4Z7MA

Novel inhibitors of bacterial methionine aminopeptidase with broad-spectrum biochemical activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Novel Inhibitors of Bacterial Methionine Aminopeptidase with Broad-Spectrum Biochemical Activity
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4z7mA00
4RGZ1 1M35A 2P98A 2EA2A 1YW7A 4S2TP 1KP0A 1XGSA 2ADUA 4MATA 2EVMA 3CTZA 2GGCA 2GU7A 4FKCA 5D6FA 2V3XA 1YW8A 4U6JA 3IG4A 1WL9A 3TAVA 5JHUA 1WLRA 1B59A 4IPAA 2EVCA 2GTXA 4EGEA 1O0XA 2B3LA 2NQ6A 1QXZA 2V6CA 1KQ9A 3PKDA 1B6AA 2NQ7A 4IKTA 4ZNGA 2Q8KA 2IW2A 4B28A 1YVMA 3FM3A 4Z7MA 2BN7A 2OKNA 1PV9A 1C23A 4RZZA 5CDLA 4ZWUA 3IU8A 4U6WA 3PKEA 3S6BA 2Q96A 2B3KA 3RORA 4U1BA 3IU7A 3IU9A 5JI6A 4FUKA 1W2MA 2BWTA 3RVAA 4IECA 2GU5A 3PKCA 5CDEA 1C22A 5CDVA 1W7VA 1XGMA 2ZSGA 3BITA 2GGBA 4S2RP 2BHAA 2GG7A 4RZYA 1XGNA 2BH3A 4ZWOA 1KQ0A 2BHDA 3CB6A 2GZ5A 4U69A 4A6VA 4A6WA 3D27A 2EVOA 5D6EA 2HOWA 2Q93A 3MX6A 1XNZA 3Q6DA 4FLIA 4IKSA 4U76A 3FMQA 3MATA 1YJ3A 4U75A 2GG8A 3PKBA 5JFRA 2P9AA 2G6PA 4IDYA 5CIKA 2BWXA 4OOKA 4U73A 4S01A 4IF7A 2EA4A 4PV4A 1R5HA 3CB5A 3L24A 3BIPA 1WKMA 1QXWA 1XGOA 1WBQA 2GG9A 5CLSA 2BB7A 2B3HA 4U6EA 1BN5A 2GU4A 2GG0A 2BWUA 2OAZA 4IU6A 5CNXA 5E5BA 2V3ZA 1QZYA 4FLLA 3PKAA 1C21A 1N51A 4U70A 3TB5A 4FO7A 2BHCA 2GG2A 4PNCA 2BWWA 5CE6A 5FCFA 2V3YA 2BWYA 2DFIA 4JUQA 4U71A 3BIQA 2Q92A 3FMRA 1R58A 4U6CA 1BOAA 1R5GA 1WN1A 2BWVA 4FLKA 2MATA 4IKRA 4U6ZA 1QXYA 2BWSA 4QR8A 4S00A 2GA2A 2BHBA 4FLJA 4FO8A 1A16A 3L7GA 4HXXA 4R60A 1C24A 1CHMA 2Q95A 1JAWA 1MATA 1WY2A 5FCHA 1WL6A 4KM3A 2P99A 1YW9A 3MR1A 2GG3A 2GU6A 4ZWPA 2GG5A 4IKUA 1Y1NA 1C27A 2Q94A
chains in the Genus database with same CATH superfamily
4RGZ1 1M35A 2P98A 2EA2A 1YW7A 4S2TP 1KP0A 1XGSA 2ADUA 4MATA 2EVMA 3CTZA 2GGCA 2GU7A 4FKCA 5D6FA 2V3XA 1YW8A 4U6JA 3IG4A 1WL9A 3TAVA 5JHUA 1WLRA 1B59A 4IPAA 2EVCA 2GTXA 4EGEA 1O0XA 2B3LA 2NQ6A 1QXZA 2V6CA 1KQ9A 3PKDA 1B6AA 2NQ7A 4IKTA 4ZNGA 2Q8KA 2IW2A 4B28A 1YVMA 3FM3A 4Z7MA 2BN7A 2OKNA 1PV9A 1C23A 4RZZA 5CDLA 4ZWUA 3IU8A 4U6WA 3PKEA 3S6BA 2Q96A 2B3KA 3RORA 4U1BA 3IU7A 3IU9A 5JI6A 