4Z7NB

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7nB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7nB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7nB03
3IJEB 1JEQB 5E6SB 1M2VA 5BV8A 4WK2B 3M6FA 5KYYA 2NUTB 4F1JA 1ZONA 5HGJA 4C29A 4WJKB 2X5NA 1JEQA 1M2VB 3PPYA 3QA3E 5KYUB 5E6UB 2I6QA 5KYYB 4IXDA 4Z7NB 1JV2A 3T3MB 2XGGA 2VDQB 1T0PA 1U8CB 1L5GA 5E6RB 3K6SB 1M10A 3E2MA 3EG9A 3N2NA 5HDBB 5HJ2A 1AO3A 5KYUA 5KYNA 3TXAA 4NENB 4O02B 1M2OA 4BJ3A 4PN7A 3ZE0B 1ZOPA 2XWBF 3AFCA 3NIFB 1ZOOA 3IJEA 1YUKA 3VI3B 1SHYB 1MQAA 5KYXA 1RRKA 3TCXB 3T3PB 1V7PC 3BQMB 3ZDXB 4HQOA 4HQKA 2P28A 1QC5B 2VDNB 2UZYB 1M1UA 1Q0PA 1IDOA 3RAGA 1MQ8B 3K72B 5LN1A 1BHO1 3K6SA 3OL2A 1UEXC 3FCUB 4O3UB 1BHQ1 1XUOA 2I6SA 3EGDA 1PCXA 4MMYA 4M76B 1N9ZA 4UM9B 2NUPA 4G1MB 1IJBA 1FE8A 4C2AA 3ZDZB 1SSLA 2ADFA 3EG9B 4NEHB 2NVOA 2VDLB 3VI4B 1TYEB 3AL8B 3V4VB 1CQPA 1XDDA 1N3YA 1DGQA 2VC2B 1QC5A 2B2XA 1SHTX 1YVRA 3FCSB 2WW8A 3GXBA 4CN8A 4Z7OB 2NUTA 5KYWB 3V4PB 1RD4A 2ODPA 2WINI 1IDN1 1RS0A 3ZQKA 4FWWA 1MHPA 4A0QA 4C2BA 3TVYA 3F78A 4MMZB 1U0NA 1XDGA 5E6UA 1U8CA 1DZIA 5E6RA 1YVPA 3F74A 1MJNA 2P26A 3PPWA 1RTKA 4GZ8A 4K3JB 1JLMA 3PPVA 4O02A 4XW2A 2ODQA 4DMUB 1U0OC 4NENA 2VDOB 3EOBI 1JEYB 3EGXA 1JEYA 4WK4B 3EH2A 4FX5A 2VDPB 3FCSA 3EGXB 4JX0A 2XWJI 4CNBA 4HQFA 4IHKA 3AL9A 1PT6A 1JV2B 2VDRB 1AOXA 4G1EA 1L5GB 3K71A 3EFOA 4G1EB 4CN9A 3EH1A 5KYWA 3NIGB 3TW0A 4WK0B 1ATZA 2NUPB 1OAKA 1QCYA 3HI6A 3NVQA 2O7NA 4MMYB 3AL8A 5E6SA 4UM8B 4F1KA 3OKYB 4MMZA 4G1MA 1FNSA 2VDKB 1SQ0A 1M1XA 1MQ9A 3BQNB 1IJKA 3NIDB 3HXOA 4Z7QB 1M1XB 4UM9D 3ZE1B 2VDMB 1AUQA 4MMXA 2IUEA 1MF7A 4WFQA 2M32A 1PD1A 1PD0A 4IGIA 3HXQA 1SHUX 4MMXB 4JDUA 3ZDYB 3OL2B 3EGDB 3Q3GE 5ES4B 2ICAA 1LFAA 1T6BY 1CK4A 3BN3A 3IBSA 3EOAI 3ZE2B 5KYXB 1OLZA 2QTVA 4O3TB 3PPXA 1NA5A 3OKWA 3K71B 3EFOB 2I91A 4HQLA 3K72A 4HQNA
chains in the Genus database with same CATH superfamily
3K1DA 2N0KA 2AXGB 2GYUA 4INAA 1SYVB 1FFNB 5SZIA 2FMHA 3D2UA 4U33A 3GD1C 4YLCA 2V9ZA 1YBAA 3ME0B 5IEKA 1E89A 4TSCL 3ASZA 3UUGA 2IXAA 1CHNA 5C37A 2JCWA 4IBTA 3MAJA 2YV3A 3SJUA 4H8WL 4GRMB 4Y88A 5H37H 3N85H 3BXHA 4DOMA 3RVBA 1G8FA 4ICXA 1TQUA 4E9VA 3WNJA 4RPGA 2I7XA 3GKWL 5T3XE 5I4KA 4FNRA 4XCVA 4HEA1 2OZ4L 4ONEA 4HMQA 2DN7A 3DMHA 2VLJB 1AUVA 1WZIA 4C4ZA 2BXZA 3RTLA 3QA3A 1AZTA 5IVXB 4AZ8B 3MNFA 1RQGA 3WGVB 1S9KC 2GABA 2HT4D 2DR2A 3GQVA 1B6RA 1TKRA 2XWJA 4Q7MB 1EDHA 5LXVA 2IP4A 2Z6VA 1NBIA 2IEIA 3SKMB 2FQFA 2FYTA 2OVBA 2DTML 5D5MA 2FQ1A 3CTTA 1DSSG 4FI8A 3I01A 2I3GA 1EWTA 1HURA 4AUMA 3BDBA 2PKCA 3V2HA 1ZANH 8MHTA 4Y6GB 4HU8A 2PGDA 1SUHA 1R2QA 4PXYA 3BZEA 3NGXA 3SC2B 3EDEA 2Q0SA 4JFXB 4KI5E 1U6AL 4Y9RA 1WHTA 3MC0A 5DW0A 4M22A 1O7DE 4FQXC 4IEFB 3DE0X 4FKBA 3K4DA 4NV3A 4EPWA 1T66C 1U8CB 4IF4A 3CPHA 1BPVA 4JQIL 1ETZA 3RU8L 2QBYB 1TFHA 2XYVA 3BPCA 1FBTA 1TU0A 4A7VA 1L9QA 2MEJB 2QT6A 4LCUA 5EIWA 2JQZA 3WG7B 3MLEA 4RK5A 4FFTA 4ZXPA 1VPVA 3D8NA 2PTTB 3O2WH 5B38G 4WBSA 3USES 1Z3GL 2PRKA 2NDGA 5GJSH 1JZDC 3E8UL 2QLNA 3PHHA 3IT1A 2G25A 1KSFX 3UC2A 3KPLA 5FS5A 1D1TA 2ZBFA 4KU4A 3S1AA 4NLHA 1XT6A 3QFJE 4JEHA 5TEVA 5CDGA 2I6UA 4LMAA 3UACA 3QDJE 2CFRA 2PX2A 2W2KB 3ZZ0A 4NPJA 3EGEA 2CIKA 2Q2NA 4IGFA 2VI5A 2WHXA 3PEWA 4E1BA 4ZC1A 2AEQL 4M0FA 4C88A 1FZJA 2FBOJ 3GI1A 4HGZA 1KBPA 4FADA 3HG1D 3RDPA 1YRAA 4QASA 1QBBA 4TNWK 4G5YA 5EP1A 1KA9H 2WBLC 5FLXA 1UXOA 3B1UA 2OHGA 5DISB 5J43A 4U0RB 3JARB 3MILA 5F7BA 1KTCA 5J4HA 4F9LC 5M95B 1GIGL 4ER6A 1GL6A 1XD8A 3LY9A 3O93A 5JXHA 3GMDA 2B4YA 3O45B 3ZHDA 3DMDA 3KWJA 2QXYA 3IEXA 3OZSA 2OZVA 3TJPA 3V0JA 1J1PL 4FCWA 3VCLB 3MTBA 1LDSA 3SPJA 4Z7WE 5LLTA 4NNPH 4RCZA 4V0KA 4CV1A 2Z31C 2Q6KA 2ZUEA 2GIMA 4E03A 4TL8A 2VCHA 3AGPA 3R3YA 4LN1A 4LQCA 4UBDC 4EYOA 3CW8X 3MV01 5TDPB 4EZMA 1Q11A 1TETH 5ALRA 5D1ZC 1XP8A 4GKJB 4BVKA 3TCKA 4YYZA 1Z62A 1O7JA 1U8LA 1WEHA 2CFTA 5F7HA 4CU2A 4RJJA 2WOJA 3EDKA 3OQJA 4BKLA 1CUCA 5DRXB 4YC7A 2B99A 5KNCD 4JWTA 5KDOA 3GSQB 3LKPB 1ATZA 3BEWA 1CPYA 2G83A 2P6MA 4DARA 1ZLWH 1YU9A 2XGOA 1NPTO 4RJIA 4UKDA 4WWKB 2REBA 4BAUA 1EDDA 3PJNA 1IUPA 3BD9A 4K23L 1JYXA 4BJHB 4M83A 1QZTA 3P54A 1TF2A 3GLFB 4LVNB 1GLNA 3RQIA 2B08A 4RRPM 3GGPA 1DQML 4B4DA 3ARWA 3K5PA 2J8UE 2QJFA 3NATA 3ANTA 3F4BA 3U44B 1QP0A 3BJEA 4Z7NB 3FQ2A 1N5JA 4B17A 1U28A 1YVDA 3TIEA 3DMRA 4PBVC 1V7ML 3MLBA 5KIAA 4IHAA 3KYDA 1GAFH 1SJVA 1JDBC 1TF5A 3X1JA 1PVOA 3VJ6A 4NU6A 3G5ZA 2Z3ZA 3HQ4O 1RHFA 3T9BA 2Y93A 3R74A 2N47A 3ZYZA 4GW1B 3JYPA 4KLCA 2L7JA 4S2UA 5FGBA 3OKNA 4M9CA 5A9SA 1KN4L 3D6FA 5IJAA 2ZXEB 4DJAA 5FWYA 3O3EB 4KRPC 4FQLH 3S9DB 1Z83A 3RFZB 1QYXA 4X20A 3LP5A 4GDMA 1JYWA 2R7MA 1Q9OA 1EFRD 4U3HA 2JKLA 4HZIA 3WE1A 1HYSC 2BC4B 4D0DB 3F6YA 1CN4A 4YRLA 5HHVL 2J57A 3F05A 2E9JA 2V9QA 2RMKA 3O26A 3I5UA 4AI7A 2HRDA 2K6YA 1JXKA 4ADGA 3U09A 1F7UA 4LDPA 4L3WA 3P4MB 1BXRB 2OMZA 2DE0X 2OM6A 3QNXB 3IBFA 1DBWA 2GSIB 4ZQTA 4F7KA 1OV6A 2IX9A 1PYGA 4IIXA 1M2GA 5EVCA 1U8OA 4N2AA 5A6SB 3FYSA 3FTXA 5LUAA 4WWNA 2P4HX 4JR2A 2BBTA 4NN7B 5HVHC 2FF5A 3FMGL 2XOKD 4MA3B 3I0MA 1BTOA 2UUOA 3HJNA 4NMLA 2WJJA 2VP0A 2LVEA 1WMDA 2XNJA 1QVOB 