4Z7JA

Structure of acetobacter aceti pure-s57a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVAAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of the conserved serine in two PurE classes
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 55
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4z7jA00
3OPQA 2FWJA 2FWPA 2NSLA 4AY3A 2FWAA 2FW9A 3RGGA 5CVTA 2FW8A 4YCDA 3RG8A 3TRHA 2FWIA 5CLIA 1O4VA 1D7AA 5CLGA 4JA0A 5BORA 4YCBA 4YCCA 4ZC8A 3ORSA 5CLHA 5C5DA 5CLFA 3OOWA 4ZMBA 4B4KA 1U11A 2FW1A 2NSHA 2H31A 2FWBA 2NSJA 1QCZA 4YCJA 4ZK2A 3LP6A 5BOSA 5BOSB 1XMPA 2FW6A 5CLJA 4Z7JA 3KUUA 5CTJA 4AY4A 2FW7A 2YWXA 4ZJYA 4GRDA 2ATEA
chains in the Genus database with same CATH superfamily
1ZS9A 4N3CA 2QZZA 3W9UA 2FFHA 5LD2C 1SK9A 2VJBA 2WYOA 2PXHA 4MI9A 2AOUB 1BKDR 1YCGA 2G6BA 2QTFA 2ZVQX 3ELBA 2RGUA 4HLCA 4W8HA 5CHYA 1CQWA 4N0QA 2IDMA 3AHEA 5DN9A 2NU9B 4AJHA 3MS4A 3WDMA 4H4CA 5DH9A 5DULA 1FE8A 5AR1A 5FA6A 2YCBA 1PDVA 3WLJA 1I6MA 4FB5A 2VJCA 4ER6A 1A0OA 5JOQA 2ZM5A 1GGHA 1PL0A 3JQBA 3W8NA 2O6HA 4O59O 2H3EA 1Z6XA 5H3CA 4UTPA 3FDXA 2PLAA 3BG5A 2HLDD 2HKIA 4P8RA 4WJZA 2IIVA 3HBMA 1PFVA 3V4VB 3TBHA 5F35A 1RQXA 3KBOA 4JI4B 2ADOA 4C5AA 4B71A 1CZRA 1VHLA 3OQPA 4UEOA 4P4NA 3DTYA 2PKWA 3Q6MA 3RSSA 4Z4EA 1O3YA 1ACLA 2BKAA 4M37A 1ISRA 4G41A 1WHTA 2H5EA 1NBME 2G1JA 2CYCA 3OT5A 1DAIA 5ICFA 3H65A 2A58A 1Z9BA 1PT9A 3IHTA 5DM0A 1F4PA 5E1BA 4O1IA 5M5BA 3T7JA 5HF5A 1QLWA 4NCAA 4IDDA 3WYEA 2VKQA 3X1KA 2P3LA 1E0DA 2R8OA 1Q0LA 2HJ9A 1YIDA 2VSNA 5K09A 3ZDXB 1B1AA 2XVZA 1ES9A 4E70A 2GERA 4C3ZA 4EHKA 2H48A 4AU1A 4IJMA 1N8NA 3WGQA 2I78A 3BDIA 3HDVA 4CM7A 2UUBB 1SXJE 4KFUA 4UPDA 3QV2A 4F5YA 1Y1RA 3S2ZA 3MW8A 2QRLA 3AWDA 3M5CA 4PINA 1ZMTA 2BDEA 1YBHA 4H1UA 2WB2A 1UWVA 1X7XA 4BZZA 1WXWA 2H8GA 3SM9A 1SJ9A 1GRCA 1A8QA 4G0UA 2ZJBA 3VHQA 2WKQA 2JIQA 3STVA 2OCAA 4OL0A 1FTWA 2H1RA 1W5TA 1II9A 3BSWA 5ICMA 4DYHA 4OLBA 3K71B 2FZVA 2FHSA 3QPWA 1N2EA 4EB6B 4PBTA 4PAGA 5T7BA 2HCJB 5IWAB 1W5FA 2Y0CA 4RHYA 5CVUA 5KYTA 3JQFA 4D1YA 2CXRA 1KMHA 2EZ8A 3L0IB 4PNEA 2K2QB 4FN5A 3K9CA 3DFUA 4XFJA 1B0AA 2J4CA 3WGMA 3T7DA 2XMPA 3TZLA 9ATCA 1Z0ZA 4Q3DA 1E2QA 3QYFA 4XGRA 4O4JA 4EHBA 4PQFA 2V58A 5FADA 1HDXA 2RHWA 3ZQ4A 3U0BA 3HCCA 1X1RA 2G0TA 1A5SB 3GLGB 3ETEA 3IEIA 5JFGA 2IS1A 1JEAA 1IONA 4GU5A 4HO1X 3A9CA 4O4LF 3RRJA 2JGMA 3WLOA 1ODJA 3U7QB 1EHIA 1JV2B 1LC0A 3GCZA 3Q8KA 4DM7A 1O4WA 1YIAA 2C0PA 4GVPA 1VL5A 4OG2A 3W79A 1XJQA 4R40A 3WHIA 4GPTA 2BUAA 2WSMA 2V4UA 3EXHC 4R9VA 3PQ8A 4KIFA 4RY9A 3FZEA 4WUTA 2J07A 4JL8A 3E9YA 3ETDA 3AUKA 1HPLA 3TM5A 2EW8A 5DX0A 1EKXA 5FWDA 4EI9A 4FMBB 1N77A 2WU0A 1Z5GA 1N32B 2PL9A 4N3BA 1TMGE 1FJXA 1H22A 2MJLA 2CHGA 1A7KA 2YVUA 3BH0A 1TU3A 2A1TR 4UMEA 4BX2A 4C0XA 1T4GA 4BKQA 3H5RA 4QBGB 1V0JA 1N1DA 2FR8C 1Z75A 4YPFA 1MJHA 2EWVA 1M7GA 3ZWAA 1Y9DA 3H5OA 3OPYI 3RTEA 4NNPA 4JXXA 4AQ7A 4CDRA 1V7CA 4LGVA 1YI0A 4ANFA 5TSDA 1E2GA 2HJGA 1RXVA 2EFYA 2OT3B 2YJNA 5TRTA 1ZL2A 1EFHA 2HEGA 4ME6A 3ER8A 4D41A 2EHJA 1KDOA 1Q3KA 3OU7A 4GIBA 5IMSA 3ZHUA 3FOBA 5CD1A 4RUKA 2JFHA 3W9SA 1KTIA 2LTAA 4WBNB 2AWNA 1G2IA 3W4IA 3JPYA 1GG5A 1UBLS 4FQ7A 1II0A 3NH9A 1YK0A 1JB1A 4WVLA 3R7SA 1ZJWA 1NBWB 4WZZA 3KTDA 1IU9A 1ADCA 1JECA 1TK9A 1HX7A 4P5PA 3QEBZ 2AB0A 1U2DA 3OTHA 3P9KA 2C0QA 1TZMA 5F7XA 4ABTA 1R6BX 5I8ZA 3ZE9A 4EFNA 5KSOA 4L78A 3K2BA 1PG5A 3CZMA 3S2GA 1MT0A 1NATA 1D2EA 1NNI1 1W19A 2QL5A 2ZDGA 4RF2A 5T6MA 4F3YA 2QWXA 1FVXA 4EW3A 1AKEA 1CUEA 4DJDC 5HZMA 5AVRA 3CZ5A 3Q10A 5JQGB 1Y89A 2O0HA 2PLNA 2B9EA 4JUAA 4I4TB 1EEHA 2IYNA 4NMHA 4JN6B 1ZSYA 4ZI2A 1CRZA 1WP9A 3S1AA 3U80A 3B9QA 1CJMA 1U7XA 3COWA 4MR8A 2J3QA 2Q5LA 4FEAA 3UWKA 1FEZA 5LQAA 4YCMA 3AHFA 3SE7A 1QS0B 4PGAA 1J1ZA 3RFXA 1GPYA 5CM2Z 3Q3IA 4JIGA 4E09A 5K20A 2D62A 2CVQA 2WUFA 2Q29A 2XX3A 1SXHA 4IH9A 4YQZA 4B3GA 2V6IA 3PR3A 1U11A 4R1NA 1Q20A 3IBTA 4XB6B 2VHWA 1M0SA 3EEFA 3GRPA 3ND5A 5IVDA 3VR4D 3CX8A 2J3MA 3WX0A 1T8PA 3UHPA 1G17A 1U0FA 4TT3A 2X9VA 4HD8A 3EUFA 1CDOA 4AMUA 2BY4A 3UV6A 1TMYA 1SB8A 3C6XA 5D84A 2LCIA 5IAOA 1TCUA 5D6OA 1OV4A 2YY6A 4D0RA 3CVXA 3S28A 1RWWA 1PJZA 3RK4A 2XVMA 4CQLA 3IAM1 1UBEA 3LDHA 3PL1A 2BZ0A 2TMGA 4Y2QA 2DSNA 4MKRA 4HNHA 4FWBA 4I8IA 1HE1C 4IIUA 4WDQA 1FXWF 1ZVQA 5AM5A 2WWHA 3GJSA 1KJJA 2DRIA 9MHTA 2G5GX 4IBOA 4O4IB 2FOIA 1JIQA 1Q74A 3AV3A 4QHYA 1BMQA 1R0WA 2OBYA 3T7AA 5JXJA 4J90A 1DAFA 1NVTA 4IMPA 4HQ0A 4JX8A 4HAZA 5DWDA 4WCFC 3CSUA 3HYLA 3T3IA 4F8EA 5IS2A 2COKA 3SD7A 5BPHA 2OO7A 4EYKA 3I53A 3W1EA 2GHIA 1Y3HA 2Q6KA 5CFLA 4CR6A 4GBED 5ENZA 2EOAA 3DZHA 1GNLA 3U9SA 4TYNA 2D74A 2IVZA 2BGUA 2LDBA 3E9RA 1Q92A 4MKZA 5FIUA 2NUPB 3WB2A 3ZI4A 4DZZA 2VLIA 1X7YB 1C8VB 1L5VA 3E2PA 3MCAA 2PD6A 4ZQBA 4EVQA 2C94A 2I6SA 1E99A 1W2HA 2O2DA 4XOUA 2M1XA 4HQFA 3R7WB 3WLHA 3EZGA 2O2JA 2HCFA 2XY4A 3PNKA 3U4DA 1QZTA 4D5GA 3STYA 4JQSA 3JQPA 2D59A 2ODPA 1UM9B 3B51X 1PFGA 3O7MA 3S7TA 3IXLA 4B81A 1ZVKA 2C97A 3CRMA 3HO8A 2J6CA 3GRAA 5GGXA 4OK3A 1ZGZA 4HN9A 4MB0A 4U6QA 3BTSA 5EI5A 4F91B 3HDJA 4FYKA 1PDWA 1TO2E 5FL7D 4IJ5A 3Q6NA 2C2MA 3GLQA 2OO5A 2BGIA 1UAAA 2QD5A 3FCYA 4AXXA 1HRDA 4X65B 2HR1A 1H94A 1PZMA 