4Z7MA

Novel inhibitors of bacterial methionine aminopeptidase with broad-spectrum biochemical activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Inhibitors of Bacterial Methionine Aminopeptidase with Broad-Spectrum Biochemical Activity
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase
total genus 83
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4z7mA00
4ZNGA 4RGZ1 1C23A 1QXZA 4Z7MA 5CE6A 1R5GA 1WL6A 4HXXA 4IKTA 4IKRA 2B3HA 2EA4A 4IKUA 4IU6A 4IPAA 4R60A 4ZWPA 2P9AA 1WN1A 2B3LA 3CB5A 4U6JA 4JUQA 1YW9A 1MATA 4IF7A 2BWXA 2GU7A 2GU4A 1WBQA 2BB7A 1KQ0A 2GZ5A 2GG9A 1Y1NA 4FO8A 3CTZA 2GG5A 4IKSA 1A16A 4U6WA 5D6FA 3RVAA 2GTXA 2EVOA 4ZWUA 3TAVA 5FCFA 5E5BA 3IU9A 1YW7A 3IU8A 3BIPA 4PNCA 5CLSA 5JFRA 2BWYA 2GA2A 3FM3A 1WL9A 4FUKA 2OKNA 1W7VA 2BN7A 2OAZA 2GGCA 3PKEA 4U70A 1R58A 1BOAA 1YJ3A 2HOWA 4U71A 2MATA 2V3XA 2ZSGA 1PV9A 4FO7A 2GG7A 2Q93A 1XNZA 2ADUA 4A6WA 2GG2A 3S6BA 4RZYA 2GU5A 3PKBA 2BH3A 3BITA 3BIQA 1JAWA 5CDLA 4IDYA 2BHBA 2Q92A 2BHDA 1QZYA 2V6CA 3L7GA 1QXYA 1W2MA 1C24A 2BWVA 2Q94A 4S01A 1XGNA 2GG0A 3FMRA 2BWUA 4U76A 1O0XA 4FLLA 5JHUA 5D6EA 4S2RP 1YW8A 1C27A 3Q6DA 1N51A 1C22A 1B6AA 3TB5A 3MR1A 2GU6A 4FLJA 4U1BA 5CDEA 1XGSA 2IW2A 1KQ9A 1XGOA 4U73A 3CB6A 3MATA 2Q8KA 1WLRA 1C21A 1YVMA 3PKCA 1KP0A 2B3KA 2Q96A 3L24A 2Q95A 4FLIA 4MATA 4U6CA 2EA2A 1WKMA 4ZWOA 2P99A 4RZZA 2GGBA 5CIKA 2GG3A 5FCHA 4U6EA 4S2TP 1R5HA 2G6PA 2P98A 4U69A 4B28A 2DFIA 2GG8A 2V3ZA 3PKAA 4OOKA 3IG4A 3MX6A 1QXWA 5CNXA 4A6VA 5CDVA 2V3YA 4U6ZA 2BWWA 4IECA 2NQ6A 2BHAA 1WY2A 1B59A 2EVMA 1XGMA 4S00A 4QR8A 1BN5A 3IU7A 1CHMA 2NQ7A 4KM3A 4EGEA 2BWTA 2BHCA 4U75A 2BWSA 3D27A 1M35A 5JI6A 4FKCA 4PV4A 3PKDA 2EVCA 3FMQA 3RORA 4FLKA
chains in the Genus database with same CATH superfamily
4ZNGA 4RGZ1 1C23A 1QXZA 4Z7MA 5CE6A 1R5GA 1WL6A 4HXXA 4IKTA 4IKRA 2B3HA 2EA4A 4IKUA 4IU6A 4IPAA 4R60A 4ZWPA 2P9AA 1WN1A 2B3LA 3CB5A 4U6JA 4JUQA 1YW9A 1MATA 4IF7A 2BWXA 2GU7A 2GU4A 1WBQA 2BB7A 1KQ0A 2GZ5A 2GG9A 1Y1NA 4FO8A 3CTZA 2GG5A 4IKSA 1A16A 4U6WA 5D6FA 3RVAA 2GTXA 2EVOA 4ZWUA 3TAVA 5FCFA 5E5BA 3IU9A 1YW7A 3IU8A 3BIPA 4PNCA 