3E9CA 4F5ZA 2XTJA 1ZI9A 3MWEB 1T26A 3PTZA 4KXVA 1PBTA 1OT5A 2REXB 2WHYA 2HWYA 1GIAA 2FWMX 2IIBA 1QGAA 3WWOA 5CFQA 1XLWA 2VZEA 4M1YA 3DL0A 4YFYA 1T2FA 1M76A 2J32A 5CYOA 1W30A 4GNKA 4MWGA 2ZBGA 1MJFA 1HX7A 1IXZA 1NPTO 4JI1B 5AVTA 4R1SA 3DT6A 4DIFA 2I3GA 4MVWA 3SZ3A 1G8GA 3UUFA 2YUTA 1QX4A 2PZFA 3NHMA 4ZZ3A 1ZL2A 2QD1A 4CLRB 2RBEA 5LQNA 4YJDA 4K26A 5AVSA 5CFMA 1VYUA 1J06A 4WLFA 4PM4A 1E2MA 1J39A 3G8DA 4PCLA 4WFKA 1GFZA 2J5XA 3CX3A 4Q18A 2I67A 3AESA 4FZ3A 4QGAA 4TTIA 3GCGA 2ZW9A 5EE3A 4PN7A 3HU5A 4D45A 2RK3A 3S8YA 1CRLA 3A6ZA 1S5PA 4Q66C 1ZUD1 3A14A 4N7BA 1YGPA 1T9CA 3TSWA 4BCCA 2O2YA 1K06A 4S1NA 2GEKA 2ZRLA 5A03A 1PYGA 3WICA 1H4QA 1O03A 4UQPA 3GLVA 1N2OA 3P97A 5MGBA 1B6TA 2C0PA 2A1UA 4GZMA 4L73A 3WV5A 3IP8A 1JHZA 5JD4A 3LQ4A 4IJQA 4N8DA 1I9GA 3TRIA 3OLXA 3PT9A 4YRGA 1ZMXA 1RZ3A 3HA2A 1XOIA 3DL4A 1EX1A 4ZC8A 3UNXA 1R8JA 1JDBC 1U5BA 2OBYA 2AK3A 3AHIA 4R40A 4XQ9A 4JXJA 3UHAA 2FFAA 4DLNA 4EG0A 5GZ1A 1YQGA 5BRNA 2OUKA 4GI7A 3ZDRA 1AQ6A 4FNGA 1WETA 3P9RA 2G8NA 5F7ZA 5DYNA 3U44A 2VP2A 4PC1A 4PSAA 2DSTA 3IMEA 1BXRB 2JJMA 1TYDE 4B2PA 3P2MA 4EENA 4DEXA 4PYQA 3QBJA 3JVUA 1F5NA 3WGOA 4F93B 4L4UA 5AJHA 3LX4A 3KL4A 4BYMA 1FQWA 5H16A 3TQHA 5BSFA 4BEBA 3PQ6A 1Q12A 3CEAA 3PXDA 4TV8F 5AXDA 3TI9A 4Z4HA 3UT5A 1LPOA 4M0CA 3UOAB 1VMIA 1K8ZB 2BMVA 1FYDA 1JQ3A 1U4NA 2H2WA 2WMDA 4IDFA 1LX6A 4LEIA 4LSGA 3D3NA 3E0XA 3TRDA 2J48A 3DAFA 1SUIA 3SP1A 1XCOA 3ON5A 2VR1A 4IIUA 4E1VA 3JXEA 3UB4A 1ZO8A 4HDRA 5DNCA 5KEIA 3WOVA 2PS0A 3GPBA 5BT8A 4N7JA 1T5HX 4L2IA 4A16A 1A8PA 3CFYA 5HCIA 2NV0A 2EZTA 2GK3A 1ZMOA 3M5PA 1J09A 3FBTA 1PTJC 4I08A 4LCJA 5DTRA 2UDPA 4O33A 2PBZA 2HIMA 2YW2A 4H6XA 1E3TA 1TX4B 2ZUVA 4C3OB 4DCPA 3TLEA 3VR4D 1HOTA 2UZAA 1TEVA 3VQTA 1X15A 2FF5A 4ENWA 4HX9A 1IG0A 1ECJA 2Q50A 1YZKA 4HWKA 1A5BB 1OZGA 3BWYA 4IICA 3X1XA 5EHXA 1P7WA 2VPIA 4E3ZA 3NGMA 3V1TC 3KP1A 3UEOA 1ZWKA 3H6HA 4BO4A 4YJ2B 2EQBA 3U40A 4EQ6A 5F2NA 1NP7A 3F6PA 1XTBA 1KEKA 3TLMA 3LQFA 2OZVA 3L8FA 4LKOA 2BD0A 3IXLA 3S44A 3VO9A 2BGNA 1L1EA 4F8EA 3KAQA 4DGQA 2J5QA 1B1AA 2B30A 4QPCA 4JX9A 2XT9A 3VNAA 1HZZC 2FRVA 2X0IA 2IW3A 1DXHA 2EBFX 3DEYX 2QR3A 3R20A 4NAVA 1RDFA 