3NXKA 4FW9A 3QUSA 3MIZA 4RKQA 5AXAA 4UTVA 3KTFA 4MMZB 2CLEB 1I7SB 5CW2A 3LO8A 1LY1A 1W5EA 1HKUA 4HDKA 5EMMA 4B85A 3T0GA 3UMBA 2PZFA 4WH0A 2Q0QA 3W5IA 1GT6A 1WUJS 4GS5A 3DE0X 3UFXA 3VKWA 1NXXA 2JAOA 1N8KA 4NOJA 3I9KA 1VYVA 1M1ZA 1BQEA 1E1YA 1SFRA 2J5BA 3MMSA 4BB5A 3ESRA 5DM1A 3T8YA 1GCAA 3KE9A 5FYQA 3VC3A 4DCOA 4DJ5X 4EG1A 3ER9A 4YAJA 1NURA 1PK9A 2VF5X 1VSVA 4LOAA 4TTQA 2VPTA 3CCBA 4MROA 4LMBA 4O33A 5CM9C 1DBRA 1NPYA 3EGVA 3KKQA 1Z37A 2BBWA 1WSBA 3WIBA 3I4CA 4M7OA 1T1IA 4IX9A 1O6GA 1JXOA 5I5GA 2BMAA 1CJCA 1XZLA 3ANXA 1PGNA 2DBVO 4JU9A 5AHXA 3BD8A 4D74A 1JHOA 1JRLA 4CIDA 2QUIA 4IDQA 3JQQA 5KYUA 1HDOA 521PA 4DANA 3JQ7B 5JYDA 1THZA 2FPLA 1GUFA 4Q05A 2GNPA 1WZEA 4WUVA 3DAOA 1P1BA 1Z39A 4IR7A 4AZ3B 4B4WA 4X95A 4BJ6A 4E21A 4OJKA 4EI2A 2H1OA 4NPHA 1WUTA 2QLJA 2XV1A 1T2VA 3K6JA 4J7XA 1WIWA 9LDBA 3V4OA 3GOQA 1JZTA 2QROA 3AONB 3N59A 4HPJB 2KBFA 1RYYA 4GWGA 3WGZA 1MJ5A 1MXHA 4GUDA 4ZANA 4LHYA 5CH3A 1RYZA 3EMVA 4YGXB 1R8QA 2P6MA 2V3WA 4LSWA 4UM7A 4ZHQA 3OH8A 1EFTA 2HU7A 1NW7A 1T1SA 1K7SN 3KXIA 2ET6A 4RULA 1EWVA 4NR0A 1I7NA 2H08A 5AHKA 1N0HA 2DVMA 1RBYA 1XZBA 2OC4A 3DMPA 3OBIA 5DBFA 1EFUA 4QGHA 2J9ZB 3S70A 4BLWA 2IK8A 1PU2A 2IZZA 4J3NA 2JKYA 4CMCA 5MN6A 3HZRA 3P7MA 1FLDA 1DJQA 3IULA 3KS9A 5IC4A 3WK5A 2FUEA 5A5FA 1EP3B 3MPUA 4WN3A 4DG8A 1WEKA 4EBFA 3OBBA 5HIJA 1Z0DA 5ELLA 1D8AA 3UAYA 4BCDA 4R0VA 4DIFA 4HZIA 1TYAE 1B6TA 3MRVA 2XUDA 3L6RA 3W5JA 4C5CA 4WY2A 3T1HB 3VVMA 4CLEA 2XNHA 1E9EA 1F8GA 3URMA 2XCLA 2FZGA 1T2FA 4FR5A 3IMEA 4LYHA 4RCVA 3EY4A 3GZTB 4KAXA 3U61B 4BFCA 4KIUA 5K45A 3U17A 2VTKA 1ISPA 3PGJA 1O03A 2ZAGA 2BIFA 1QVWA 1NOKA 1Y0BA 2X19A 3JARB 4G0YA 4Q9NA 3P0HA 4WZAB 3IV7A 3ZJ4A 4CKXA 2X14A 1XQWA 4QX6A 4N9WA 1EDZA 2FUNB 2XMSA 3H9EO 2YRWA 3EGDA 1JKFA 3WGIA 4UBJA 1P7CA 1LH0A 3EIOA 3OQ6A 4BASA 4BEVA 4QVIA 2O19A 5F7OA 2YHBA 1Y5RA 2J7KA 4FFVA 1OPRA 3H1TA 5TT0A 3MERA 4X7MA 3B52X 3F5FA 2YRFA 4ER3A 4IIJF 5KJ6A 3ISVA 4ECAA 5H7XA 4YRGA 3JQ7A 1JHQA 5KUTA 3KWMA 1E3QA 2FCAA 3A1VA 3O8BA 1G0NA 3GELA 5CR9A 1J2RA 2RBKA 4QAQA 2FFBA 1OOEA 3WQRA 4TVSA 2GJKA 1J90A 1X13A 2HL6A 3NORA 4RDCA 2D2FA 1CUCA 1UMDA 2AXPA 4YUZA 3R9WA 3K05A 2WY2D 1X15A 1JWAB 2AZXA 3DAHA 1O5IA 1I2MA 4L5AA 2V7TA 2VPZA 3HVHA 5JZOA 4AMGA 3MTIA 2XYRA 3VGPA 5JMWA 4L27A 1OIWA 1T9CA 1WMDA 3VO9A 5BSEA 5L7TA 1UDCA 3F7TA 1E77A 2M6LA 4P7FA 3TQFA 3EVCA 1AMOA 3EK2A 3DBLB 2BMEA 1P18A 4EF5A 4I50F 1IN8A 3U19A 3FOWA 4MPRA 1MZVA 1N2CB 3HKDB 3DL4A 4XLZA 5JU6A 2QTNA 5L4SA 4OJMX 4C08A 2VUIB 4FVTA 4OPMA 5CLIA 5D6NA 3CRRA 821PA 2X8LA 1OLUB 5AJTA 2X5KO 5EP1A 4M9QA 4QFDA 3LCJA 4O4LA 4X45A 1X3SA 4JI1B 3RIYA 5AW0A 4J03A 2BUCA 4YXWD 2QRZA 2TMYA 2H0RA 1PW7A 3QU7A 3VJKA 4P53A 4BKOA 2DTEA 4V0OA 1SIUA 5FNVF 3ROZA 2VYQA 5EWMA 3P27A 4YRSA 3PITA 2VHUA 1Y3FE 5AVKA 4LF4B 2GFQA 3E8SA 4JVNA 3F7NA 4UEWA 3AL0C 1TEHA 3RC8A 3KYDA 1B6SA 5FBKA 2PV0A 1KO5A 4FK8A 1ZCZA 5E1OA 3VX4A 3GQBA 4L4RA 1G63A 1Y1PA 2Q9AA 5LNK6 1XU7A 2VCYA 4J1QA 4KNWA 4COKA 1Q17A 1U7WA 1UPBA 2QN9A 3ELUA 4WGFA 5ITWA 4EUSA 4RXUA 2C9BA 2HLHA 2CZCA 3QELA 3C16C 4XYBA 3RJ5A 1Z5OA 1UMKA 1A9RA 4I5IA 1NYTA 4K6HA 4DGSA 4ZFNA 2QRHA 4KTTE 4LZZA 4F11A 5BQ3A 2XE6A 1XMVA 4C05A 4GXQA 1I24A 3M5WA 5F3RA 1C1XB 1G8SA 1N6PA 2DFLA 2GQ0A 3I9NA 3NYRA 4DF3A 3B9RA 5JEEA 4E1VA 1N34B 4V03A 2FRXA 2VWHA 3VPGA 4EGFA 4ENWA 3CW8X 1X1AA 5FJIA 4JYAB 1U3VA 3ZYCA 1ZRHA 3C2QA 4FLFA 4R0MA 4Q4DA 2R8XA 3OPXA 1PEDA 2C61A 4B09A 4RW0A 3TUJC 4DWOA 5JBIA 4RK6A 4URXR 3UICA 3E7PA 3IODA 5TPZA 4QFCA 4WWHA 2YFKA 2VP6A 3TJMA 4UJ3A 4EF6A 4NCXA 4Y1GA 3L4JA 2IUTA 3W2EA 5A0TA 3EXEA 1W1WA 3B1ZA 1T8WA 5JW6A 2O50A 3UVEA 5HX7A 3PXBA 3RVRA 4U8GA 2G76A 1ZK2A 2JK0A 3ADKA 3DAYA 2PIAA 3L1JA 3BL6A 4Z51A 5DGXA 1NE7A 4I1PA 5E9QA 3LX8A 3T9FA 5D3ZA 2Z3WA 3AHJA 2INGX 2G0NA 2X3UA 2XA9A 3BCHA 1IWOA 4JFAA 2YV5A 3HJTA 2C96A 5EWJB 4YCBA 1XPRA 1N0VC 1HQCA 3NOOA 4QG3A 2QBYB 5LQSA 3N8GA 1Y6RA 3IIIA 1QSGA 3P9QA 3PJGA 4I5DA 1EK1A 2GMWA 3O8CA 3ZH9B 4Z1MA 2W22A 5TMBA 4RK1A 5TPWB 2ZR8A 4M0DA 3IVMA 1K2WA 4HMOA 4OXXA 4IJWA 2P79A 3J7TA 3T1QA 3UMYA 1Y5MA 2XWSA 2D13A 5D01A 4Q93A 4MI6A 1HUQA 4M99A 4BZXA 3HJGA 1BE1A 1AS0A 2JFZA 3L6CA 5F21A 5BV8A 5MHTA 1GLVA 1AGYA 1RYEA 1PIWA 1PJ4A 1U6KA 3FM9A 3FAZA 3K9NA 2JCVA 4JLDA 4MVJG 3E70C 4MULA 5KNBA 3CVUA 1JHMA 1UJMA 1ZHOA 4PLYA 3M33A 3MBKA 1OI2A 5BP7A 4HYEA 3L9WA 1ZGCA 4PYQA 2V97A 3SMQA 3A8TA 4YY3B 1XDSA 1KK0A 4AWBA 1GL7A 4OHPA 1U31A 2GBGA 3QVGA 5C1PA 2OSBA 4RD1A 4TXNA 4IIYA 1M6EX 1T8UA 1VJ0A 1RDFA 4OP3A 1H93A 2XTZA 3H84A 4YA6A 3ZDRA 1O54A 3CX3A 4NJEA 4EL5A 1NW4A 2FXVA 4ZMRA 4KWTA 4RYDA 1V96A 5EKDA 1JKJA 3GROA 1D6SA 2P8SA 4I2NA 2QNBA 1RWQA 4X7PA 3TW6A 2X1HA 2QUHA 4ETWA 1LK0A 1O8BA 4ZZ3A 4DUYB 3MRSA 4KRFA 3GRKA 4ATNA 3H5IA 1LVGA 1DTWA 4QPNA 4X85A 2XWBF 4Q9HA 5IBPA 1QC5A 1X7WB 1Y1KE 2AYZA 3AF0A 3BERA 3RAJA 4LBVA 4IUBS 2A2ZA 5MF6A 2G9NA 4XGNA 3QE9Y 4OI4A 1YOVB 4HNSA 4W5HA 3VFDA 4HRAA 1SUPA 3A3PA 4YC7A 3EPPA 4CRWB 1AZTA 3RUHA 4ZICA 3R9XA 1F14A 3W8EA 3ZD9A 5KQPA 1W36C 4JI8B 1KZ6A 3QE4A 5ITZA 5KDOA 1QFYA 4J16A 4XX1A 2QN8A 2C5EA 3ZY6A 2GOYA 1TL7C 4ZCIA 1Z0UA 3G88A 5CNMA 2LDXA 4BU1A 5A6VA 2OYCA 