4FUKA 1W2MA 2BWTA 3RVAA 4IECA 2GU5A 3PKCA 5CDEA 1C22A 5CDVA 1W7VA 1XGMA 2ZSGA 3BITA 2GGBA 4S2RP 2BHAA 2GG7A 4RZYA 1XGNA 2BH3A 4ZWOA 1KQ0A 2BHDA 3CB6A 2GZ5A 4U69A 4A6VA 4A6WA 3D27A 2EVOA 5D6EA 2HOWA 2Q93A 3MX6A 1XNZA 3Q6DA 4FLIA 4IKSA 4U76A 3FMQA 3MATA 1YJ3A 4U75A 2GG8A 3PKBA 5JFRA 2P9AA 2G6PA 4IDYA 5CIKA 2BWXA 4OOKA 4U73A 4S01A 4IF7A 2EA4A 4PV4A 1R5HA 3CB5A 3L24A 3BIPA 1WKMA 1QXWA 1XGOA 1WBQA 2GG9A 5CLSA 2BB7A 2B3HA 4U6EA 1BN5A 2GU4A 2GG0A 2BWUA 2OAZA 4IU6A 5CNXA 5E5BA 2V3ZA 1QZYA 4FLLA 3PKAA 1C21A 1N51A 4U70A 3TB5A 4FO7A 2BHCA 2GG2A 4PNCA 2BWWA 5CE6A 5FCFA 2V3YA 2BWYA 2DFIA 4JUQA 4U71A 3BIQA 2Q92A 3FMRA 1R58A 4U6CA 1BOAA 1R5GA 1WN1A 2BWVA 4FLKA 2MATA 4IKRA 4U6ZA 1QXYA 2BWSA 4QR8A 4S00A 2GA2A 2BHBA 4FLJA 4FO8A 1A16A 3L7GA 4HXXA 4R60A 1C24A 1CHMA 2Q95A 1JAWA 1MATA 1WY2A 5FCHA 1WL6A 4KM3A 2P99A 1YW9A 3MR1A 2GG3A 2GU6A 4ZWPA 2GG5A 4IKUA 1Y1NA 1C27A 2Q94A
chains in the Genus database with same CATH topology
4RGZ1 1M35A 2P98A 2EA2A 1YW7A 4S2TP 1KP0A 1XGSA 2ADUA 4MATA 2EVMA 3CTZA 2GGCA 2GU7A 4FKCA 5D6FA 2V3XA 1YW8A 4U6JA 3IG4A 1WL9A 3TAVA 5JHUA 1WLRA 1B59A 4IPAA 2EVCA 2GTXA 4EGEA 1O0XA 2B3LA 2NQ6A 1QXZA 2V6CA 1KQ9A 3PKDA 1B6AA 2NQ7A 4IKTA 4ZNGA 2Q8KA 2IW2A 4B28A 1YVMA 3FM3A 4Z7MA 2BN7A 2OKNA 1PV9A 1C23A 4RZZA 5CDLA 4ZWUA 3IU8A 4U6WA 3PKEA 3S6BA 2Q96A 2B3KA 3RORA 4U1BA 3IU7A 3IU9A 5JI6A 4FUKA 1W2MA 2BWTA 3RVAA 4IECA 2GU5A 3PKCA 5CDEA 1C22A 5CDVA 1W7VA 1XGMA 2ZSGA 3BITA 2GGBA 4S2RP 2BHAA 2GG7A 4RZYA 1XGNA 2BH3A 4ZWOA 1KQ0A 2BHDA 3CB6A 2GZ5A 4U69A 4A6VA 4A6WA 3D27A 2EVOA 5D6EA 2HOWA 2Q93A 3MX6A 1XNZA 3Q6DA 4FLIA 4IKSA 4U76A 3FMQA 3MATA 1YJ3A 4U75A 2GG8A 3PKBA 5JFRA 2P9AA 2G6PA 4IDYA 5CIKA 2BWXA 4OOKA 4U73A 4S01A 4IF7A 2EA4A 4PV4A 1R5HA 3CB5A 3L24A 3BIPA 1WKMA 1QXWA 1XGOA 1WBQA 2GG9A 5CLSA 2BB7A 2B3HA 4U6EA 1BN5A 2GU4A 2GG0A 2BWUA 2OAZA 4IU6A 5CNXA 5E5BA 2V3ZA 1QZYA 4FLLA 3PKAA 1C21A 1N51A 4U70A 3TB5A 4FO7A 2BHCA 2GG2A 4PNCA 2BWWA 5CE6A 5FCFA 2V3YA 2BWYA 2DFIA 4JUQA 4U71A 3BIQA 2Q92A 3FMRA 1R58A 4U6CA 1BOAA 1R5GA 1WN1A 2BWVA 4FLKA 2MATA 4IKRA 4U6ZA 1QXYA 2BWSA 4QR8A 4S00A 