4RO0A 4AJJA 5HJ5A 3O8CA 1XUOA 2A86A 1Q22A 2JJ1A 3AVOA 3OJWA 3N05A 4OJTA 2ECKA 1VIMA 4XTCS 3DWFA 1Y8QB 2GM5A 3N7TA 3BJZA 4GR4A 4RD1A 5HIAA 2WW8A 1M8PA 4WA8A 2PD6A 2Y0DA 4OKNA 5L7YA 5K20A 2V7PA 3HMQA 4KBYA 3HJFA 1XMQB 1W8DA 4F38A 1WOMA 3ME5A 3N2YA 1J2YA 3WIBA 2A0UA 2W7TA 1JJIA 3CY6A 3CLTD 3W8NA 1CR2A 2AEJA 4FMCB 3C3YA 4XGQA 5HBGA 1PEKE 2WNSA 3IBCA 3R8XA 1IZ7A 3SEAA 2UUOA 3S2GA 1EB8A 1WP4A 3IKLA 5E9QA 4BNNA 1A95A 2JCVA 4UBNA 1YVPA 5P8WA 1JFTA 2QXTA 4RE5A 4AS3A 4ZGGA 5KVVA 2OHGA 3TL6A 2J3DA 2F1RA 2B3DA 1E1YA 2JD2A 1F1BA 1MU0A 2V6BA 4DA0A 5K7SA 2ZAIA 3J81A 4BX9A 3WYNA 4LJ5A 2AN1A 1H2YA 3FNIA 3U2QA 3ADKA 1TU3A 1PGJA 4HXFB 2ONKA 2WM2A 4AURA 5IDXA 3TW8B 1Z88A 4LVNA 5IMSA 1GR1A 4JJEA 2ZVPX 3RHFA 3QEJA 1GARA 2WZDA 1N32B 3LP6A 1FRNA 5LLSA 4WCDA 2BCJQ 2YW9A 5FX2A 2XMGA 1XC7A 2HHJA 5DM70 1NN5A 1C41A 4GE3A 3B6MA 4CUJA 1G9XA 2O2SA 1UFRA 3DAHA 2FN4A 1JBKA 2I6SA 4QQNA 3TW0A 2NUAB 2IF2A 1XDGA 2VYQA 3U17A 3V2GA 3H8VA 4B6SA 4MR8B 4BKPA 1M8JA 4FHCA 5K2OA 1TQ4A 2MINB 1T0BA 4FHGA 4ZTUB 2G80A 1OAOA 2G4VA 4NC9A 1V11B 1X1EA 4AP5A 4EY8A 3D4IA 2VT7A 1Y9JA 2Z3WA 3HGMA 3MJFA 4A3SA 1TVCA 4IRXA 2TMYA 2DAPA 2B4YA 3ZI7A 2GEVA 2J0SA 2VJBA 2ZI5A 5P21A 1ZCJA 5MDHA 1HWYA 1N6KA 1NBHA 2XCRB 4TM7A 4RPKA 2PZMA 1ZMTA 2HZ7A 4M8IA 3FDJA 3R2JA 5GVSA 1ADFA 1NIPA 4GRAA 1ZITA 2GM3A 3BWVA 4V0KA 4Z3OA 3M34A 4B79A 4CDNA 4KC0A 5LA6A 5DBEX 4DCMA 5GMOA 3C3PA 3QUCA 4F6RA 2O8EA 1RFLA 3AM1A 2JFOA 3TZEA 1VMDA 3C8UA 5FPHA 1X3LA 2NTVA 1O58A 2QJWA 2JFXA 4PS1A 2BEJA 4NJMA 5E4YA 1OWNA 2QY9A 2V9ZA 4N0EA 1ZC4A 2BN4A 2YC2C 1PT5A 2PKWA 2IE8A 2CLHB 2KW5A 1QH0A 4UHKA 5K8IA 3W5AA 3O4GA 4RVSA 3I6BA 5JC1A 5JZVA 1DV2A 3LBHA 5TJ9A 3I0NA 3QBVA 3GVCA 4ODIA 2IVFA 1XPJA 1T8RA 3T35A 2GPAA 2HXYA 3RTCA 4JLKA 1LJUA 1Z4IA 3BRCA 4G0VA 4RTQA 5JAIA 1JHOA 4RDCA 4UNNA 5CU7A 1OBCA 3MLEA 2I8LA 4MGIR 3I53A 4TX1A 4BO8A 1M6WA 2Y99A 1ORDA 2B8EA 2ZI4A 4TTAA 4CFYA 4H7KA 4KQGA 1UBJS 3PQ3A 5D51S 4AQDA 5B55A 3OIWA 4BNTA 2QL6A 1VI2A 3H86A 4BLTA 2MSKA 3IP9A 1SCBA 1VG1A 1X7YB 4CBVA 5L40A 4JI2B 4YB8A 1ESEA 5BSTA 5AVOA 5AK0A 3DEKA 3NVKI 1QANA 2W6JA 4XDHA 3ORHA 1IB0A 2CUTA 4UARA 2JLSA 3NWBA 3THYA 