3Q5OA 7ADHA 1YVUA 3GMOB 2H8KA 4GLLA 5J5AA 1G59A 3KU1A 3B1KA 4GI1A 4YAGA 1ISSA 3KW7A 3F0TA 5IAEA 1W36D 2V5RA 4YHOL 4WN9A 1WTAA 5FP0A 2ZP0T 4J3TA 4UV7H 3H9SA 1R24B 4CRWB 1PU2A 3VNRA 1I7PA 4FGMA 1MC1A 4ZVOA 1W4ZA 1HEZB 5ECGC 5F9AC 1EFVA 3BSSA 4JLJA 1A8IA 5TMPA 3OOHA 3DX9A 1GZHA 2Q5LA 1RJZA 5FKAA 4IUYA 3EPRA 4AZ3B 2I60H 4OYYA 4FFBA 2GKIA 4MAMA 4FNOA 4E6PA 2F3UA 4MAUH 1GYRA 4XNDA 3ZY6A 3IDFA 1KU0A 2PMWB 4YJ3A 2ROQA 2TMGA 4ZQHA 1HE7A 4J6RL 5DMIH 2NWQA 2R9HD 4DREA 1EVEA 1RRCA 4CIYA 2J9RA 3OLDA 3TAHA 3EY9A 4B3SB 3BOSA 4ZX6A 4AH2A 3K9WA 4WH0A 2LQRA 1LI4A 4UQCA 2ZBPA 4UT6H 3H11B 4RDIA 5BURA 1EUYA 3BZFA 3BD4A 3FFCB 1BMGA 1GC1C 3PNLA 3MRBB 2CD0A 4ES6A 3HM9A 3L93A 2BKVA 2DH5A 4JDTH 2A58A 1YS9A 1ZV9A 4XGZA 3VU9B 3KT3A 4XPBL 3KXIA 3WV4A 1PPIA 1DVRA 2H2IA 4PJGF 1NBWB 1SBZA 2QYHA 1ZUNA 2R6CA 5IAKA 3DYBA 4PZ0A 4EVIA 4NO5B 3WGQA 4WNQA 4M6AA 2IOQA 2FR0A 3D25A 4MUMA 3IT8D 6GPBA 3CHOA 2EP8A 1AXSA 3BSZA 2Q3FA 1TMYA 1J25A 4AQ8C 5I82A 5JUEL 4ZI7A 3RS8A 4U0JA 4YXWD 5JW4Q 4G5RA 3DGGA 3X3FH 5CD3B 3NX4A 2AOWA 3D08A 5FGCB 1PFYA 4B2LA 1VI2A 3CZUB 3US1A 3VO9A 2RARA 1ZHNB 5CS7A 5CAEA 3VGAB 2JB9A 1K4CB 5A3VA 2BWIA 4C4BA 3K9LA 4H0NA 3HLAB 3TSYA 4YHMH 4AQZA 1ISJA 4BFNA 3B2MA 2QMEA 1WISA 5JSZB 4QRUB 5CEXA 2BTQB 4OO3A 1J99A 4FZ8L 3HTLX 5EIIG 5TQVA 3IE0A 3QKSA 3O0RH 1E4EA 1HQKA 4LHXA 3ES6B 2GHRA 1MEOA 1JGEA 1JIQA 4PX5A 5CCKH 2JWHA 4NHCH 4DMCA 5D6OA 5FM5O 4L0YA 4GVLA 2CDEB 2AFVA 2WLTA 4CKBB 3B52X 1E5LA 5B8CB 2BUAA 1AC5A 4TYMA 5C80A 4WI0B 3HEAA 4NMHA 1C0EA 4FW8A 3K0CA 4K5LA 1QKJA 4GOOD 4B9ZA 2DUWA 1FJ1B 3EO0B 1TTGA 4H5SA 1VL0A 3HABA 5JROA 3ZZQA 3MMZA 3WIDA 4HETA 5EFIA 1P2SA 4PR5A 3RFRA 3W9DA 4QJ3A 1RK7A 4BUQA 1RFLA 3WIEA 4B9FA 2OJEA 2DU8A 2CK3D 2IDTA 1C3JA 1V37A 1Y34E 2P68A 2ZUWA 4H6XA 1RPTA 3UG6A 1NNUA 3EIOA 1P4AA 2RGSA 2C20A 2ZIUB 3ROTA 4A7GF 5CB4A 5LBSA 5KYNA 4CMEC 4B7ZA 5EZQA 2Q8BH 4KL8S 2VABB 2E5WA 3P9LA 2W9EL 1E9CA 5CD9A 5I8OH 1S96A 2VDPL 1JPJA 2Q4OA 2CVHA 1NDTA 2A9MH 1C2TA 3LKRA 5I6KA 2CKNA 1OH5A 4B4WA 2QD4A 4HKZB 2WWMD 4BNWA 3O4LE 15C8L 4D6PA 3DLHA 3JQCA 1UBSB 1XZDA 1TYEB 5E9DE 2FG5A 1IM8A 4ZW3A 1GW6A 5CK4A 3BE4A 1XFDA 4LPYA 3AF1A 3PUHA 1UUNA 2Q6WB 5A6MA 1GSAA 2OAGA 4YVNA 1RSFA 4P83A 2LDBA 1GJUA 1MJUL 5K0SA 4LLUA 2XA9A 1X5FA 2ZRJA 3N9GL 4U39A 2KE5A 4BJ1A 1AS3A 1PX3A 1CXIA 3MFFA 4HPOL 2BPBA 3U0WH 1FYVA 3CHRA 4JI1B 4BQCA 4EGSA 1P3Y1 4PZLA 1W8EA 3B12A 2J2ZA 2YIHA 4F8OA 5DCWA 4AZ8A 2EJTA 2WZCA 2R0LH 4G8GE 1GTL1 4HAWA 5E8NA 1J42A 4FONA 3RW9A 4DUGA 3IIEA 2VXTL 3M4XA 2O4EA 4OQTL 3AQ4A 5JCJA 1OBOA 2FSVC 4XT1C 3ROLA 1Z6XA 4F1ZA 3ZKSD 4X5WB 4AVYA 3D3JA 4R2WA 1NJ6A 1T91A 3PFCA 3U3KA 3HUTA 5LB4A 1QNFA 1RHRA 4UT9H 3GGSA 1XLTA 2JCCA 4L4VD 2CUHA 3DX6B 2B34A 4EN3B 4WDRA 3FS9A 4AW7A 3L9XA 4QCIB 5IBLC 3HZYB 1HFKA 1KEEB 1L5OA 5L0QB 4ZFOA 3ETBJ 2X0EA 5C2BH 2PLNA 1AZRA 1ECFA 5B2EA 4KC0A 3PICA 5SWSA 3Q88A 4N0EA 1QSFD 2V3CC 2CGRH 1DOHA 4M61B 3NFSH 3C6XA 3ZGIA 4GIBA 2GHQA 3B2UC 4U2YA 1P7QD 3GG9A 4WFIA 3GSNA 3G6AB 4IBVA 5IK3A 1JHPA 2V8OA 1HC7A 3JQ6A 3QZWG 2E3JA 3WC4A 1QHOA 4YCSA 2AEFA 4OOEA 3FPSA 2EADA 4G4GA 3IO3A 3DDZX 3GN1A 1XSEA 3I9OA 1RK0A 4TMXA 3T4AC 3B9VA 4DEPC 2N1KA 4PS4H 4CVUA 2PGLA 2R3SA 4ENSA 1FU4A 4DQXA 1P81A 4WW2B 5AI0A 5KJ1A 2B78A 3RL2A 3QW4B 1VSBA 4D97A 2FEWB 1C9EA 5AHXA 3CSTA 4ZOEA 3GELA 3D25B 1EWYA 2ECPA 1F3OA 3KYKL 4AZTA 4TKVB 3HR7A 4KR9A 4Y0VA 4FZEH 1AGEA 2Y6SD 4OJYA 4KOAA 3G6WA 3G3LA 2PKQP 3U3JA 4EO9A 3COJA 3RK4A 3UZEA 1AO0A 2QG6A 5CFPA 1Y6FA 1J0ZA 3KM1A 7AT1A 1RKBA 4WXPA 4UF7C 1QLWA 4YAKA 2JGAA 5KYKA 1U3JA 1RPNA 1Y48E 2FSDA 4NJEA 3WS3A 3V0FA 1AOHA 4HB4A 4Q37A 3ME5A 5B1IA 3LMJH 4XIJA 2VXVH 3ID6C 2B14A 2RFXA 121PA 3L2MA 5GZNC 2PLTA 3U4EB 1R9JA 1UH2A 3OKFA 2QD1A 3WNIA 4A6YH 4Z23A 1FG9C 1LBEA 1MO2A 3FWHA 4JAVC 3A4FA 4X5QA 4IS6A 3SCMA 5GRJL 1Y8RB 2B0CA 5DR5L 4CGYA 5HQ3A 3O3MB 3SF8A 5T7BA 1NYTA 2C1OA 4LVEA 1SXJE 1FLVA 1F0PA 4D46A 1NVVQ 3WQHA 1QG6A 3F5SA 1IVNA 2Q0QA 1HESA 4LYJA 2NSYA 5C5IA 4MV4A 5BUCA 4AS1A 5LAXB 4HBZA 1UEYA 5CLHA 1A2YA 3WSQL 2XCUA 3DW1X 2Y2TA 1UBJS 2ZI5A 1CY6A 2IBSA 1DCFA 1Z0KA 3IMWA 3VAEA 3T41A 3NCYP 2PMEA 3ITKA 35C8L 1YR6A 5ALFA 2OX5B 1Z9NA 2W2NA 2NYYC 5ILGA 5LZ4A 3MINB 1MCNA 2P80A 3J81A 1Y5LA 1C4OA 1KYDA 1NUSA 4MAFA 3VVVA 1K4MA 2FO4A 4YV1A 1N2CE 2R23A 1WS6A 1A7KA 4JWKA 3GVHA 2N0SA 2IPKA 2BT4A 5ALZA 1ULSA 4MVJE 1MJGA 2OM5A 2HLFC 1AHKA 2UY6B 3ZXIA 5HCUA 1GZ4A 3ROOA 4NPYA 5IHLB 4KRNA 4OH2A 2HSEA 4RD0A 2XUPA 1A72A 1CUIA 3QEQB 2BPOA 3P3TA 1CGXA 2BS71 2VNCA 1ODKA 3NAGA 4LCYA 1TEYA 4TUKH 1EZLA 3WELA 4J6RH 1Z0JA 2C8NA 3NANA 5F21A 4A7GA 4WGGA 5ABAA 3CN4A 1R6XA 5HHQB 4Y2LA 4X8LA 1DC6A 3DAPA 4PVLA 2IUTA 5DRWB 3U7YH 3LT5A 2BX5A 3O8XC 5CJ8A 3DEKA 2ZANA 4O4IB 3VVMA 3AV3A 1C8KA 1IJ9A 2WWVD 1Z1WA 3I75B 3TBWA 3HKEB 4E5XB 1TYBE 5CH5A 1ZWIB 3FCTA 5J7CC 1GQOA 3FSAA 4IMKA 4YEEA 2WVUA 2IV7A 3BG5A 5D55A 4IHJA 3RU9A 3S4YA 3DFFA 2X4UA 4GLRI 5GGQL 4J4BA 1YI0A 1Y9ZA 1W5AA 4TQ8A 4JW3A 4FHGA 3I6BA 1ORSB 4OGAD 2WMNB 1AIFB 2JFZA 4JFUA 2Z5GA 1NYRA 5LOVA 4X7FC 3PL1A 3T3IA 2CMHA 2VBCA 1HILA 1JD9A 3AONB 4H3HB 3EEYA 3ZZSA 2BTOA 4DWWA 