5CLSA 5JFRA 2BWYA 2GA2A 3FM3A 1WL9A 4FUKA 2OKNA 1W7VA 2BN7A 2OAZA 2GGCA 3PKEA 4U70A 1R58A 1BOAA 1YJ3A 2HOWA 4U71A 2MATA 2V3XA 2ZSGA 1PV9A 4FO7A 2GG7A 2Q93A 1XNZA 2ADUA 4A6WA 2GG2A 3S6BA 4RZYA 2GU5A 3PKBA 2BH3A 3BITA 3BIQA 1JAWA 5CDLA 4IDYA 2BHBA 2Q92A 2BHDA 1QZYA 2V6CA 3L7GA 1QXYA 1W2MA 1C24A 2BWVA 2Q94A 4S01A 1XGNA 2GG0A 3FMRA 2BWUA 4U76A 1O0XA 4FLLA 5JHUA 5D6EA 4S2RP 1YW8A 1C27A 3Q6DA 1N51A 1C22A 1B6AA 3TB5A 3MR1A 2GU6A 4FLJA 4U1BA 5CDEA 1XGSA 2IW2A 1KQ9A 1XGOA 4U73A 3CB6A 3MATA 2Q8KA 1WLRA 1C21A 1YVMA 3PKCA 1KP0A 2B3KA 2Q96A 3L24A 2Q95A 4FLIA 4MATA 4U6CA 2EA2A 1WKMA 4ZWOA 2P99A 4RZZA 2GGBA 5CIKA 2GG3A 5FCHA 4U6EA 4S2TP 1R5HA 2G6PA 2P98A 4U69A 4B28A 2DFIA 2GG8A 2V3ZA 3PKAA 4OOKA 3IG4A 3MX6A 1QXWA 5CNXA 4A6VA 5CDVA 2V3YA 4U6ZA 2BWWA 4IECA 2NQ6A 2BHAA 1WY2A 1B59A 2EVMA 1XGMA 4S00A 4QR8A 1BN5A 3IU7A 1CHMA 2NQ7A 4KM3A 4EGEA 2BWTA 2BHCA 4U75A 2BWSA 3D27A 1M35A 5JI6A 4FKCA 4PV4A 3PKDA 2EVCA 3FMQA 3RORA 4FLKA
chains in the Genus database with same CATH topology
4ZNGA 4RGZ1 1C23A 1QXZA 4Z7MA 5CE6A 1R5GA 1WL6A 4HXXA 4IKTA 4IKRA 2B3HA 2EA4A 4IKUA 4IU6A 4IPAA 4R60A 4ZWPA 2P9AA 1WN1A 2B3LA 3CB5A 4U6JA 4JUQA 1YW9A 1MATA 4IF7A 2BWXA 2GU7A 2GU4A 1WBQA 2BB7A 1KQ0A 2GZ5A 2GG9A 1Y1NA 4FO8A 3CTZA 2GG5A 4IKSA 1A16A 4U6WA 5D6FA 3RVAA 2GTXA 2EVOA 4ZWUA 3TAVA 5FCFA 5E5BA 3IU9A 1YW7A 3IU8A 3BIPA 4PNCA 5CLSA 5JFRA 2BWYA 2GA2A 3FM3A 1WL9A 4FUKA 2OKNA 1W7VA 2BN7A 2OAZA 2GGCA 3PKEA 4U70A 1R58A 1BOAA 1YJ3A 2HOWA 4U71A 2MATA 2V3XA 2ZSGA 1PV9A 4FO7A 2GG7A 2Q93A 1XNZA 2ADUA 4A6WA 2GG2A 3S6BA 4RZYA 2GU5A 3PKBA 2BH3A 3BITA 3BIQA 1JAWA 5CDLA 4IDYA 2BHBA 2Q92A 2BHDA 1QZYA 2V6CA 3L7GA 1QXYA 1W2MA 1C24A 2BWVA 2Q94A 4S01A 1XGNA 2GG0A 3FMRA 2BWUA 4U76A 1O0XA 4FLLA 5JHUA 5D6EA 4S2RP 1YW8A 1C27A 3Q6DA 1N51A 1C22A 1B6AA 3TB5A 3MR1A 2GU6A 4FLJA 4U1BA 5CDEA 1XGSA 2IW2A 1KQ9A 1XGOA 4U73A 3CB6A 3MATA 2Q8KA 1WLRA 1C21A 1YVMA 3PKCA 1KP0A 2B3KA 2Q96A 3L24A 2Q95A 4FLIA 4MATA 4U6CA 2EA2A 1WKMA 4ZWOA 2P99A 4RZZA 2GGBA 5CIKA 2GG3A 5FCHA 4U6EA 4S2TP 1R5HA 2G6PA 2P98A 4U69A 4B28A 2DFIA 2GG8A 2V3ZA 3PKAA 4OOKA 3IG4A 3MX6A 1QXWA 