2DE0X 4BO2A 4YMWA 4OD0A 3VJLA 1G6HA 2O3JA 4DV6B 3WTBA 2C9DA 3JD4A 3OA2A 1BH2A 2J46A 1QR6A 4MKZA 3U48A 5BMOA 2R7AA 1QF6A 2Y1EA 4GYYA 3P7MA 4KVZA 1MP0A 3NEAA 4CRWB 1UAAA 5CYPA 4WZAB 4Z1MA 4FNAA 3Q7QA 2NW6A 4BJHB 1P74A 1CY7A 2FP3A 2ZRKA 3E2PA 3FMOB 4HMPA 4MUJA 5CTJA 3CUUA 4FDVA 1OLXA 3SX0A 3U7QA 4BO9A 1R8YA 1IDN1 3JD0A 2HM7A 3WFIA 4ZAVA 2FQQA 2NXEA 2QTLA 2GYYA 3EXHC 2P0AA 4JYPA 4RPLA 2ZYVX 2P67A 3PUKA 5AKEA 1LQTA 2CLEB 3SEQA 3KYCA 4WXPA 1DFGA 5BWNA 2VSYA 1OQAA 3B3AA 1YV9A 3PJDA 4OQDA 3GT7A 4HGPA 3MTDA 1P9LA 1WB4A 2B5OA 2G07A 2XNSA 3M83A 5DN6A 4ZICA 1E1CB 1E9SA 2Z5FA 4GQIA 2WU8A 1THGA 3LRTA 3TZBA 2QIOA 1O3YA 3BCSA 1JU3A 4QICA 1L3CA 1U5AA 3KPYA 3L1KA 4RWZA 2D5IA 4HRVA 2VP9A 4D9MA 4PZZA 2BH9A 3ZGLA 2J6CA 2W6JD 1DG9A 2LCFA 1ISRA 1ZEJA 1QRTA 2KI5A 2WSSD 3IUQA 3AM4A 3DF9A 3ZW7A 2CFTA 1IQ0A 2UUBB 3LVBA 3QFSA 2WTUA 1E4EB 1S8FA 5FNVB 2XSZD 2Q6TA 3DM9B 5LQJA 3PQ2A 4EHLA 1PDWA 3H19A 2ILTA 3L4SO 3ZD6A 4S24A 1I4TD 5JS7A 2I7DA 4OBBA 1NW7A 1YACA 1KJJA 1Y9EA 2OYCA 2B8JA 4HZUB 3M6IA 1M10A 4YP7A 3RJTA 1W25A 1XEWX 3W8FA 4BNZA 4OKSA 1OTXA 1BROA 2R6AA 4GLJA 2B99A 2X3YA 1MJGM 4F1WA 1QRRA 2D59A 1U0SY 4ZQBA 3TSZA 2Y2VA 1W4CA 2AR7A 5FDFA 2B98A 1AXRA 5LXTF 1NR7A 3CGGA 4K87A 3OHPA 5CYFA 1CRZA 1PZXA 1OI3A 1XQ1A 2CBGA 1XVLA 2JI9A 3NM4A 2CCJA 4GX1A 2AQIA 1JI3A 2O7RA 1V1JA 3P71T 5EL0A 1I36A 4DVJA 4F85A 2BFAA 5I6DA 2O7VA 1A76A 2KMLA 1BA2A 4UVGA 2XPCA 4NJEB 2BP7A 4A2QA 1JUDA 3FE2A 3NJRA 2PL3A 4P84A 4MUEA 2UVDA 1BG6A 3MS2A 3PFIA 3PEUA 1DFHA 3UBTA 1TZJA 4PLGA 3WZLA 2HHLA 1GSAA 2VDOB 1ZH0A 2HREA 1VECA 3AUFA 3MAAC 4FX2A 2XCQA 3QYAA 4DMLA 4EGQA 4I3GA 3ZJYA 1TIKA 4DSZA 2CE2X 2C5BA 1DIRA 1X0XA 3FPCA 1ZOPA 2UZ1A 3WDSA 1D1QA 4EH1A 6AT1A 1YRQA 3QF4B 5K51A 5SV2A 4YLEA 4Z4FA 4KZPA 4DLRA 3C4VA 2VK8A 5KAMA 1FYVA 2RJOA 2Q0XA 4PXSA 5TPWB 3A06A 5ALEA 3LBAA 4NE9A 1J1UA 3KAKA 5LCXA 3KTOA 1M6HA 1XD9A 3DO5A 3SE0A 1XLVA 3QEBZ 1S9DA 3Q5GA 4RGBA 2CMFA 4UCFA 4KKVA 4GIBA 3AQ4A 3T5CA 4EPWA 1SM4A 1B0UA 4JL8A 4LNUA 1QV7A 5C46F 4Q3CA 4LWPA 3ESZA 2HHCA 2VAMA 2FZCA 1S2MA 2AVDA 2O3TA 3FHOA 1QO0A 4I3HA 3NHWA 3UAGA 5IT4A 5HKKA 5JLJA 1Y1QA 2DH6A 4ZOQI 2NN3C 3RT9A 2RK6A 