3DBVO 1YQTA 5DKFA 4APQC 3P4NB 5AM1A 4PFSA 1IC1A 3RK1A 1KJMA 1DDIA 3C5EA 2HK9A 1V7MH 1PS9A 5ICGA 1MIOB 4ZCSA 1RYHA 4MS1B 2NSHA 1N7IA 4X6EA 4GKLA 4AKEA 2WUCH 4RTSA 3KQMA 5GSVA 3N1PC 3KLBA 4G0WA 4YP1A 4DFHA 3O8OB 2YARA 3SE4C 1UKQA 1X3SA 1B0GA 4QO8A 1CXEA 1KY3A 1X38A 3URMA 3RK0A 1UCTA 5BOJA 4DT1A 4GZ5A 3UAOA 4RDCA 5IJKA 2BFGA 4TQ9A 1RU9L 2EE6A 4W7SA 1LDMA 5KVQA 2VN7A 3CX5J 2WQSA 1P5JA 2NU8A 4R97B 1C9KA 3F3KA 1W4RA 5EO1A 1NXSA 5B58C 1JB1A 2GHIA 4B87A 1CICC 5DMGD 5EZJB 3DBLA 5HS4A 3E5MA 3ESRA 4RQUA 4IOKA 3OESA 2O19A 2RBLA 3I6MA 3L1EA 2GQHA 3VB9A 3C4JA 1KIQB 5KSVB 2D2OA 4P59H 1YEIL 2L7UA 5JEEA 1ZD1A 2I5YH 4QO1B 2Z8XA 1MCRA 1Y5NA 5ITBH 1NP7A 3ZHVA 2NQ8A 3NFRA 3VQ1C 4A0GA 1FZMA 1PD0A 3ISJA 4PAWA 4NUJA 4OLZH 5BSGA 3LKQA 1H93A 4D9HA 4ZXBC 1KNQA 4J2QA 1KXVC 2UWEF 4MUFA 1KBOA 4JLBA 2BNQD 3EF3A 1IC4H 3W2IA 1ZQ1A 1PFVA 3FPXA 4ZFQA 1A9BB 3H2PA 4HB2A 3REVB 4LEBA 3SDDD 3ZSTA 3EMDA 2BH0A 2BGLA 2CXNA 4GI5A 4X6CA 2CJUL 3EA5A 1Q90A 5KREA 4KKLD 4ES9A 4K2AA 3G9UA 4D9QE 1A8PA 4IINA 3D8BA 4W82A 5FFGA 2PQ2A 3TTWA 3WBBA 2JS7A 3LQFA 4NNPL 2ZLBA 4HKXB 4JM2D 4U6VL 1FRVA 3R0XA 3CJQA 1AGYA 3D6TB 3OI7A 2VXUL 1ZVHA 3GMQA 3BSZH 3E6FA 3KEDA 1WBXA 1OF0A 3KSZO 4M62H 4NPCA 3IXAB 3DPUA 2D59A 3D1LA 3T0AA 1BFUA 3RGVD 1KXTA 4I6GA 1CGVA 5GVRA 2R69H 4N7BA 1B2RA 4KWIA 4HJGA 2X89D 1AR1C 4IIQA 1HPLA 2V7EA 1NBMA 4HS9A 4YK4C 3NYKA 5A3QA 1A25A 2IX3A 3JQEA 5SWZB 3H4MA 2VLIA 2AD1A 4M89A 1ECLA 5CGTA 3STVA 1A4BA 4WGWB 2BMVA 3FG9A 3T7DA 3SIKA 1PDOA 1VRCA 2A4KA 4A9AA 1MI5A 4KTGA 3N8IA 5EU4A 5AOKA 4R3NA 4MMXB 2XFGB 1OHHD 5HIJA 3V9CA 4EM6A 3C3YA 1KN2L 1NWPA 2ZXGA 4QD2E 5CZVH 2P2GA 1BQRA 2YMOA 3W5MA 5A3IC 2FR8A 1HFWA 4KQIA 3WDHA 3MNWA 1N7ML 3H9SB 4KK9D 4PW9A 4C07A 4ARBA 3TECE 4ZMLA 2AJTA 3F6EX 3EUWA 3OY2A 4LEXH 2EFGA 2R29A 1A5FL 1DBVO 3BFXA 4Q7KA 4HDSB 1AHIA 4KO5A 3QP3A 1NQXA 4OH1A 3UJ7A 1KBGH 4L4XA 2WLZA 1E9OB 2Z4QA 3ZSSA 3EXG1 1MAML 4FA7B 3DQZA 2DLGA 4W68A 3OUZA 4RPKA 4LE1A 3KPYA 1Y6JA 1LLDA 1YJQA 3DYMA 2XV1A 1HXHA 1JT2A 4Z8XA 1QGAA 1RIHH 3OIVA 4PS4L 4FQQA 1C7FA 3EZ7A 1TEXA 2X87A 1IPFA 1QIEA 1WCBA 5LN8A 2Q2OA 3EZ2A 4O4LF 3VNQA 4M7LL 2PUHA 3K1AA 4OAWA 4QREA 4ABUA 5I0XA 1SA0B 2PVSA 3IK2A 3NWJA 1KHTA 2UAGA 2FZKA 4OLVH 1CZNA 3Q7TA 5FB3A 4RYDA 3C1OA 3FTZA 2UVDA 1G0DA 3M82A 4J0GA 4P4KC 2F67A 2VF8A 3AFLA 3GT6A 1GL9B 3BXNA 3UZQA 4XLTA 3OAWA 3QUKB 1WWCA 4FQLL 1S5PA 3I6KB 1UK8A 1IBMB 3FAZA 3PXEA 1RUAH 4KI1A 2PUEA 1KJQA 1CZOA 1ZSDA 1SG9A 4AX3A 5FYJH 4P2BA 4A6YL 1KCSL 3MMEB 3CVHA 2DJMA 1MX9A 1ZCFA 2JASA 2A88A 4R54A 5BVGA 4EENA 5GRJH 2NQ2C 3UL4A 3MMSA 3GFRA 4W1SA 2NXZB 4J3OD 1ABEA 1CP2A 1ACLA 1KZ7B 2G36A 3SYQA 4H3KB 5EE0A 1T20B 3QIAA 3GSRA 1XCJA 1Z7JA 4HIIB 4CG1A 2O0JA 2O2YA 4MW0A 5ICCA 3L7LA 2PR2A 1HZKA 2IYEA 5C32A 4MR8B 1NJ5A 1I1AD 2NAFA 2YBEA 5BSFA 1C2YA 3EGIA 1ZT1A 2BEJA 3UV6A 3ADPA 3ZHYA 2CL6X 1BX3A 3LKBA 1GFWA 4CETA 2E5EA 1JNNL 3S7GA 3KL3A 4IH1A 1REQA 3NBKA 1M0TA 4DC0A 3CJTA 4W5TA 1HWGB 1E0KA 5FUVA 2GCOA 2QGZA 1YMMA 5INDB 4F7PA 1L3BA 3GDFA 4OB5L 1JTTA 1TPXC 3AK4A 4AQDA 1PZ3A 4UCXA 3ORYA 4ZVMA 1S3RA 4H8HA 3A3YB 4KXNA 5EQTA 2Q9UA 4UWQB 4DR3B 3CDCA 4GRIA 2X4OA 4ZW7A 3ADCA 1M3IA 1ZVSA 3FN4A 3R7DA 2B1HH 2CLLB 3ZYJA 4FA8A 2R6AA 4WW0A 2HDHA 1OHZA 1EAQA 4J94A 5CEEA 4TUKL 1EE1A 2Z1NA 4LEOA 1GGVA 2P8MA 3Q48A 1OV8A 2XNSA 3HG4A 2J09A 4JY5H 4GXNA 4ZUVA 4DWVA 1X15A 2NY0B 2GCEA 1E9VA 3QJQB 4J29A 4X00A 4LHJB 1XQ6A 3CVDA 4JKPL 3FR8A 4JHXA 2FX3A 4PJHB 3HG7A 3BRWA 2JJ1A 1S01A 2AQRA 1MZVA 1LX7A 3DTVD 3BVNA 1E6UA 4ZDHA 4YGVA 1E6MA 3RRZA 3D1MC 3G7TA 1ZUD1 1DGQA 1CG6A 5GGUA 2H2HA 4D74A 1NWCA 4GM0A 7YASA 3QUMA 4MVBD 4QY8B 1PFCA 3OZ9L 3UY4A 3VI4F 1RZGB 1ZBQA 3C8KB 5DJAA 1U6AH 2IYQA 1W72H 3N74A 4MW6A 4X7SH 4LCWA 4G1EA 1GTSA 3UTTB 1SA0A 3MV7D 1OXVA 4E08A 2Q3XA 4OCSH 3BTUA 3KFVA 3F7QA 5NULA 3HRZC 2F3RA 1E4XL 2AKRA 5F8RC 1RUKL 4URVR 2ZYIA 5KQMA 5ADOH 5D00A 4LJKA 1CL7I 2IAAC 3F00A 1I5OA 3L0IB 3CLUC 2ICES 1T03H 2PCLA 1KVSA 1RLBA 3S88L 3PDJA 3LC2O 4EZJA 1JR4A 3O0RL 3B3FA 5BRJA 1VL1A 3V7AE 2OE2A 4HG4K 1T2EA 4PJ8C 2AV6A 5E6IA 1PT5A 4HFMA 2H6PA 3P4LA 1IBFA 1S7GA 2NO4A 3PB3A 5E6UB 3BDAA 2ATKB 4TWRA 3KJEA 4BINA 3ECBB 4FIZA 4Z9YA 4PW4A 4U1SA 1R4ZA 3G2QA 3T9AA 1RU9H 3ARBD 4BX2A 5KCMA 2O54A 3E6HB 4MB0A 3ZHZA 2BMFA 1T4CA 4LZKA 3LH5A 4QT5A 1MQ8B 3NHLA 4RD1A 3DX1A 4N28A 1CVLA 3OCVA 3GSVB 3GM8A 4TLSA 3ZWVA 3CVHB 4IRZA 2NO0A 4IJMA 1NINA 3DL0A 4MQ7A 3QWOA 5HJ5A 5KS2A 2VHYA 4MNTA 1JZ4A 1FNCA 1U98A 1XDWA 3EAKA 3OA0A 4NTZA 2N7BA 1SCAA 2AD5A 3EIHA 1XD0A 4O08A 2IH1A 3TU6A 3OH8A 4DB2A 1AY0A 2Q2VA 2VHXA 2YJZA 3A6FA 3MA7B 1QTQA 1WOMA 4LX8A 4NKOA 3MLPA 1OYOA 2DBZA 2K87A 1EFLA 1V3KA 3C5JB 3QE3A 3IU3A 5IUSA 3SGJA 2DYPD 1SUDA 2XVBA 3TWYA 4MJID 2QTMA 5IAJA 3MOIA 2JK1A 2B39A 4OLWL 5DYFA 4C4KT 1KC3A 1LE9A 4ACPA 4ALMA 1G6RB 5AHOA 2GJAA 4NATA 1HQDA 4W8HA 3VOBA 2RHGB 2EXWC 1CPUA 3GY0A 4RL6A 1U2TA 4KDRA 3TO2B 3RY6A 5EN4A 3UGKA 2OL3B 1MJ8H 5DX1A 3BIWA 3PRKE 5FCUL 3EFDH 1YRHA 1TEZA 1W91A 4R2GB 1BOGB 4I9UA 4B5ZA 3ZXUB 3ISRA 1GZPB 1IB5A 1YS7A 1P4RA 3LL7A 4XIYA 2XN0A 4F8JA 4BNNA 4LYDA 2OTWB 4FHFA 1XXFC 