4Z7MA

Novel inhibitors of bacterial methionine aminopeptidase with broad-spectrum biochemical activity
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Novel Inhibitors of Bacterial Methionine Aminopeptidase with Broad-Spectrum Biochemical Activity
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4z7mA00
1W7VA 2P98A 2Q95A 3S6BA 2B3KA 2GGCA 1C27A 2EA4A 4S2TP 4A6VA 5CLSA 5CDVA 2IW2A 3PKBA 2V3ZA 4ZNGA 2MATA 4Z7MA 4IF7A 1C21A 1YVMA 2BHAA 2DFIA 2BWUA 4RGZ1 4ZWOA 4QR8A 3PKEA 4S00A 2BWVA 3MX6A 2Q93A 4U6CA 4RZYA 4U76A 2BWSA 2OAZA 4FUKA 4U6ZA 1BN5A 5JI6A 2Q8KA 2BWXA 4JUQA 1YW7A 2EA2A 3CB6A 2GU5A 2V6CA 4U70A 2GG9A 3IU7A 1QXYA 3L7GA 3RORA 1XGMA 5FCHA 2BHBA 3FMRA 2NQ6A 3TAVA 3RVAA 5CDLA 1JAWA 4U6JA 1Y1NA 2BWYA 4U6WA 4EGEA 2BB7A 1N51A 4FO8A 2GG7A 4U6EA 2ADUA 2GG8A 2Q96A 2BWWA 1B6AA 3BITA 4U71A 4IKTA 5D6EA 2P99A 1M35A 1WL9A 4FLLA 3FMQA 2EVMA 5CNXA 1YW8A 1BOAA 1C23A 1KQ0A 4U69A 4IECA 4OOKA 3PKCA 5CE6A 1O0XA 3CTZA 4U73A 2G6PA 5CDEA 2Q92A 3BIPA 4HXXA 4IDYA 4S01A 4IKUA 3IU9A 1XGNA 5CIKA 2GA2A 5E5BA 4IKRA 2NQ7A 4FLJA 2P9AA 4S2RP 1WL6A 1XGOA 1XNZA 2GU6A 3CB5A 5FCFA 2GGBA 4PV4A 3BIQA 3FM3A 1WBQA 1C22A 1R58A 4FLKA 1YJ3A 3PKAA 4KM3A 2V3XA 1XGSA 5JHUA 1QXZA 3Q6DA 2EVCA 4IPAA 4ZWPA 1A16A 5D6FA 4ZWUA 2HOWA 2BHDA 4R60A 1KQ9A 3PKDA 4MATA 4RZZA 2OKNA 2BN7A 3IU8A 1WLRA 1WKMA 1YW9A 2GU7A 3L24A 2GTXA 3MATA 2BWTA 2GG2A 2B3LA 4IKSA 3D27A 4PNCA 4FLIA 1C24A 4FKCA 4U1BA 2GG3A 2GG0A 1WN1A 1CHMA 2GZ5A 2V3YA 1R5HA 4U75A 2GU4A 1R5GA 2GG5A 2BHCA 1PV9A 3MR1A 1QZYA 2Q94A 1MATA 1WY2A 2EVOA 4IU6A 2ZSGA 4A6WA 4B28A 1W2MA 3IG4A 5JFRA 3TB5A 1KP0A 4FO7A 1QXWA 1B59A 2B3HA 2BH3A
chains in the Genus database with same CATH superfamily
1W7VA 2P98A 2Q95A 3S6BA 2B3KA 2GGCA 1C27A 2EA4A 4S2TP 4A6VA 5CLSA 5CDVA 2IW2A 3PKBA 2V3ZA 4ZNGA 2MATA 4Z7MA 4IF7A 1C21A 1YVMA 2BHAA 2DFIA 2BWUA 4RGZ1 4ZWOA 4QR8A 3PKEA 4S00A 2BWVA 3MX6A 2Q93A 4U6CA 4RZYA 4U76A 2BWSA 2OAZA 4FUKA 4U6ZA 1BN5A 5JI6A 2Q8KA 2BWXA 4JUQA 1YW7A 2EA2A 3CB6A 2GU5A 2V6CA 4U70A 2GG9A 3IU7A 1QXYA 3L7GA 3RORA 1XGMA 5FCHA 2BHBA 3FMRA 2NQ6A 3TAVA 3RVAA 5CDLA 