1XPUA 1K88A 2EKQA 1K2VN 1PVVA 1PT7A 4QU5A 3OZBA 1LC3A 2YV3A 3E2MA 1GKUB 4BNUA 4S2UA 3NVMB 1KVUA 4B6RA 4EFDA 3VSDA 1K7EB 3DZIA 5BWBA 1T1GA 1C3VA 3WGJA 1UK7A 1NW9B 2O6HA 3WGZA 4X1IB 3QM1A 4LV8B 3AFNA 3TJZA 5KQLA 2D7CA 2AS0A 1DNPA 3LC1O 4HQ6A 4L9RA 1ZIDA 2FE4A 4MQ6A 1PF7E 3D0OA 2QTFA 2GM4A 4YROA 2XADA 1RAIA 2CJWA 2VDPB 3I3OA 4PG4A 4Z7QB 1K2WA 5IWAB 3ZGZA 1ZKDA 4TWJA 2K2QB 1ZIXA 3DP9A 2YFHA 3K6RA 1EDEA 4UW9A 2ZP1A 3NT5A 1J0AA 4J2HA 3VV2A 2AN5A 3ESYA 3KXDA 1WABA 1CU1A 4RVUA 2VYVD 3OE4A 1YU6A 3W9YA 3RUDA 3CLVA 2ZUEA 4H18A 4IXWA 1F2VA 5D6NA 4ZCLA 2H29A 3OJCA 1NULA 2VK2A 3NEPX 3IQFA 1G1MA 4O08A 2WILA 4E13A 1NSTA 3K5IA 4HWOA 1RE1A 2H9IA 4NENB 4PG5A 3BE5A 4R1TA 3ZU3A 3KZNA 5EHIA 5TMBA 1C3EA 4A1OA 1CEYA 4O1HA 5K6RA 2W93A 4M60A 4NCHA 1O96B 1QVZA 2G82A 2QY6A 4XIGS 4ZYXA 2GBLC 2WKQA 2JLCA 2ZYWX 3E22A 2RHMA 4WNYA 3SGLA 2RGNA 4JP8A 4Q82A 3JWPA 4PHFA 4KWIA 1IYZA 2FK7A 1A77A 4QDUA 4RIGA 2Z2YA 3TX6A 4FNMA 4DE5A 3QVXA 1CZLA 2HR1A 2VDQB 2CUNA 2GVNA 2RH9B 2WZQA 2G9UA 3V7UA 2WTMA 5LWQA 3IMGA 4EYKA 2ETXA 2WIDA 4DKXA 1NM5A 3WLKX 2CLIB 1QHSA 4A0RA 2QPTA 3AP3A 5K3SA 2BKEA 4IHKA 3R7SA 1CUSA 1OXTA 3MQ4A 1SXHA 1UPAA 1JLKA 2F43A 4B3RB 3QE2A 1Z8NA 1ORVA 4L4SA 3WQSB 1NMYA 2ESRA 3CEJA 3MWKA 2BGKA 3KQKA 1ISMA 5DHTA 2OGWA 5AW5A 1U1IA 2I2AA 3CPJB 2VATA 5CXQA 3L02A 3RU7A 5L4LA 2ZXUA 2XQJA 5TPZD 1RCFA 5AUQA 2YXBA 2ZKIA 1JDUA 2WZCA 4UXJA 1KEEA 1XK6A 1L5ZA 3Q12A 1JFVA 2I4LA 2V55B 2FDRA 1E61A 4RVOA 2L42A 1NVEA 3D7RA 4UOEA 3UCXA 4XW2A 4B4WA 2G4CA 3BD6A 1U99A 3GD7A 2W4QA 2QQ5A 2WHPA 3L0IB 1QGUA 3LUDA 4RPGA 1WQ4A 3JYHA 2FPGA 1RYBA 2TS1A 2ZE8A 1OH8A 2AG1A 4GMDA 2GUWA 4LY6A 2VP0A 4YMVA 5JY6A 4R69A 2QVLA 3GZTB 3C4JA 3VAAA 1NVBA 2MSCB 1LB1B 3HZOA 5E0OA 2ODQA 3W04A 2OO5C 1GUZA 2O8DB 3I8XA 1SXJE 2PFSA 3Q2KA 4BQIA 2O8BA 2IV3A 1Y3FE 1GO2A 1MIOA 3AY0A 1YZ3A 2PU5A 3EHDA 4QSHA 4YACA 5DE3A 1QZUA 1QH1A 1V3VA 5LUBA 4FFBB 3SSNA 3UJPA 3WLPA 1GGEA 4DTIA 5M04A 2CV2A 3N53A 2V5VA 2Z09A 4YLYA 1S89A 4WFQA 1RVDA 4P08A 5BN5A 4YREA 4C0SA 3U39A 3M3PA 2GD6A 2HKIA 4JYZA 4K9LA 3EVZA 1R00A 2GH1A 3MJVA 1Y5RA 3K0FB 3LVRE 3GVPA 3PFNA 3PNBA 4D8XA 2V6JA 3VPBA 4CE6A 4Y1RB 4MUKA 