1OXTA 4RD4A 2JI1A 4QFDA 3R7BA 4FGWA 2MHAB 5IJXA 5CW2A 1LO5A 4ICIA 1UJ4A 3QCTL 2HUHA 4MCIA 2JGEA 4D8YA 1SKYE 5HGBB 3RT1A 3VSCA 3RC8A 2WPDD 1KO8A 1A1SA 3B7GA 3ZZLA 4TF4A 2OCIA 1UKSA 1KCVH 4JN2A 1U6KA 4AITA 3FN3A 2VJ0A 2MCAA 2AI3A 3OF6D 4EEKA 4TQAA 3EJTA 5KKAA 4NENA 3TEYA 3UW1A 1TVDA 4PJ9A 4D99A 3MTJA 4IXMA 4OF7A 3DEHA 5HD8C 3QWQB 3IVCA 4TPKA 2YHBA 4DP6X 5DMYA 2ODHA 4GX0A 4MRAA 4XWTA 4Q4CA 1XR8B 4UFNA 5E2WL 4JJAA 2RCSH 4C0SA 2R2HB 2XMPA 3US0A 3E7JA 1IGFL 3GJZA 1YUHA 4K3HA 1OW0A 2BHUA 4UINH 2C4UA 2ZU6A 4DIDA 3GQBA 1K9TA 3MK31 1UMCB 5GGTH 5EC2B 43CAA 1OWOA 4KIJA 5TPWA 4JGUA 3P30H 1Z4JA 3R7WB 4LCWD 1E4HA 2J71A 3GT0A 1EIZA 2DG2A 2ZE5A 4ZUWA 2E7MA 3L81A 2PTUA 2IH3B 1DN0A 4IZHA 3OC5A 4D9FA 4EFLA 2WF7A 1UINA 2VWEC 2QV2A 4Y1TA 2W6JD 1UT1A 1QUPA 4JXXA 2AV1A 5AJUA 4GO9A 5GGVL 5DHMC 2VBGA 2VSXA 3WKBA 4GP6A 5IP4A 4HJJL 3MBWA 4YJGB 2Q28A 3O75A 1KFAL 4UM5A 3CLRD 5IUNC 4AEHH 4KMOA 3CWQA 4Y2YA 1NR7A 3PKIA 4P23D 2BRUC 1PR5A 4H26A 3CFDA 2BHYA 5CVTA 2ZJ7A 2UYCA 3ARBB 2VOEA 5C7ZA 1X8KA 1RS0A 5LNK1 4JPIB 3MJ9L 5DVLA 4PYHA 3LM8A 4UUQA 4GOJA 3H2BA 4KWUA 3MAAC 1IARB 3KOMA 1N36B 2YHUA 2QPUA 2I7TA 4TTIA 3TLBA 3PWUB 2PU7A 4RWEA 2XPCA 4OATA 3N5CA 3CHPA 4EUPB 2PZ8A 1QFWI 3DULA 3L92A 2EW8A 2W6ID 2P62A 2WWYA 1CDEA 5IB1A 3R23A 1ZS2A 3K9CA 5IHWA 4PU0A 1K7FB 4RBPK 2BONA 4AZ3A 5HE8A 4BTEA 4HWEL 3E82A 4OFQA 2G1UA 4YO0B 4DABA 4YBQD 2XRZA 5CBEA 1WU8A 2GD0A 1ZD6A 4PFKA 3FUJA 1RJ9A 2WP3O 3NM6B 5A1AA 3MVSA 5EJ8A 1MO5A 3CLVA 2D8MA 2Y06L 4DLRA 5I8ZA 3L4YA 4NG5A 3QDAA 2ZUCA 1MT0A 3KR3L 3BL5A 3DHUA 5FLYA 3GS7A 3AFIA 3FSOA 1LSJA 3L6FA 3TBFA 5I7SA 1MFMA 3HE6B 3NBZC 5FI5A 4ARSA 2FB9A 4IDNA 5A5FA 2RBEA 1E1DA 5F7XA 4X1KB 2CXKA 4Y2DA 3HBJA 1KO1A 4G3YL 4U05A 2EGGA 4U3XA 4K9RA 5GS3A 1JMKC 2HEIA 1DUIA 3NPSB 1EJFA 1QYGH 4X92A 1JNNH 4HWOA 2CDAA 4NS4A 3RVJA 3OPVA 3IF1A 5IHZA 2Z30A 4M7KH 3GMMA 1I7QB 3KH4A 5FYJU 5ARDA 2QG9A 4KQ3L 5CM1A 1NJ2A 4MW7A 4AVHA 1LNUA 3AETB 2GKGA 3MBEB 4Y5XB 4B9GA 1W87A 5D7IF 1EHCA 3UTTD 1KI6A 4JPIA 4Z1MD 3T3PE 4O4HA 4QO7A 1IPEA 2NUPB 4O2CA 1OF1A 1VL5A 4HEME 3OP1A 4LZPA 4CMBA 4NFHA 1P2CA 2AI2A 4FN5A 2PNJA 3RKDD 1PFUA 4LJ8A 2H26A 2BFBB 1KIUB 5DK0B 1Q95A 2A14A 1VL2A 2IEZA 3HMQA 3G0CA 4NCJA 4S3MA 2BNQB 2FE4A 3FCGA 2APFA 3AG4B 5C0EA 2X0DA 1YAJA 2WFZA 3SZ3A 1BM3H 3UJ8A 4KQJA 1EVYA 3OM1A 4G8BA 1KPRA 3CLEL 2QT9A 4CIVA 3LXCA 1Q9WA 3QUXD 2RK6A 3ZKWA 1ISIA 3ZQXA 3HU1A 4ZTPL 4L3EE 2IK8A 1JHUA 3OQBA 4XAKD 2OK0L 5AWNL 1VB5A 1FLNA 3Q8BA 3LPNA 1NR5A 1R34A 1GPOL 4Z9BA 4XI5D 3PA8A 2P9QA 1A14L 1AHMA 4KKVA 3DAGA 4D8VA 3AWIA 3MRNB 4YMPA 3LGSA 4C0HA 4OKVB 1HYQA 4O00A 4QXTB 4NQCA 2CPUA 3BUPA 1SVBA 4JDVB 4OK6A 4Q9KA 3QEQE 4KFCA 4FSDA 4XVJH 4P84A 2VJOA 1JG6A 4PLTA 4JVWA 4DXHA 2PYEA 1JSYA 3S98A 3T8YA 1HK6A 3NHPA 2PNFA 3SLGA 1G9SA 3ZTJG 3IOMA 5KTMA 3F85A 1YK0A 4OCWH 5ADPH 5HYJA 1E66A 5ALXA 2AH5A 2PH5A 3H8JA 4X0KA 1FO0B 1TQBC 2BSED 4S1SH 1M6YA 4E32A 4XZUA 3SBQA 3QWNA 3C98A 3ETDA 2WY3B 4ZXBD 1RAHA 3PA6A 2DJIA 4B75A 1AOZA 5F6IB 2YMQA 4IDAA 3V8OA 1ZM9A 4I9XA 4Y2TA 1FVCB 1NUHA 4FJ1A 3LJ3A 1NVGA 1O03A 4J75A 2GZDA 2X1HA 4HLUC 5D1QA 1FFXA 2NYUA 3KYBA 3QFTA 4HP8A 2Y7MA 2C00A 2GF9A 4NKIL 1PDKB 4ZMWA 5AI6A 3SDXA 3WIIL 4IDGA 5GM2A 4GUCA 2G7MC 1PSZA 2C31A 2RHHA 5EE1A 1K8IB 3RZWA 3VH4A 4HD5A 4DGQA 1SRRA 2DH3A 4ZI8A 4GS5A 2DBJA 4XFKA 5H80A 2IHVA 3CNHA 3NHRA 1JBKA 3R7LA 2I6GA 4L3VA 4H7HA 5AM5A 5EZYA 2IQ5A 2RGNC 1TO6A 2Q1WA 4BE7B 2YGVA 3RURA 3KRTA 4V02A 1PEDA 4E5XG 3WMWA 4ZALA 2WINB 3CQPA 1GJIA 1GNVA 5GINE 3W39A 4GMTL 2JFNA 2I8AA 5CITA 4LXUA 4V38A 2EIJB 4JUFA 4DEWA 3G2NA 2D0FA 1OC2A 2YRLA 2Y7NA 3I83A 1HSAA 3VGFA 3LKPA 1NJ9B 2ICWJ 3QG6A 4BH7B 3MBIA 1GGCL 4PJIB 1OT3A 3C5CA 5E4EC 1V1JA 4F06A 1DDGA 2YIJA 4CCYA 5H5JA 5FBWB 1XF5A 3U6XS 1BN7A 1T24A 3PQYA 3LHDA 3VDMA 1XIVA 1R3IL 2F5AL 3FO9B 1AOXA 3T4AB 2CK3A 1NMCB 1ICIA 3UZVB 3GBNL 3ULVE 1KTIA 1SOQA 4EHBA 4XNYH 5ALJA 2K1MA 2O2HA 5JCPA 1HL9A 2FE0A 4FLSA 4R8MA 4ASUA 5IYZB 3H1ZA 3BP4B 1EEUA 5KJ4A 2WM2A 4CIDA 2NQDA 2FPRA 1NEUA 2YX1A 5AFSA 5F1YA 4N5LA 4JAMA 4PLPA 3BESR 3WRXC 2YA1A 1DWOA 2NT0A 4LL9A 4MS8C 2WLYA 1T1YA 2XWEA 3IDZA 1VHQA 4NQTA 5AW0B 1QFMA 4LVOC 3ECAA 3IM1A 4FIDA 1CTQA 4NQVA 3M17A 3B9KB 1YR8A 2W90A 3NHWA 5FGSA 4G5GA 3VR5H 2XZAL 4E11A 1UENA 5ISZA 4PJAB 3F73A 3GEBA 4YHYC 2LAAA 3DMTA 2V65A 5JW5A 4ND1A 3IJ9A 1QIMA 3BGDA 3OG9A 3V1NA 2AR0A 2JGFA 3KEGA 2R59A 2I3DA 2ZIWB 4YH6A 1R5OA 5K1JA 5JBIA 3MJHA 3TJHD 3N05A 1JPGA 2ENQA 2YZKA 4ARAA 4OQFA 4GLJA 5FOJA 3ENKA 3FLBA 3NFNB 3ND8A 2HW8A 1MWAH 3TZVC 2XVGA 3ZN2A 4UNUA 3L49A 4XB2A 4GW3A 1X1TA 2HG0A 4YZFE 3LZDA 2Q7YA 4HSAC 2BVUA 1T3SA 4YDLC 1LMIA 3QA3B 3LX6A 1VADB 2B98A 4NIYE 2TAAA 1IBYA 3S2ZA 3OX8A 2DQMA 2WRZA 4UQ9A 1LD9B 1P5UB 2XUOA 3OMIB 3P9WB 3T7RA 1GPWB 4IUBS 5EUKA 2UYLB 3ZBMA 5L3RA 1OGYA 4XBGA 3BMNB 3EOBA 1TAGA 4W6QA 2WAMA 1DFXA 1I7DA 4KQFA 4DMFA 1F6WA 1XZFA 4HAUA 1U65A 1EAPB 2GZ2A 3EJJX 1YE3A 1QMPA 3WDLA 4UT7H 4KSYA 4FHBD 3L4TA 5DD6A 3QRLA 1IZZA 2CXOA 3QXDB 1YMVA 5HYSA 1CCZA 4YGXB 3ARDB 2EUWA 1WMBA 3H3JA 3ARGA 4U7WA 2PT7A 3V8NA 4JJEA 5ALPA 1P5HA 4OYRA 2ZSKA 5C46F 