4Z7NA

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 104
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4z7nA00
5E6UA 3VI3A 4O02A 3FCSA 5HDBA 3IJEA 4WK0A 4WK2A 3ZE1A 5E6SA 4MMXA 4NENA 3NIFA 2VDQA 4G1EA 4MMYA 3ZDZA 4Z7NA 2VDPA 5FFOA 2VDRA 1TYEA 3K6SA 1M1XA 3NIGA 4UM8A 3K72A 3NIDA 4UM9A 3T3PA 3V4PA 5FFGA 3ZE0A 3ZDXA 2VDMA 4WK4A 4IRZA 4MMZA 1JV2A 2VDKA 1U8CA 2VDNA 2VDLA 3T3MA 2VC2A 4G1MA 3ZE2A 1L5GA 5E6RA 3V4VA 2VDOA 4WJKA 4Z7OA 3FCUA 3ZDYA 3K71A 4Z7QA 3VI4A
chains in the Genus database with same CATH superfamily
1VZ3A 1GOTB 3RN1D 2IURA 2HU7A 4D9SA 4BP9A 5GMKn 4I79A 4PC0A 1P22A 3SXTD 2H6NA 2CN3A 4GM8A 3AFCA 2HU5A 3V4PA 5HE0B 2QR5A 1JV2A 3T3MA 2OVPB 5C2VB 3JZHA 4DNUA 3EQ8A 4KFMB 3RFHA 3BG1A 3DWLC 4FB1D 2H9MA 3O4IA 4QAMA 4JSPC 2EIEA 1JJUB 1N6FA 3L4MD 4CY3A 2YMUA 2XU7A 3JROA 1Q47A 1B9YA 5IT9g 3ZE1A 2P9LC 2VDQA 3QI0A 1NEXB 2IUPA 3GFCA 1VYHC 3JPXA 3V5WB 4OWRA 5M5SA 4J0WA 4A0BA 1JTDB 4XYIA 2GC4A 2YNNA 1O6FA 2J56H 2XL2A 4E5ZA 5EMJB 2XZGA 2VDLA 5FLXg 1QFMA 4CZXA 3MUOA 2G9AA 3SJLD 1PEVA 4WJKA 3SBQA 1H2ZA 3SHFA 4J8GA 3IURA 1UOQA 3FRXA 4R7AB 4NC4A 4E54B 2BKLA 3AL8A 4PBZA 4Y5RD 3N0DA 2CO0A 1TYQC 4GZ8A 2B4EA 3MZKA 3U4YA 3IJ1A 5HQGA 1H2XA 4FA4D 3NIDA 4UM9A 3P4FA 3ZDXA 3OKWA 2GC7A 2OVRB 4MMZA 4ZN4A 4CI1A 1FWXA 3EI3B 5TDHB 4ZOVA 2YBAA 1K32A 3UVMA 2QC5A 3CFVA 3ODTA 3I7LA 1UTCA 4Z7QA 5E6UA 4ERQA 2I0TA 1YR2A 5EAMA 4BCCA 4UI9R 1VZ2A 3O4HA 3EI2B 1GOHA 3FM0A 3SWSD 1I2MB 1XKSA 4EWRA 3K6SA 4E54A 1QNIA 1MG3A 5JWZA 3AL9A 5FFGA 3ZE0A 4PBYA 4CC9A 5IC7A 5M5TA 5TEFA 3UR4A 4GMBA 2IAAA 3KRWB 2AH1A 1L5GA 5E6RA 2CN2A 3K27A 5CXBA 3V4VA 4J79A 5TEEA 3E0CA 4AMZA 3UKRC 2AQ5A 3UVOA 3F3GA 3I7NA 4GGDA 1UOOA 2AGWA 3SFZA 4FA9D 4WK0A 3MKQA 4FAND 3DXKC 3NIFA 4L1QD 1S4UX 2Z2PA 4A7JA 4BH6A 2BBKH 3CFSB 4TZ4A 2H9NA 5K1CC 3DSMA 5I5IA 1UOPA 4J77A 1MDAH 2VDNA 4H5IA 3OKTA 3IUJA 3GREA 3JAMg 1XIPA 4X60B 3FCUA 1PI6A 4O3TB 5EARA 1O6GA 4NBMA 1C9IA 2P9UC 3UVKA 3MUNA 3B7FA 4L9OA 4CY1A 4AN1A 2HESX 3F3PA 1E5TA 1GXRA 4JT5C 3VA6A 4E5ZB 2HKMA 2OIZA 5CYKA 5AFU3 4GGAA 3NVNA 5C2WB 5FKTA 4XEIC 1NR0A 5EM2A 4FAVD 1E8NA 4O2WA 2O9KA 4IA9A 5A2Qg 3C5MA 