4Z7OA

Integrin alphaiibbeta3 in complex with agdv peptide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
455
structure length
455
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Membrane protein/immune system
source organism Homo sapiens
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
total genus 97
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 4z7oA00
5FFGA 3IJEA 3FCSA 4UM9A 2VDKA 4UM8A 4MMZA 3ZE2A 3NIDA 5HDBA 5E6SA 3ZE1A 4WJKA 3ZDZA 3V4VA 5E6RA 3T3PA 4NENA 2VC2A 2VDQA 2VDOA 4O02A 1M1XA 2VDMA 3ZDYA 3T3MA 3NIGA 3ZDXA 1U8CA 2VDRA 4WK4A 3NIFA 4MMXA 4WK2A 5FFOA 4Z7OA 3K71A 3VI4A 3FCUA 4G1MA 4G1EA 1JV2A 2VDNA 2VDPA 3VI3A 4WK0A 4Z7QA 1L5GA 4IRZA 3K6SA 2VDLA 3ZE0A 1TYEA 4MMYA 4Z7NA 3V4PA 5E6UA 3K72A
chains in the Genus database with same CATH superfamily
4J82A 4JSXC 5FFGA 3UVMA 2PM9B 2JKXA 4GQ2P 4NBMA 4D6VA 4GGCA 4FAVD 3IIWA 4E5ZA 2Z2NA 1N6EA 3T3PA 3JZNA 4FA1D 2XDWA 5HE2B 1SHYB 4ZOYA 4O45A 4N14A 4BUJC 4LG8A 4BH6A 3C5MA 3MKSB 1GG2B 2I0SA 4NAAA 4J8GA 2HU7A 2CN2A 3AL8A 3AH8B 2EBSA 5B4WA 2YNNA 2P9IC 4WJKA 5E6RA 1JJUB 3PXTD 3JB9L 3O4IA 5FKSA 3IJ1A 2CO0A 4J79A 2G99A 2OK6A 5KDOB 4A0BA 3UKRC 2H6NA 4UI9R 2J56H 4ERQA 2H9NA 5FKTA 2BCJB 2IWKA 5THAA 3RFGA 2VZ1A 4CY3A 4J73A 1U2VC 2IUQA 2QXVA 3DXKC 4MK0B 5HE0B 5CXCB 4JSPC 3FRXA 3SBPA 1FWXA 3IVMA 1I2MB 3O4GA 4J81A 2BBKH 4UM8A 1C9LA 4O9DA 1MG3A 2XE4A 4D9SA 3EG6A 4A08A 2H13A 2AH1A 4G55A 5AMSA 4O1QD 5EMLB 4O02A 4NC4A 5EAMA 3CFVA 4NSXA 1QFSA 2PBIB 2EIEA 3GD1I 5AJAA 4WK2A 3ODTA 1GOFA 5FFOA 1MG2A 3AL9A 1TBGA 3VA6A 5C92A 2H6KA 1PI6A 2H14A 4BCCA 1A0RB 1GOHA 3K27A 3RMZD 4QQEA 5E6UA 1GOTB 3JAMg 2OVPB 1GOGA 3DWLC 4A0BB 4FWWA 2YB8B 3OKYA 4ZOVA 4FB1D 4DNWA 5IJ7E 3I7NA 5GXIA 1K8KC 2AGXA 5FKQA 1JMZB 2AGZA 4L1QD 4HDJA 3V5WB 3ZDYA 1VE6A 3ZDXA 3B7FA 2AH0A 4ES0A 4OWRA 3SXTD 2HYEA 3NIFA 4J86A 3FGBA 2P9SC 4E54B 2VDPA 3I7LA 2Q7QA 1PBYB 2MTAH 2QZPA 4CY5A 4JD2C 4UM9A 3O4HA 5I5JA 3ZE2A 2IWFA 3L4MD 2P9NC 1VZ2A 4J84A 