1G7QB 4ZU3A 3BREA 2AJZB 3AUXA 3MA0A 1BXGB 1Y1KE 2QN6A 3F3YA 4O51A 3MLWH 4PGCB 1A5TA 1QTPA 5FR3A 4YCDA 3GSRB 3ZIDA 4WXYB 3I3EA 2H0RA 2I5YL 1X8LA 2V3WA 2H9AA 4AICA 1AGCB 4ZT3A 3KGSA 3UMBA 3PNMA 1UURA 1H6FA 3FAKA 4KNWA 3TSAA 2VNSA 3KPQA 4KVAA 2APVA 1YZVA 1XN1A 3W5JA 4GFTB 2VHWA 3QPAA 1QBKC 5F2KA 1K3TA 2FW7A 2WWRA 3H3KA 1JLMA 4QGHA 4R2XA 5TF4A 1G9MC 2OP4L 1CUZA 3GLHE 3LVEA 4RZCB 3TOSA 3ZDQA 3QA9A 4FQHA 5A02A 3CLUD 2IW3A 3IDMB 4YR6A 5EZPA 3ZIYA 4XJXA 2X4TB 2A0FA 2GN1A 5BN5B 3QUMH 3NEYA 1JZIA 4JVOA 4FYSA 1H65A 3WYDA 4A6EA 4UUAA 3ZR5A 2HTEA 2E6KA 4KIWA 2D31A 4QBTA 3ARBC 1D6NA 1Y0LB 4YJFB 3TO4A 3ZDZE 5FF6A 2SEBB 4L8VA 5JA8B 2VJMA 5GRXG 4WHCA 4CGTA 3HYTA 4QXRA 3QBDA 1BWPA 2Y06H 3W5VA 5B38A 3TG2A 1CE8B 3QNFA 3NOXA 4YIKA 4B2PA 3ME0A 5IEKB 1I85A 4LVOB 3KSAC 1M6UA 1ES0B 3THYA 2F3PA 4R8RA 2VDQB 3ZD8A 4QX6A 3PSAA 1LJ8A 1IOLA 4ODSL 1YL7A 3ARRA 4LPKA 2JCCE 1LWJA 3T1OA 4QOGA 3MRKA 1SXCA 5AW0A 3S34L 5KQRA 4OD0A 5E5MA 4H0IA 3OLXA 1RYDA 4EZKA 4HS4A 3RVOA 4HADA 4G8AC 3U4BL 2GVNA 4EB0A 3B2XA 2FPGB 2X7LA 1P3JA 3DO6A 4KCGA 4DY6A 1XDDA 5E4FA 2Z91B 5EXSA 4AO7A 4L75A 3MV9A 3KZCA 3ZR6A 5I16A 3VYSB 4ITVA 1BVNT 4MYTA 4LE8A 3C4VA 5IXYA 1W72L 4QXPA 4ZBJA 4NXNB 1T9DA 1JFVA 3W38A 3U1BA 3TA3A 3OHXC 2CXGA 4XRCB 3PUCA 4WDIA 1PT6A 4JVPA 1LWRA 3E3LA 3FO2B 1DJMA 1HZHH 3RVPA 1XHHA 1ACZA 4Y2SA 1PZ5B 5ILQA 3FVTA 1HL4A 2HPZA 5TE4L 4D02A 5IBPA 2WCPA 4HO1X 2NYRA 3QJFB 4PYGA 1EGVB 1E7QA 4B5EA 3RC7A 1F12A 2OBYA 2JB5L 2W0FA 2R97A 4N7RA 2PCPB 3RJ5A 4YE4H 3PVSA 1PS3A 3X13A 3OIFA 3TLRA 3RVVC 1JVLA 2ORBL 1SD5A 2Q8AH 4KV5F 3ZKXC 1QO3A 1X5GA 1NAHA 2VE6A 1I7ZA 5G2NA 2Y0DA 5AVUB 4KUZH 3L3OC 2Q21A 2F1RA 1HCFX 3U61B 4JHWH 2H7VA 2WZBA 5U9CA 1WBZB 1P4HA 2YWRA 1E43A 4BUZA 1OGJA 4D8PA 1TYRA 3H3PL 1EO8L 1KDVA 3HCBA 1DLHB 1UXMA 4KO8A 2OW6A 4EG1A 5L2KE 1JF8A 4PNPA 1PKXA 1G9XA 5D1XE 5ADOL 4EHAA 1JDJA 4KK8C 5GGRA 1DXYA 4N0RA 2J6EH 3EZXA 3L3JB 4BP3A 1FNSH 4RQQA 4CDHA 5FPKA 2ZUBA 1D7BA 3M9WA 1FW6A 4BFUA 5KTOA 4CMGA 4MDIB 4KY1H 3PGVA 5K9OA 2XUIA 4MA8H 4ZNEE 2VUKA 2DQFA 4HCIA 1QQ7A 2BZSA 1KU6A 2YRWA 4XVHA 1IC7L 1OP4A 2HMIC 1FSGA 4R8KA 3FULA 1EHXA 2G2NA 1AACA 3RRYA 3D0LB 4YRCA 2UUAB 5IB5A 3UGEA 2VO8A 2ICEB 1IKNA 1VB9A 5AL0A 1XYYA 5FWXA 5K6AA 4M48H 1MEXL 5JY6A 1QVVA 3VXNA 3FU7A 1DVFA 3TV8A 3ZDYF 3KL4A 4M4RB 3EYFB 2QX7A 3WBFA 4KACA 4PLWA 4NKIH 1I3VA 2XECA 3LRKA 1V5FA 4LRSB 3UCQA 4BFOA 4HZLA 3PY9A 4PJXB 2BP7B 3FYTA 5EAIA 2C9OA 2EKPA 4W4OA 3IWVA 3VG9C 2MPAL 2R29H 3MTEA 1IEAB 5G41A 4HJ1A 2VC2L 3JV0A 1JEQB 4B7LA 1W15A 3ZWQA 5J2TA 2Y5TB 2UXDB 3KJGA 2P40A 2OK7A 3D3QA 3G04B 4E22A 4ABQA 4O2BA 2PIDA 4I3HA 4OIFA 4F86A 4FC6A 2XX0A 3IV7A 4U6QA 8GPBA 1QWHA 2C92A 1QF6A 4QXUL 3RA7H 3U48A 2FT7A 5TXGA 2RK4A 4WVRA 1Z5NA 2ARKA 4P5TC 1XQ9A 3M2PA 3PJRA 2QZQA 3IALA 1KXZA 4FHKA 3MMNA 4L5JA 5F1IA 1BS1A 4K6KA 3QYCA 2E7LC 1B6DA 4Y8VA 3OQRA 9LDTA 4NFCA 3CCHA 3PC8A 4WWHA 4ZT6A 1VCIA 4AIOA 2WIDA 3TT3H 2AVNA 5KSAA 4WADA 4XUGB 3K6IA 1CF1A 1RIVH 3EJRA 3M89A 2F9MA 1OM3L 1N26A 2XRAL 3MRCB 1TNDA 2F5AH 2IIBA 1EGJL 3MLSH 5TK2A 2UYGA 3HDJA 4ZCPA 2ODEA 3HUUA 2D3NA 4O8CA 4IUCS 1YCGA 4ZU1X 4JBLA 5BMFH 3U36A 5EGNA 2P2DA 3D0QA 5FKJA 1D5WA 3MUFA 1R00A 4H60A 4BWTA 4Z7JA 1CULC 1BVLB 4OBEA 3CQFA 3U1PA 3V52L 4AQ1A 4CG2A 3MNMA 2D2CC 3K32A 3TCTA 1BAWA 3LRLA 3I92A 3AFHA 3EASA 3CG0A 1AG6A 1FSPA 3U2SA 5C0AE 3DB2A 1DBPA 1CU1A 3O3BB 3AG3B 4RZKA 1CBJA 1QPKA 1LSSA 2AV7B 2EXYD 3T2NH 1WAAA 1WGOA 2OK0H 2NADA 4NCBA 2V58A 5LMCA 1Q0HA 3EZ8A 2GQ0A 4K6GA 3JVDA 3AYZB 1OXSC 1MIOA 5KWSA 2ZDHA 3QFRA 3L5XH 2HRLA 1N64L 3K6DA 3W1VA 3B1FA 1YB6A 4S0SD 5J5EA 2EF1A 3GFGA 4ZFGH 3RNKA 2ZCKH 5AW1B 4WW2C 4PGAA 3K53A 4MQ4A 2WK1A 2VUYA 2HHAA 2CBQA 1XZNA 2QGNA 3NGLA 1C8BA 4WSJA 2CVFA 5F3HB 1RUKH 3I1IA 5J4KA 3FT1A 4H8QA 3DVIA 2VC2B 4E5UA 2MT9A 4BEBA 3FT4B 3RWFA 4QFBA 3FTDA 2Z5FA 3RV3A 1C1XA 1C50A 1KRHA 1GA4A 4JI7B 4GEIA 1TCUA 4M1GL 4WA7A 2O8FB 3OF5A 2PYDA 2C5EA 2A35A 1XQ4A 2CV0A 1R19A 4C83B 1J8DA 1IAKA 4LI3X 4HUCA 2C9PA 4HQFA 3WRWA 2H85A 5EPMA 1U93B 2JJWA 6ADHA 3PL6C 4AX8A 4WL0A 2FJHA 1H8EA 2B7BA 3AQYA 1HLFA 4LASL 2PKYX 1WKBA 3A4EA 1QE0A 5CVUA 5I5GA 3DGCR 3MFQA 3T34A 5HK9A 3FPBA 1PQZB 2WYTA 4ON9A 2JLRA 1Q4NX 3HZMB 3EYUH 2OYKA 2W6CX 4NMMA 4E41B 1N5YL 1PZNA 3HE7C 1AQNA 3U4AA 5DHFA 1LW6E 2FHPA 4GT0A 3CURA 4DV3B 3DFKA 1KYWA 1W4CA 5KVFE 3AHIA 2NXNA 1XOIA 1DYZA 3UC0L 1HT6A 2XPGB 5JD3A 3DTVB 3IDIA 4LA4A 3K8YA 1YK1A 2BSSA 3DTXB 2WT4A 3ABLB 2PEZA 3E9CA 1NH6A 3VB8A 4DP5X 5BV7B 2PJZA 1KVRA 5D51S 1NQBA 2W2XA 3EVFA 3KYMA 1T43A 3DOCA 1P9MA 4PGHA 2B0JA 2EAEA 4H17A 1YEGH 3Q3VA 1CR1A 4Q1AA 3RUDA 1X5IA 4HS3B 1VZHA 4YP9A 3BMXA 1XR3A 1UM5L 1TU2A 2J85A 3MV7B 2VHEA 4MLSA 1GUDA 3S2YA 4KK5C 5CXSA 3QJGA 3PVZA 2PW1A 1SQGA 1SF5A 1H3WM 3OQIA 2CB0A 4Q9QH 5L3QA 2I1LA 1WVGA 3RZCC 4QFMA 1TUIA 4ZK6A 3IKLA 4ZO6A 4XMKL 4OGFA 1U2EA 3WB1A 5FFLA 4N90E 1E96A 2E1PA 1YQWA 4U5XA 4DZRA 4GR4A 3WB9A 2RKOA 1Y5IA 5JSUA 4OFXA 4JHVA 4MW9A 2IUEA 4N2IA 3M1OA 4QICA 3MHZA 3INGA 3CH1A 2AJSL 1S7XA 1Y37A 5F7OA 4LGPB 3VZRA 3WGVA 1YSCA 3C09C 3G2PA 4LQDA 5DRWA 3VE0B 3EQ9A 3D4OA 2AX4A 4KO4S 