3JZGA 2H6KA 4GQ1A 5EMLB 1GOFA 5M5UA 2EBSA 4D0KA 3OL2B 3FCSA 2CE8A 5M5RA 4MMXA 3PE7A 2AGLA 2OK6A 2OJYA 4GM9A 3OTTA 4BP8A 3OW8A 5FKQA 3T3PA 5K19A 5AMSA 4X61B 4K3ID 4LG9A 4A09B 4A2LA 4O3UB 5C92A 4JHPC 2VDOA 4PSXB 4FWWA 4CI8A 3J80g 3I7OA 5EM2B 2AGXA 4J81A 2Q7QA 2IWKA 4PNKB 4WK2A 1R5MA 1QFSA 1OMWB 1T2XA 3PSLA 3BG0A 3KRXB 1GOGA 2VDPA 3EMHA 4J73A 2H6QA 5IGQA 1L0QA 2AGZA 3EQ9A 3NVQA 3IVMA 4D6VA 3EU7A 2MTAH 3PXSD 4Y7RA 5HE3B 3K26A 3V7DB 4LGNA 3EG6A 2PM9A 2EIBA 4JT6C 4CI2A 2HJBA 1K3IA 4ERZA 4G1MA 3I7HA 4GQ2P 3GD1I 2OVQB 1SHYB 3VI3A 4MK0B 4H5JA 1ERJA 3IJEA 2HJ4A 2VZ1A 1A12A 2AH0A 3BWSA 3OKYB 3PSCB 2H14A 5HE1B 4Z7NA 2VDRA 4JSXC 2VZ3A 4UM8A 3C99A 1N6EA 4XYHA 4DNVA 5TF2A 3UKUC 3N0EA 5H17A 3EI3A 4A08B 2YB8B 5CXBB 2J57G 2TRCB 2XL3A 1JMXB 2PM9B 4ERYA 3EWEA 2CO0C 4U7AA 4BUJC 4ESGA 4O02A 1VE7A 3MMYA 5M61A 3RMZD 3IIWA 4NENA 3ZDZA 3EI2A 3AH8B 4CZVA 2EICA 4FA5D 5HE2B 3O4JA 3ULEC 3AL8B 3NIGA 5I5JA 2XYIA 2Z2OA 3IULA 3V9FA 4O1QD 3J81g 4A08A 3GC3B 3IJ0A 5CXCB 4ES0A 3DDUA 4G56B 3IUQA 4A0AA 4BCBA 4CY5A 1GP2B 5IJ8E 3IJCA 5GXIA 4ZOZA 3UVLA 5FKRA 2GNQA 1TYEA 1U2VC 2P9SC 3PVWB 1E8MA 2IUVA 4N14A 5FKSA 3MVDK 4WK4A 1YFQA 2VDKA 1U8CA 4IMMA 1B9XA 3I8EA 4CY2A 3I7KA 1K8KC 4JD2C 4L3HD 1PGUA 3A0FA 5KDOB 3MKSB 4CZYA 5GSAA 3K71A 4JSNC 5I5MA 1BPOA 3ORVD 2EIDA 4JXMA 2IWFA 4AOWA 3I7PA 3PXWD 2AGYA 2WQ8A 1N6DA 4OZUA 2J55H 4YVDA 5SXMA 3IUMA 2YNPA 5CYKB 3I8CA 4GM3A 4J78A 4Z8LA 4AEZA 5IJ7E 4L3GD 3RRMC 3EI4B 3JZNA 4QRJA 2P9NC 3QHYB 3ZE2A 1A0RB 4GQBB 1H2WA 2I3TA 3OF7A 3KCIA 3ZDYA 4BCDA 2B5MA 3OL2A 3C9CA 5FQDA 3L4OD 3VGZA 5EMKB 4QQEA 3DM0A 1U4CA 3MZLA 5HDBA 2BCJB 2Z2NA 3JRPA 4A2MA 3SN6B 4DNWA 2I3SA 3PXTD 2B5LA 4A11B 4A11A 4PXWA 2H47A 1XHMA 2HXCA 2H68A 3CIKB 2XE4A 2H3XA 5GXHA 4JSVC 4X3EA 2VDMA 4IRZA 2I0SA 1JOFA 2B5NA 5IGOA 5H1MA 2PM6B 3EQ7A 3NVXA 4X63B 4FHLA 4A09A 3JB9L 1RI6A 3EI4A 1C9LA 2UZYB 5EALA 4ZOYA 3SLED 2H9PA 4O9DA 5M5VA 3UVNA 3ZWLB 4ZOXA 4LG8A 4AMYA 4G1EA 4NAAA 3RN0D 5EAPA 3DXMC 1M1XA 3IKOA 5B4WA 5EMMB 2P9PC 3F3FA 4BL0A 3RSEC 3W15A 2CNXA 3I89A 2HKRA 5CXCA 5AJAA 1PBYB 4A0BB 1TBGA 4JHNA 2CE9A 2P9KC 4O45A 1OLZA 4PSWB 4Z7OA 2QZPA 3VH0A 