4Z7MA

Novel inhibitors of bacterial methionine aminopeptidase with broad-spectrum biochemical activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Inhibitors of Bacterial Methionine Aminopeptidase with Broad-Spectrum Biochemical Activity
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase
total genus 83
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4z7mA00
1BN5A 2NQ6A 4U76A 1WL9A 4QR8A 1W7VA 2IW2A 1XGOA 2EVMA 2P99A 3IU8A 5JI6A 3L7GA 2BHCA 2EVOA 2GA2A 2GU4A 5E5BA 4MATA 1WKMA 4U6CA 4FO8A 2BB7A 3CB6A 3BIQA 1C24A 4FKCA 2GG9A 2EA4A 2EVCA 1C22A 2GTXA 3MR1A 2GG2A 5CIKA 1R5GA 1C27A 4U75A 1CHMA 1WLRA 5CLSA 2Q94A 2GG8A 2BWTA 4A6VA 1QXZA 1B6AA 4S00A 2Q92A 2Q95A 5CE6A 1WL6A 1YVMA 4U73A 3PKDA 2BWWA 3MATA 2V3XA 4U6EA 3D27A 4S2TP 4IKRA 3IU7A 2BH3A 4S2RP 1WN1A 1YW9A 4U6ZA 1XGNA 4FLLA 4RZZA 2ADUA 4Z7MA 2BWXA 1KQ0A 3BITA 2GU6A 4IDYA 2NQ7A 3PKAA 4ZNGA 5FCFA 4ZWPA 2DFIA 4IECA 1R5HA 1C23A 3FMQA 4PNCA 1QZYA 3FM3A 2GG0A 2Q96A 1B59A 4RZYA 1YJ3A 3TAVA 3Q6DA 2B3LA 2GG5A 5D6EA 1PV9A 3PKEA 4S01A 4OOKA 4ZWOA 2OAZA 2BN7A 3MX6A 4PV4A 1JAWA 2GZ5A 3TB5A 3RORA 4U70A 4IPAA 2P98A 4U69A 5CNXA 5JFRA 4FUKA 1QXWA 3L24A 2MATA 5D6FA 1M35A 4FLIA 3IG4A 4FLKA 1N51A 2BWUA 4IKTA 1XNZA 3BIPA 4JUQA 2BHDA 4R60A 3S6BA 4FLJA 2GG7A 2ZSGA 4IKSA 2B3HA 1C21A 5CDVA 2BWSA 4U1BA 1O0XA 1Y1NA 4FO7A 3RVAA 2V3YA 1KP0A 2EA2A 3CTZA 3CB5A 2V3ZA 3PKBA 4U6JA 4A6WA 1A16A 2OKNA 4U6WA 2BHBA 1BOAA 1QXYA 5FCHA 1WY2A 2P9AA 4U71A 4HXXA 2BWYA 2GG3A 1WBQA 1XGMA 2GGBA 4IF7A 4B28A 4IU6A 1XGSA 2GU7A 2Q93A 4IKUA 2Q8KA 2GGCA 4EGEA 1W2MA 1YW7A 3IU9A 1KQ9A 3FMRA 1MATA 1R58A 5CDEA 1YW8A 5JHUA 2HOWA 2G6PA 5CDLA 4KM3A 4ZWUA 3PKCA 2BHAA 2BWVA 2B3KA 2GU5A 2V6CA 4RGZ1
chains in the Genus database with same CATH superfamily
1BN5A 2NQ6A 4U76A 1WL9A 4QR8A 1W7VA 2IW2A 1XGOA 2EVMA 2P99A 3IU8A 5JI6A 3L7GA 2BHCA 2EVOA 2GA2A 2GU4A 5E5BA 4MATA 1WKMA 4U6CA 4FO8A 2BB7A 3CB6A 3BIQA 1C24A 4FKCA 2GG9A 2EA4A 2EVCA 1C22A 2GTXA 3MR1A 2GG2A 5CIKA 1R5GA 1C27A 4U75A 1CHMA 1WLRA 5CLSA 2Q94A 2GG8A 2BWTA 4A6VA 1QXZA 1B6AA 4S00A 2Q92A 2Q95A 5CE6A 1WL6A 1YVMA 4U73A 3PKDA 