5CNXA 4A6VA 5CDVA 2V3YA 4U6ZA 2BWWA 4IECA 2NQ6A 2BHAA 1WY2A 1B59A 2EVMA 1XGMA 4S00A 4QR8A 1BN5A 3IU7A 1CHMA 2NQ7A 4KM3A 4EGEA 2BWTA 2BHCA 4U75A 2BWSA 3D27A 1M35A 5JI6A 4FKCA 4PV4A 3PKDA 2EVCA 3FMQA 3RORA 4FLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNG A;  4RGZ 1;  1C23 A;  1QXZ A;  4Z7M A;  5CE6 A;  1R5G A;  1WL6 A;  4HXX A;  4IKT A;  4IKR A;  2B3H A;  2EA4 A;  4IKU A;  4IU6 A;  4IPA A;  4R60 A;  4ZWP A;  2P9A A;  1WN1 A;  2B3L A;  3CB5 A;  4U6J A;  4JUQ A;  1YW9 A;  1MAT A;  4IF7 A;  2BWX A;  2GU7 A;  2GU4 A;  1WBQ A;  2BB7 A;  1KQ0 A;  2GZ5 A;  2GG9 A;  1Y1N A;  4FO8 A;  3CTZ A;  2GG5 A;  4IKS A;  1A16 A;  4U6W A;  5D6F A;  3RVA A;  2GTX A;  2EVO A;  4ZWU A;  3TAV A;  5FCF A;  5E5B A;  3IU9 A;  1YW7 A;  3IU8 A;  3BIP A;  4PNC A;  5CLS A;  5JFR A;  2BWY A;  2GA2 A;  3FM3 A;  1WL9 A;  4FUK A;  2OKN A;  1W7V A;  2BN7 A;  2OAZ A;  2GGC A;  3PKE A;  4U70 A;  1R58 A;  1BOA A;  1YJ3 A;  2HOW A;  4U71 A;  2MAT A;  2V3X A;  2ZSG A;  1PV9 A;  4FO7 A;  2GG7 A;  2Q93 A;  1XNZ A;  2ADU A;  4A6W A;  2GG2 A;  3S6B A;  4RZY A;  2GU5 A;  3PKB A;  2BH3 A;  3BIT A;  3BIQ A;  1JAW A;  5CDL A;  4IDY A;  2BHB A;  2Q92 A;  2BHD A;  1QZY A;  2V6C A;  3L7G A;  1QXY A;  1W2M A;  1C24 A;  2BWV A;  2Q94 A;  4S01 A;  1XGN A;  2GG0 A;  3FMR A;  2BWU A;  4U76 A;  1O0X A;  4FLL A;  5JHU A;  5D6E A;  4S2R P;  1YW8 A;  1C27 A;  3Q6D A;  1N51 A;  1C22 A;  1B6A A;  3TB5 A;  3MR1 A;  2GU6 A;  4FLJ A;  4U1B A;  5CDE A;  1XGS A;  2IW2 A;  1KQ9 A;  1XGO A;  4U73 A;  3CB6 A;  3MAT A;  2Q8K A;  1WLR A;  1C21 A;  1YVM A;  3PKC A;  1KP0 A;  2B3K A;  2Q96 A;  3L24 A;  2Q95 A;  4FLI A;  4MAT A;  4U6C A;  2EA2 A;  1WKM A;  4ZWO A;  2P99 A;  4RZZ A;  2GGB A;  5CIK A;  2GG3 A;  5FCH A;  4U6E A;  4S2T P;  1R5H A;  2G6P A;  2P98 A;  4U69 A;  4B28 A;  2DFI A;  2GG8 A;  2V3Z A;  3PKA A;  4OOK A;  3IG4 A;  3MX6 A;  1QXW A;  5CNX A;  4A6V A;  5CDV A;  2V3Y A;  4U6Z A;  2BWW A;  4IEC A;  2NQ6 A;  2BHA A;  1WY2 A;  1B59 A;  2EVM A;  1XGM A;  4S00 A;  4QR8 A;  1BN5 A;  3IU7 A;  1CHM A;  2NQ7 A;  4KM3 A;  4EGE A;  2BWT A;  2BHC A;  4U75 A;  2BWS A;  3D27 A;  1M35 A;  5JI6 A;  4FKC A;  4PV4 A;  3PKD A;  2EVC A;  3FMQ A;  3ROR A;  4FLK A; 