1JMZB 4J82A 1H2YA 2H9LA 4G55A 2HYEA 3SVWD 4J84A 5E6SA 3OKYA 2OK4A 3IUNA 2UZXB 2G99A 3MXXA 1SQ9A 2JKXA 4L1MA 5HYNB 3EI1B 2YNOA 3O4GA 3SMRA 2HU8A 4NSXA 3FGBA 4J0XA 3SCYA 1GG2B 2I0RA 2PM7B 1MG2A 3IIYA 2W18A 4QT8A 4U1EI 1VE6A 4J8BA 2QXVA 4MMYA 4RE6A 5C86A 1SQJA 5FFOA 5THAA 4HDJA 3RLMD 4QL1A 4K3JB 4GGCA 3HFQA 4FA1D 3K72A 2PBIB 3SBPA 4CI3A 3EI1A 2XDWA 5H14A 3RFGA 3I2NA 2VC2A 4AX4A 2P9IC 5FA5B 5FXYA 2H13A 3PVUB 3C75H 2IUQA 4RE5A 3SBRA 5C9ZB 4J86A 4A0AB 4J87A 4AN0A 3VI4A
chains in the Genus database with same CATH topology
5E6UA 3VI3A 4O02A 3FCSA 5HDBA 3IJEA 4WK0A 4WK2A 3ZE1A 5E6SA 4MMXA 4NENA 3NIFA 2VDQA 4G1EA 4MMYA 3ZDZA 4Z7NA 2VDPA 5FFOA 2VDRA 1TYEA 3K6SA 1M1XA 3NIGA 4UM8A 3K72A 3NIDA 4UM9A 3T3PA 3V4PA 5FFGA 3ZE0A 3ZDXA 2VDMA 4WK4A 4IRZA 4MMZA 1JV2A 2VDKA 1U8CA 2VDNA 2VDLA 3T3MA 2VC2A 4G1MA 3ZE2A 1L5GA 5E6RA 3V4VA 2VDOA 4WJKA 4Z7OA 3FCUA 3ZDYA 3K71A 4Z7QA 3VI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6U A;  3VI3 A;  4O02 A;  3FCS A;  5HDB A;  3IJE A;  4WK0 A;  4WK2 A;  3ZE1 A;  5E6S A;  4MMX A;  4NEN A;  3NIF A;  2VDQ A;  4G1E A;  4MMY A;  3ZDZ A;  4Z7N A;  2VDP A;  5FFO A;  2VDR A;  1TYE A;  3K6S A;  1M1X A;  3NIG A;  4UM8 A;  3K72 A;  3NID A;  4UM9 A;  3T3P A;  3V4P A;  5FFG A;  3ZE0 A;  3ZDX A;  2VDM A;  4WK4 A;  4IRZ A;  4MMZ A;  1JV2 A;  2VDK A;  1U8C A;  2VDN A;  2VDL A;  3T3M A;  2VC2 A;  4G1M A;  3ZE2 A;  1L5G A;  5E6R A;  3V4V A;  2VDO A;  4WJK A;  4Z7O A;  3FCU A;  3ZDY A;  3K71 A;  4Z7Q A;  3VI4 A; 
#chains in the Genus database with same CATH topology
 1VZ3 A;  1GOT B;  3RN1 D;  2IUR A;  2HU7 A;  4D9S A;  4BP9 A;  5GMK n;  4I79 A;  4PC0 A;  1P22 A;  3SXT D;  2H6N A;  2CN3 A;  4GM8 A;  3AFC A;  2HU5 A;  3V4P A;  5HE0 B;  2QR5 A;  1JV2 A;  3T3M A;  2OVP B;  5C2V B;  3JZH A;  4DNU A;  3EQ8 A;  4KFM B;  3RFH A;  3BG1 A;  3DWL C;  4FB1 D;  2H9M A;  3O4I A;  4QAM A;  4JSP C;  2EIE A;  1JJU B;  1N6F A;  3L4M D;  4CY3 A;  2YMU A;  2XU7 A;  3JRO A;  1Q47 A;  1B9Y A;  5IT9 g;  3ZE1 A;  2P9L C;  2VDQ A;  3QI0 A;  1NEX B;  2IUP A;  3GFC A;  1VYH C;  3JPX A;  3V5W B;  4OWR A;  5M5S A;  