1MDAH 2VDQA 2W18A 1VYHC 3SHFA 1UTCA 2AGYA 3EI3A 5EALA 4ERYA 5FA5B 5EARA 2VDRA 2YMUA 1N6FA 5FQDA 5TDHB 3K26A 2YNPA 3EMHA 4CY1A 2EIDA 2HU8A 1H2XA 3F3GA 4AEZA 4Z7QA 4PXWA 2UZXB 3PVWB 5H1MA 4E54A 3EI4B 3K72A 3BG1A 2GNQA 4A0AB 5FKRA 3SN6B 2OJYA 4ZOXA 4EWRA 3IUNA 3JZGA 4PC0A 3NVXA 4QRJA 1OLZA 1SQJA 4U1EI 3ULEC 3F3PA 3GFCA 3SVWD 2HU5A 3MZLA 5H17A 3UVKA 1JTDB 1T2XA 1U8CA 1H2ZA 2EIBA 3N0EA 4ESGA 2H3XA 1YFQA 4BL0A 1E8NA 3PE7A 1QFMA 3CIKB 4GQBB 3ZE0A 4GM3A 4OZUA 2IURA 4XYHA 3EWEA 2HXCA 2I3TA 3DSMA 4QAMA 2XL2A 1P22A 5EMKB 2IAAA 4O2WA 4L1MA 1QNIA 1PGUA 3O4JA 2WQ8A 4JSNC 3T3MA 1K3IA 3J80g 4JHPC 3UVLA 3AFCA 4L3HD 3K71A 3FCUA 3IIYA 1OMWB 4IRZA 3IUMA 2G9AA 3F3FA 4BCDA 3MZKA 5C2WB 3SCYA 2YBAA 4MMZA 4CZXA 5M61A 3GC3B 2I0TA 4GM8A 2EICA 3N0DA 4LG9A 4AMYA 3SMRA 4J0WA 4E5ZB 3IUJA 4L9OA 3NIGA 3EI2B 4CZVA 3I7PA 4R7AB 2J57G 3I8CA 4WK4A 4XEIC 3I7KA 4I79A 5EMJB 3EI4A 5M5RA 4H5IA 5EAPA 4CI1A 3NVNA 4G1MA 1L5GA 1XHMA 2XU7A 4TZ4A 4JHNA 3V4PA 1L0QA 4K3JB 2YNOA 2CN3A 1PEVA 3NIDA 4H5JA 4L3GD 4FAND 1U4CA 4GMBA 3A0FA 2XYIA 1K32A 5HQGA 3SJLD 2CE8A 4PBYA 2H9MA 3AL8B 3QI0A 1GXRA 3J81g 3P4FA 5EMMB 5M5SA 2P9PC 2VDMA 3C9CA 4YVDA 2I0RA 5IT9g 2B5MA 1O6FA 4U7AA 5I5IA 3MXXA 4Y5RD 4O3TB 1JV2A 4GQ1A 2AGWA 2P9KC 4AN1A 4J87A 2H47A 2AQ5A 4MMYA 5I5MA 3SFZA 1B9XA 3EI2A 4ZOZA 3VH0A 1JMXB 3DDUA 3EI3B 3EQ9A 4NENA 4XYIA 3C75H 1GP2B 4IA9A 3QHYB 5TEFA 1M1XA 3MKQA 4X3EA 3RSEC 5IGQA 1UOOA 4CC9A 2CNXA 3IULA 5CYKB 4A09A 3GREA 3EU7A 2VDNA 4PNKB 5M5VA 4PBZA 4A0AA 2VDLA 1UOQA 5IGOA 3UR4A 5M5UA 3FCSA 2H68A 2VZ3A 4ERZA 1Q47A 3IJ0A 3RFHA 3RRMC 5HDBA 4ZN4A 3DXMC 2OVQB 3V4VA 2HKMA 2CO0C 1H2WA 5CXBB 3OTTA 3U4YA 4J78A 4PSXB 2UZYB 3OKYB 4RE5A 4BP9A 2B5NA 3L4OD 2XZGA 4CY2A 2AGLA 3C99A 2IUPA 3RN0D 1XIPA 1VE7A 3IJCA 3PXSD 4A09B 3IUQA 3I89A 3BWSA 3I7HA 3OKTA 5IC7A 1A12A 1JOFA 1E8MA 2PM7B 1H2YA 3ZDZA 5GMKn 4KFMB 4BCBA 5SXMA 2VC2A 4CI2A 4Z8LA 3MVDK 4J0XA 2HESX 3BG0A 2H6QA 4JT5C 5HE1B 1N6DA 3JZHA 1ERJA 4MMXA 3OF7A 2Z2OA 