1JAWA 4U6JA 1Y1NA 2BWYA 4U6WA 4EGEA 2BB7A 1N51A 4FO8A 2GG7A 4U6EA 2ADUA 2GG8A 2Q96A 2BWWA 1B6AA 3BITA 4U71A 4IKTA 5D6EA 2P99A 1M35A 1WL9A 4FLLA 3FMQA 2EVMA 5CNXA 1YW8A 1BOAA 1C23A 1KQ0A 4U69A 4IECA 4OOKA 3PKCA 5CE6A 1O0XA 3CTZA 4U73A 2G6PA 5CDEA 2Q92A 3BIPA 4HXXA 4IDYA 4S01A 4IKUA 3IU9A 1XGNA 5CIKA 2GA2A 5E5BA 4IKRA 2NQ7A 4FLJA 2P9AA 4S2RP 1WL6A 1XGOA 1XNZA 2GU6A 3CB5A 5FCFA 2GGBA 4PV4A 3BIQA 3FM3A 1WBQA 1C22A 1R58A 4FLKA 1YJ3A 3PKAA 4KM3A 2V3XA 1XGSA 5JHUA 1QXZA 3Q6DA 2EVCA 4IPAA 4ZWPA 1A16A 5D6FA 4ZWUA 2HOWA 2BHDA 4R60A 1KQ9A 3PKDA 4MATA 4RZZA 2OKNA 2BN7A 3IU8A 1WLRA 1WKMA 1YW9A 2GU7A 3L24A 2GTXA 3MATA 2BWTA 2GG2A 2B3LA 4IKSA 3D27A 4PNCA 4FLIA 1C24A 4FKCA 4U1BA 2GG3A 2GG0A 1WN1A 1CHMA 2GZ5A 2V3YA 1R5HA 4U75A 2GU4A 1R5GA 2GG5A 2BHCA 1PV9A 3MR1A 1QZYA 2Q94A 1MATA 1WY2A 2EVOA 4IU6A 2ZSGA 4A6WA 4B28A 1W2MA 3IG4A 5JFRA 3TB5A 1KP0A 4FO7A 1QXWA 1B59A 2B3HA 2BH3A
chains in the Genus database with same CATH topology
1W7VA 2P98A 2Q95A 3S6BA 2B3KA 2GGCA 1C27A 2EA4A 4S2TP 4A6VA 5CLSA 5CDVA 2IW2A 3PKBA 2V3ZA 4ZNGA 2MATA 4Z7MA 4IF7A 1C21A 1YVMA 2BHAA 2DFIA 2BWUA 4RGZ1 4ZWOA 4QR8A 3PKEA 4S00A 2BWVA 3MX6A 2Q93A 4U6CA 4RZYA 4U76A 2BWSA 2OAZA 4FUKA 4U6ZA 1BN5A 5JI6A 2Q8KA 2BWXA 4JUQA 1YW7A 2EA2A 3CB6A 2GU5A 2V6CA 4U70A 2GG9A 3IU7A 1QXYA 3L7GA 3RORA 1XGMA 5FCHA 2BHBA 3FMRA 2NQ6A 3TAVA 3RVAA 5CDLA 1JAWA 4U6JA 1Y1NA 2BWYA 4U6WA 4EGEA 2BB7A 1N51A 4FO8A 2GG7A 4U6EA 2ADUA 2GG8A 2Q96A 2BWWA 1B6AA 3BITA 4U71A 4IKTA 5D6EA 2P99A 1M35A 1WL9A 4FLLA 3FMQA 2EVMA 5CNXA 1YW8A 1BOAA 1C23A 1KQ0A 4U69A 4IECA 4OOKA 3PKCA 5CE6A 1O0XA 3CTZA 4U73A 2G6PA 5CDEA 2Q92A 3BIPA 4HXXA 4IDYA 4S01A 4IKUA 3IU9A 1XGNA 5CIKA 2GA2A 5E5BA 4IKRA 2NQ7A 4FLJA 2P9AA 4S2RP 1WL6A 1XGOA 1XNZA 2GU6A 3CB5A 5FCFA 2GGBA 4PV4A 3BIQA 3FM3A 1WBQA 1C22A 1R58A 4FLKA 1YJ3A 3PKAA 4KM3A 2V3XA 1XGSA 5JHUA 1QXZA 3Q6DA 2EVCA 4IPAA 4ZWPA 1A16A 5D6FA 4ZWUA 2HOWA 2BHDA 4R60A 1KQ9A 3PKDA 4MATA 4RZZA 2OKNA 2BN7A 3IU8A 1WLRA 1WKMA 1YW9A 2GU7A 3L24A 2GTXA 3MATA 2BWTA 2GG2A 2B3LA 4IKSA 3D27A 4PNCA 4FLIA 1C24A 4FKCA 4U1BA 2GG3A 2GG0A 1WN1A 1CHMA 