4MAMA 4N5HX 1YWGO 3AC0A 4L76A 1T36B 4AO7A 2WWIA 2EV9A 1CPYA 1L4EA 4U4AA 1W46A 2HFJA 5B57C 1GZHB 3VPFA 2JGKA 4YI5A 3FOEC 4JHXA 4DSTA 3KT0A 4HBZA 3T9CA 2WAYA 2CFCA 2VJOA 1Y9DA 3ZEIA 4G07A 1EUCB 4YRKA 3AR6A 4Y2PA 3N8GA 2K4MA 3G9UA 4BLVA 2P6RA 4R1PA 4KITB 1NC3A 4GPEA 4N54A 4DIMA 1RAAA 3MINB 1JHXA 1NVWQ 4PX2A 1E9RA 1AGRA 3V4FA 1G3QA 3ANNA 3GLKA 3K9QO 4KO3S 4UZSA 4GVXA 5T67A 3OT4A 1HL7A 1L8AA 4ZVMA 2C96A 3JD3A 2J3KA 4KWHA 2RH4A 4DCSA 3TUJC 3HP4A 3OAAA 2EFCB 4IDPA 4PGFA 3W8DA 5JWRA 2Z3VA 3AIMA 5M7EA 1FX1A 2ID9A 3MOGA 5C8DA 1W2HA 3SF0A 3LL7A 4Z7NB 2DTXA 5EG5A 1FUUA 2EBUA 4EYOA 4YPVA 5CVTA 1EVIA 1OR8A 3OURA 2VQ3A 4QUKA 4H77A 4RA6B 1WV0A 2UXCB 3FUWA 1T1SA 1AKQA 2HSEA 2H4XA 1O95C 3DAYA 3E70C 3OKPA 3PR3A 4JGIA 1Z5PA 1N8NA 3FZYA 4H3VA 4MW4A 3S5JA 2Z8ZA 3PEEA 1BKDR 1PZFA 4Y9SA 1Y7IA 3K72B 5EMMA 4RJ2A 2R8EA 3M8KA 4M49A 2HLDA 5IJWA 5DO9A 1TO1E 2QAGC 2VNAA 2XRFA 3AU8A 1K63A 3EGEA 4DJ5X 5LP6F 1Q19A 1E9FA 1MT0A 3B3JA 3IAXA 1CQPA 4I50A 4D8UA 4KK4A 1KQ3A 1EHYA 3AESB 4LECA 4JJ7A 3D4LA 2ZRCA 3PGVA 3QX7A 3MQFA 4OQQA 2DKNA 2G72A 1CP3A 3BSFA 1J9ZA 3MIZA 4PC7A 4F9TA 1UOOA 3KLNA 3MCUA 4WDQA 4R8SA 5JHGB 4YIHA 1EGAA 2EYQA 3UG7A 3KVOA 5FWAA 4IIVA 4BVGA 5LD2B 1KQOA 3U9LA 2DY1A 1VL0A 1C7RA 4QQ8A 5A5GA 1PSWA 3CLKA 4DSOA 3NATA 3IEVA 2RONA 3IUYA 2PS1A 4FMDB 4XUEA 5ALWA 4A5OA 2HL6A 3NTLA 2ZBRA 4ZT7A 4PVDA 3SHTA 4EYSA 4UNRA 2XA9A 4I99A 1STOA 4L57A 5FI1B 3ZUPA 1C1DA 1E2LA 1N9ZA 2A1UB 2C8LA 3FOCA 3VC1A 2J0QA 1EXMA 5CVCA 1QP7A 1BS2A 3HR8A 3G3EA 3ZWMA 2A84A 1KGDA 3DV0A 4HF7A 4H4EA 5KKCA 1VPWA 4JEIA 2XNDD 3LQ2A 3OLYA 4P98A 1OV6A 3ZDQA 2G1UA 3TO5A 3EULA 4X6LA 3I4LA 1VG0B 4LHXA 5I51A 2IW1A 3F97A 2OXFA 2PJUA 4RZUA 5A9SB 4UBLA 1KDVA 4WY8A 3H2SA 1Q1EA 2OG2A 3SOPA 4R2XA 3H3FA 3MT0A 1P81A 4RY0A 1BVRA 4DIDA 4ZK2A 1DHTA 3ZE7A 5K8TA 3FHCB 3SYMA 2WHEA 1H3EA 2HLDD 2Y8EA 4RCVA 2VJKA 3CUKA 1S8AA 4OXNA 3SU8A 4U2KA 1ATZA 1JTFA 4YXFA 3BBPA 1H8HD 3U44B 3H2BA 1TMGE 5B1DA 3INTA 3UH0A 2JF0A 4FT4A 1Y4ZA 2H7YA 4LWZA 1YDEA 2ZRGA 1E1DA 4TXMA 1JFSA 4MW6A 1QBKC 5CFRA 1O94A 3PNVA 3GAAA 2VEOA 3MGBA 2DPGA 3RUEA 2AC4A 5BNTA 1KY5A 2GARA 1F3OA 1HO3A 3GARA 4L7QA 3KHTA 