1ZSNA 3ACDA 3V8QA 3ZV4A 4QLBA 2D06A 3GNQA 3HU1A 1QRRA 3PUWA 4KLAA 3BFVA 2W83A 2O1SA 3OZWA 1NLMA 1JDZA 1T26A 1WMBA 3KSMA 4PO1A 4XGQA 2GBFA 5LL6P 1R3DA 1QHHB 3S8MA 3HEAA 4AB1A 2WWWA 4BUCA 4C0QC 5AI5A 3O73A 2QP3A 5DBIA 2M9MA 1T2UA 3FSJX 1Y9JA 5AH0A 4YRDA 3RM3A 5F1KA 4F1KA 4X3PA 3U4QA 2R97A 3N2LA 1MAVA 1KAMA 1V2GA 3L82B 4QECA 3RYHA 2C57A 4ND3A 4EJMA 2Q0HA 3A27A 1YS1X 4XSGA 2VOEA 4Z9BA 4RGYA 4BQOA 4CM3A 1SG6A 2YYYA 1P8AA 3UTDA 5A3SA 3CXUA 5L53A 4JLAA 4HBGA 1ZIOA 2VLBA 4UEJA 2P3SA 3CIFA 5C0OE 3FZNA 4EJSC 3LHDA 5EJMA 3JZDA 4NE9A 1WDWB 2YICA 1AURA 1NONA 2H4XA 2PFSA 2R7NA 5SY6A 4B43A 3K6KA 4MEAA 1LA2A 1DIBA 2GESA 1EBBA 3UJAA 4BX9A 1GSOA 1CCWA 4MB2A 1VE3A 1X8XA 1XTSA 4L72A 2OM6A 1ABEA 1YWGO 3OU2A 2L17A 4KQFA 5EN4A 2VHJA 4PCAA 4QIHA 1AQUA 1KMNA 1DX9A 2I66A 2X23A 3GFFA 1FOEB 16PKA 1KSJA 2PYDA 2D4AA 4GQIA 4NI5A 2P91A 1QRAA 4F1WA 4R8SA 3HB9A 4LOIA 2OFFA 3K94A 2VAXA 2ZLBA 4HWSA 3OZBA 1E1RD 2IZ7A 3F7MA 3UBMA 1MW9X 5A4KA 1U7OA 5J63A 1CLEA 2QMUA 1JI3A 1GPMA 2ECQA 1ZL0A 2HQBA 3B6EA 3OLZA 4FZ5A 4G0MA 5AICA 4BJ5A 3KETA 2WUGA 5BO5A 1L3IA 4WFKA 4E51A 2CJXA 3OKAA 5C4GB 4AUMA 2XLBA 2EFHB 1NF3A 3RVSA 4AKGA 1KFCB 3RQIA 4EDFA 1GUBA 1KHTA 2ZS9A 3F6SA 4BC1A 4L16A 1LNZA 1W25A 2OENG 1W7AA 5AKJA 2PMDA 2SKCA 4NEHB 1XEWY 2BE7A 1LQUA 1AK9A 3K2EA 4F5EA 4KYUA 3Q1KA 3SKVA 5BV1A 3UJNA 4O02B 5J5AA 4ZAFA 1U2ZA 1NXQA 1AK1A 1L7PA 4LQDA 4CM1A 3NHJA 2NU7B 3THWA 3W7BA 1CPYA 1S4QA 3PYMA 1TCVA 1KJIA 3CUVA 5JZMA 1N2HA 1ADFA 1DMSA 5FO1A 3IDZA 4MS1B 3MEQA 1JQDA 2X8AA 1A1SA 5LLTA 1N6IA 5FBZA 4JGGA 3IQIX 3RLIA 4RF3A 1JG7A 4ZO8A 1SD1A 1O5TA 1Y7IA 1YIOA 3GFTA 1N3BA 2X13A 4QLOA 3ZE1B 5IAAA 3H11A 4ES6A 3WTCA 4MUHA 5JAQA 3GA5A 3RVQA 1XMOB 1WS6A 2YFQA 3GB9A 3ZQKA 5A4DA 4AZTA 3ZNPA 1NN1A 1ZKMA 2AOUA 3M6MD 3FJYA 1E9AA 1IPFA 3GHHA 3PB3A 2R68A 3OD1A 1RFGE 4HMQA 4W8GA 5JO9A 4BTEA 2G17A 2YC4C 5HSGA 2AC2A 1ZA1A 2JGDA 3MQ2A 4O4IA 5CW1A 3RD5A 3ZE8A 3A31A 3OQVA 3K35A 4EELA 1L4BA 3GCWA 3VDQA 1A95A 5HP4A 4O5AA 1MRNA 3KC2A 3TEFA 2H54A 1PX0A 4DHEA 2WWVD 4EUEA 4PX3A 2E21A 1RU3A 4ZO4A 1RPTA 4D4KA 2C7RA 2JEZA 3ECAA 1WLYA 1GHTA 4BO3A 4DQKA 1UR5A 2XGMA 5HZHA 2XMCA 5GM2A 3DVQX 4ZOBA 3HP1A 3IUYA 2JA1A 1ZNZA 3NRCA 3R75A 3R3WA 1ZK0A 1SRQA 4LISA 3HA3A 4WKPA 1BDJA 2DBQA 1OA0A 2DGDA 3PNBA 1N1GA 3KLOA 5L4NA 4Y6LA 2XKJE 4P4SB 3U37A 2PKCA 4UE2A 3RK0A 2AJCA 3OZCA 3K16A 2ASEA 5K2MA 3FUCA 1MP0A 1PJTA 3BE4A 1J8QA 4MICA 4CL8A 2GYVA 4RLFA 4RH3A 1F7VA 2XCSB 5I01A 2FPUA 2ZANA 3DLCA 3NPAA 3O31A 3ADPA 2BMDA 5CDFE 4P0QB 2ZU6A 1GSAA 3UJ7A 4B3JA 3DCNA 1P4SA 4WSOA 4KVGA 4F6RB 1B76A 1O77A 4J0DA 8LDHA 1RHQA 2QS9A 3L6DA 3KDSE 5KOIA 1ZNXA 1J8YF 1V8DA 1DG3A 1VJCA 1NLYA 3UENA 3N2ZB 4A16A 1GU0A 1E7MA 1L1RA 4WINA 1RLOA 3K4PA 3EXEB 3TSWA 3KQSA 3P5SA 2WNHA 1X1TA 2Q6OA 1UF9A 4CTKA 2CCKA 3FZGA 5IVKA 1ZY2A 4ZQEA 4EX7A 1OH7A 3EG9B 4B40A 2RARA 4RFLA 3QEMA 2VT2A 1QTNA 1XX6A 4I3HA 5JV5A 3ROKA 1US8A 1NUPA 3GFRA 1IDN1 5LDHA 4X20B 1K75A 3IPAA 3EDYA 4WOJA 4F2HA 4ZAVA 1E8MA 3R8CA 2K2WA 1LFDB 1UDBA 2OCYC 3DTTA 4J0KA 4OOEA 4P5DA 3SYKA 2NO0A 4NCIA 1GAXA 1YS9A 4FYWA 3RGWS 4DGQA 1PJLA 2OQIA 3HBFA 3HUFA 4GR4A 1W36B 1FMLA 1EFPB 1NBMD 1LFAA 2ZWOA 4FPXA 2DP4E 1DKNA 3WKCA 5DI9A 4Y98A 1UBOS 2WPDA 2HHJA 3O0TA 2C7PA 3NEPX 1RCUA 1KJNA 5E0OA 1ZM4A 3EAFA 1HTTA 1E89A 2I2WA 4B4VA 1GTMA 1YHYA 3MQ4A 5DWQA 3T3GA 3DVLA 2WHXA 3PE3A 1FTQA 3IUBA 4BLPA 2R8EA 2WABA 5F9FA 4Z4IA 1E0SA 3MS7A 4JXZA 4P0TA 3CN7A 3COVA 1JFSA 4RVOA 4B4DA 1M7BA 1JDJA 3AEZA 2QSYA 1KR2A 4IZ6A 2O2IA 1S7CA 2F8TA 3EA0A 2FFRA 1NT2A 3Q0TA 2P4SA 3C3MA 1E7YA 1T1JA 3FMGA 4LOHA 4Q3AA 4HB4A 4ADSG 1SHJA 4A91A 2XCOA 1QHYA 1WPGA 3A0UA 3L07A 2IP4A 3F2VA 4HYYA 2UZAA 2RHBA 5IC5A 4JI7B 4GLBA 2HWKA 1ZQ1A 1FYEA 2HXSA 4IOLA 5L3QB 5DKFA 1DMRA 2XOEA 5BRJA 4ND5A 3OPYB 2DG2A 3GXOA 1D6JA 3QFCA 3AF5A 4RZQA 3SKYA 1XLTA 3UG6A 3IEMA 4DR5B 5KTKA 3D7LA 2VNIA 5BXYA 2A0KA 1NDUA 4ISBA 2AN5A 4GKKB 4M3NA 4FE3A 1JDBB 3IESA 3EXAA 3R5FA 1ESDA 4XLLA 5JY1A 5JS7A 3VR3D 2FWAA 1BWQA 4W4TA 3MMZA 1E66A 5ALRA 5CFNA 4RMNA 2JI4A 3LLUA 2COUA 3IBGA 3TYXA 1XDUA 3D3KA 1SZDA 5DW3A 1PVVA 2GPYA 2W6PA 1EX6A 2MT9A 1P60A 4JA0A 4MYTA 3OM9A 3SS7X 5A2QA 4E08A 1RBQA 3FPBA 4G4SP 1GT91 3GAFA 2QTVB 3MTAA 2CXOA 4MW7A 3M4ZA 2GA8A 3V55A 2C07A 3HYRA 4E03A 5J3JA 3G23A 2AXEA 1AUQA 4B48A 5G1OA 3HUTA 1Z88A 3NATA 3DAFA 3G79A 3QPCA 3B3QA 3OPNA 4NCJA 1J8DA 2OFOA 1I80A 2XUPA 1YOVA 4FFBA 2Y1OA 5C7LO 1GM5A 1FFEA 5IU6A 4BNUA 1WETA 5IVIA 2YQZA 1LSSA 2VJDA 2JG3A 2JKVA 2H9AA 3BF7A 4JLKA 3EMKA 4PVCA 3V1MA 3WMWA 5JRDS 5LUAA 1Z68A 2ZRHA 1UC5B 4H7KA 3FN4A 1SBCA 2TS1A 3VAZA 4Z7NB 1J22A 1LI5A 1N57A 1TT7A 3NIGB 3E58A 1TYBE 4EYEA 1Y1SA 4PIMA 5LDDC 3KDAA 1QRDA 2HH9A 3CZQA 3M4JA 3E82A 4XJVA 2ONZA 4U3JB 2J0SA 3UAOA 1BFUA 2FMKA 4WZBA 1K98A 2D0PB 2YVLA 1K0UA 4HZUB 2GCEA 1OFGA 2GRUA 4JBLA 3ROPA 3VI4B 3HJCA 4MS3A 3PRKE 2J85A 4GYYA 4Z3DA 1EFVB 1JA0A 1FLVA 4ZRMA 5TT1A 2ZBGA 5KSWB 3FHTA 4BLUA 2O5CA 1MU0A 1RHJA 1VHWA 2YXNA 3ECCA 4O08A 2H65A 3AR7A 4IQGA 4NVRA 4P7GA 3EA5A 4EYQA 2VDWA 3OQNA 3DA8A 1OAOA 2Z9CA 4C01A 1AGRA 4NDAA 1IXYA 1DEOA 2RGBA 1PYDA 3WFIA 4BZWA 4L8LA 4ZJZA 1XAIA 