3V9FA 4A7JA 5EM2A 3JPXA 4WK0A 3PXWD 3PVUB 3V7DB 5TEEA 4GGAA 4A11A 3MMYA 5H14A 5CYKA 3EQ7A 4AX4A 2H9LA 1NEXB 2P9UC 3OL2A 4GM9A 2H9PA 5C9ZB 5FXYA 5IJ8E 3KRXB 3UVOA 5M5TA 4IMMA 3MUOA 1S4UX 2CE9A 3NVQA 4O3UB 1SQ9A 4A2LA 2GC7A 4DNVA 2XL3A 4CI8A 5FLXg 3ZWLB 1O6GA 3SLED 1B9YA 3JROA 4LGNA 2IUVA 1TYEA 2HJBA 3MUNA 5EM2B 1NR0A 2VDKA 3OKWA 5AFU3 4JSVC 5CXCA 3HFQA 3EI1A 2B5LA 1VZ3A 3ORVD 3UVNA 4X63B 5TF2A 3OL2B 2GC4A 5HE3B 2QC5A 3SBRA 4FHLA 1UOPA 4JT6C 4RE6A 4A11B 2Z2PA 4AOWA 2O9KA 4BP8A 4GZ8A 4JXMA 5C2VB 4Z7OA 2PM9A 3EQ8A 2HKRA 5K19A 3KRWB 3K6SA 3DM0A 2OVRB 1YR2A 3PSLA 3E0CA 3IJEA 5GSAA 4AN0A 3RLMD 2J55H 1RI6A 4G56B 1E5TA 3JRPA 3UKUC 4X60B 3RN1D 3PSCB 1R5MA 2OK4A 4GGDA 4FA4D 1TYQC 4A08B 4FA9D 5JWZA 3IURA 1C9IA 2HJ4A 4D0KA 2OIZA 2P9LC 3VI4A 4G1EA 3I2NA 3VI3A 4QT8A 2PM6B 3I8EA 4K3ID 4A2MA 3W15A 4CI3A 3VGZA 4J77A 4CZYA 4PSWB 3SWSD 3KCIA 1BPOA 5CXBA 5K1CC 2I3SA 5A2Qg 5E6SA 3ZE1A 5GXHA 3FM0A 2B4EA 4QL1A 4Y7RA 2QR5A 4DNUA 2VDOA 2BKLA 3I7OA 3OW8A 4X61B 3EI1B 3IKOA 5C86A 1XKSA 4AMZA 3CFSB 2TRCB 4J8BA 4Z7NA 5HYNB 4FA5D 3SBQA
chains in the Genus database with same CATH topology
5FFGA 3IJEA 3FCSA 4UM9A 2VDKA 4UM8A 4MMZA 3ZE2A 3NIDA 5HDBA 5E6SA 3ZE1A 4WJKA 3ZDZA 3V4VA 5E6RA 3T3PA 4NENA 2VC2A 2VDQA 2VDOA 4O02A 1M1XA 2VDMA 3ZDYA 3T3MA 3NIGA 3ZDXA 1U8CA 2VDRA 4WK4A 3NIFA 4MMXA 4WK2A 5FFOA 4Z7OA 3K71A 3VI4A 3FCUA 4G1MA 4G1EA 1JV2A 2VDNA 2VDPA 3VI3A 4WK0A 4Z7QA 1L5GA 4IRZA 3K6SA 2VDLA 3ZE0A 1TYEA 4MMYA 4Z7NA 3V4PA 5E6UA 3K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFG A;  3IJE A;  3FCS A;  4UM9 A;  2VDK A;  4UM8 A;  4MMZ A;  3ZE2 A;  3NID A;  5HDB A;  5E6S A;  3ZE1 A;  4WJK A;  3ZDZ A;  3V4V A;  5E6R A;  3T3P A;  4NEN A;  2VC2 A;  2VDQ A;  2VDO A;  4O02 A;  1M1X A;  2VDM A;  3ZDY A;  3T3M A;  3NIG A;  3ZDX A;  1U8C A;  2VDR A;  4WK4 A;  3NIF A;  4MMX A;  4WK2 A;  5FFO A;  4Z7O A;  3K71 A;  3VI4 A;  3FCU A;  4G1M A;  4G1E A;  1JV2 A;  2VDN A;  2VDP A;  3VI3 A;  4WK0 A;  4Z7Q A;  1L5G A;  4IRZ A;  3K6S A;  2VDL A;  3ZE0 A;  1TYE A;  4MMY A;  4Z7N A;  3V4P A;  5E6U A;  3K72 A; 