1OW3B 1QZTA 2QUIA 4HATA 4Q12A 5C80A 4N82A 3ZH9B 5BQPA 2A7XA 2Y68A 3ZYZA 1CF2O 1R1DA 2H5IA 2R62A 1D2EA 1A7JA 4HDRB 4HLCA 2V4UA 5AVRA 1O0BA 4M1ZA 2P6MA 4NEHB 4QFDA 4L2IB 3FW1A 3I2FA 4D80A 4PC3A 5FEMA 3HS3A 1LLUA 2WIAA 1SJ9A 1RMQA 3GCZA 3P9PA 3DZCA 4PSCA 1KI2A 1ZNQO 1EJ6A 3EVTA 3G0HA 4IXNA 1P1FA 2P8SA 4GFDA 4YUVA 2R6CA 1DIHA 2IPAB 3TE7A 5HZHA 5JH7B 1W36B 1CERA 1Z75A 2O6LA 4Q37A 3AQIA 3H18A 3R0XA 4GT1A 4MQ5A 4NMXB 4Q34A 2DCUA 2IDZA 4RGQA 5K0NA 1QQ6A 1Y3IA 4G5QA 1URPA 4GPTA 1LFAA 3DDOA 3OJFA 3OD5A 2GBFA 1PIWA 1IE3A 4NZMA 3PE6A 5LQSA 3X3HA 2IC5A 2A5FA 2X6TA 3JATA 4FIZA 4Q3KA 2XB2A 3MVEA 3EG9A 1KMNA 1JRLA 3PXAA 2I4OA 1I6WA 4N0MA 2VHQA 3DE5X 4ZMSA 4HDAA 2VDKB 4UHHA 1KO1A 1CUFA 3EFEA 4M1KA 1C3JA 1DKPA 1WKCA 2HQOA 4R71A 1KR2A 2NZXA 3EASA 3F4KA 3VR5D 2B8TA 2VWHA 1Q2UA 1QONA 2BUAA 3F9IA 3NKFA 2JIBA 4H59A 4IVQA 3KVRA 4UVDA 2IL1A 4MMZB 4UNPA 3IOEA 3LUJA 4QXAA 5AM1A 1WXXA 1BFUA 3FHJA 5HNKA 3NVAA 2DH5A 3OOJA 3CA8A 1T4MA 3PYLA 4FCCA 4I6EA 4MK4A 2O3UA 1XTKA 4H35A 5DVZA 1KIFA 2VNSA 2NP7A 1PJSA 1CW2B 3VNVA 1TK3A 4GR5A 1UJBA 2V8BA 4G56A 4RHFA 1N8KA 1YCGA 5AM4A 1USWA 2EBHX 1NATA 721PA 4V0QA 5BUSA 5I01A 1GD1O 1SCUA 4NPAA 2FMTA 5EZ6B 3LRXA 4L4YA 4LUCA 4BMSA 4QPPA 3CPSA 3UICA 3VBCA 1RRPA 1A9PA 4NNPA 2CXXA 2DQZA 2ZJ2A 1JU9A 3K0HA 5C8ZA 3VTKA 3QOFA 3T7SA 4JVLA 2XZOA 1PZGA 3E61A 1W581 4J43A 3RRXA 4C78A 2CLFB 1KZHA 3GA0A 1HYBA 4UM9D 2QAJA 3MJHA 2VNJA 4D02A 3E05A 4G9GA 4FEEA 4XUCA 2WNHA 1FDVA 1DJOA 2EJWA 1VMKA 1CIVA 1U4SA 1IN5A 1KDTA 3GG2A 3IP7A 3COVA 4TRNA 2IUUA 2NZUG 1KPGA 3N76A 5HQTA 1X2BA 1DTSA 1U8ZA 1ZGGA 1LQ2A 1Z68A 2X1HA 3DH0A 3FPGA 2P75A 2JI7A 3OA0A 3EF0A 3VNRA 1J25A 3N58A 5B6IA 4B44A 2YICA 4DMGA 1NW3A 1BWPA 2C4MA 2GB4A 3A6KA 1K1EA 1GA6A 1HA3A 4RIIA 1A8SA 1A4UA 2IK8A 4EPYA 4EGAA 1R6XA 1DEKA 2FJUA 1V5WA 2AI1A 4QX6A 1VSVA 2FZKA 2RAUA 3PDIA 3PHIA 3VNUA 1LJLA 3FN4A 1Z2CA 3CCFA 3RVLA 4UUAA 1ZVQA 3ND9A 3ASYA 1ZVMA 2WU3A 3LUAA 1CUYA 4JA0A 4Z0NA 4RGYA 2HT1A 4DDMA 2VHCA 3H9UA 4A92A 4WDRA 1RYHA 3FR8A 2I62A 3IUPA 5DT2A 2VK1A 1M33A 2CLLB 1NP3A 3K96A 5C4MA 2XNCA 2BCEA 9LDTA 4GS5A 3F73A 4QTUB 5A4MS 3IQIX 2OVFA 1GSOA 3D2LA 3G2HA 2OWDA 