4KR9A 4BO0A 1XOIA 3W1WA 4YX9A 4OHYA 4S1OA 1EEXB 1TD9A 4MVJI 1WB9A 4IHQA 2FPSA 1CR2A 3ONEA 4DJAA 3FSGD 4S0XA 3HK2A 2ZS7A 2XA1A 3IEXA 3JQRA 4QXQA 5GZ3A 3IJPA 1E2IA 2ZCUA 4UDNA 4GFDA 3CNOA 3RIGA 2EGUA 3AR2A 3AESB 4J9VA 1TKCA 4JI3B 1ZX1A 4HB2A 4IRUB 1BWSA 3NW9A 1JT9A 1CUAA 3VPHA 3ZDYB 3C6QA 3IXMA 2EGGA 2GZ1A 4PO9A 2PLFA 4OJTA 1IOZA 1Y8QA 1NSTA 2YJ5A 1U7PA 4KFCA 4KR6A 4RH1A 2XTMA 5CUQA 4OSEA 1N1EA 2V03A 5BW5A 4KAJA 1BXRA 3LXUX 4NICA 1TJPB 1GPH1 3NYWA 3R4CA 3QITA 1XQYA 1SG0A 3LECA 4J94A 5ED0A 3UWDA 3TJZA 3QEKA 1JMKC 1Z2NX 3UXYA 3X44A 4MYHA 1P6UA 1IEQA 3IDSA 4E2XA 1NW5A 5AUQA 1QVRA 3RIEA 4IXTA 3HV0A 1NWHA 1JR3A 2VRWA 4JT2A 4MWCA 3SHOA 4BBZA 5K03A 3BB4A 4RL4A 2QF7A 4BTLA 1PR6A 1ONPA 3CVVA 4UQPA 3D3EA 2QX9A 5A4FS 3HYSA 4BO5A 2I80A 1TRHA 4XX0B 4CU5A 4IX1A 3BHJA 3FSEA 1NR5A 2OZVA 3DUWA 1AQJA 3NUQA 4BMOB 3TR0A 4P3XA 5CA0A 4V0LA 1NFFA 4PN7A 1DXQA 1LLDA 4X3OA 3TRKA 4BLVA 3TG8A 4JXJA 4H27A 2H52A 4DRXB 4RZUA 3HJHA 2FVYA 3U4AA 1V5IA 1GJRA 1QX3A 4U8HA 3R6LA 4I9UA 4W5RA 3WYFA 4HX9A 5JO0A 1I14A 1ZITA 1H9AA 2RG7A 5REQA 1EVYA 4G67A 4QELA 4QRHA 5ELMA 3CGWA 5HDQA 1MA3A 5K8UA 2YJ6A 2BI4A 2DKNA 2IZ1A 5A3JA 4ZCLA 1YDFA 5ADWA 3PDUA 3CT4A 5HIIA 1DKQA 3VKUA 4DILA 1U2SA 1VA4A 1ZG3A 5FWYA 3EXFA 1FQKA 2ZT8A 621PA 3PS9A 2EBFX 4QYWA 5L45A 4UD2A 1ORIA 1HTWA 5F2EA 2WD8A 4XR9A 3NBXX 4RVCA 4QPCA 1YCHA 5DRYA 1UPCA 3G5AA 5CB6A 3ZW9A 4ETNA 2XKAA 4XIIA 2R751 3PPVA 2JHPA 2OQRA 4DLLA 3ZCQA 1Q0UA 1SR8A 1N25A 1OZ0A 4L4ZA 2GUWA 5ARDA 1MOPA 1GU7A 5IAGA 3FCOA 3AKYA 3H9JA 3UJDA 5KOHA 3O74A 2VCHA 1KI6A 2NYUA 4JUCA 3JR3A 1ORDA 1YONA 2JPDA 1KDYA 4PG4A 3H8WA 4B3TB 5IX8A 2VDQB 4PPNA 4WW0A 5HCNA 1SUAA 5DTJA 3L7NA 5LYYA 3VH1A 1XRMA 1G2OA 4B5LA 3W2TA 2JJ2A 2ZIFA 4MWZA 4RE6A 2PHZA 3BX1A 4G26A 2QGNA 4CPDA 3L84A 3F7OA 5B1SA 3I45A 3RVPA 1V47A 2ZI5A 4BDTA 1R12A 3ZI7A 1NVVR 4PX5A 2DUJA 5AOVA 4DSNA 5JROA 1SBQA 2EJWA 4HGOA 4RY8A 2Q45A 1H0HA 3LCMA 2PTGA 2G40A 1FSFA 3G2JA 4GBGA 2I7VA 3H99A 1M67A 2OVBA 1UAYA 3WSWA 1MDBA 3WMGA 2HSEA 1TMOA 5ICSA 2D7DA 1L4LA 4QYMA 1MLDA 3PFNA 3P9XA 1IFXA 2FYTA 1HE8B 1ZK4A 3KHSA 1B16A 2B1GA 1KQOA 2Z5FA 3OOHA 2DBZA 4KR0A 2NT3A 5ESDA 3TE6A 3LL7A 6ADHA 5CRIA 1SRRA 3WOVA 3ZKWA 4B82A 1DT3A 1YRWA 5IKMA 2QTMA 1ONSA 3COPA 1NV8A 4CI9A 4G1CA 3W3AD 1LSOA 5KVQA 4JYZA 3N76A 3C3AA 1RPJA 4OM8A 5D3KA 1N0UA 2FWIA 5D1NA 3BJEA 1UM8A 2NPFA 1NW6A 4YONB 1SU7A 2DPYA 5IKEA 4K0RA 3SVLA 3LPCA 4WDRA 4C07A 3CLVA 3Q3GE 5JVDF 4F96A 2AA3A 1TKBA 3PICA 3PUVA 5B7GA 2F4VB 2IYWA 4NMMA 5FI0B 1ONBA 1TEXA 2CVOA 4DLPA 2O8CB 2AZDA 5KSZA 1WEHA 2CSUA 4XVRA 5IBQA 2XDYA 1JG1A 2PX4A 3LT0A 2FUCA 2XYQA 4FR2A 3UZUA 3D3NA 3LL4A 2AXNA 1EDEA 3GUHA 3NBZC 4M21A 3UQYS 2BEKA 5SY9A 2J7PD 1YZGA 1R88A 2LIVA 3D8SA 4NEQA 2DLNA 2OLKA 2WYHA 5FPKA 3BQMB 5JXWA 4N0DA 5AKIA 1WMAA 5BN1A 1A8HA 3NHWA 1E3SA 4PLTA 1G21B 2JCGA 4J1TA 3COYA 5E2IA 4X64B 3USES 1COWA 1XQXA 3JAKA 1HNXB 3T0FA 5KWVA 4WNIA 1HNZB 2BGLA 2GNOA 4U2KA 3DHNA 4FI3F 2NIPA 3GYBA 4TS3A 1S02A 2GPJA 4B8WA 5EIBC 3NALA 2AUNA 3TLXA 3H86A 3G13A 3KB1A 5A0FA 1XI2A 4LTMA 2XSZD 1N0IA 1T25A 1KJ8A 2GWHA 4JDPA 3WRXA 1U9YA 2ADFA 5CDYA 4OUDA 1W0KD 4GLLA 3QKRA 5AVTA 2PH7A 2XODA 3Q8LA 4LHXA 4MP6A 4PYLA 4KWIA 4BMDA 2JLAA 3NWBA 1ML4A 3M49A 1H6DA 1FP4A 1CKEA 4KXYA 1DX6A 3RVKA 3ZKWB 2GZAA 5C8YA 2W37A 4LCJA 4G01B 4AYXA 2VO1A 1LTKA 2XNKA 1XNHA 4L75A 1W4BA 5FULA 3RRNA 4KQXA 3CZCA 4UEQA 3I0ZA 4DCGA 1NMZA 3DO5A 2HI0A 4JBGA 4IILA 1X86B 2OUKA 3E9MA 4YH1A 3B5IA 4EFDA 4CDNA 3UMRA 1WZCA 3AI7A 2Y0BA 5GIOE 4DKJA 4GI5A 2O2CA 1OH5A 2D2EA 4BRSA 5I8WA 3VJRA 3RC2A 1GWNA 5AW1A 4KQEA 3V7FA 1KEPA 1H0RA 3M89A 3QFHA 2OD2A 4GLFA 3SJZA 1KI8A 1GNTA 1MC1A 4PC7A 4TL9A 3ZJ5A 4F93B 3OZXA 2Z8YM 4U2BA 1MJGM 1S8NA 4OQDA 2ZZKA 5GMOA 3ZBQA 4DCNA 3RFUA 2WHEA 2FZEA 3HDQA 3K0BA 2XMZA 3ILVA 4GP7A 4YWHA 5A4MS 3H4MA 3T1YB 2O2GA 4UCXA 5LZ4A 3NBKA 4Q4LA 4WHMA 1C9MA 3GCXA 1AKWA 2BRUC 3C24A 4HB3A 4UATA 5K8JB 1MAUA 3THYB 2Q3JA 3ZC3A 5C1DA 5HE9A 1QK4A 4DV4B 1S9HA 1C8BA 2R48A 4EZBA 5ADVA 5GVSA 3LC0A 2DMRA 5J40A 2PFGA 1VHQA 3DE1X 3OCXA 4J6EA 3CVJA 4K2HA 3TIXB 1SHKA 1MRZA 2O5RA 1JAXA 1HL3A 1RC8A 3WXMA 5K0EA 1TGYA 2ZBQA 1V4NA 1BMTA 3EQ2A 1N6KA 2PXAA 3EVTA 3EXFB 3T7RA 2W71A 4XGKA 2REBA 5L3ZA 2VDMB 2XCUA 1USUA 1U2TA 4OHXA 1YE8A 4TS9A 3UK0A 3TW8A 2EIXA 4YV2A 1MQSA 3CLUC 5E8RA 4GMFA 5BSHA 1QIEA 4GHWA 1LKZA 3HKCB 3N2YA 3Q2OA 4M1TA 1E20A 1XE3A 5DNAA 4BFSA 5AM2A 2RAUA 1QH0A 1OGIA 4XUDA 2D1SA 2PKXA 3LVFO 4GSKA 2PLWA 4LHEA 4OB6A 1WLSA 1Z13A 4HFJA 2YKGA 1YQUA 3QXXA 3ZWVA 1SCQA 1RLMA 2AV6A 4X1KA 1DAEA 4NAUA 4LZPA 3ND9A 4QQNA 1DELA 4EPYA 1DO2A 4XM2A 1W47A 2I34A 2BM8A 4YT2A 4ZVRA 5F9HA 3I32A 3E9EA 2ZIEA 1MIOA 4DA6A 3A4NA 1P91A 1RHUA 3PQDA 4A0SA 1V95A 3OQIB 5BQPA 1H4VB 4UXHA 3IUEA 4BBAA 2NP7A 3BF8A 2CBXA 4KVZA 1V3UA 3K9FC 1MTOA 1FUYB 1ZISA 3ENNA 1NRXA 3A6GA 2QL9A 5KAMA 2VZ0A 1Z3CA 1W0JD 3D4BA 1G41A 4CHTA 2FW6A 3O3NB 1IUPA 4PC2A 1QFJA 4Y0VA 2R1TA 4TXMA 2X0DA 1YDWA 1D03A 2HRZA 2CJFA 3I04M 2Q6LA 1PCXA 2BZSA 1S01A 1U63A 1KJZA 5LXTB 4GKAA 4V39A 2H0AA 4L0MA 3NTOA 3I62A 3RUPA 2VWPA 1VTKA 4L4YA 2XXAA 2F3UA 5CNJA 5DYIA 5HCUA 5AJYA 1N4AA 3TZEA 