#chains in the Genus database with same CATH topology
 4ZNG A;  4RGZ 1;  1C23 A;  1QXZ A;  4Z7M A;  5CE6 A;  1R5G A;  1WL6 A;  4HXX A;  4IKT A;  4IKR A;  2B3H A;  2EA4 A;  4IKU A;  4IU6 A;  4IPA A;  4R60 A;  4ZWP A;  2P9A A;  1WN1 A;  2B3L A;  3CB5 A;  4U6J A;  4JUQ A;  1YW9 A;  1MAT A;  4IF7 A;  2BWX A;  2GU7 A;  2GU4 A;  1WBQ A;  2BB7 A;  1KQ0 A;  2GZ5 A;  2GG9 A;  1Y1N A;  4FO8 A;  3CTZ A;  2GG5 A;  4IKS A;  1A16 A;  4U6W A;  5D6F A;  3RVA A;  2GTX A;  2EVO A;  4ZWU A;  3TAV A;  5FCF A;  5E5B A;  3IU9 A;  1YW7 A;  3IU8 A;  3BIP A;  4PNC A;  5CLS A;  5JFR A;  2BWY A;  2GA2 A;  3FM3 A;  1WL9 A;  4FUK A;  2OKN A;  1W7V A;  2BN7 A;  2OAZ A;  2GGC A;  3PKE A;  4U70 A;  1R58 A;  1BOA A;  1YJ3 A;  2HOW A;  4U71 A;  2MAT A;  2V3X A;  2ZSG A;  1PV9 A;  4FO7 A;  2GG7 A;  2Q93 A;  1XNZ A;  2ADU A;  4A6W A;  2GG2 A;  3S6B A;  4RZY A;  2GU5 A;  3PKB A;  2BH3 A;  3BIT A;  3BIQ A;  1JAW A;  5CDL A;  4IDY A;  2BHB A;  2Q92 A;  2BHD A;  1QZY A;  2V6C A;  3L7G A;  1QXY A;  1W2M A;  1C24 A;  2BWV A;  2Q94 A;  4S01 A;  1XGN A;  2GG0 A;  3FMR A;  2BWU A;  4U76 A;  1O0X A;  4FLL A;  5JHU A;  5D6E A;  4S2R P;  1YW8 A;  1C27 A;  3Q6D A;  1N51 A;  1C22 A;  1B6A A;  3TB5 A;  3MR1 A;  2GU6 A;  4FLJ A;  4U1B A;  5CDE A;  1XGS A;  2IW2 A;  1KQ9 A;  1XGO A;  4U73 A;  3CB6 A;  3MAT A;  2Q8K A;  1WLR A;  1C21 A;  1YVM A;  3PKC A;  1KP0 A;  2B3K A;  2Q96 A;  3L24 A;  2Q95 A;  4FLI A;  4MAT A;  4U6C A;  2EA2 A;  1WKM A;  4ZWO A;  2P99 A;  4RZZ A;  2GGB A;  5CIK A;  2GG3 A;  5FCH A;  4U6E A;  4S2T P;  1R5H A;  2G6P A;  2P98 A;  4U69 A;  4B28 A;  2DFI A;  2GG8 A;  2V3Z A;  3PKA A;  4OOK A;  3IG4 A;  3MX6 A;  1QXW A;  5CNX A;  4A6V A;  5CDV A;  2V3Y A;  4U6Z A;  2BWW A;  4IEC A;  2NQ6 A;  2BHA A;  1WY2 A;  1B59 A;  2EVM A;  1XGM A;  4S00 A;  4QR8 A;  1BN5 A;  3IU7 A;  1CHM A;  2NQ7 A;  4KM3 A;  4EGE A;  2BWT A;  2BHC A;  4U75 A;  2BWS A;  3D27 A;  1M35 A;  5JI6 A;  4FKC A;  4PV4 A;  3PKD A;  2EVC A;  3FMQ A;  3ROR A;  4FLK A; 