3ORRA 4UBMA 1NJ8A 5E0KB 5LA6B 4R5HA 5CXSA 1J24A 4AP9A 4G2TA 3MOSA 4F6RB 5K0FA 4R51A 4ZI5A 1UAGA 5TXGA 3EH2A 5EOVA 3CJRA 1ADYA 2PN1A 3P26A 1YBAA 3BXHA 3LSTA 3LU1A 3QSYA 2W6CX 2GO7A 1K08A 4XXHA 4GP6A 3PPIA 3OX2A 1R4ZA 4GPBA 3DTVD 5EIEA 4NJMB 1EX6A 3IEKA 4ADSG 1ES9A 2VEDA 1EEHA 1OASA 1Y8CA 3V2UA 3AFIA 2BLNA 1N75A 3H9GA 5L7TA 1FZQA 1HLDA 1U7ZA 1ELOA 1NQTA 1C8VB 5JQGF 2I2XB 1KEVA 3H2HA 1RMTA 4PWYA 4RA9B 3OQBA 4MWSA 3ADCA 3S6JA 3QRWA 1N2IA 5ALNA 5I4BA 1HT1E 1L4UA 4ZI7A 2FEAA 4FLMA 2RAFA 3KB2A 5ABPA 4XGNA 5B58T 9ATCA 4ZDJA 4AJ9A 2P9QA 3QLVA 4S05A 2QIPA 5K03A 3W5SA 3I5YA 3K1JA 5FUMA 3T3DA 1DUIA 4I4LA 3STYA 1KQGA 3F5DA 2X5JO 1GCIA 3OBBA 3DPSA 3GW8A 3LOUA 3CUSA 4FONA 2HT6A 3HJUA 4CT5A 1NUHA 3RANA 4A2PA 5BWCA 3FUUA 1CTQA 2NVBA 1GZVA 3KM0A 2JAPA 1I4EB 1IWBB 2R00C 1TQHA 3A04A 3LK7A 4K6CA 5TF0A 3L4KA 4AF8A 1GYQA 4J6EA 5IKOA 1Z5UA 4G0YA 4ZMRA 3EQ7A 1UXHA 2EU8A 2VA9A 5KYYA 4ZYLA 4E7OA 5FUQA 3DOFA 2H1SA 4AUKA 1SIBE 4BQOA 5IZCA 5BNZA 1LS6A 3THYB 2OZLA 2P65A 4G5HA 3WMWA 5KBYA 4QGHA 3WQRA 3WB0A 2LR0A 1MIHA 3DMGA 3UXHA 3JW8A 5J63A 1SBHA 2PSFA 3U1TA 5EPOA 2C7OA 4XTRA 4RULA 4HNRA 2AMVA 1D2RA 3I37X 1N2EA 1OLUA 1RRMA 1W0JA 1RAFA 2XB4A 3AZQA 1EFUA 1IHDA 3G5AA 1OLXB 3JD1A 3U7QB 3SVLA 3GGDA 2HF8A 2XUFA 3O95A 4N6NA 1DTEA 1ID1A 4RTJA 4N3GA 4YS6A 3ROGA 4RANA 3VR6D 3F7OA 3KYCB 2MSLA 2GK6A 3QLUA 1LPPA 2XY4A 5ITVA 2PLAA 5EI5A 4DBZA 3EW7A 3RTDA 1SEPA 1U7DA 4G5FA 4FYHA 3WC4A 1FFEA 1AD2A 2B6HA 5EKXA 3WLOA 1BN7A 1GPLA 2RSLA 3ZOZA 2IXBA 2P90A 4Q1EA 3H4MA 1C7QA 5DRYA 2JZCA 1TNDA 3QXCA 2V7TA 4MV7A 4G0WA 3DGEC 1XL1A 5DB4A 4D9CA 2OC4A 2VS1A 3A3PA 4L8FA 3GLHE 4QEZA 4G23A 1N5JA 1WCIA 4RSGA 1AK9A 3F7TA 2B0JA 3ZU6A 3MSXA 5F2OA 4JI8B 1IPHA 1PAUA 3LC0A 4FOTA 4TMTA 2J33A 2YV5A 4IS2A 5TGZA 4EB6A 2BM9A 1BWSA 1S3SA 2CVPA 2Y9MB 4B6EA 3LI2A 1UXGA 4MYUA 3VPCA 1QHFA 2R86A 3B48A 3IIKA 1BFKA 3E7PA 5DX1A 1T6ZA 1TIBA 3KHKA 5B53A 2LUOA 3U3DA 1FBNA 2H7VA 1RZRA 5IC5A 1QGED 1OXVA 4HGNA 4DLTA 3L7DA 1UKYA 3RKSA 4KMOA 3FSGA 2Y0EA 1ODLA 1V2GA 4I14A 2JGIA 4M3NA 3QHAA 5K4GA 1SNYA 4OXKA 3WFZA 4MO9A 2C2WA 3GZ4A 1CJMA 3QWHA 1T15A 5K3DA 1P17A 2RE8A 3BCRA 1SIOA 3LYUA 1A27A 