2GA2A 2BHBA 4FLJA 4FO8A 1A16A 3L7GA 4HXXA 4R60A 1C24A 1CHMA 2Q95A 1JAWA 1MATA 1WY2A 5FCHA 1WL6A 4KM3A 2P99A 1YW9A 3MR1A 2GG3A 2GU6A 4ZWPA 2GG5A 4IKUA 1Y1NA 1C27A 2Q94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGZ 1;  1M35 A;  2P98 A;  2EA2 A;  1YW7 A;  4S2T P;  1KP0 A;  1XGS A;  2ADU A;  4MAT A;  2EVM A;  3CTZ A;  2GGC A;  2GU7 A;  4FKC A;  5D6F A;  2V3X A;  1YW8 A;  4U6J A;  3IG4 A;  1WL9 A;  3TAV A;  5JHU A;  1WLR A;  1B59 A;  4IPA A;  2EVC A;  2GTX A;  4EGE A;  1O0X A;  2B3L A;  2NQ6 A;  1QXZ A;  2V6C A;  1KQ9 A;  3PKD A;  1B6A A;  2NQ7 A;  4IKT A;  4ZNG A;  2Q8K A;  2IW2 A;  4B28 A;  1YVM A;  3FM3 A;  4Z7M A;  2BN7 A;  2OKN A;  1PV9 A;  1C23 A;  4RZZ A;  5CDL A;  4ZWU A;  3IU8 A;  4U6W A;  3PKE A;  3S6B A;  2Q96 A;  2B3K A;  3ROR A;  4U1B A;  3IU7 A;  3IU9 A;  5JI6 A;  4FUK A;  1W2M A;  2BWT A;  3RVA A;  4IEC A;  2GU5 A;  3PKC A;  5CDE A;  1C22 A;  5CDV A;  1W7V A;  1XGM A;  2ZSG A;  3BIT A;  2GGB A;  4S2R P;  2BHA A;  2GG7 A;  4RZY A;  1XGN A;  2BH3 A;  4ZWO A;  1KQ0 A;  2BHD A;  3CB6 A;  2GZ5 A;  4U69 A;  4A6V A;  4A6W A;  3D27 A;  2EVO A;  5D6E A;  2HOW A;  2Q93 A;  3MX6 A;  1XNZ A;  3Q6D A;  4FLI A;  4IKS A;  4U76 A;  3FMQ A;  3MAT A;  1YJ3 A;  4U75 A;  2GG8 A;  3PKB A;  5JFR A;  2P9A A;  2G6P A;  4IDY A;  5CIK A;  2BWX A;  4OOK A;  4U73 A;  4S01 A;  4IF7 A;  2EA4 A;  4PV4 A;  1R5H A;  3CB5 A;  3L24 A;  3BIP A;  1WKM A;  1QXW A;  1XGO A;  1WBQ A;  2GG9 A;  5CLS A;  2BB7 A;  2B3H A;  4U6E A;  1BN5 A;  2GU4 A;  2GG0 A;  2BWU A;  2OAZ A;  4IU6 A;  5CNX A;  5E5B A;  2V3Z A;  1QZY A;  4FLL A;  3PKA A;  1C21 A;  1N51 A;  4U70 A;  3TB5 A;  4FO7 A;  2BHC A;  2GG2 A;  4PNC A;  2BWW A;  5CE6 A;  5FCF A;  2V3Y A;  2BWY A;  2DFI A;  4JUQ A;  4U71 A;  3BIQ A;  2Q92 A;  3FMR A;  1R58 A;  4U6C A;  1BOA A;  1R5G A;  1WN1 A;  2BWV A;  4FLK A;  2MAT A;  4IKR A;  4U6Z A;  1QXY A;  2BWS A;  4QR8 A;  4S00 A;  2GA2 A;  2BHB A;  4FLJ A;  4FO8 A;  1A16 A;  3L7G A;  4HXX A;  4R60 A;  1C24 A;  1CHM A;  2Q95 A;  1JAW A;  1MAT A;  1WY2 A;  5FCH A;  1WL6 A;  4KM3 A;  2P99 A;  1YW9 A;  3MR1 A;  2GG3 A;  2GU6 A;  4ZWP A;  2GG5 A;  4IKU A;  1Y1N A;  1C27 A;  2Q94 A; 