2BWWA 3MATA 2V3XA 4U6EA 3D27A 4S2TP 4IKRA 3IU7A 2BH3A 4S2RP 1WN1A 1YW9A 4U6ZA 1XGNA 4FLLA 4RZZA 2ADUA 4Z7MA 2BWXA 1KQ0A 3BITA 2GU6A 4IDYA 2NQ7A 3PKAA 4ZNGA 5FCFA 4ZWPA 2DFIA 4IECA 1R5HA 1C23A 3FMQA 4PNCA 1QZYA 3FM3A 2GG0A 2Q96A 1B59A 4RZYA 1YJ3A 3TAVA 3Q6DA 2B3LA 2GG5A 5D6EA 1PV9A 3PKEA 4S01A 4OOKA 4ZWOA 2OAZA 2BN7A 3MX6A 4PV4A 1JAWA 2GZ5A 3TB5A 3RORA 4U70A 4IPAA 2P98A 4U69A 5CNXA 5JFRA 4FUKA 1QXWA 3L24A 2MATA 5D6FA 1M35A 4FLIA 3IG4A 4FLKA 1N51A 2BWUA 4IKTA 1XNZA 3BIPA 4JUQA 2BHDA 4R60A 3S6BA 4FLJA 2GG7A 2ZSGA 4IKSA 2B3HA 1C21A 5CDVA 2BWSA 4U1BA 1O0XA 1Y1NA 4FO7A 3RVAA 2V3YA 1KP0A 2EA2A 3CTZA 3CB5A 2V3ZA 3PKBA 4U6JA 4A6WA 1A16A 2OKNA 4U6WA 2BHBA 1BOAA 1QXYA 5FCHA 1WY2A 2P9AA 4U71A 4HXXA 2BWYA 2GG3A 1WBQA 1XGMA 2GGBA 4IF7A 4B28A 4IU6A 1XGSA 2GU7A 2Q93A 4IKUA 2Q8KA 2GGCA 4EGEA 1W2MA 1YW7A 3IU9A 1KQ9A 3FMRA 1MATA 1R58A 5CDEA 1YW8A 5JHUA 2HOWA 2G6PA 5CDLA 4KM3A 4ZWUA 3PKCA 2BHAA 2BWVA 2B3KA 2GU5A 2V6CA 4RGZ1
chains in the Genus database with same CATH topology
1BN5A 2NQ6A 4U76A 1WL9A 4QR8A 1W7VA 2IW2A 1XGOA 2EVMA 2P99A 3IU8A 5JI6A 3L7GA 2BHCA 2EVOA 2GA2A 2GU4A 5E5BA 4MATA 1WKMA 4U6CA 4FO8A 2BB7A 3CB6A 3BIQA 1C24A 4FKCA 2GG9A 2EA4A 2EVCA 1C22A 2GTXA 3MR1A 2GG2A 5CIKA 1R5GA 1C27A 4U75A 1CHMA 1WLRA 5CLSA 2Q94A 2GG8A 2BWTA 4A6VA 1QXZA 1B6AA 4S00A 2Q92A 2Q95A 5CE6A 1WL6A 1YVMA 4U73A 3PKDA 2BWWA 3MATA 2V3XA 4U6EA 3D27A 4S2TP 4IKRA 3IU7A 2BH3A 4S2RP 1WN1A 1YW9A 4U6ZA 1XGNA 4FLLA 4RZZA 2ADUA 4Z7MA 2BWXA 1KQ0A 3BITA 2GU6A 4IDYA 2NQ7A 3PKAA 4ZNGA 5FCFA 4ZWPA 2DFIA 4IECA 1R5HA 1C23A 3FMQA 4PNCA 1QZYA 3FM3A 2GG0A 2Q96A 1B59A 4RZYA 1YJ3A 3TAVA 3Q6DA 2B3LA 2GG5A 5D6EA 1PV9A 3PKEA 4S01A 4OOKA 4ZWOA 2OAZA 2BN7A 3MX6A 4PV4A 1JAWA 2GZ5A 3TB5A 3RORA 4U70A 4IPAA 2P98A 4U69A 5CNXA 5JFRA 4FUKA 1QXWA 3L24A 2MATA 5D6FA 1M35A 4FLIA 3IG4A 4FLKA 1N51A 2BWUA 4IKTA 1XNZA 3BIPA 4JUQA 2BHDA 4R60A 3S6BA 4FLJA 2GG7A 2ZSGA 4IKSA 2B3HA 1C21A 5CDVA 2BWSA 4U1BA 1O0XA 1Y1NA 4FO7A 3RVAA 2V3YA 1KP0A 2EA2A 3CTZA 3CB5A 2V3ZA 3PKBA 4U6JA 4A6WA 1A16A 2OKNA 4U6WA 2BHBA 1BOAA 1QXYA 5FCHA 1WY2A 2P9AA 4U71A 4HXXA 2BWYA 2GG3A 