5ADHA 4G09A 3I5AA 4BYGA 5ICEA 4ARVA 3H4TA 1T4CA 3LCUA 3PC7A 3X1DA 3V2HA 5AVYA 1MB4A 2ERYA 1JHAA 2GCIA 3LMKA 5C0OE 3ZTYA 4XVCA 2FG5A 1IHOA 1K4KA 2P41A 2IOFA 3DP7A 1IZYA 1I7NA 3F96A 3HCOA 3MEQA 3OZXA 3QKWA 3D6HA 4HOYA 2Y0CA 4JEMA 1OGYA 2RC6A 2VAWA 2AVNA 3ANTA 4AYTA 2BP7B 2ISSD 4L5IA 2X1MA 3IA7A 1NKSA 4WERA 2OY0A 3UKOA 4I4CA 1ILEA 1UT8A 4BAUA 5ISMA 2A0YA 4LSWA 4DDVA 1DRJA 4JLOA 4Y0NA 1NW5A 3I05A 4URZR 3EWSA 5CA1F 5IT5A 1VYVA 3V8NA 4U7JA 2EX1A 4W9MC 2J9RA 1Q84A 3BXFA 4O4JB 1XDDA 4AZ0B 3FIUA 3DBOB 2J6BA 5G1NA 1Y1KE 4N3BA 1E32A 2C4KA 3LQRA 2R1TA 1MMFB 2BGTA 1PWXA 3MUOA 2YR0A 4B3FX 1CDDA 4YWJA 5JMTA 3PHJA 1RC1A 3FPJA 3EAGA 3EB9A 3GHHA 4TLBA 3VKWA 1YE8A 5JDIA 1RZRD 1DADA 5IXYA 3K35A 1R16A 4KRXA 4H9GA 1G4HA 4LNUB 3FSJX 2ZSBA 3EQ6A 3MCVA 1L5KA 5ULLA 2JAQA 3FOFC 4YNBA 3ZV5A 3CRRA 2NSDA 4P4LA 5CIQA 4BVBA 4AWAA 2I3BA 3RS9A 1SXJA 1XJQA 3UTCA 3GRKA 4JXKA 1R5OA 3SEFA 4KO1S 4K3UA 1UFOA 1Z4MA 2NUTA 2Z6VA 1BQ4A 3JYLA 2PMDA 3OIUA 1C7EA 4AJPA 4AECA 3UF0A 4UKDA 3HPQA 1O6FA 4QJ5A 5ALFA 3K05A 5KX5A 3CVWA 2JJ8A 2VJPA 4OQFA 5BSEA 4J0HA 4GZLA 5KVQA 1DMRA 5JUWA 1TEXA 2WJ4A 3AY7A 3CMMA 3G49A 5FFFA 4CMKA 4DIOA 4DXHA 1HQKA 4J0EA 2OE2A 3TR0A 1ZS9A 3UGTA 3WNQA 5CVVA 5JVDF 3ICPA 3IP3A 3NIGB 2XOEA 5E7JA 1OIWA 4PLPA 5FH9A 4LOAA 1ZFNA 2PBLA 3K09A 4W5NA 1KKLA 4MCJA 1I2MA 2ANBA 4M87A 3H9JA 1VG9B 3L4BA 3OESA 1RD4A 1IOVA 4L4ZA 4PZCA 3EIEA 3NHFA 4OLFA 1T0PA 1JU4A 1UXJA 3BMNA 2RGYA 4KR3A 3HCEA 3HVKA 1ZSYA 2XGSA 3LK6A 1GOTA 4FYPA 5AVWA 2VF2A 5HX7A 5LBIA 4FZRA 2OAQ1 1EFPB 3EXFA 3SI7A 1JG1A 1RLUA 4J75A 4PCVA 1G8MA 1Z07A 2JL1A 4MUFA 2FSUA 1JZTA 4NOMA 3TM5A 1KK2A 4PEVA 2QRQA 3WBKA 4IFTA 4CKBB 5JTTA 2HNAA 4YP6A 2B2XA 2RARA 4ZAXA 3ZVKA 2C2HA 4G5SA 3AO0B 2OHJA 3DA8A 3E22B 1X1SA 2N75A 4HAWA 3WHIA 1KYQA 2OTCA 3KQYA 4WOPA 1F8GA 1L7PA 1W47A 1GSIA 1YK1A 3DW1X 4R3WA 4YDHB 3VYRB 1RHUA 1U02A 2GJKA 4ZZ2A 1GRQA 2ZT7A 3L0YA 5A4FS 1M9NA 1WP9A 4MVJP 4AP6A 3U16A 3QKUA 4K2AA 3H5OA 4PE5B 2C3OA 2JA1A 2ZTVA 3TK1A 3GX1A 5IC4A 3GCDA 4LDQA 3ZY2A 3KSAC 3AF3A 5FFMA 1QK3A 1EFRD 4JJAA 4C0JA 1SUEA 1U3GA 2F43B 3UMGA 2ZDGA 3RGGA 3L7BA 2ZSKA 3T41A 1EGQA 2HTFA 4FGSA 5L3RA <