2GZ5A 2V3YA 1R5HA 4U75A 2GU4A 1R5GA 2GG5A 2BHCA 1PV9A 3MR1A 1QZYA 2Q94A 1MATA 1WY2A 2EVOA 4IU6A 2ZSGA 4A6WA 4B28A 1W2MA 3IG4A 5JFRA 3TB5A 1KP0A 4FO7A 1QXWA 1B59A 2B3HA 2BH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7V A;  2P98 A;  2Q95 A;  3S6B A;  2B3K A;  2GGC A;  1C27 A;  2EA4 A;  4S2T P;  4A6V A;  5CLS A;  5CDV A;  2IW2 A;  3PKB A;  2V3Z A;  4ZNG A;  2MAT A;  4Z7M A;  4IF7 A;  1C21 A;  1YVM A;  2BHA A;  2DFI A;  2BWU A;  4RGZ 1;  4ZWO A;  4QR8 A;  3PKE A;  4S00 A;  2BWV A;  3MX6 A;  2Q93 A;  4U6C A;  4RZY A;  4U76 A;  2BWS A;  2OAZ A;  4FUK A;  4U6Z A;  1BN5 A;  5JI6 A;  2Q8K A;  2BWX A;  4JUQ A;  1YW7 A;  2EA2 A;  3CB6 A;  2GU5 A;  2V6C A;  4U70 A;  2GG9 A;  3IU7 A;  1QXY A;  3L7G A;  3ROR A;  1XGM A;  5FCH A;  2BHB A;  3FMR A;  2NQ6 A;  3TAV A;  3RVA A;  5CDL A;  1JAW A;  4U6J A;  1Y1N A;  2BWY A;  4U6W A;  4EGE A;  2BB7 A;  1N51 A;  4FO8 A;  2GG7 A;  4U6E A;  2ADU A;  2GG8 A;  2Q96 A;  2BWW A;  1B6A A;  3BIT A;  4U71 A;  4IKT A;  5D6E A;  2P99 A;  1M35 A;  1WL9 A;  4FLL A;  3FMQ A;  2EVM A;  5CNX A;  1YW8 A;  1BOA A;  1C23 A;  1KQ0 A;  4U69 A;  4IEC A;  4OOK A;  3PKC A;  5CE6 A;  1O0X A;  3CTZ A;  4U73 A;  2G6P A;  5CDE A;  2Q92 A;  3BIP A;  4HXX A;  4IDY A;  4S01 A;  4IKU A;  3IU9 A;  1XGN A;  5CIK A;  2GA2 A;  5E5B A;  4IKR A;  2NQ7 A;  4FLJ A;  2P9A A;  4S2R P;  1WL6 A;  1XGO A;  1XNZ A;  2GU6 A;  3CB5 A;  5FCF A;  2GGB A;  4PV4 A;  3BIQ A;  3FM3 A;  1WBQ A;  1C22 A;  1R58 A;  4FLK A;  1YJ3 A;  3PKA A;  4KM3 A;  2V3X A;  1XGS A;  5JHU A;  1QXZ A;  3Q6D A;  2EVC A;  4IPA A;  4ZWP A;  1A16 A;  5D6F A;  4ZWU A;  2HOW A;  2BHD A;  4R60 A;  1KQ9 A;  3PKD A;  4MAT A;  4RZZ A;  2OKN A;  2BN7 A;  3IU8 A;  1WLR A;  1WKM A;  1YW9 A;  2GU7 A;  3L24 A;  2GTX A;  3MAT A;  2BWT A;  2GG2 A;  2B3L A;  4IKS A;  3D27 A;  4PNC A;  4FLI A;  1C24 A;  4FKC A;  4U1B A;  2GG3 A;  2GG0 A;  1WN1 A;  1CHM A;  2GZ5 A;  2V3Y A;  1R5H A;  4U75 A;  2GU4 A;  1R5G A;  2GG5 A;  2BHC A;  1PV9 A;  3MR1 A;  1QZY A;  2Q94 A;  1MAT A;  1WY2 A;  2EVO A;  4IU6 A;  2ZSG A;  4A6W A;  4B28 A;  1W2M A;  3IG4 A;  5JFR A;  3TB5 A;  1KP0 A;  4FO7 A;  1QXW A;  1B59 A;  2B3H A;  2BH3 A; 