2NTNA 2IFFH 1N1MA 3MRGA 1OJLA 3DD5A 1RPQA 5SZHB 3GSNB 1XT5A 2OULB 4PN7A 1BRMA 2BSBA 4TV8F 3D4NA 3TNNA 1ECJA 4B79A 2W60B 1JQEA 4AL4A 1ROWA 2ORIA 3DOOA 3BCSA 3LCUA 3G5MA 1C7QA 5LN1A 1NF9A 5DXJA 4FVTA 1UBGA 1DDHB 5TK4A 5B4MC 4L05A 1XV5A 1EP1B 2HMYB 4B80A 3MAWA 4KWCA 3ND5A 4UOJA 3AX6A 1J8KA 1VCBC 3V0HA 1HE2A 1VMDA 2QJWA 2EFCB 4AIZA 2HLFD 1X1EA 3JQAB 5CXPA 2AKEA 4Y9GA 4XOUA 3WFIA 3WYCA 4U9HS 1B2YA 5CYGA 2IYUA 3RX7A 4AF7A 1QMUA 3FOZA 4CN6A 3OXSB 2R6JA 3N2ZB 2G3XA 4HJRA 4WI1A 1L9OA 3R0NA 1DJSA 2VPTA 3BW9A 4HDRA 2FSVA 3DQPA 3PJSB 1AS6A 2DTDA 2K3HA 2GK4A 4FPXA 4XTCS 4CGUB 2VCYA 3P9RA 3O38A 1T1ZB 1BQKA 1IH8A 4AJNA 3NESA 2E46A 3MYRA 2ZG6A 3GMRA 3RFZC 4NBYB 2BCEA 3QX7A 4V0RA 3PDHA 3UMCA 5CCDA 1J5PA 1F00I 1CUBA 4RPHA 3Q06A 3L6RA 4M55A 4ONFH 3NJ4A 4IRJD 4ZO9A 2F5BL 4I5BA 2ZKLA 3C2AL 4LECA 2UXCB 5LP6A 1H22A 2ZRLA 1IFRA 2V1UA 3WNDA 1HDRA 2LABA 3JQAD 1DO0A 4QUEA 3NJNA 1RLTA 1NCDH 3V9EA 1SY6A 2Y1VA 4MJXA 2JIMA 3VGBA 1PFOA 1PWHA 4IW3B 1BA9A 3O2DA 1G3UA 2XKAA 2ZZKA 5DZNA 3WEXA 4HLZG 2VLLA 2DLEA 1U7TA 1ODCA 5D1ZA 3CVOA 4NBTA 4JPWL 3LP8A 2LKDA 1DQJA 2W0PA 1LQTA 4HW6A 5LQMA 2ZI3A 4MHSA 3HFRA 2ZUXA 4XNMA 3ZVMA 2IQ9H 1A1OA 2PTVA 4U1GB 4NU0A 2MTPA 3I2HA 3MRIA 2VJPA 1X2EA 2REQB 1GXSB 5F7LB 4G07A 3TINA 5KOJA 2HSWA 3MERA 1AZZC 4G56A 9LDBA 4OJEH 4L8WB 3V6OE 4BMOB 4WJLA 2NNCA 4KZKA 4DN4H 3OAZK 2E4AA 2NLJA 2IKQA 4GI8A 2HUNA 5B7FA 4BBPA 2G9KA 4GMSL 3C7CB 3X1WA 4GMTH 2HSZA 1TETL 1P9RA 5INCA 4YXHH 2QSZA 2IWGA 3MTDA 2OKMA 4F2FA 1RMTA 1RPAA 3L3BA 4S1NA 5E5LA 3L4JA 3IMTA 1JE1A 3F2VA 4XN4A 1UGNA 3CFBA 3T3MF 5HYSB 1Q12A 5EU5B 1XF9A 4AWXA 3CLWA 2HQSA 3JASB 5KC8A 4UBLA 1XH3B 5D4JA 1PEZA 2IDJA 2XGGA 1B6GA 4NPKA 4NAQA 4HS6B 3IKTA 4O3MA 3FGPA 3FW6A 3D6HA 1LK0A 5BVPH 2ZCLH 3EXFB 2QT1A 4HOMA 1E6JL 2IHJA 2G4LA 2BDNH 5E2VH 1HDCA 1YOVA 1HQRA 4ENRA 2GO7A 1HYRC 4K46A 3RWGA 1G84A 1XBRA 1AE6H 2JCGA 4DO5A 4JCLA 2VA9A 1NPNA 3HJEA 2QAJA 5JD6A 3JT2A 1TJIH 4JO1L 3KUKA 2OXRA 1ZIDA 3PQ2A 1N8ZB 2HU8A 1QZ3A 1U3HA 4TTDD 1I3OA 3ZNNA 3DF7A 4JBYA 1L7EA 1QSEA 2P79A 4HUKB 1MW2A 3DMYA 1KEPA 3HRIA 5ALVA 3QULB 3PNOA 2Q27A 2J48A 2BERA 2WU0A 1NGSA 1YZTA 4LKCA 1C5KA 4JFFB 4HNTA 1NKOA 4ZVVA 2D2FA 4RHFA 1G8SA 2XN9D 1A7BA 2GPAA 1OLSA 1YJCA 4M86A 1U7OA 1QLJA 2TYSB 2HFEB 4Z7WB 2N42A 1TYZA 4ZZ2A 2PG3A 2AW3A 4N82A 3CH5A 3JWDH 4WU7A 3S3BB 4L2YA 1LP9F 3KETA 2WLLB 1KP9A 2O6LA 4NLAA 2WBJA 3LQZB 1EM8A 2G9HA 4LYYA 4RPJA 1CE1H 4PHFA 3VNUA 5DRYA 5GP1A 1QV9A 1A88A 1B43A 4J0CA 4AI6A 3H42H 1Q0PA 4KKQA 4WO4D 2BZ0A 4BVJA 4LLMA 3CG8A 1JWMB 1AQKH 4NO0A 2UXFA 1D0SA 3QDGE 2IPAB 1P5UA 4MA8L 3O03A 2QHRL 2K8QA 4RA9A 3AP2A 1NWHA 1FJ1A 1YR3A 2DH2A 4CMMB 1MUUA 1CFQB 1T6WA 5GRZA 4LDLB 4A0FA 1BVLA 2JLXA 2C97A 2QQQA 1AKEA 3NBYC 4FT2A 4DWHA 3KLKA 3PHCA 1R5VA 2JGNA 2HX1A 2JL1A 1T9GS 5KYGA 4DCNA 1U95A 4NS1A 5J59A 4DRXA 2C1EA 3SKNA 4IRZL 2AZMA 1MWAA 4M0LA 4LHUG 2IOFA 2A30A 3T8XB 1OB5A 5JAUA 4Y8DC 1QLRB 4RFSB 1IU1A 5C9KA 1NVXQ 4J3FA 3AL2A 2XIDA 5CEFA 4ZV7A 2V1XA 2C1PA 4MB1A 4LZAA 3E22A 3F9CA 1LH0A 1CZLA 4CMHB 4YJKA 4BPBA 4ARCA 3KJFA 1PO7A 4RY9A 3C5SA 3BB1A 4X45A 4ADSG 3GJFB 2X0JA 3MJ7B 1S7SA 5JC8A 3E2MA 1PE0A 1DWUA 5CAEB 3WEAA 3GDOA 4Q15A 1B6TA 1RHHB 2BSAA 4A66A 2K4WA 1SMKA 1NLDH 2WTAA 4WZBA 3GNLA 3FQUA 4IIZA 4EB6B 1EB9A 3CVVA 5CGYD 3NI2A 2CCLA 2F62A 2XCLA 5G0SA 3H9QA 3GLTA 2XUQA 2FHCA 4NFBA 5AXDA 3V8QA 1M8JA 4EL5A 4OJFH 2BHZA 1RIVL 1C7ZA 3TMYA 4LRTB 4KLAA 1N2CA 4EKYA 1T36B 3A4DA 1FBNA 2GN2A 4EVSA 1IDN1 2WANA 5SX5H 4F3FA 4NDNE 4NCC2 1NLBH 3FBTA 5AQ1A 2E4YA 1SGKA 3AXIA 2X0IA 3ULSB 4PJBF 3G9XA 4WKPA 1FFYA 1QZXA 5I74B 2WXIA 1OP3K 3UPRB 3X12A 2P3QA 5ESVA 3NN8B 4M9XA 4ZTPH 4HDMB 3QE9Y 1X5AA 1KI4A 2ID9A 3FUXA 1IAII 4LK2A 3MUGB 4KQ2A 4GRWB 4FZ8H 2QTEA 3TZBA 2DJSA 4U1LB 4IFBA 1RVV1 4BEVA 3IMVA 1EH9A 2EP5A 1YHZA 3EYAA 3WKDA 1X5JA 4YR7A 4L8DB 1UJ5A 1GU0A 2OHXA 3ZDXE 3QF7A 3W9UA 2VLJE 1MFZA 1NMBH 4BQRA 1AKQA 5LIPA 4Y6LA 2MCFA 4M6ML 3FTGB 4EJMA 3R09A 1E79A 1TPYA 2ZULA 4RD3A 4YBQC 2AJLI 3R2JA 5AUMA 2AC4A 4F2MA 1MFNA 3HBMA 4NOJA 3Q1EA 4FFZL 1RQ7A 1UP7A 4OZIE 3UMYA 3HZMA 4M43L 1IE3A 4KKNA 4PHHA 4EUSA 2OGSA 5JCZA 1GAFL 3G79A 1HZHL 1EFXD 4RU1A 4AMYA 2ESVD 1PLCA 4GZ6A 3EGWA 1J05A 4P08A 2EXYC 5AW1A 1MLDA 2YKGA 4LC1A 1XU4A 3JQGA 2A1UA 5JPCA 3LRSA 2GJSA 3ZL4L 3SZOA 2W8BA 3B9EA 2I55A 1ZL0A 1B8UA 4M8VA 1WCV1 3GBPA 2E7CA 4OUKX 4Z54A 3EJYC 4I14A 5IMMA 2R39A 4I4CA 1PT7A 3GRWA 1UJBA 1I7SB 4TOYL 2FEJA 5BO1L 4ZIRA 5B7NA 2XA3A 2CMGA 5KYTA 4TVPE 2OTPA 1SFDA 1PJAA 3L1GA 2RJNA 3FUMA 4M6OH 1NAKL 1H5QA 2Q76B 3HWRA 1PUIA 4UQLA 4Y16A 3FDZB 2RHEA 2VBIA 1OFUA 2AG8A 4LHUD 4G1CA 4A2GA 4TSBL 1WWBX 4CSTA 5EZ6B 1J8FA 1CKEA 1P4JA 1R0BA 2K6GA 4XM2A 1V7NL 1TO1E 4RKEA 3DLBA 2ZWSA 4OGYH 1KZ6A 4M6WA 1UKTA 5HVWA 4LLDB 2CPCA 2H32A 1KPHA 3PPIA 4EKEA 4IJ3B 2BSEA 1YZ3A 3D3WA 4IW4C 1GY2A 2PFKA 1AZWA 1FLRL 1T5LA 3DV2A 4M1KA 3S35X 3H5AA 4XMPL 3NHAA 1YVPA 4LNRB 3UJTL 5A3JA 3SK0A 2DHQA 4V3BA 5DBHX 3UTZB 1N2ZA 4W9CC 4ZYZA 2DP4E 4OZGA 1RYFA 1TCCA 3H2QA 2P9JA 1EDOA 1JHTA 2NTFB 3G82C 4D0BB 4HLJA 1DQQB 1Y89A 3WRYC 1EFCA 4PB0H 3AZOA 2XCSB 3EDRA 3SQWA 