3WKEA 1M34E 3Q87B 2BR5A 3KOZA 4OHZA 3UT5B 4RTNA 4DSOA 5LPNA 3IDFA 1UBHS 4V38A 4RHFA 4NC9A 2QB5A 4JCCA 2FP3A 2EQAA 3B12A 1D1QA 5T64A 1CYDA 5TNXA 2CL5A 1OIVA 1NXWA 3TCXB 2Z57A 3SJCA 4WNAB 3WLEA 3VPBA 4IDHA 1KU0A 5KTOA 3I6ZA 3L1VA 2FEOA 4I4TA 2C4TA 3NOQA 5GJVC 3WB0A 3X1MA 2ZJFA 1Z7EA 1Y7PA 4TV8B 1QVZA 4LBZA 3KJEA 1NLUA 4ZJPA 5E1DA 3KSZO 3GRUA 1AB5A 2PUTA 2HMVA 2BOVA 2QM8A 1CZLA 1DUSA 1KPHA 2NYAA 2IX9A 2PGDA 3PQEA 3OEHA 2LE0A 4X61A 1PFKA 5E9AA 5K0TA 1CY6A 1BCSB 1T2CA 4M22A 1RI1A 5L4LA 5I7EA 5DNUA 3SI7A 1ID1A 1NT4A 3GP3A 3TB4A 4DLVA 1Q1ZA 1SO8A 1A1VA 1A97A 3LG2A 3OCUA 1I0IA 2JIPA 1WQ3A 3HGQA 3ME5A 1F6DA 1ZUIA 2WWXA 3N3AC 1ISSA 5BSVA 4WT7A 3AF6A 3EDOA 3EQ8A 3PE6A 1NXVA 1S8OA 4M0EA 1GR1A 4WADA 2GLTA 1PHPA 5F52A 2RMKA 2ZJZA 2NUAB 4BB6A 3UM9A 4D25A 4KPUB 1XTJA 1XVIA 2OLJA 4KPUA 1M0WA 2C8LA 1GGMA 3I92A 4KE7A 4MVJF 4EUHA 2GT1A 4P7KA 1UODA 5JDCA 1Z7WA 3W6ZA 5BVHB 2A0WA 4MINA 1C0PA 4J4HA 1WUKS 5I4IA 1DUVG 1NX6A 1KZ7B 4DY6A 1PUJA 2R1VA 1Z5WA 3KFVA 4Y2SA 4Z86A 2X41A 2YWJA 4YTEA 3EMBA 5AP9A 4N39A 4ZJUA 2HJWA 1P5RA 3L7YA 3BKXA 3IMGA 4DDKA 1L7OA 3PFBA 1M0EA 1TM7E 1GZ3A 2VDLB 1XZ8A 1IOVA 1DTWB 2ZEJA 3IOCA 2AC4A 2IXGA 1PJCA 1QZ3A 2QHXA 3DMNA 3FCEA 3JY6A 3L7CA 2Z95A 4CL2A 3DWGA 4AIRA 1KEWA 1I7QB 3K9GA 3DOCA 4EGCB 2C58A 3A6EA 3L46A 4B3DA 1J0CA 2BM0A 2WIKA 4TMZA 1AO0A 2LW7A 3HHEA 5IKPA 2BN4A 4TV9F 5K3AA 1F0YA 2FN8A 4Y9DA 5JE8A 5KC8A 4RTMA 2J0UA 4OQZA 1COZA 2BFDB 3IDAA 3GFPA 4JP2A 1TZCA 3PUZA 5DVZA 3VR4H 4FW8A 3ZGXA 1DC7A 3KZ1E 2DU8A 1BCSA 4IWNA 1VGRA 1R9GA 1XCBA 5IJWA 1TA4A 2FRVA 4O4JB 3H5AA 4K9RA 1T3GA 5JMTA 3B9BA 5B1IA 3KYBA 1NF8A 2H4WA 3VO1A 1IM2A 4S2UA 2C78A 1XBTA 3A1FA 4GGMX 4INZA 4RIHA 3KZNA 2OCGA 4EB3A 4Q3LA 4UNSA 4PEVA 1C7RA 3RHTA 1PSWA 3LYLA 1CP2A 3RG2A 1BX0A 4CV1A 1Y63A 3GIDA 1P4AA 4MS1A 1TJYA 5IT5A 3HTXA 4KUHA 3TTSA 1DEKA 3TLAA 1DB3A 1P73A 4GI2A 7GPBA 5KOJB 2A5FA 2CMHA 4NFSA 1N2SA 3G0GA 5KX5F 3S68A 4C4RA 2E18A 5FO0A 2CMFA 4M9SA 3TLYA 3HB0A 2QRPA 4ZP1A 1FTNA 3S2IA 3VQTA 4EO9A 2JLXA 3L06A 1J2YA 3E03A 1NNEA 2FPIB 3ZGYA 2XXJA 4F4DA 3BIJA 3ICCA 2VZEA 3ESXA 1K66A 4X93A 1QHHA 1PQPA 1DV2A 1G20A 3VZQA 1EFPA 5JY6A 3UWPA 1Z4JA 3TGLA 3GPLA 2H59A 2R6JA 3BTOA 4UTXA 2GFIA 4JR0A 1J4AA 2HCBA 2EFCB 4ZYXA 2WZDA 3JQFC 5ICCA 1RYFA 5EIXA 3FOAA 1AMNA 3E9NA 1GCIA 2PJZA 1W5AA 3IS3A 3P2KA 1ZC3A 2R8PA 3UHFA 1N36B 4K9QA 4UM9B 1CJKC 1NQAO 3JAWA 1ZJ4A 2V4MA 4O4HB 1R8JA 3Q8MA 2PT6A 2O1EA 1QH1B 2ZSUA 1YRLA 1QB8A 2E1RA 2R8BA 3FFWA 2P6OA 3E22B 3PDWA 3RJ9A 5I7RA 1QH9A 1IQ0A 3AY3A 4MRNA 3BWYA 5F1YA 2IXTA 3UPDA 3N5CA 1P3Y1 5KAPA 1ISJA 2RCNA 4IXNA 5DBGA 2FA9A 3CE9A 4NZ9A 2A4KA 1A7JA 1VBKA 4GYJA 4CCWA 1KMHB 2Y1FA 1YRHA 1O5OA 1QOPB 4WLEA 3ZWBA 1J0BA 3TB6A 4ARBA 2FQWA 1TJ5A 4ZCTA 1B0UA 1F2VA 1UDAA 1TAUA 2IEGA 2P2DA 1SVMA 5EQDA 1CZNA 1N7GA 3NBFA 5KIAA 3A1UA 5ABPA 1G8JA 3P1JA 2I99A 1IY8A 4FKMA 5HW0A 2LV8A 4MUMA 2GM4A 1EINA 1H3FA 1X7WA 4MVYA 1X7XB 4KN6A 5BWLA 4L57A 3MK31 3HZZA 1FRNA 3OQOA 4OLJA 3C3BA 3H87A 2G06A 1I5RA 2JFWA 3T3NA 2I7DA 3J81k 3TTWA 1JKJB 1KQFA 1BIFA 5I9NA 4JQOA 5J1SB 1A4XA 1ZD1A 3UAGA 3PHBE 4NFHA 4KW7A 1CTQA 2WJIA 3K8YA 5TE9A 1QKIA 5ITVA 1QFMA 4AUNA 5A3RA 1RXWA 1NJ5A 4NG4A 2FHPA 3IALA 4EMTA 1KERA 3TG2A 3HXMA 3X1WA 4NHOA 1BDBA 1O95A 3HFSA 3KQQA 3GK3A 3MWKA 1GDHA 4TYPA 4RH0A 3DLBA 2MSDB 3IUNA 4LVUA 2Z6AA 2HSJA 2WIFA 4E1AA 3IVAA 2QR2A 3EXHA 5T5QA 3VNRA 1PGQA 1UOOA 2ZJ4A 4A0RA 1YF3A 1FA9A 3ZHZA 4KFSA 1XXHA 4MAAA 3QW4B 4YXWA 3FF4A 3SIRA 3CLTC 4B2LA 4F5ZA 5BVGB 3V97A 1KRWA 1CUDA 4XKJA 2E85A 3KSDO 4BO8A 2X0JA 3R3UA 3H3FA 3BJZA 3GUCA 5B1EA 3RFFA 2FP4A 5E6SB 4CKYA 3O91A 3FGOA 8AT1A 3TRHA 4U9UA 5ESRA 4Y6SA 2WKSA 1CDZA 1JAZA 1JIVA 4KE6A 4QT0A 3GPBA 4YACA 4C78A 9GPBA 4ZDJA 5CCDA 3PENA 4ARIA 5EPUA 1ECFA 3W8DA 1JHAA 1KI4A 4MUEA 5EC8A 3NP9A 4QASA 1SIBE 5E8JA 3T7CA 3K1AA 2HF7A 3AJ8A 2Q8QA 5KYWB 4F46A 1OVMA 3QOXA 4RIEA 3ZXUB 1YB4A 4KXQA 5LXTA 1P6XA 2VBCA 3C5CA 1NW3A 1AN0A 3GDOA 1R50A 2I55A 3A58B 3C3DA 1C14A 4KN5A 1KE2A 3N0VA 4W9RA 5B2EA 3UJCA 1O6BA 3MT0A 5KYXA 1EZ1A 1P2SA 2OHFA 4YAFA 4BFXA 3A6FA 4P3PA 1SVIA 4HUQB 4WN9B 2AEEA 4BGUA 2RGGA 1DOZA 1BFKA 3AY6A 3RIXA 4J1NA 3TZKA 4ZQHA 1IWBB 1IUKA 2DKFA 2JLZA 1HV8A 4HDRA 4M1QA 1HEYA 4RVSA 1EXNA 2HA3A 2PR2A 1EP2B 1OASA 3W7AA 3JRWA 4KQ2A 1CQJA 1F6WA 2FSSA 2H2HA 4YP6A 1HTBA 3OHSX 1J2UA 2I7CA 3QTTA 4RIFA 3ZU4A 4OQFA 3QH4A 7MDHA 2HD4A 1WPXA 5DHFA 1IVSA 4GT1A 4JMLA 3RNLA 1SC3A 3S8EA 1GLNA 5EE3A 2BMVA 3U49A 3TVYA 2I03A 4F4UA 1ZWLA 3ZGOA 5ADHA 1UBJS 3A6DA 3DEIA 2Q49A 3EVBA 1QQ7A 4J7AA 4UVEA 3RREA 4BP8A 1J1IA 1QVAA 5CGQB 3E7WA 3B1FA 3ORYA 4B17A 2Q9BA 2P4QA 1NXTA 3OPMA 3UMJA 1TD1A 1EUDB 2IA5A 3A37A 3H2JA 2Y9PB 3KT8A 4QUIA 4A10A 2OV8A 4DL9A 2IYFA 3ZDBA 5BURA 2BFAA 1EVLA 1P77A 2EW1A 3BWCA 4OBBA 3MWYW 1DX4A 3MTDA 1IXRC 1JQ3A 2P1RA 4NJOA 3FE2A 1L5MA 1G8HA 1P3DA 3VKGA 4LBWA 4RF5A 2GGSA 3TS1A 1E5QA 3NHKA 3EXG1 1C2TA 2O57A 6REQA 1W8DA 3TUZC 4EENA 3I2KA 1DCTA 6REQB 1LVUA 1UFOA 2Y0PA 1WKCA 2YUTA 5BSGA 3H8SA 4KU4A 5SV2A 5TV2A 1WD5A 3OWHA 2UUCB 3FPFA 5AVXA 3T9BA 1KKLA 2B61A 3DF7A 3EAGA 3KJNA 4E5UA 2NO7A 1WKBA 5D00A 4W5NA 2J9XB 1X8JA 