4J0W A;  4A0B A;  1JTD B;  4XYI A;  2GC4 A;  2YNN A;  1O6F A;  2J56 H;  2XL2 A;  4E5Z A;  5EMJ B;  2XZG A;  2VDL A;  5FLX g;  1QFM A;  4CZX A;  3MUO A;  2G9A A;  3SJL D;  1PEV A;  4WJK A;  3SBQ A;  1H2Z A;  3SHF A;  4J8G A;  3IUR A;  1UOQ A;  3FRX A;  4R7A B;  4NC4 A;  4E54 B;  2BKL A;  3AL8 A;  4PBZ A;  4Y5R D;  3N0D A;  2CO0 A;  1TYQ C;  4GZ8 A;  2B4E A;  3MZK A;  3U4Y A;  3IJ1 A;  5HQG A;  1H2X A;  4FA4 D;  3NID A;  4UM9 A;  3P4F A;  3ZDX A;  3OKW A;  2GC7 A;  2OVR B;  4MMZ A;  4ZN4 A;  4CI1 A;  1FWX A;  3EI3 B;  5TDH B;  4ZOV A;  2YBA A;  1K32 A;  3UVM A;  2QC5 A;  3CFV A;  3ODT A;  3I7L A;  1UTC A;  4Z7Q A;  5E6U A;  4ERQ A;  2I0T A;  1YR2 A;  5EAM A;  4BCC A;  4UI9 R;  1VZ2 A;  3O4H A;  3EI2 B;  1GOH A;  3FM0 A;  3SWS D;  1I2M B;  1XKS A;  4EWR A;  3K6S A;  4E54 A;  1QNI A;  1MG3 A;  5JWZ A;  3AL9 A;  5FFG A;  3ZE0 A;  4PBY A;  4CC9 A;  5IC7 A;  5M5T A;  5TEF A;  3UR4 A;  4GMB A;  2IAA A;  3KRW B;  2AH1 A;  1L5G A;  5E6R A;  2CN2 A;  3K27 A;  5CXB A;  3V4V A;  4J79 A;  5TEE A;  3E0C A;  4AMZ A;  3UKR C;  2AQ5 A;  3UVO A;  3F3G A;  3I7N A;  4GGD A;  1UOO A;  2AGW A;  3SFZ A;  4FA9 D;  4WK0 A;  3MKQ A;  4FAN D;  3DXK C;  3NIF A;  4L1Q D;  1S4U X;  2Z2P A;  4A7J A;  4BH6 A;  2BBK H;  3CFS B;  4TZ4 A;  2H9N A;  5K1C C;  3DSM A;  5I5I A;  1UOP A;  4J77 A;  1MDA H;  2VDN A;  4H5I A;  3OKT A;  3IUJ A;  3GRE A;  3JAM g;  1XIP A;  4X60 B;  3FCU A;  1PI6 A;  4O3T B;  5EAR A;  1O6G A;  4NBM A;  1C9I A;  2P9U C;  3UVK A;  3MUN A;  3B7F A;  4L9O A;  4CY1 A;  4AN1 A;  2HES X;  3F3P A;  1E5T A;  1GXR A;  4JT5 C;  3VA6 A;  4E5Z B;  2HKM A;  2OIZ A;  5CYK A;  5AFU 3;  4GGA A;  3NVN A;  5C2W B;  5FKT A;  4XEI C;  1NR0 A;  5EM2 A;  4FAV D;  1E8N A;  4O2W A;  2O9K A;  4IA9 A;  5A2Q g;  3C5M A;  3JZG A;  2H6K A;  4GQ1 A;  5EML B;  1GOF A;  5M5U A;  2EBS A;  4D0K A;  3OL2 B;  3FCS A;  2CE8 A;  5M5R A;  4MMX A;  3PE7 A;  2AGL A;  2OK6 A;  2OJY A;  4GM9 A;  3OTT A;  4BP8 A;  3OW8 A;  5FKQ A;  3T3P A;  5K19 A;  5AMS A;  4X61 B;  4K3I D;  4LG9 A;  4A09 B;  4A2L A;  4O3U B;  5C92 A;  4JHP C;  2VDO A;  4PSX B;  