1WBQA 1XGMA 2GGBA 4IF7A 4B28A 4IU6A 1XGSA 2GU7A 2Q93A 4IKUA 2Q8KA 2GGCA 4EGEA 1W2MA 1YW7A 3IU9A 1KQ9A 3FMRA 1MATA 1R58A 5CDEA 1YW8A 5JHUA 2HOWA 2G6PA 5CDLA 4KM3A 4ZWUA 3PKCA 2BHAA 2BWVA 2B3KA 2GU5A 2V6CA 4RGZ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN5 A;  2NQ6 A;  4U76 A;  1WL9 A;  4QR8 A;  1W7V A;  2IW2 A;  1XGO A;  2EVM A;  2P99 A;  3IU8 A;  5JI6 A;  3L7G A;  2BHC A;  2EVO A;  2GA2 A;  2GU4 A;  5E5B A;  4MAT A;  1WKM A;  4U6C A;  4FO8 A;  2BB7 A;  3CB6 A;  3BIQ A;  1C24 A;  4FKC A;  2GG9 A;  2EA4 A;  2EVC A;  1C22 A;  2GTX A;  3MR1 A;  2GG2 A;  5CIK A;  1R5G A;  1C27 A;  4U75 A;  1CHM A;  1WLR A;  5CLS A;  2Q94 A;  2GG8 A;  2BWT A;  4A6V A;  1QXZ A;  1B6A A;  4S00 A;  2Q92 A;  2Q95 A;  5CE6 A;  1WL6 A;  1YVM A;  4U73 A;  3PKD A;  2BWW A;  3MAT A;  2V3X A;  4U6E A;  3D27 A;  4S2T P;  4IKR A;  3IU7 A;  2BH3 A;  4S2R P;  1WN1 A;  1YW9 A;  4U6Z A;  1XGN A;  4FLL A;  4RZZ A;  2ADU A;  4Z7M A;  2BWX A;  1KQ0 A;  3BIT A;  2GU6 A;  4IDY A;  2NQ7 A;  3PKA A;  4ZNG A;  5FCF A;  4ZWP A;  2DFI A;  4IEC A;  1R5H A;  1C23 A;  3FMQ A;  4PNC A;  1QZY A;  3FM3 A;  2GG0 A;  2Q96 A;  1B59 A;  4RZY A;  1YJ3 A;  3TAV A;  3Q6D A;  2B3L A;  2GG5 A;  5D6E A;  1PV9 A;  3PKE A;  4S01 A;  4OOK A;  4ZWO A;  2OAZ A;  2BN7 A;  3MX6 A;  4PV4 A;  1JAW A;  2GZ5 A;  3TB5 A;  3ROR A;  4U70 A;  4IPA A;  2P98 A;  4U69 A;  5CNX A;  5JFR A;  4FUK A;  1QXW A;  3L24 A;  2MAT A;  5D6F A;  1M35 A;  4FLI A;  3IG4 A;  4FLK A;  1N51 A;  2BWU A;  4IKT A;  1XNZ A;  3BIP A;  4JUQ A;  2BHD A;  4R60 A;  3S6B A;  4FLJ A;  2GG7 A;  2ZSG A;  4IKS A;  2B3H A;  1C21 A;  5CDV A;  2BWS A;  4U1B A;  1O0X A;  1Y1N A;  4FO7 A;  3RVA A;  2V3Y A;  1KP0 A;  2EA2 A;  3CTZ A;  3CB5 A;  2V3Z A;  3PKB A;  4U6J A;  4A6W A;  1A16 A;  2OKN A;  4U6W A;  2BHB A;  1BOA A;  1QXY A;  5FCH A;  1WY2 A;  2P9A A;  4U71 A;  4HXX A;  2BWY A;  2GG3 A;  1WBQ A;  1XGM A;  2GGB A;  4IF7 A;  4B28 A;  4IU6 A;  1XGS A;  2GU7 A;  2Q93 A;  4IKU A;  2Q8K A;  2GGC A;  4EGE A;  1W2M A;  1YW7 A;  3IU9 A;  1KQ9 A;  3FMR A;  1MAT A;  1R58 A;  5CDE A;  1YW8 A;  5JHU A;  2HOW A;  2G6P A;  5CDL A;  4KM3 A;  4ZWU A;  3PKC A;  2BHA A;  2BWV A;  2B3K A;  2GU5 A;  2V6C A;  4RGZ 1; 