1ORRA 3N0TA 2YV1A 5D3MA 5J47A 2PX6A 3I9OA 2XCRB 4CEHB 5DTQA 4Z0NA 3EOAI 4A9AA 4CLHA 3JWGA 2XDWA 3QY0A 4MJLA 1VPTA 1HK7A 4BVFA 3PXEA 5AW8A 1T9GS 5BN4B 1S2GA 2J5RA 1D2AA 2Q2WA 3B8HA 2L69A 2HQ1A 3E18A 3ZHCA 5CT4A 1X80A 3ZZMA 2CLFB 1TK3A 5I45A 1IIRA 2QI9F 2IU0A 4PHTA 3N0WA 3RASA 4TGLA 5FOWA 1QRUA 2XJ9A 4JP5A 8ABPA 1E9VA 2CNOA 2V0CA 2WA2A 3N6VA 4FJ0A 4MKHA 3TQSA 3T0IA 3INTA 4KI7A 1AGNA 4MGIR 5H9VA 2I91A 1VXRA 3RLFA 4RPIA 1G8YA 4QC2A 2FPGA 4WERA 1PR3A 1KA9H 1YQXA 1SURA 3DL7A 1XPJA 2HDWA 3HN7A 2YFYA 3ILXA 3DMTC 3D0QA 1W2GA 2C9ZA 3KX2A 2PGOA 3AM5A 3GFOA 2CNNA 4PLVA 4U4AA 3WLNA 5KYXB 1KFEB 1NNUA 1YAHA 2P30A 4PLCA 2WSLA 2AX3A 5EZQA 4Z54A 1XTBA 1MNAA 2R6CA 3GVPA 1I5EA 2QXTA 5MN5A 5T4FA 4JZKA 1OILA 4QEKA 4AO7A 3C5WP 5LQMA 2XGSA 3DOFA 1DAHA 3VSAA 2B6NA 1JQAA 5GV8A 5T41A 3THRA 3ZGZA 4E2FA 2GCGA 3B6ZA 1BU8A 1J9ZA 3ZVMA 4WX2B 4GX2A 4M46A 4E5VA 5IMBA 3GY0A 5C4MA 1L7XA 3ESAA 4OMUA 3ZCRA 3O0DA 3U9TA 1MZPA 1N9ZA 2F8SA 2GHTA 2OHHA 5B3AA 3ZXIA 1RPZA 4PC1A 3A1NA 3LUBA 3LK7A 1FMJA 2QP9X 3DZIA 2EWWA 3C45A 2RFLA 3TVTA 1T2AA 2FUKA 1NWCA 1X6VA 1AO3A 2WM2A 3G1WA 3OLXA 1AKMA 4RKRA 5ALEA 4CIYA 1TC1A 2Z04A 2XVXA 4L4XA 2IZ6A 3ADCA 1TUBA 2P9BA 3A6PC 2PMKA 4G0PA 4X1IB 4BNIA 4WPGA 4JEMA 3A9WA 4E6EA 3DDUA 2OVFA 5E4JA 1G9SA 5IFKA 2NX2A 3RTDA 4L22A 4YCDA 3I34X 4PQGA 1MX5A 1TTTA 2Z08A 2FFJA 1CUWA 2W6CX 1OC2A 4ENPA 5F2KA 3A04A 3R3VA 5CITA 5IM5A 3FFXA 4EY7A 4RTRA 3E05A 4F71A 3N9IA 1KC1A 3RC9A 1E2BA 2PSEA 4D9FA 1YU9A 5LYJA 2GZ3A 2D0OB 4BRZA 3UGJA 1RZRA 1ENOA 2Y1WA 3ZWPA 4YJ2A 4M1EA 1Z16A 4DLRA 3NKFA 1KYVA 1SVLA 4O2BB 5EHQA 5EIBD 2V5AA 2BW0A 2Q2OA 3AT1A 4BO7A 2HXYA 1CVRA 2P62A 2PO7A 4G1EB 3UJPA 1V11B 5ALGA 1LD3A 4DPKA 2AFIA 5JHGB 2BC9A 4QYIA 2WHQA 4EY3A 2I54A 5DSXA 1ZDMA 3X2EA 1YBMA 2L2QA 3B9PA 1UK8A 3DHYA 5JH7F 1LPSA 1N8TA 5K0GA 3WNDA 5MGBA 2C82A 3T38A 1RRVA 1VFPA 5A9TA 5JISA 3UHJA 3PXAA 1CUSA 4AJPA 3QNMA 1C0EA 1DGQA 1OXVA 2CBGA 1LEHA 3W9YA 3EXG2 2RGNC 1EHCA 5G40A 1RHKA 1GSHA 1NMXA 2O48X 3TI9A 2YWXA 2D4HA 3NV9A 3F6EX 1XZNA 4GMXA 1FTSA 2X76A 2P9CA 3HYCA 5HKKA 1UBGA 3LWZA 3KYDB 4TQUS 1TXGA 4JB2A 1E98A 2C3OA 2WPNA 1OWLA 1MABB 1RMQA 1MVOA 2XNSA 1O96A 1ZH4A 4NQRA 4GMHA 1OT3A 3UJ8A 3EEOA 1YT5A 3BIFA 3EODA 1ADBA 3MMNA 4NENB 5KYNA 5IM4A 2VP3A 1QM5A 3DOIA 1BVHA 5GOZA 3RYCB 4JT4A 3H16A 5LDGA 3ZWMA 1KMMA 1VKRA 2F00A 3I9LA 3TX2A 1TIKA 1QHNA 2QQEA 2YXBA 3O3MB 4TQGA 3L8DA 4FFMA 1EWQA 4R2IA 2GEDA 2WSIA 5K8TA 1K9VF 4XUEA 4Z8XA 4F3NA 3JQEA 2C0CA 1GZ7A 3K4QA 3OIDA 4BGVA 2W90A 5IPFA 1YD7A 3OFND 4ZA2A 5G0VA 1X1BA 4KXWA 5JRJA 1QV6A 4ZD6A 2JIZD 3MUOA 3DB2A 5H3HA 2K87A 5K3EA 1YU6A 2FR0A 4FEGA 5BXQC 1G20B 3RHZA 2OV3A 2GEJA 4O0LA 4V0MA 3BFJA 1C9KA 2IEZA 4B79A 4E2WA 1ZRSA 4ZK6A 5BMVF 1K0FA 5JSYA 3S7ZA 4AMYA 3QUAA 2DH6A 2OFPA 3DWFA 1VE7A 2UXBB 3OJOA 1SXJA 3P71T 5JJLA 2IE8A 3I4FA 3N58A 5DLQC 4WNYA 4BAZA 1B41A 1PJ2A 2HQOA 2YN2A 2ZUWA 4LNAA 2Z56A 5KCMA 3GLSA 5ULLA 2MCFA 5KOJA 1EK5A 2OYRA 5LMNB 1NN0A 4LTNA 4OD0A 3ZWDA 4F8YA 4ONEA 2I3ZA 4M7RA 1P3JA 1VKJA 2IEIA 1BYIA 1S2IA 4ZGGA 2X6TA 1PDOA 2FR8A 3OQ1A 3WL5A 3AG6A 3IVXA 3N75A 4URFA 3T9CA 1U8XX 4I6EA 4YRBA 4WY8A 1G4UR 4FFPA 3EDRA 3NHRA 5HJ7A 1E92A 1ZH2A 2C8VA 2CL0X 1EWTA 5IEBA 5CA1F 3ZCPA 2ZPAA 4NF2A 1J07A 1FDVA 1R37A 3NO4A 1ZIDA 3DV0B 2JJQA 3C1UA 1MVLA 4OKIA 1AQLA 1C4XA 1Z4PX 1TIBA 4KGVA 3IEPA 2JLYA 4HWGA 2GCOB 1XMJA 1E59A 3P9YA 2L18A 1Y4UA 1K5PA 1VYTA 2J6BA 3I28A 2VPYA 4MV4A 4NIMA 1SN7A 2JGKA 3LZCA 3JQ8B 4YRCA 4BFTA 3PPXA 3O9VA 3O8NA 5DSTA 5AXBA 3DEZA 3IH5A 3LX5A 4ZPXA 4JC5A 4GOND 5TEWA 4RDIA 3QWHA 2QLTA 2X2EA 3PF9A 4N1AA 3PU6A 3TZCA 1FZQA 1CZKA 3OOSA 3JV7A 3QIAA 4OAQA 3BREA 4UAVA 3W78A 4HDSB 5HJEA 1G2PA 4FR0A 4DBLC 3ZY5A 2JA2A 1F8UA 1GILA 1Y6JA 2VSFA 4G9BA 5B7QA 1XCOA 2ZB8A 4C6RA 1RABA 1YCDA 4NBWA 3ENKA 3LTEA 1X7DA 2GM5A 4AG5A 5KKCA 2ZG6A 2Z4TA 4N7JA 2VJMB 2E5WA 2YXDA 2E2WA 1TO6A 4PZDA 4GP9A 3GWZA 1ESEA 4DPMA 1HOXA 1ZUHA 2XIJA 5JNTA 4HGZA 3UPTA 1SBZA 1RI2A 2XMBA 1GFZA 3OX4A 4U7WA 4JUIA 4ZAYA 4DRYA 1DZIA 4MWBA 2AMLA 2RIPA 2BGNA 2ZW9A 3E7XA 2JW5A 4EECA 2PUEA 1RWPA 1OYVA 3ONDA 1XVAA 2D1YA 4FJ1A 3FLBA 5B5SA 1X19A 4O5OA 2AUMA 3QPVA 1UADA 4IEFB 5LZ2A 2HF9A 1ZIYA 3UJBA 4F5WA 1I3CA 2M2IA 4N0MA 4ZOLF 1YR1A 3EPLA 4AVYA 1OZAA 1XN4A 2CVFA 2PSHA 4J2TA 5JR3A 2XDAA 2I4NA 3ADBA 5K6AC 1M76A 3H6KA 2YYZA 1O97C 3JXEA 4ZV9A 4PN3A 3DZDA 3RS4A 2V7UA 3RRFA 4NK5A 1NVMB 4YMGA 3HGTA 2JRCA 4XJTA 1LDNA 2C9YA 3LE8A 4H7JA 1IC6A 1ZOIA 1L7VC 2FSUA 4TYMA 5IULC 2F9LA 3JATA 1RLTA 3DAPA 1U3DA 3PT9A 1R5NA 2C5SA 3IP1A 3BXZA 3G8BA 1XD9A 5DZSA 3NTLA 1Z0AA 2QNIA 2WSBA 3RDPA 2C31A 2ZCVA 2BEWA 3I6YA 2JFVA 3IFSA 2GK4A 4JA2A 1Q91A 1U1GA 4HUJA 5FUYA 1LLCA 2GZSA 3EDCA 2ZR7A 1F8YA 4O4HA 4IDEA 4BLTA 4II3A 2G5TA 4RTSA 1UH5A 4L95C 4E2ZA 5CEEA 4AMVA 3P0EA 5IWCA 4DA9A 5G1PA 1SXJC 2DZDA 2EG9A 3ZQJA 5EIEA 2CYAA 3O38A 1R2QA 1KEVA 4KYTA 3I58A 4ZTBA 3GJ6A 3RVDA 2VDOB 4ND2A 2RSLA 3R6GA 3HZHA 1R0BA 4TT3D 2QE7A 3PXGA 4AFNA 2V3CC 1JEQA 3KQLA 1TTQB 2OOKA 2ZYDA 3AIKA 1BDHA 1X2EA 1D2MA 1X74A 1V9SA 1P1KA 3RFCA 4DSZA 5THXA 1J5EB 2DKOA 2JI7A 1KY2A 1WKVA 1EVKA 1H8HD 1YQEA 3AF2A 1RAEA 3LRPA 1ECPA 