#chains in the Genus database with same CATH topology
 4RGZ 1;  1M35 A;  2P98 A;  2EA2 A;  1YW7 A;  4S2T P;  1KP0 A;  1XGS A;  2ADU A;  4MAT A;  2EVM A;  3CTZ A;  2GGC A;  2GU7 A;  4FKC A;  5D6F A;  2V3X A;  1YW8 A;  4U6J A;  3IG4 A;  1WL9 A;  3TAV A;  5JHU A;  1WLR A;  1B59 A;  4IPA A;  2EVC A;  2GTX A;  4EGE A;  1O0X A;  2B3L A;  2NQ6 A;  1QXZ A;  2V6C A;  1KQ9 A;  3PKD A;  1B6A A;  2NQ7 A;  4IKT A;  4ZNG A;  2Q8K A;  2IW2 A;  4B28 A;  1YVM A;  3FM3 A;  4Z7M A;  2BN7 A;  2OKN A;  1PV9 A;  1C23 A;  4RZZ A;  5CDL A;  4ZWU A;  3IU8 A;  4U6W A;  3PKE A;  3S6B A;  2Q96 A;  2B3K A;  3ROR A;  4U1B A;  3IU7 A;  3IU9 A;  5JI6 A;  4FUK A;  1W2M A;  2BWT A;  3RVA A;  4IEC A;  2GU5 A;  3PKC A;  5CDE A;  1C22 A;  5CDV A;  1W7V A;  1XGM A;  2ZSG A;  3BIT A;  2GGB A;  4S2R P;  2BHA A;  2GG7 A;  4RZY A;  1XGN A;  2BH3 A;  4ZWO A;  1KQ0 A;  2BHD A;  3CB6 A;  2GZ5 A;  4U69 A;  4A6V A;  4A6W A;  3D27 A;  2EVO A;  5D6E A;  2HOW A;  2Q93 A;  3MX6 A;  1XNZ A;  3Q6D A;  4FLI A;  4IKS A;  4U76 A;  3FMQ A;  3MAT A;  1YJ3 A;  4U75 A;  2GG8 A;  3PKB A;  5JFR A;  2P9A A;  2G6P A;  4IDY A;  5CIK A;  2BWX A;  4OOK A;  4U73 A;  4S01 A;  4IF7 A;  2EA4 A;  4PV4 A;  1R5H A;  3CB5 A;  3L24 A;  3BIP A;  1WKM A;  1QXW A;  1XGO A;  1WBQ A;  2GG9 A;  5CLS A;  2BB7 A;  2B3H A;  4U6E A;  1BN5 A;  2GU4 A;  2GG0 A;  2BWU A;  2OAZ A;  4IU6 A;  5CNX A;  5E5B A;  2V3Z A;  1QZY A;  4FLL A;  3PKA A;  1C21 A;  1N51 A;  4U70 A;  3TB5 A;  4FO7 A;  2BHC A;  2GG2 A;  4PNC A;  2BWW A;  5CE6 A;  5FCF A;  2V3Y A;  2BWY A;  2DFI A;  4JUQ A;  4U71 A;  3BIQ A;  2Q92 A;  3FMR A;  1R58 A;  4U6C A;  1BOA A;  1R5G A;  1WN1 A;  2BWV A;  4FLK A;  2MAT A;  4IKR A;  4U6Z A;  1QXY A;  2BWS A;  4QR8 A;  4S00 A;  2GA2 A;  2BHB A;  4FLJ A;  4FO8 A;  1A16 A;  3L7G A;  4HXX A;  4R60 A;  1C24 A;  1CHM A;  2Q95 A;  1JAW A;  1MAT A;  1WY2 A;  5FCH A;  1WL6 A;  4KM3 A;  2P99 A;  1YW9 A;  3MR1 A;  2GG3 A;  2GU6 A;  4ZWP A;  2GG5 A;  4IKU A;  1Y1N A;  1C27 A;  2Q94 A; 