#chains in the Genus database with same CATH topology
 1BN5 A;  2NQ6 A;  4U76 A;  1WL9 A;  4QR8 A;  1W7V A;  2IW2 A;  1XGO A;  2EVM A;  2P99 A;  3IU8 A;  5JI6 A;  3L7G A;  2BHC A;  2EVO A;  2GA2 A;  2GU4 A;  5E5B A;  4MAT A;  1WKM A;  4U6C A;  4FO8 A;  2BB7 A;  3CB6 A;  3BIQ A;  1C24 A;  4FKC A;  2GG9 A;  2EA4 A;  2EVC A;  1C22 A;  2GTX A;  3MR1 A;  2GG2 A;  5CIK A;  1R5G A;  1C27 A;  4U75 A;  1CHM A;  1WLR A;  5CLS A;  2Q94 A;  2GG8 A;  2BWT A;  4A6V A;  1QXZ A;  1B6A A;  4S00 A;  2Q92 A;  2Q95 A;  5CE6 A;  1WL6 A;  1YVM A;  4U73 A;  3PKD A;  2BWW A;  3MAT A;  2V3X A;  4U6E A;  3D27 A;  4S2T P;  4IKR A;  3IU7 A;  2BH3 A;  4S2R P;  1WN1 A;  1YW9 A;  4U6Z A;  1XGN A;  4FLL A;  4RZZ A;  2ADU A;  4Z7M A;  2BWX A;  1KQ0 A;  3BIT A;  2GU6 A;  4IDY A;  2NQ7 A;  3PKA A;  4ZNG A;  5FCF A;  4ZWP A;  2DFI A;  4IEC A;  1R5H A;  1C23 A;  3FMQ A;  4PNC A;  1QZY A;  3FM3 A;  2GG0 A;  2Q96 A;  1B59 A;  4RZY A;  1YJ3 A;  3TAV A;  3Q6D A;  2B3L A;  2GG5 A;  5D6E A;  1PV9 A;  3PKE A;  4S01 A;  4OOK A;  4ZWO A;  2OAZ A;  2BN7 A;  3MX6 A;  4PV4 A;  1JAW A;  2GZ5 A;  3TB5 A;  3ROR A;  4U70 A;  4IPA A;  2P98 A;  4U69 A;  5CNX A;  5JFR A;  4FUK A;  1QXW A;  3L24 A;  2MAT A;  5D6F A;  1M35 A;  4FLI A;  3IG4 A;  4FLK A;  1N51 A;  2BWU A;  4IKT A;  1XNZ A;  3BIP A;  4JUQ A;  2BHD A;  4R60 A;  3S6B A;  4FLJ A;  2GG7 A;  2ZSG A;  4IKS A;  2B3H A;  1C21 A;  5CDV A;  2BWS A;  4U1B A;  1O0X A;  1Y1N A;  4FO7 A;  3RVA A;  2V3Y A;  1KP0 A;  2EA2 A;  3CTZ A;  3CB5 A;  2V3Z A;  3PKB A;  4U6J A;  4A6W A;  1A16 A;  2OKN A;  4U6W A;  2BHB A;  1BOA A;  1QXY A;  5FCH A;  1WY2 A;  2P9A A;  4U71 A;  4HXX A;  2BWY A;  2GG3 A;  1WBQ A;  1XGM A;  2GGB A;  4IF7 A;  4B28 A;  4IU6 A;  1XGS A;  2GU7 A;  2Q93 A;  4IKU A;  2Q8K A;  2GGC A;  4EGE A;  1W2M A;  1YW7 A;  3IU9 A;  1KQ9 A;  3FMR A;  1MAT A;  1R58 A;  5CDE A;  1YW8 A;  5JHU A;  2HOW A;  2G6P A;  5CDL A;  4KM3 A;  4ZWU A;  3PKC A;  2BHA A;  2BWV A;  2B3K A;  2GU5 A;  2V6C A;  4RGZ 1; 