1MC8A 1H2HA 3JZFA 3DLIA 3GVCA 3W0LB 1OYYA 3KR1A 3IKJA 3K4HA 3NUZA 1JVNA 4E3ZA 3E7DA 1Q1AA 1JX6A 3F46A 4UW9A 3SQMA 1ZA2A 1B3RA 1LNQA 1RM4A 1MG0A 2TECE 1IIBA 5J2UF 1WPRA 3W2HA 2EF0A 3CPSA 3C3CA 3F4LA 4NU8X 4HEA6 2C1XA 2NU8B 3SS8A 4DLTA 2ZJ7A 1KEZA 1XD8A 2AOTA 1IAQA 4HAVA 1MR3F 2HFKA 3FI0A 4K46A 5BQXA 3S5UA 1PW5A 3ECSA 4GC5A 1Z62A 5KTTA 1ECBA 4WESA 4EHJA 2GEKA 1M6HA 3FR7A 4L85A 2XT6A 3TSOA 5LP1A 4O8CA 2GWRA 1Z7GA 2QTHA 4EW6A 4EL0A 4B3CA 3A7DA 4TYQA 5JJIA 3PIRA 4HLUA 4E6PA 3EC7A 4IG9A 4JSRA 4RA6A 4UUBA 5IN4A 4X91A 4G0ZA 3QBDA 3KLNA 4TQAA 1A76A 2X1VA 1DT5A 3MIIA 2XAAA 3U7QA 3W2GA 5LD2B 1QNFA 3MMPA 1G8GA 1XEFA 1K1EA 2ZSDA 3EVNA 1I7LA 5BSKA 3TTUA 3PNQA 4QOIA 1GFIA 1N2CE 3NLLA 5FBRB 2YVKA 2I76A 2PY6A 1SUCA 3E5NA 1ESCA 2ZJ3A 2MR6A 2IY9A 2HGSA 2O7RA 4CVNA 5KDDA 2JIMA 4U2GA 1UC4B 3QKUA 1Z0IA 1MFPA 3QXHA 3TTVA 1UBTS 1XK7A 3MT7A 3U81A 5COBA 2I1LA 4QOEA 4TZKA 1NJ2A 1DHRA 3WYCA 3B3JA 1E3JA 1JVBA 3QX9A 4ZOCA 2A5YB 1NQXA 3DZKA 4XSHA 1XROA 3SX4A 1LI7A 4AWAA 3T12A 1NOJA 1C50A 4Z6KA 1LRLA 4BKRA 2NQTA 1VDMA 4G3XA 3TO5A 4R1MA 1U98A 1UXOA 3P96A 2XCTB 1G5QA 3AEUB 4BVBA 5JDCC 1AOXA 3I9FA 3OJEA 4R6XA 1T5IA 1BQ3A 4PHCA 1M2EA 1OKKD 4B35A 4MCIA 3QEOA 4YQYA 2ERYA 3VXKA 4B7XA 4H6WA 1B8OA 3TK1A 2FX5A 4P82A 4XDGA 5CXUA 1U0GA 2HWYA 3OWXA 4FDVA 4RVDA 2JFFA 3UH1A 1E4EB 3RS5A 4BIMA 3KK0A 2Q50A 2W2TA 4ZRDA 4QDXA 5JQGA 2X0IA 2IODA 1ACJA 3W05A 1D7OA 4P3YA 3JVEA 3D6MA 4RK5A 4HDSA 2YS6A 2YOHA 3SF8A 1OU0A 4UULA 5ALZA 5EJIA 3UCFA 3SYTA 5LB4A 2AZTA 1QO9A 4RD0A 2QT0A 2CK3A 4G5HA 5AK5A 1T8YA 2B8WA 4IHJB 4CR8A 4MJXA 3JX9A 1FP4B 2VNJA 4INOA 4CCSA 3JQDA 2P6RA 1RVDA 2O8DA 1LCIA 3RBAA 3DWIA 1U2RA 2WFMA 4P2GA 1S9DA 2QJRA 5CT8A 3E9CA 2PD3A 5HUJA 3AIMA 2IXDA 4X71A 1VBFA 4HDMB 1M8JA 4MEBA 3PUHA 3EQ9A 4RVGA 1Y6QA 2RIRA 3LJKA 2YJGA 3NU1A 2IYXA 4WXHA 1M1YE 5JS6A 2QVZX 4RIGA 4EQZA 2G70A 1CW2B 3LM8A 5FQOA 3U4MA 5L3SA 5H82A 4DMCA 3EIQA 4RORA 2ID9A 1K8RA 5D3QA 2H29A 2Z3VA 2WM9B 1GNVA 3T3MB 3VYRB 1T9GR 2CVHA 2IEAA 3ORRA 4L02A 4N7MA 4OQPA 2P6UA 2BR4A 1O6CA 3GGOA 1OXBB 3TBKA 5CA1B 1R9NA 1BCRA 1TU4A 3KKNA 4K7JA 4CM8A 3QJGA 4WEOA 3EA4A 2VC2B 1E1CA 3GUVA 1OXUA 3QYPA 4KVAA 5ANRB 3SQDA 3X1JA 2O3SA 5EJ4A 3RSOA 3C15C 3PFGA 3U44A 4TMYA 1KDTA 2QX8A 4PX9A 2CE7A 2QTGA 2BFBB 4YDQA 2CBZA 2OK8A 4KPEC 4K9MA 4D9JA 4QUAA 3H13A 4NBTA 1JHPA 2QRVB 2AS0A 2FPXA 4IGEA 2DFPA 2QTAA 4D9EA 1W46A 2O1WA 1VJGA 3A11A 1O58A 1ISGA 2PQ2A 2R6AA 2XUJA 3NJ4A 4PSCA 4RFSA 4CKBB 1DKOA 3IP5A 3N39C 1KE1A 1HLDA 2BWJA 2JEOA 5CFOA 3ABQB 2MINA 1QE5A 1UDXA 3IGFA 3OZFA 2FEWB 4BN5A 1W75A 3KKOA 2C4VA 4JP3A 4MQBA 3E27A 4PF1A 5HILA 3ZGNA 4DXAA 5C4IA 4DQVA 4OOFA 2PV7A 1NZFA 1SKAA 1M6NA 5CAEB 2J3DA 3I83A 2B5WA 2NU6B 4ZCMA 3G9QA 1OHHD 3H1AA 3BXFA 4Y0AA 3T5PA 1V7PC 1U0NA 2ORED 3C8ZA 5IUKC 4I7EA 2CF6A 3LFHA 1U9JA 2FMFA 1OWMA 2YMLA 1HT3A 2V7BA 4P80A 4UE6A 2W6JA 2FFQA 5F12A 3P45A 1EH5A 3ANMA 3QKWA 4AL4A 4YRZA 3ZV7A 3JD2A 2GAAA 1DQRA 2Z1NA 2H7XA 1IJKA 3QF4B 4DA8A 2JKZA 4YV7A 3OQHA 5BR4A 4ZPJA 2O5VA 4L2IA 3TNLA 2EVWX 1B7GO 5MGNA 3J81A 1JR3E 2UYCA 1GYPA 2W2XA 2YMMA 4G6ZA 3I73A 1U65A 4DLKA 2FJPA 1GKLA 5HE8A 4DDVA 1IJEA 5HQTA 5B3JA 3V1NA 5JNVA 3G2NA 1IZYA 1GGNA 4XWTA 1ZUD1 3TLGA 1HOTA 2AH5A 1H3NA 2HRQA 2APJA 4K8OA 4CGYA 4DCVA 2OUIA 3RBZA 1AF7A 2G3YA 2Z83A 3H2YA 4J1TC 3GNTA 4YI3A 3BMCA 4IGFA 1MJFA 1Y6FA 4MUAA 4QQRA 4YV0A 2V74B 4JJGA 3FD8A 1QBKC 1QVVA 3C98A 4MV7A 3EVDA 3IQHX 3TLKA 3U56A 3P94A 5BOSA 2VATA 2G4CA 1XHFA 3KJQA 5CK5A 1T1GA 2POQX 2LZ0A 3LKZA 4MO9A 4U39A 3TSCA 5G41A 1FP7A 5EMKA 3M1AA 3ZLJA 3OP4A 4RPJA 1Z6YA 1E0KA 2AK2A 2MSWA 2QN6A 5I7FA 2ZRKA 5ALVA 1NQVA 3DOEA 5M7EA 1BHQ1 1FNNA 1ZONA 1CQZA 3K8ZA 1NG1A 4ZYLA 1IY9A 1E9CA 3D7MA 4RSHA 4J91A 2GPTA 3AVQA 5FWYB 2J3IA 1BHJA 3OKPA 5A05A 1BU5A 2OXIA 3A4VA 2AR7A 4MRAA 4PYNA 4U0KA 1YUMA 4ESEA 1E0AA 3DF9A 1H6BA 2QA5A 4BMVA 4FYMA 2B9VA 3MWEA 3SJAA 3OE4A 1XCLA 1CNFA 3R5HA 4NYMQ 3ANSA 4WXRA 3T4PA 5LM3A 3PFIA 4LYJA 1MB2A 2F67A 1J7JA 3BMNB 4QGBA 1XD2B 1KSGA 1DC8A 3ZZ1A 3DBLA 2ZOSA 4JHXA 1T1RA 4B4OA 4E88A 3WVNA 2FG6C 1RHMA 5DBOA 1RRGA 2EARA 3BAFA 4KEAA 4OJQA 3T34A 1ESZA 4QYIB 3B3AA 1PR1A 4H6XA 4IFTA 4EO7A 2D2VA 1VJ1A 4TSKA 1V11A 5LWHA 4BX8A 3OLQA 5CNIA 1BGWA 4MTLA 4ARAA 3X0DA 1W88B 3CNNA 5HOEA 3U16A 2PZEA 3GEDA 3VYTB 1IN4A 4RD4A 4WN9A 3HWRA 1LBIA 3C3PA 3JQAA 5K3SA 4PC3A 4CLOA 3HWWA 3EHEA 4WCFB 3IVRA 5BMVB 3L4EA 1E2JA 1DXYA 3IKTA 2BFFB 1O6FA 4PSVA 2N47A 4RPHA 2Q27A 2R2AA 1RACA 2OZEA 2D5IA 3AHCA 3DMYA 3GLHE 1KSHA 2BMWA 4BNDA 1HLFA 2HYDA 3V80A 4F72A 2QX6A 2I9KA 3IIEA 3LSTA 3VR2A 2X2OA 3MHTA 4MGYR 3BXEA 5HF9A 1IOLA 1EGMB 4OCZA 4CR7A 5AVJA 2Y77A 3HMQA 1OF1A 2W5UA 3AERB 1A8SA 4PCLA 4E4YA 3TF5A 1OTXA 1TECE 2HCTA 1TKAA 1ECJA 2EFDB 3W6NA 3QHAA 8ATCA 3REQB 2MYPA 3CZ9A 1SIWA 3ZJYA 2F9MA 4O63O 3HKEA 4MH0R 3WYBA 3E53A 1OT5A 1B00A 1TYZA 3DTVD 5F2NA 4O4HF 4HNRA 3KVYA 5M2QA 2CZGA 3CKKA 1DFIA 3E4CA 3AK4A 4P84A 1WJGA 1K5GA 3BSFA 3V4RA 1M5RA 4KC0A 2NXNA 1R18A 2P7HA 3PVSA 5G0SA 4A03A 5A06A 5AJUA 2G9ZA 4ZCSA 4A4DA 2PQ6A 3O9MA 5HIKA 3D31A 2ZZNA 2W2KA 4OBEA 1GZUA 3S55A 1YUNA 1USVA 2O3JA 3D6JA 3VGJA 2Y0DA 5JTUA 