4FWW A;  4CI8 A;  3J80 g;  3I7O A;  5EM2 B;  2AGX A;  4J81 A;  2Q7Q A;  2IWK A;  4PNK B;  4WK2 A;  1R5M A;  1QFS A;  1OMW B;  1T2X A;  3PSL A;  3BG0 A;  3KRX B;  1GOG A;  2VDP A;  3EMH A;  4J73 A;  2H6Q A;  5IGQ A;  1L0Q A;  2AGZ A;  3EQ9 A;  3NVQ A;  3IVM A;  4D6V A;  3EU7 A;  2MTA H;  3PXS D;  4Y7R A;  5HE3 B;  3K26 A;  3V7D B;  4LGN A;  3EG6 A;  2PM9 A;  2EIB A;  4JT6 C;  4CI2 A;  2HJB A;  1K3I A;  4ERZ A;  4G1M A;  3I7H A;  4GQ2 P;  3GD1 I;  2OVQ B;  1SHY B;  3VI3 A;  4MK0 B;  4H5J A;  1ERJ A;  3IJE A;  2HJ4 A;  2VZ1 A;  1A12 A;  2AH0 A;  3BWS A;  3OKY B;  3PSC B;  2H14 A;  5HE1 B;  4Z7N A;  2VDR A;  4JSX C;  2VZ3 A;  4UM8 A;  3C99 A;  1N6E A;  4XYH A;  4DNV A;  5TF2 A;  3UKU C;  3N0E A;  5H17 A;  3EI3 A;  4A08 B;  2YB8 B;  5CXB B;  2J57 G;  2TRC B;  2XL3 A;  1JMX B;  2PM9 B;  4ERY A;  3EWE A;  2CO0 C;  4U7A A;  4BUJ C;  4ESG A;  4O02 A;  1VE7 A;  3MMY A;  5M61 A;  3RMZ D;  3IIW A;  4NEN A;  3ZDZ A;  3EI2 A;  3AH8 B;  4CZV A;  2EIC A;  4FA5 D;  5HE2 B;  3O4J A;  3ULE C;  3AL8 B;  3NIG A;  5I5J A;  2XYI A;  2Z2O A;  3IUL A;  3V9F A;  4O1Q D;  3J81 g;  4A08 A;  3GC3 B;  3IJ0 A;  5CXC B;  4ES0 A;  3DDU A;  4G56 B;  3IUQ A;  4A0A A;  4BCB A;  4CY5 A;  1GP2 B;  5IJ8 E;  3IJC A;  5GXI A;  4ZOZ A;  3UVL A;  5FKR A;  2GNQ A;  1TYE A;  1U2V C;  2P9S C;  3PVW B;  1E8M A;  2IUV A;  4N14 A;  5FKS A;  3MVD K;  4WK4 A;  1YFQ A;  2VDK A;  1U8C A;  4IMM A;  1B9X A;  3I8E A;  4CY2 A;  3I7K A;  1K8K C;  4JD2 C;  4L3H D;  1PGU A;  3A0F A;  5KDO B;  3MKS B;  4CZY A;  5GSA A;  3K71 A;  4JSN C;  5I5M A;  1BPO A;  3ORV D;  2EID A;  4JXM A;  2IWF A;  4AOW A;  3I7P A;  3PXW D;  2AGY A;  2WQ8 A;  1N6D A;  4OZU A;  2J55 H;  4YVD A;  5SXM A;  3IUM A;  2YNP A;  5CYK B;  3I8C A;  4GM3 A;  4J78 A;  4Z8L A;  4AEZ A;  5IJ7 E;  4L3G D;  3RRM C;  3EI4 B;  3JZN A;  4QRJ A;  2P9N C;  3QHY B;  3ZE2 A;  1A0R B;  4GQB B;  1H2W A;  2I3T A;  3OF7 A;  3KCI A;  3ZDY A;  4BCD A;  2B5M A;  3OL2 A;  3C9C A;  5FQD A;  3L4O D;  3VGZ A;  5EMK B;  4QQE A;  3DM0 A;  1U4C A;  3MZL A;  5HDB A;  2BCJ B;  2Z2N A;  3JRP A;  4A2M A;  3SN6 B;  