#chains in the Genus database with same CATH homology
 1BN5 A;  2NQ6 A;  4U76 A;  1WL9 A;  4QR8 A;  1W7V A;  2IW2 A;  1XGO A;  2EVM A;  2P99 A;  3IU8 A;  5JI6 A;  3L7G A;  2BHC A;  2EVO A;  2GA2 A;  2GU4 A;  5E5B A;  4MAT A;  1WKM A;  4U6C A;  4FO8 A;  2BB7 A;  3CB6 A;  3BIQ A;  1C24 A;  4FKC A;  2GG9 A;  2EA4 A;  2EVC A;  1C22 A;  2GTX A;  3MR1 A;  2GG2 A;  5CIK A;  1R5G A;  1C27 A;  4U75 A;  1CHM A;  1WLR A;  5CLS A;  2Q94 A;  2GG8 A;  2BWT A;  4A6V A;  1QXZ A;  1B6A A;  4S00 A;  2Q92 A;  2Q95 A;  5CE6 A;  1WL6 A;  1YVM A;  4U73 A;  3PKD A;  2BWW A;  3MAT A;  2V3X A;  4U6E A;  3D27 A;  4S2T P;  4IKR A;  3IU7 A;  2BH3 A;  4S2R P;  1WN1 A;  1YW9 A;  4U6Z A;  1XGN A;  4FLL A;  4RZZ A;  2ADU A;  4Z7M A;  2BWX A;  1KQ0 A;  3BIT A;  2GU6 A;  4IDY A;  2NQ7 A;  3PKA A;  4ZNG A;  5FCF A;  4ZWP A;  2DFI A;  4IEC A;  1R5H A;  1C23 A;  3FMQ A;  4PNC A;  1QZY A;  3FM3 A;  2GG0 A;  2Q96 A;  1B59 A;  4RZY A;  1YJ3 A;  3TAV A;  3Q6D A;  2B3L A;  2GG5 A;  5D6E A;  1PV9 A;  3PKE A;  4S01 A;  4OOK A;  4ZWO A;  2OAZ A;  2BN7 A;  3MX6 A;  4PV4 A;  1JAW A;  2GZ5 A;  3TB5 A;  3ROR A;  4U70 A;  4IPA A;  2P98 A;  4U69 A;  5CNX A;  5JFR A;  4FUK A;  1QXW A;  3L24 A;  2MAT A;  5D6F A;  1M35 A;  4FLI A;  3IG4 A;  4FLK A;  1N51 A;  2BWU A;  4IKT A;  1XNZ A;  3BIP A;  4JUQ A;  2BHD A;  4R60 A;  3S6B A;  4FLJ A;  2GG7 A;  2ZSG A;  4IKS A;  2B3H A;  1C21 A;  5CDV A;  2BWS A;  4U1B A;  1O0X A;  1Y1N A;  4FO7 A;  3RVA A;  2V3Y A;  1KP0 A;  2EA2 A;  3CTZ A;  3CB5 A;  2V3Z A;  3PKB A;  4U6J A;  4A6W A;  1A16 A;  2OKN A;  4U6W A;  2BHB A;  1BOA A;  1QXY A;  5FCH A;  1WY2 A;  2P9A A;  4U71 A;  4HXX A;  2BWY A;  2GG3 A;  1WBQ A;  1XGM A;  2GGB A;  4IF7 A;  4B28 A;  4IU6 A;  1XGS A;  2GU7 A;  2Q93 A;  4IKU A;  2Q8K A;  2GGC A;  4EGE A;  1W2M A;  1YW7 A;  3IU9 A;  1KQ9 A;  3FMR A;  1MAT A;  1R58 A;  5CDE A;  1YW8 A;  5JHU A;  2HOW A;  2G6P A;  5CDL A;  4KM3 A;  4ZWU A;  3PKC A;  2BHA A;  2BWV A;  2B3K A;  2GU5 A;  2V6C A;  4RGZ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...