1R9GA 4B2IA 1X70A 5AB1A 1JECA 5L6LB 1ONOA 1EQWA 4H4NA 5K9KA 4JODA 4U1MA 1OBVA 3Q7EA 2K7FA 2NVUA 4F7DA 3TRKA 1JPUA 4E2OA 1JIVA 3E0GA 4MJHA 1MV8A 3M34A 5B39B 3IV6A 5D1ZI 3HSKA 5FUZL 3UMNA 1GNRA 4YAEA 4NPHA 4Y19E 1OE1A 5DRXA 3JYQA 3KT0A 3UHFA 4GAEA 3CZPA 3SC2A 3T4PA 4BLTA 3E2PA 2BP7A 4UJ5A 4N9GB 5AOJA 5AJZA 4PRPD 3F9IA 2VJ8A 3BK7A 5HTOA 4PQGA 4C57C 3MRJA 4LCIH 2WUGA 1S89A 3RFVA 3SJVD 3LV3A 1I6LA 1CLZH 1BDIA 1F4YH 5J47A 3DDGA 3OF2A 2F8XC 3GNTA 1QRTA 1NJ1A 2GBLA 1WXWA 2W81C 4NZUH 1ZJBA 3ZEAA 2BJML 3AU9A 4ZT1A 4JJ5B 5IVXF 1U36A 2H1CA 2OS7A 4AM0B 1I10A 5IFKA 5ESVB 1L5YA 2H1IA 5C4GB 1MLBB 1MR3F 2VXQA 2IHZA 4N0YL 1GOFA 3LIPA 4KBGA 3FTUA 5ALUA 3CN0A 3GLIA 1L5HB 4LAQH 1TQCB 2XTSA 1ZGLM 4G9DB 3LDBC 5JQ6H 4PGMA 4Y2DD 5IYZF 1R6DA 2D1SA 1YRKA 3MJ4A 4DDMA 3Q2VA 2G3MA 1CTNA 1IQ0A 4XN8A 2OMNA 2GEJA 2WBWB 2Q2WA 1X9GA 1PCSA 1XTBA 2DFTA 2ZTHA 4QQKA 3AOGA 5EIVA 3C5ZC 3T2NL 4K5OA 1T34A 2Q1TA 4FNMA 2X9LA 2YGQA 2ZT5A 2VP6A 3T0BA 3BGSA 3OXSA 1TM2A 2IQAA 4CL3A 1KYVA 4BE5A 3P2OA 4R7DB 2QE7D 3FJ1A 3GJ3A 1SBCA 4AX4A 1GGUA 4HEPA 3LQAL 3VSTA 3QUGA 4X84A 5CBAB 1XMVA 4N2GA 4L2IA 5J2UA 4IOSD 3T95A 1G18A 2B0SH 2COKA 1WDAA 4PG4A 4IDPA 4UILH 1K63A 3ZI4A 5EEUA 1FVDA 1WD8A 1H0KA 4M3HA 3IAHA 3JWDC 3WMRA 2Q46A 1M4KA 4U7JA 4DHWA 4M9RA 4NPAA 4WI8A 5T33L 5JJIA 3D0LA 1IC5H 2ERCA 4A82A 4L9SA 4KQ4H 3W5CA 5T6MA 3HU3A 2JIBA 4HPYL 5A9TA 3R9KA 1ID5I 3N86A 1ZT7A 2RKWA 5FOBA 4PBSA 1C8LA 4MRNA 4RF2A 4P98A 3WZ2A 3SG0A 2VT0A 2FPMA 4ZYLA 2EACA 3FRJA 5I7WA 2C4VA 1JNHA 2FHSA 4Q0MA 2YW2A 2ZYRA 4AE0A 4C3OB 4ZQIA 3PGDA 1YBFA 4XM0A 1PZ5A 2ZOLB 1L7IH 4OFYD 3S97C 3EFEA 1IL1A 3KZ1E 4IEEA 5EGSA 2K9UA 4ODVL 2WP0A 1DVTA 1RMFL 5LVAA 1GPUA 3W7BA 1FFQA 4I8XA 1IJNA 3GC6A 1RIUH 3T0GA 4UANA 1SUBA 1JNYA 3UJJH 5LXTA 5F0PB 3CQQA 1MFEH 4OKNA 4IQ0A 2QL9A 3AROA 3AERB 4M62L 2GTIA 1J48A 2CLRA 3TUJC 1QFYA 2BR3A 2OQRA 4XHJD 1UDCA 3KFXA 1EB8A 4UDTB 1Z6PA 1HI6B 1SJXA 4BCDA 2GLTA 4F24A 3QQPA 2OSVA 1UH3A 2ENJA 2QSJA 4PJDE 3VOAA 3CVIL 3PKJA 4REOA 3A4TA 3MNZB 4OHXA 4FQJH 4FGLA 1BQLH 4HOYA 1SURA 2ZROA 2IIJA 4HULB 1DVUA 1OAZH 5I48A 3PUUA 1Q91A 1LD3A 5IM7A 5FLVA 2P9ZA 4ECEA 1ES0A 4PG7A 4IRJB 2Z0MA 4JVSB 4EDHA 3ZWYA 2P4UA 2J5XA 4DRZA 1RJCA 1YMME 4B9PA 3F9RA 3ML1A 1XAGA 5JI2E 2H9GA 1PSDA 2D74A 2AABH 2O7SA 3TTVA 5I4CA 1BBJB 5B3JF 1E1MA 5FF6B 1EXUA 1U42A 1PBNA 4A8JB 1BMFA 5EJFA 4H1LA 3FQRA 4C6RA 2I67A 4PJIA 2XN9E 1EFPB 4G36A 4XOIA 2XIQA 3A9RA 4DYVA 3VNZA 4XN9A 1Q14A 4M76B 1JMZA 3RBGA 1P1HA 3IGUA 1P6FA 1OCWH 4CV2A 3EO0A 2UXBB 1QFWM 5LQKA 1BWMA 1DBKH 4MYCA 5BWBA 2ZSBA 2OXGB 1DXOA 2OD7A 3BT7A 1D2OA 4TOIA 3LPAA 5E6RA 4AY3A 3ABIA 3VYPA 2IFFL 3LQKA 2F19L 3SZGA 4DGVH 3M6DA 5JXEC 2HNAA 2Q5IA 2VR6A 1S8DA 2V7XA 1S6NA 2FZ3B 4Z7OF 2FSEB 2OGUA 5AB2A 1Y1UA 3BRCA 2ZAHA 1EMTL 3TF7C 1NRIA 4Y2QA 2QZ5A 5HYJD 2OXEA 5C0JA 2D31B 3OKPA 4UOEA 1QPZA 3A6GA 4Y2PA 1JNHB 1ISRA 5FDWB 4B41A 1EJ0A 5B4MD 3D5QA 4P2GA 2OTUB 5EHQA 4XR9A 1CE1L 4C2UA 4X1OA 4MDFA 3F6JA 1FF9A 1FHNA 3SHFA 2M6KA 1PYOA 4P59L 1G9NL 2F55A 4M1OA 4CDNA 4IM7A 1MP0A 3N2LA 3ED5A 4H16A 2DIJA 4X93A 3ZGHA 4UNIA 2HO5A 5E2TL 3GLFE 1YIOA 2DQKA 3G2MA 3PVCA 2ZYVX 3F7OA 3EAFA 1ZLUH 3GI9H 4OQTA 1U8KB 4CUZA 3Q4GA 2VGLM 3FQ1A 3WSWA 4M8NE 2V9RA 2Q5CA 1I7UA 3OGCA 1WFMA 1RLIA 3O1HB 3DUHA 3FROA 5IFHL 4YSUA 5I9QC 3GR6A 3CBRA 5JQGB 2P7HA 4GKOA 5KJEA 1KNXA 2YHIB 1U8CA 3AEUA 5JO0A 3AG1B 5FUCE 3TESA 4A3SA 1ULZA 3AEYA 3L5OA 4EPTA 3QFJD 5IT4A 4QGTA 3VUFA 1L4MA 4MULA 3IB6A 4NCNA 1YEIH 3SD5A 3ELQA 3RVUD 5IW1B 4PYOA 4FULA 3TS8A 4GMSH 3FO0L 1JAEA 3GGWA 5B7PA 3GXPA 2JBWA 3NQ41 1N1DA 2CNDA 2GNOA 4TMKA 2P8PA 3TZQA 1U8FO 2J6CA 4MWCA 1R74A 4HEPG 3L45A 3IT2A 5LLSA 4MXDA 5FPSA 5IF0A 2R0LL 5AVXA 3J8F7 2YZ8A 1NVVR 3P9XA 5EG5A 5EY5B 4KK9C 2XNAB 3S3PA 1J1XL 2Y25A 1W1UA 1X9RA 1Y1TA 2GILA 3OZFA 4ZCRA 3CRQA 1DAGA 3QLTA 4CNQA 1G5AA 1E9PA 1AVAA 4DFDA 4DLUA 1S7TA 4P0TA 5L45A 2ALJA 3NM4A 5B36A 5IIEA 2B3RA 1Z06A 5B1BB 2DQUH 2ZOUA 1J2EA 3U4MA 2AUNA 3U7RA 1Z0NA 1XHFA 2Y24A 4Y2NA 2B5WA 2QAGB 1E3IA 1E6WA 2RTTA 3WXMA 4R4JA 4Y9SA 3EDMA 5H35A 1EVLA 1FS4A 1AKUA 4FXKC 1O3YA 1RIIA 3QUTA 5LDSA 1YG9A 2YR0A 4JU8A 4NYJQ 1TVHA 4OGWA 3O6FD 3AF6A 3VU1A 3AW5A 3Q9SA 2HCTA 2BF4A 3FO1A 3QJSB 1LX6A 5DVOA 1OIXA 1XU7A 3GA7A 4D3CL 3UTPD 1CFJA 1LO4L 4A1RA 1Z5OA 3T5PA 3X2SA 2OFQA 2F6RA 3BVDB 1NMAH 4H4CA 4IDJH 3VAYA 4WVLA 1E1RA 2BVQA 3TEXA 1F5NA 3FN0L 1CJSA 1XTTA 2PW2B 3PFIA 3GPIA 2HA3A 3IAS6 1WGVA 1P7KA 3WI7A 1Y1LA 4K6CA 1KELL 4BO5A 5F7DA 5SV2A 3WNKA 1YMMD 4QTHA 5BSHA 1WZ1H 4MWFA 2P4EA 4TMFA 4UEWA 3TURA 4UMFA 1G5FA 3FUFA 3MR9A 4AJOA 3UBXG 1S3GA 2WG2A 1MN4A 1XB2A 5AOAA 3A31A 3O8NA 5KU7A 2EDJA 2HBRA 3W6OA 3QFHA 4U2KA 4N5NA 1EWKA 5BQDA 5IJBC 2BZDA 3PEVA 2EXSA 3WTSA 4Z8YA 3QJXA 4ZYKA 3K0EA 4TULL 1LWNA 1FP7A 4XAWL 2ESVA 4A27A 1OGPA 1JHOA 3WFZA 5JHDE 2AEIT 4J0EA 5CDYA 3FPEA 1JALA 5T3ZE 1OAYL 3JD2A 4IQFA 1W6LA 1FSKC 3RHTA 5LGKA 3OO1A 4D94A 1I36A 4FQCH 1CZRA 4LYHA 4CILA 1H4TA 1PZDA 1KI1A 3VRIA 3K1AB 2IEGA 5JR3A 5IZCA 1JE0A 4CCWA 1JHLL 3F78A 3UTSA 2FOIA 4DDWA 2YSSB 4W7IA 2WUWE 3WK7A 1BAFH 4XC3H 4BFRA 1B3JA 2H9GB 