4DNW A;  2I3S A;  3PXT D;  2B5L A;  4A11 B;  4A11 A;  4PXW A;  2H47 A;  1XHM A;  2HXC A;  2H68 A;  3CIK B;  2XE4 A;  2H3X A;  5GXH A;  4JSV C;  4X3E A;  2VDM A;  4IRZ A;  2I0S A;  1JOF A;  2B5N A;  5IGO A;  5H1M A;  2PM6 B;  3EQ7 A;  3NVX A;  4X63 B;  4FHL A;  4A09 A;  3JB9 L;  1RI6 A;  3EI4 A;  1C9L A;  2UZY B;  5EAL A;  4ZOY A;  3SLE D;  2H9P A;  4O9D A;  5M5V A;  3UVN A;  3ZWL B;  4ZOX A;  4LG8 A;  4AMY A;  4G1E A;  4NAA A;  3RN0 D;  5EAP A;  3DXM C;  1M1X A;  3IKO A;  5B4W A;  5EMM B;  2P9P C;  3F3F A;  4BL0 A;  3RSE C;  3W15 A;  2CNX A;  3I89 A;  2HKR A;  5CXC A;  5AJA A;  1PBY B;  4A0B B;  1TBG A;  4JHN A;  2CE9 A;  2P9K C;  4O45 A;  1OLZ A;  4PSW B;  4Z7O A;  2QZP A;  3VH0 A;  1JMZ B;  4J82 A;  1H2Y A;  2H9L A;  4G55 A;  2HYE A;  3SVW D;  4J84 A;  5E6S A;  3OKY A;  2OK4 A;  3IUN A;  2UZX B;  2G99 A;  3MXX A;  1SQ9 A;  2JKX A;  4L1M A;  5HYN B;  3EI1 B;  2YNO A;  3O4G A;  3SMR A;  2HU8 A;  4NSX A;  3FGB A;  4J0X A;  3SCY A;  1GG2 B;  2I0R A;  2PM7 B;  1MG2 A;  3IIY A;  2W18 A;  4QT8 A;  4U1E I;  1VE6 A;  4J8B A;  2QXV A;  4MMY A;  4RE6 A;  5C86 A;  1SQJ A;  5FFO A;  5THA A;  4HDJ A;  3RLM D;  4QL1 A;  4K3J B;  4GGC A;  3HFQ A;  4FA1 D;  3K72 A;  2PBI B;  3SBP A;  4CI3 A;  3EI1 A;  2XDW A;  5H14 A;  3RFG A;  3I2N A;  2VC2 A;  4AX4 A;  2P9I C;  5FA5 B;  5FXY A;  2H13 A;  3PVU B;  3C75 H;  2IUQ A;  4RE5 A;  3SBR A;  5C9Z B;  4J86 A;  4A0A B;  4J87 A;  4AN0 A;  3VI4 A; 
#chains in the Genus database with same CATH homology
 5E6U A;  3VI3 A;  4O02 A;  3FCS A;  5HDB A;  3IJE A;  4WK0 A;  4WK2 A;  3ZE1 A;  5E6S A;  4MMX A;  4NEN A;  3NIF A;  2VDQ A;  4G1E A;  4MMY A;  3ZDZ A;  4Z7N A;  2VDP A;  5FFO A;  2VDR A;  1TYE A;  3K6S A;  1M1X A;  3NIG A;  4UM8 A;  3K72 A;  3NID A;  4UM9 A;  3T3P A;  3V4P A;  5FFG A;  3ZE0 A;  3ZDX A;  2VDM A;  4WK4 A;  4IRZ A;  4MMZ A;  1JV2 A;  2VDK A;  1U8C A;  2VDN A;  2VDL A;  3T3M A;  2VC2 A;  4G1M A;  3ZE2 A;  1L5G A;  5E6R A;  3V4V A;  2VDO A;  4WJK A;  4Z7O A;  3FCU A;  3ZDY A;  3K71 A;  4Z7Q A;  3VI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...