#chains in the Genus database with same CATH homology
 4ZNG A;  4RGZ 1;  1C23 A;  1QXZ A;  4Z7M A;  5CE6 A;  1R5G A;  1WL6 A;  4HXX A;  4IKT A;  4IKR A;  2B3H A;  2EA4 A;  4IKU A;  4IU6 A;  4IPA A;  4R60 A;  4ZWP A;  2P9A A;  1WN1 A;  2B3L A;  3CB5 A;  4U6J A;  4JUQ A;  1YW9 A;  1MAT A;  4IF7 A;  2BWX A;  2GU7 A;  2GU4 A;  1WBQ A;  2BB7 A;  1KQ0 A;  2GZ5 A;  2GG9 A;  1Y1N A;  4FO8 A;  3CTZ A;  2GG5 A;  4IKS A;  1A16 A;  4U6W A;  5D6F A;  3RVA A;  2GTX A;  2EVO A;  4ZWU A;  3TAV A;  5FCF A;  5E5B A;  3IU9 A;  1YW7 A;  3IU8 A;  3BIP A;  4PNC A;  5CLS A;  5JFR A;  2BWY A;  2GA2 A;  3FM3 A;  1WL9 A;  4FUK A;  2OKN A;  1W7V A;  2BN7 A;  2OAZ A;  2GGC A;  3PKE A;  4U70 A;  1R58 A;  1BOA A;  1YJ3 A;  2HOW A;  4U71 A;  2MAT A;  2V3X A;  2ZSG A;  1PV9 A;  4FO7 A;  2GG7 A;  2Q93 A;  1XNZ A;  2ADU A;  4A6W A;  2GG2 A;  3S6B A;  4RZY A;  2GU5 A;  3PKB A;  2BH3 A;  3BIT A;  3BIQ A;  1JAW A;  5CDL A;  4IDY A;  2BHB A;  2Q92 A;  2BHD A;  1QZY A;  2V6C A;  3L7G A;  1QXY A;  1W2M A;  1C24 A;  2BWV A;  2Q94 A;  4S01 A;  1XGN A;  2GG0 A;  3FMR A;  2BWU A;  4U76 A;  1O0X A;  4FLL A;  5JHU A;  5D6E A;  4S2R P;  1YW8 A;  1C27 A;  3Q6D A;  1N51 A;  1C22 A;  1B6A A;  3TB5 A;  3MR1 A;  2GU6 A;  4FLJ A;  4U1B A;  5CDE A;  1XGS A;  2IW2 A;  1KQ9 A;  1XGO A;  4U73 A;  3CB6 A;  3MAT A;  2Q8K A;  1WLR A;  1C21 A;  1YVM A;  3PKC A;  1KP0 A;  2B3K A;  2Q96 A;  3L24 A;  2Q95 A;  4FLI A;  4MAT A;  4U6C A;  2EA2 A;  1WKM A;  4ZWO A;  2P99 A;  4RZZ A;  2GGB A;  5CIK A;  2GG3 A;  5FCH A;  4U6E A;  4S2T P;  1R5H A;  2G6P A;  2P98 A;  4U69 A;  4B28 A;  2DFI A;  2GG8 A;  2V3Z A;  3PKA A;  4OOK A;  3IG4 A;  3MX6 A;  1QXW A;  5CNX A;  4A6V A;  5CDV A;  2V3Y A;  4U6Z A;  2BWW A;  4IEC A;  2NQ6 A;  2BHA A;  1WY2 A;  1B59 A;  2EVM A;  1XGM A;  4S00 A;  4QR8 A;  1BN5 A;  3IU7 A;  1CHM A;  2NQ7 A;  4KM3 A;  4EGE A;  2BWT A;  2BHC A;  4U75 A;  2BWS A;  3D27 A;  1M35 A;  5JI6 A;  4FKC A;  4PV4 A;  3PKD A;  2EVC A;  3FMQ A;  3ROR A;  4FLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...