2BVOB 3Q5EA 3BAIA 5EJEA 4BHUA 5JWOA 2WYUA 3KXFE 4L3FA 2GR9A 2W6OA 5GWXA 3IAS1 2G5UA 3V55A 4F33B 3FT0A 2NSLA 3BHMA 4P7KA 1XL4A 1P2CB 1RQ2A 4RHUA 4PJ9D 3F58H 1ODLA 4CGZA 1GRNA 5CJXC 4PLGA 2QKYA 3OJWA 4EVNA 4C78A 3RY5A 2FUG1 3VTZA 4HG4J 5ARBA 1KGWA 1F6BA 1JLRA 1U8QA 3ZYOA 3G0OA 3LPWA 2Y1XA 3N7TA 5BSWA 5KAMA 2WPNA 3QPXH 3K0AB 5DVMA 4QC2A 3OTTA 1YDWA 4HXBH 1VHJA 2EKLA 2Q20A 5I9QB 4ACAA 1P4GA 4HY3A 3PGFL 1E1QA 4JHLA 2OCKA 3HFMH 4TLTA 2QL1A 1F86A 1MFCL 3VR6D 1T29A 1NDHA 1QB8A 3W06A 3SQBA 5EU6D 4IYJA 5FV7A 4DV6B 4HLCA 3NP9A 3Q2KA 4ZVNA 3IETA 4PIRF 4K9NA 4HCGA 4C58B 2DBYA 3V6ZB 5BRQA 2HQBA 5IMKA 4EA6A 4C21A 1EXNA 4F7CA 2CXQA 2OBXA 4AGQA 3QKWA 4PYLA 4MA1C 1GNPA 3U39A 4AEIL 3VJLA 2ORED 4P23C 4IKIA 1YZUA 4PPYA 1HQ4B 2H8PA 1G5IA 1ED3B 1TJMA 1J90A 3CBGA 3MG9A 4N6RA 4LCCC 3L6BA 3VH1A 3RJMA 4OQZA 1ZH8A 3LHKA 1E7SA 4S1DC 1A3LL 3BWUC 1P44A 5IHZB 4F9PC 1HE8B 1XEDA 1RT9A 5K59F 1DJPA 2V3FA 4NNJA 4TPRH 3UZEC 3NEEA 1C1EL 1PZHA 3JD4A 5L6YH 2IO5A 2YJ4A 1B0GB 1G9HA 2Z31B 3M6WA 2A9AA 5EDSA 3JYBA 4AYID 4XNAA 4QQ8A 1T22A 3I50L 2F58L 2EIKB 3EHBD 1BO6A 2WD0A 1DO8A 1Q7GA 4PW3A 5CEZE 5B1SA 3MACH 1ZRNA 1PP4A 4MW4A 5AB9A 2X7LB 2Q5QA 3K9GA 4NDMA 2XB2A 3TFBA 4E5NA 1R18A 2K4MA 3T9CA 2VKWA 4EP1A 3BSYA 4FE7A 3K74B 1GFIA 1L4LA 2D1QA 1Q21A 3VU0A 4MXWL 2Z3FA 1SCNE 3M1YA 4HH0A 3ZL2A 3TN0A 4JKPH 4WO0A 3T1QA 2VQDA 3RTEA 4XCFH 4RM3A 5I7UA 4LT7A 1KY4A 3U4HA 3RVVD 1NIJA 3QC5X 3HVUA 1SMAA 1JCVA 5H35B 4KRGA 4P3WA 2P47B 2SKEA 4BNDA 1ZA3A 5L9DH 3PRZA 1VGRA 3DRQB 4L8GA 2WC1A 2C9ZA 5JW4R 4JQYA 4FCCA 1KR2A 3AREB 3CFBB 1M5UA 2BFMA 3DDWA 2IJ0C 4XARA 1P29A 1P0CA 3RBAA 4HDNB 2B8OT 1KFAH 1SCJA 5BN1A 1UYWL 1U2CA 4KH2A 1XVSA 4LLYA 3U3MA 1M34B 2NVWA 4NHUA 3DHYA 3WRXA 4N86A 5ENZA 4E9WA 1OA0A 3GRAA 4LDCA 4XRGA 1B9KA 2R1ZA 4BVBA 3UO1L 1C08A 1TZ2A 3QEQA 1GPH1 1P9OA 4JFQB 1QFOA 3CHXA 3HYLA 4BATA 3P9MA 1P2FA 4YMWA 1KEKA 2NY2D 1AG0A 4BVAA 3LPMA 4FQXB 1BIIA 1T0NA 3U9PL 3DI2B 3IFLL 4WHYG 3SPHA 2G75A 3CJJA 4Z0BH 3GA0A 4I77L 1G1MA 2OG2A 1DQSA 4CIXA 3JW8A 1TQ2A 3LFTA 1UATA 5ESQB 3BD6A 5EBMB 4DBZA 2WXNA 2ILTA 4H6PA 2JEZA 3N3BC 2WZPA 5F64A 2X5KO 2H32H 2XA1A 5I47A 3LAWA 2ZJ8A 5F6IC 1PW7A 2QGCA 2PXXA 1ZVYA 2QV7A 3IVRA 1V7NH 3OR6A 4RQQB 3I05A 1V5EA 4XWKA 5FPTA 5F7WC 4MS4A 5JNYA 1I3GH 2XQJA 4Q34A 3VACA 1ILUA 3SDXE 1E63A 1VBFA 4KJZA 2QRKA 2V5MA 2MSWA 2PPAA 3G6DH 4AQAB 1X6NA 2QX8A 3M1CA 1BXVA 1Q0YL 3OSUA 4OB7A 3HC3L 1IY2A 2D7TL 4YQEA 1F9AA 3SZKC 1ZTMA 2APSA 1RBQA 2YWBA 3VH8G 5A5EA 3RVDA 1ETZB 3U9SA 3WGLA 1FDUA 4IDBA 1AJEA 1P7PA 3V6FA 4KKZA 5UKDA 3VI3A 4RO0A 1LEIA 1ESMA 3A22A 3B3QA 3ZVVA 4BFWA 4L74A 2GNAA 1BH6A 5AK4A 3IFOA 2R8XA 3EYOA 2Q7YB 1D9XA 5FW8A 3MAGA 2QRJA 2BOCA 1PTZA 4PIBA 3W8DA 1ZDQA 1J8QA 4U6YB 1TLFA 2ISDA 1WHSB 4X9BA 1W36B 3E2HC 4ZMXA 5C3LD 1OFVA 5A2IH 5L40A 1NLBL 2NU7B 4IX9A 1NGWB 1N77A 5T4EA 1QXSA 4PG9A 3L48A 1BE8A 2ZUVA 4HKJB 2ONJA 3VYWA 1GSIA 4UCWA 3VHLB 2VR3A 4V11A 5DYOA 4DPCX 1K92A 4FFSA 3HZRA 1F90H 1T83A 4G0QA 5TPWH 2I6SA 2KQNA 3QVTA 3BKYL 1HBJA 4YAOA 3DPBB 5JLZB 3EZGA 2QQ5A 1OTYA 1ZA6B 5C8XA 1P6QA 3N59A 2JLPA 4Z3GA 5HBGA 4JLSA 2YOAA 5J6HA 5BWCA 3F6IA 2XODA 2G4EA 1U4NA 2YQ3A 3LUPA 3G6AA 2AZTA 1Z9LA 2J8OA 4PZYA 4J8RB 3MGTA 5T3XL 1VSCA 1GXSA 3TIGA 5F5NA 2I66A 4UNSA 3F7RA 3P4OB 1ZZGA 1GGTA 5KBYA 2OFOA 4ZOLA 1CJBA 4KZDL 5MN4A 3G8CA 1M72A 4PCTA 1PWEA 5LMZA 5EXXA 4A2LA 1WPCA 2GC7C 2IYPA 1NVDA 4NM8H 4JROA 4NDAA 4XBPB 1PVDA 4WW2F 3EGDB 2VJMB 4JFPB 4OD3L 1WA2X 3BXNB 3UZQB 4OZIB 5CCHE 3PR2B 3M4ZA 4QTYA 1R66A 4GR9A 4NQEA 3KDPA 3CFTA 2EILB 2P80D 3DYIA 1XGPB 1WUIS 5BZDB 1KAQA 4GPIB 1GV1A 3KQQA 2NYZA 4QDUA 1L4YA 2KHZA 3B8YA 4ABTA 5JW3H 2PRSA 4OSOA 1RZ3A 1K8XB 2J2ZB 3OT5A 5BRNA 1SFHA 4FLOA 2OXFA 5DJ8A 3UA3A 4E9RA 1E60A 2AVGA 3AG5A 2EEDA 3DL4A 4A10A 4KHXH 5C07D 4MQLA 3DC0A 3MO1B 3GBEA 1Z0AA 3Q1KA 4L4ZA 3IBTA 1CL7H 4JCOA 1BLNA 4NJOA 1U8PA 4J16C 2R7LA 1EGMB 4D79A 3MCTA 4Q3LA 5ALBH 4D9RD 1SDAB 2QMJA 4Y9DA 4G82A 4K2UH 1F38A 2ZJAA 3RBXA 4X6DF 1XX6A 4HISA 3E80A 2UZIH 1N6QL 3DPIA 1WRBA 5CT4A 5SWQA 3QO1B 4A39A 3VXSB 3K5RA 4MRMB 2OV4A 1SUFA 1WCXA 1FLRH 4X8OA 1JLKA 2JI7A 1NBOA 2O2ZA 2FN8A 1KI6B 1QO7A 3KWXA 4JG0H 1AKRA 3QNYA 1ZLVH 2ZX7A 4N2OA 3ROKA 3O1JC 4TVSA 3KLHD 4RFLA 2OXTA 4J90A 2Z31D 2O26U 1N7GA 3FRIA 3NH6A 1B74A 1QUNB 5DZ9A 4AY0A 2I8LA 1VHWA 3LCJA 3UUWA 4PVMA 3KDSE 3X1KA 2CZNA 3CZGA 3R8FA 1EZVY 3LN4B 3ZWBA 3HZYA 1NUNB 4KNTA 2P35A 2QB5A 1VLMA 4GB9A 3UTZA 3FFBA 1AKWA 4ZG1A 4X6DA 1XKLA 1WHSA 5E95B 1ZINA 3IDIB 3TLKA 4N3UA 4F4UA 4Z7UF 4UU1A 2V6HA 3S36L 3L3KA 2QQNH 4PSRA 1CS6A 1KY5A 3JUYA 3S1SA 4MA0A 4DIXA 1CIPA 1S3SA 3SAJA 3QDMA 1U0LA 3GMLA 1M34E 3VI3B 3UXYA 1UOWA 4JMXA 4XPTL 3GFOA 3QELB 1KB5L 4Y2XA 3Q9PA 2JAUA 2R9VA 4BUGA 2O8VA 3U79A 1JRHI 2TS1A 2WMDA 4PBTA 2H17A 1SBSL 4C2AA 3BQUA 1BGXL 3SJBA 4E1VA 2O4UX 1MI5E 1U8XX 3F7TA 4BVEA 3OIUA 1YAZA 1KAOA 3R5TA 2NV0A 4PO9A 2GVZC 1HHHB 5FLUA 1HYGA 3ONNA 4JA0A 3DF9A 2DQGL 2G9RA 3EA4A 3DJFA 2C3VB 4YX2H 3VYVA 4NZUL 1TJ3A 3B1YA 4KQ3H 4G8FB 1OH7A 2RONA 1BNCA 1QR2A 1E28B 5MF6A 2I7VA 4G7VH 1NW6A 1I7TA 2H2GA 3QFSA 3KHTA 3QZOA 2D7JA <