#chains in the Genus database with same CATH topology
 1W7V A;  2P98 A;  2Q95 A;  3S6B A;  2B3K A;  2GGC A;  1C27 A;  2EA4 A;  4S2T P;  4A6V A;  5CLS A;  5CDV A;  2IW2 A;  3PKB A;  2V3Z A;  4ZNG A;  2MAT A;  4Z7M A;  4IF7 A;  1C21 A;  1YVM A;  2BHA A;  2DFI A;  2BWU A;  4RGZ 1;  4ZWO A;  4QR8 A;  3PKE A;  4S00 A;  2BWV A;  3MX6 A;  2Q93 A;  4U6C A;  4RZY A;  4U76 A;  2BWS A;  2OAZ A;  4FUK A;  4U6Z A;  1BN5 A;  5JI6 A;  2Q8K A;  2BWX A;  4JUQ A;  1YW7 A;  2EA2 A;  3CB6 A;  2GU5 A;  2V6C A;  4U70 A;  2GG9 A;  3IU7 A;  1QXY A;  3L7G A;  3ROR A;  1XGM A;  5FCH A;  2BHB A;  3FMR A;  2NQ6 A;  3TAV A;  3RVA A;  5CDL A;  1JAW A;  4U6J A;  1Y1N A;  2BWY A;  4U6W A;  4EGE A;  2BB7 A;  1N51 A;  4FO8 A;  2GG7 A;  4U6E A;  2ADU A;  2GG8 A;  2Q96 A;  2BWW A;  1B6A A;  3BIT A;  4U71 A;  4IKT A;  5D6E A;  2P99 A;  1M35 A;  1WL9 A;  4FLL A;  3FMQ A;  2EVM A;  5CNX A;  1YW8 A;  1BOA A;  1C23 A;  1KQ0 A;  4U69 A;  4IEC A;  4OOK A;  3PKC A;  5CE6 A;  1O0X A;  3CTZ A;  4U73 A;  2G6P A;  5CDE A;  2Q92 A;  3BIP A;  4HXX A;  4IDY A;  4S01 A;  4IKU A;  3IU9 A;  1XGN A;  5CIK A;  2GA2 A;  5E5B A;  4IKR A;  2NQ7 A;  4FLJ A;  2P9A A;  4S2R P;  1WL6 A;  1XGO A;  1XNZ A;  2GU6 A;  3CB5 A;  5FCF A;  2GGB A;  4PV4 A;  3BIQ A;  3FM3 A;  1WBQ A;  1C22 A;  1R58 A;  4FLK A;  1YJ3 A;  3PKA A;  4KM3 A;  2V3X A;  1XGS A;  5JHU A;  1QXZ A;  3Q6D A;  2EVC A;  4IPA A;  4ZWP A;  1A16 A;  5D6F A;  4ZWU A;  2HOW A;  2BHD A;  4R60 A;  1KQ9 A;  3PKD A;  4MAT A;  4RZZ A;  2OKN A;  2BN7 A;  3IU8 A;  1WLR A;  1WKM A;  1YW9 A;  2GU7 A;  3L24 A;  2GTX A;  3MAT A;  2BWT A;  2GG2 A;  2B3L A;  4IKS A;  3D27 A;  4PNC A;  4FLI A;  1C24 A;  4FKC A;  4U1B A;  2GG3 A;  2GG0 A;  1WN1 A;  1CHM A;  2GZ5 A;  2V3Y A;  1R5H A;  4U75 A;  2GU4 A;  1R5G A;  2GG5 A;  2BHC A;  1PV9 A;  3MR1 A;  1QZY A;  2Q94 A;  1MAT A;  1WY2 A;  2EVO A;  4IU6 A;  2ZSG A;  4A6W A;  4B28 A;  1W2M A;  3IG4 A;  5JFR A;  3TB5 A;  1KP0 A;  4FO7 A;  1QXW A;  1B59 A;  2B3H A;  2BH3 A; 