1I4TD 3EWIA 4H17A 3RK1A 1RLUA 1PVOA 3STUA 1EFDN 3FKSD 5G1NA 4CCYB 4B0OA 1JSXA 1XNQB 3AI1A 2FPPA 4NFYA 2ZUEA 4L50A 5B4UA 1Q2UA 3CEHA 2X6RA 5L7WA 4IH1A 3AEYA 3OC6A 4WAUA 2RKBA 5KYUB 2LRHA 3UAXA 4ZARA 2ATXA 1AC5A 3B1XA 3LWNA 2V7QA 3GZNB 3GUZA 1NLZA 4FMCB 4OQLA 2J87A 3IC5A 1J39A 3L8EA 4A92A 5KX5B 5J2UA 4CLXA 3N8HA 3RHSA 5JWHA 2E6UX 4GYKA 3DDZX 1UOPA 4GR5A 4PYKA 3W5VA 2Q0SA 1PG2A 2I0FA 4MPTA 1VECA 1YMQA 4G89A 1P61B 1RCTE 3VISA 1A88A 2J46A 3W9BA 2I3DA 3TIVA 1OFHA 4H60A 1B8UA 3CUWA 4KJXA 1D4ZA 3HM9A 2ZSEA 1HSOA 3EZNA 1C80A 1DG1G 4HSEA 4IQ4A 1OFIA 1E6MA 1XD2A 1AT1A 4B33A 4IQ8A 1KQGA 5T67A 2ZE7A 1F5NA 4QA9A 4DNXA 3NS7A 1Q12A 4JB8A 4RPLA 4ZO7A 3FWKA 3CF2A 1Z56C 3MVEA 2OCPA 2DXIA 3ORHA 3CB4A 3BWXA 3K1YA 1IATA 2HIMA 3AFIA 2A88A 2X2FA 4TV9B 1DBSA 1KH3A 2PNFA 3VPXA 5JNSA 3OT1A 5DHTA 3WLSA 4EEKA 3X1DA 4JBWA 1K27A 2ONCA 2AI1A 1YZFA 2XE4A 4YCLA 3CEPB 3RAFC 4PG7A 3B1KA 5EJ5A 3W2FA 3PJDA 4J0JA 4D3DA 3HLKA 1Q15A 3FTPA 4PZPA 3AEKA 3LXXA 4AURA 4PIVA 1XZPA 3LMKA 5AM0A 1E58A 1GQYA 1GNQA 2G83A 5KMGB 2K5UA 5CU7A 4BNVA 1I10A 2DUNA 1XDDA 5J58A 4NMWA 3BK2A 2OXTA 1T5HX 2WT8A 4G0QA 5FBWB 4FZVA 4YMHA 1VZ3A 1XG5A 5CT5A 4P83A 4YUVA 1KAQA 1T29A 1X14A 2RAVA 1UKEA 5DNCA 3VH2A 1GNPA 1EUDA 2OYSA 3B3FA 3VSDA 2Q1SA 4G5YA 4WFJA 4QGFA 2RGCA 2X7XA 5FI5A 4IRMA 2MYUA 1P33A 3V7UA 5C34B 3I12A 4WK6A 4X24A 3UG7A 4B45A 2Q5CA 4MV6A 3B6JA 4NATA 3QKTA 2IV2X 3ZCSA 4BFYA 2O4CA 2HWXA 3EIEA 4C1NA 3LKBA 4QTUB 4ENVA 5H4GA 4JQCA 5HUHA 5EAIA 4F2DA 2RH4A 3EFBA 3WJ7A 3IUPA 4MDEA 1DQYA 4FXOA 3G0OA 2HRRA 4Q1EA 2WKRA 2YHUA 1W581 3FSRA 4O25A 1M66A 4PGHA 3LY7A 5FUWA 5LSAA 1DO0A 1NAHA 4YNBA 5TEVA 2YWFA 1GQFA 3JYHA 4DBZA 4GRDA 3E61A 3FOZA 3NETA 4M4SA 4D46A 1VCNA 2XWQA 4KWEA 4M87A 4UVDA 4QICA 2BFBA 3A26A 1M5TA 1FP6A 1PD1A 2F3QA 3MJEA 2FE1A 3LD9A 3CJRA 3P0JA 4KX5A 3RV3A 1Y7HA 3X1YA 1E5VA 4HFNA 3IIJA 5EP3A 2I6TA 1ABFA 4GX0A 4JLMA 3RVOA 3FYTA 4BFZA 4PSKA 4OGLA 5C7IO 4FB4A 1VM6A 2IP2A 2NZUG 1R0XA 3LPAA 1Z5PA 2CHQA 3ZU6A 3VM6A 2ECKA 1G5RA 4DCJA 5CFPA 2V8OA 2A9VA 4KQKA 1VSUA 3AVTA 2UVDA 2AIRA 1V2HE 4HXYA 1FVOA 1XRSB 1ULUA 1UFRA 2UAGA 1X1SA 2X7HA 3GLTA 1NZDA 4BX0A 5CEFA 4TZ6A 4IM7A 1TT5B 2Y71A 3IT0A 3IQXA 5HCIA 1Z18A 2IHVA 3QVSA 2O52A 1IAVA 4FBLA 4F4FA 4KNVA 3QRWA 4R31A 4RK4A 3U3JA 3W6UA 6Q21A 3I4LA 5FI3A 1R0CA 2C59A 2JCYA 1NL3A 3AEUA 3OD5A 2EV9A 1JUDA 1MO3A 4HTAA 4COOA 4FT2A 1EGAA 1RPAA 5M29A 3TFOA 1Z0SA 3H19A 3H5VA 4QEZA 2M98A 1H0KA 4ND1A 3ZXYA 4D99A 1JSLA 2GF2A 3G5TA 4QBFA 3E48A 3JQ6A 1D9ZA 2VK4A 3RJTA 3RUEA 5B36A 1XNGA 1ZESA 4Q21A 4Q3BA 1H65A 5ALNA 2W9XA 1JXMA 4YT5A 3PYXA 2WUDA 1BXKA 5E6UB 1OLSB 4P58A 4XDZA 3ZTWA 5DEIA 3CCCA 1PEYA 4UHJA 5FTNA 5LKAA 1CUGA 1GPAA 1QGUA 3T5AA 1CEEA 2DFTA 4G1UC 1S2LA 3TLZA 4XPIB 5KB3A 1I6WA 2OGZA 3O6VA 4N9QA 3ICQB 2XIQA 4DCSA 1EYZA 3KJZA 3F6YA 2XLCA 3ZD6A 1F38A 4NX2A 1W5BA 1C1DA 2O54A 4CLDA 3AINA 3ZE6A 4RA6B 3QA9A 5CNKA 2CXQA 2VOJA 4UCWA 3KELA 5EXTA 1QG6A 4JODA 3K5PA 4Q24A 3VU0A 3LW8A 2VPIA 5IYZB 2B4RO 4JBIA 1TKRA 1UKAA 3QWFA 4MTCA 4N49A 5AI4A 4D57A 1VHJA 4WFQA 4EGAA 4QTYA 3PD7A 1MA0A 3A1SA 4OLHA 4PO8A 3OJLA 3W8FA 4MS4A 5HJ5A 2O7QA 3SVTA 4LDZA 4DA0A 5IVPA 3ZUPA 2ZR0A 5EXDA 3UFXB 2PKQO 4YS6A 3USZA 4YWJA 1TJ4A 2QUJA 1U1CA 2HX1A 5JBQA 3R23A 2YASA 1YH3A 1JZSA 4ITUA 4YR9A 5BV2P 1LZLA 2PT7A 1W76A 2WTXA 5INTA 3WWOA 1MC4A 4NCBA 3TVDA 1PLKA 3S6JA 4D81A 3OY2A 1LBSA 2ZJ6A 3FLMA 2WSSA 3I2GA 5TF4A 3D8RA 3ODPA 2NV2B 5PGMA 4D9GA 2A84A 2Q0XA 3DCJA 1CUJA 5FXMA 1FMCA 5E3HA 3W6PA 4LECA 4FHCA 3VV2A 1I2CA 3WADA 3BGWA 4P2BA 4PY2A 3AR6A 2XYGA 1E3WB 1UZUA 4YRPA 3Q9UA 3VAYA 2ZDHA 5JPDA 4DDTA 4I9HA 5F7ZA 2NSLA 3K0AB 4RMGA 2GJSA 4POAA 4CV2A 1T4CB 3WBBA 4DKXA 1U7HA 4MX8A 4C4YA 1Z8NA 2W0SA 1UWCA 1OIXA 2HU5A 3KB2A 1DJPA 4W1RA 3R7WA 4BP9A 4XWAA 4TTIA 3FBWA 1VKHA 3H9GA 2XEXA 4RD6A 4XXHA 5GJBA 3PNPA 1YR3A 1GUZA 1NMEA 2C20A 4RESA 5C5DA 1NVWQ 1DDGA 1HQDA 2ROQA 2IYZA 3D1VA 3ZWWA 2OAP1 1Z47A 1XLTC 2ZB2A 3MUEA 1EBFA 4M1ZA 4HNTA 4FTWA 4HF7A 4TVBA 3VZPA 3ZVLA 1U8EA 1PT8A 2PGAA 1CRQA 2PU7A 3NAMA 4WD3A 4DA7A 1LVHA 3A32A 3NC1C 4W6QA 2ATEA 3E8XA 5CIQA 3SZLA 4DREA 4XVCA 4KSBA 3LDUA 4IDGA 2PIDA 1F3OA 3BWBA 1G66A 1EJ2A 3KT6A 3QUBA 5DTIA 1C1DB 5F64A 1CUBA 5FJJA 2EKDA 3E23A 4QU8A 3HDTA 3GJZA 3HYNA 4ENSA 2WFAA 2E49A 4YAEA 3VTFA 2JLUA 4M1OA 1JPJA 3A1DA 3KWJA 4BO9A 2AR9A 4B32A 4TKLA 3R4VA 5EXEA 2DWUA 3SOPA 3VYUB 2F43A 2WG1A 3JCZA 1E3MA 1T5BA 1QGUB 2H3HA 3IBSA 1K7XB 2JLRA 2NQ8A 5BUSA 2P77A 1OLSA 2GZRA 5IN5A 3C1TA 1EPUA 1BWPA 3GHYA 5ESXA 5AFSA 4FCCA 3F8WA 5D7BA 3WAJA 4C6HA 2QJOA 3VVCA 4XM0A 3TECE 5FTKA 1LPOA 1YMUA 4M60A 1FNBA 3O21A 1A50B 1R6AA 3KKKA 3QLVA 1OZHA 4LZNA 3V5NA 4LFBB 1S1MA 2VRBA 3HZOA 4MYCA 5AHOA 5HA5A 4C3UA 4CUKA 1B93A 1V35A 2PJRA 1X1EA 4RTQA 1PQWA 2PJDA 1IB0A 4UUQA 3UY4A 5LOVF 5CCBA 1C3XA 5E6RB 5IYZA 4MCJA 1WDTA 3FW1A 5I9LA 1EESA 4R1PA 2HPHA 4RMHA 1VLLA 3CUYA 1YE5A 4LY6A 1QYIA 3DE5X 1L9XA 4N41A 2ZB4A 3DT6A 4C2BA 3GFSA 5GVRA 4G0WA 3JRXA 2QRUA 1JHXA 1W96A 1DCFA 3DZCA 4JROA 3WLAA 4DMKA 2BRUA 4JBYA 3RSCA 4X63A 2VH2A 1X9GA 2JAPA 2KJQA 2ZSAA 4HVTA 1QG0A 2VPWA 3AVXA 4KITB 1SM4A 1KH2A 3IELA 3WYA<