#chains in the Genus database with same CATH homology
 4RGZ 1;  1M35 A;  2P98 A;  2EA2 A;  1YW7 A;  4S2T P;  1KP0 A;  1XGS A;  2ADU A;  4MAT A;  2EVM A;  3CTZ A;  2GGC A;  2GU7 A;  4FKC A;  5D6F A;  2V3X A;  1YW8 A;  4U6J A;  3IG4 A;  1WL9 A;  3TAV A;  5JHU A;  1WLR A;  1B59 A;  4IPA A;  2EVC A;  2GTX A;  4EGE A;  1O0X A;  2B3L A;  2NQ6 A;  1QXZ A;  2V6C A;  1KQ9 A;  3PKD A;  1B6A A;  2NQ7 A;  4IKT A;  4ZNG A;  2Q8K A;  2IW2 A;  4B28 A;  1YVM A;  3FM3 A;  4Z7M A;  2BN7 A;  2OKN A;  1PV9 A;  1C23 A;  4RZZ A;  5CDL A;  4ZWU A;  3IU8 A;  4U6W A;  3PKE A;  3S6B A;  2Q96 A;  2B3K A;  3ROR A;  4U1B A;  3IU7 A;  3IU9 A;  5JI6 A;  4FUK A;  1W2M A;  2BWT A;  3RVA A;  4IEC A;  2GU5 A;  3PKC A;  5CDE A;  1C22 A;  5CDV A;  1W7V A;  1XGM A;  2ZSG A;  3BIT A;  2GGB A;  4S2R P;  2BHA A;  2GG7 A;  4RZY A;  1XGN A;  2BH3 A;  4ZWO A;  1KQ0 A;  2BHD A;  3CB6 A;  2GZ5 A;  4U69 A;  4A6V A;  4A6W A;  3D27 A;  2EVO A;  5D6E A;  2HOW A;  2Q93 A;  3MX6 A;  1XNZ A;  3Q6D A;  4FLI A;  4IKS A;  4U76 A;  3FMQ A;  3MAT A;  1YJ3 A;  4U75 A;  2GG8 A;  3PKB A;  5JFR A;  2P9A A;  2G6P A;  4IDY A;  5CIK A;  2BWX A;  4OOK A;  4U73 A;  4S01 A;  4IF7 A;  2EA4 A;  4PV4 A;  1R5H A;  3CB5 A;  3L24 A;  3BIP A;  1WKM A;  1QXW A;  1XGO A;  1WBQ A;  2GG9 A;  5CLS A;  2BB7 A;  2B3H A;  4U6E A;  1BN5 A;  2GU4 A;  2GG0 A;  2BWU A;  2OAZ A;  4IU6 A;  5CNX A;  5E5B A;  2V3Z A;  1QZY A;  4FLL A;  3PKA A;  1C21 A;  1N51 A;  4U70 A;  3TB5 A;  4FO7 A;  2BHC A;  2GG2 A;  4PNC A;  2BWW A;  5CE6 A;  5FCF A;  2V3Y A;  2BWY A;  2DFI A;  4JUQ A;  4U71 A;  3BIQ A;  2Q92 A;  3FMR A;  1R58 A;  4U6C A;  1BOA A;  1R5G A;  1WN1 A;  2BWV A;  4FLK A;  2MAT A;  4IKR A;  4U6Z A;  1QXY A;  2BWS A;  4QR8 A;  4S00 A;  2GA2 A;  2BHB A;  4FLJ A;  4FO8 A;  1A16 A;  3L7G A;  4HXX A;  4R60 A;  1C24 A;  1CHM A;  2Q95 A;  1JAW A;  1MAT A;  1WY2 A;  5FCH A;  1WL6 A;  4KM3 A;  2P99 A;  1YW9 A;  3MR1 A;  2GG3 A;  2GU6 A;  4ZWP A;  2GG5 A;  4IKU A;  1Y1N A;  1C27 A;  2Q94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...