#chains in the Genus database with same CATH homology
 1W7V A;  2P98 A;  2Q95 A;  3S6B A;  2B3K A;  2GGC A;  1C27 A;  2EA4 A;  4S2T P;  4A6V A;  5CLS A;  5CDV A;  2IW2 A;  3PKB A;  2V3Z A;  4ZNG A;  2MAT A;  4Z7M A;  4IF7 A;  1C21 A;  1YVM A;  2BHA A;  2DFI A;  2BWU A;  4RGZ 1;  4ZWO A;  4QR8 A;  3PKE A;  4S00 A;  2BWV A;  3MX6 A;  2Q93 A;  4U6C A;  4RZY A;  4U76 A;  2BWS A;  2OAZ A;  4FUK A;  4U6Z A;  1BN5 A;  5JI6 A;  2Q8K A;  2BWX A;  4JUQ A;  1YW7 A;  2EA2 A;  3CB6 A;  2GU5 A;  2V6C A;  4U70 A;  2GG9 A;  3IU7 A;  1QXY A;  3L7G A;  3ROR A;  1XGM A;  5FCH A;  2BHB A;  3FMR A;  2NQ6 A;  3TAV A;  3RVA A;  5CDL A;  1JAW A;  4U6J A;  1Y1N A;  2BWY A;  4U6W A;  4EGE A;  2BB7 A;  1N51 A;  4FO8 A;  2GG7 A;  4U6E A;  2ADU A;  2GG8 A;  2Q96 A;  2BWW A;  1B6A A;  3BIT A;  4U71 A;  4IKT A;  5D6E A;  2P99 A;  1M35 A;  1WL9 A;  4FLL A;  3FMQ A;  2EVM A;  5CNX A;  1YW8 A;  1BOA A;  1C23 A;  1KQ0 A;  4U69 A;  4IEC A;  4OOK A;  3PKC A;  5CE6 A;  1O0X A;  3CTZ A;  4U73 A;  2G6P A;  5CDE A;  2Q92 A;  3BIP A;  4HXX A;  4IDY A;  4S01 A;  4IKU A;  3IU9 A;  1XGN A;  5CIK A;  2GA2 A;  5E5B A;  4IKR A;  2NQ7 A;  4FLJ A;  2P9A A;  4S2R P;  1WL6 A;  1XGO A;  1XNZ A;  2GU6 A;  3CB5 A;  5FCF A;  2GGB A;  4PV4 A;  3BIQ A;  3FM3 A;  1WBQ A;  1C22 A;  1R58 A;  4FLK A;  1YJ3 A;  3PKA A;  4KM3 A;  2V3X A;  1XGS A;  5JHU A;  1QXZ A;  3Q6D A;  2EVC A;  4IPA A;  4ZWP A;  1A16 A;  5D6F A;  4ZWU A;  2HOW A;  2BHD A;  4R60 A;  1KQ9 A;  3PKD A;  4MAT A;  4RZZ A;  2OKN A;  2BN7 A;  3IU8 A;  1WLR A;  1WKM A;  1YW9 A;  2GU7 A;  3L24 A;  2GTX A;  3MAT A;  2BWT A;  2GG2 A;  2B3L A;  4IKS A;  3D27 A;  4PNC A;  4FLI A;  1C24 A;  4FKC A;  4U1B A;  2GG3 A;  2GG0 A;  1WN1 A;  1CHM A;  2GZ5 A;  2V3Y A;  1R5H A;  4U75 A;  2GU4 A;  1R5G A;  2GG5 A;  2BHC A;  1PV9 A;  3MR1 A;  1QZY A;  2Q94 A;  1MAT A;  1WY2 A;  2EVO A;  4IU6 A;  2ZSG A;  4A6W A;  4B28 A;  1W2M A;  3IG4 A;  5JFR A;  3TB5 A;  1KP0 A;  4FO7 A;  1QXW A;  1B59 A;  2B3H A;  2BH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...