#chains in the Genus database with same CATH topology
 4J82 A;  4JSX C;  5FFG A;  3UVM A;  2PM9 B;  2JKX A;  4GQ2 P;  4NBM A;  4D6V A;  4GGC A;  4FAV D;  3IIW A;  4E5Z A;  2Z2N A;  1N6E A;  3T3P A;  3JZN A;  4FA1 D;  2XDW A;  5HE2 B;  1SHY B;  4ZOY A;  4O45 A;  4N14 A;  4BUJ C;  4LG8 A;  4BH6 A;  3C5M A;  3MKS B;  1GG2 B;  2I0S A;  4NAA A;  4J8G A;  2HU7 A;  2CN2 A;  3AL8 A;  3AH8 B;  2EBS A;  5B4W A;  2YNN A;  2P9I C;  4WJK A;  5E6R A;  1JJU B;  3PXT D;  3JB9 L;  3O4I A;  5FKS A;  3IJ1 A;  2CO0 A;  4J79 A;  2G99 A;  2OK6 A;  5KDO B;  4A0B A;  3UKR C;  2H6N A;  4UI9 R;  2J56 H;  4ERQ A;  2H9N A;  5FKT A;  2BCJ B;  2IWK A;  5THA A;  3RFG A;  2VZ1 A;  4CY3 A;  4J73 A;  1U2V C;  2IUQ A;  2QXV A;  3DXK C;  4MK0 B;  5HE0 B;  5CXC B;  4JSP C;  3FRX A;  3SBP A;  1FWX A;  3IVM A;  1I2M B;  3O4G A;  4J81 A;  2BBK H;  4UM8 A;  1C9L A;  4O9D A;  1MG3 A;  2XE4 A;  4D9S A;  3EG6 A;  4A08 A;  2H13 A;  2AH1 A;  4G55 A;  5AMS A;  4O1Q D;  5EML B;  4O02 A;  4NC4 A;  5EAM A;  3CFV A;  4NSX A;  1QFS A;  2PBI B;  2EIE A;  3GD1 I;  5AJA A;  4WK2 A;  3ODT A;  1GOF A;  5FFO A;  1MG2 A;  3AL9 A;  1TBG A;  3VA6 A;  5C92 A;  2H6K A;  1PI6 A;  2H14 A;  4BCC A;  1A0R B;  1GOH A;  3K27 A;  3RMZ D;  4QQE A;  5E6U A;  1GOT B;  3JAM g;  2OVP B;  1GOG A;  3DWL C;  4A0B B;  4FWW A;  2YB8 B;  3OKY A;  4ZOV A;  4FB1 D;  4DNW A;  5IJ7 E;  3I7N A;  5GXI A;  1K8K C;  2AGX A;  5FKQ A;  1JMZ B;  2AGZ A;  4L1Q D;  4HDJ A;  3V5W B;  3ZDY A;  1VE6 A;  3ZDX A;  3B7F A;  2AH0 A;  4ES0 A;  4OWR A;  3SXT D;  2HYE A;  3NIF A;  4J86 A;  3FGB A;  2P9S C;  4E54 B;  2VDP A;  3I7L A;  2Q7Q A;  1PBY B;  2MTA H;  2QZP A;  4CY5 A;  4JD2 C;  4UM9 A;  3O4H A;  5I5J A;  3ZE2 A;  2IWF A;  3L4M D;  2P9N C;  1VZ2 A;  4J84 A;  1MDA H;  2VDQ A;  2W18 A;  1VYH C;  3SHF A;  1UTC A;  2AGY A;  3EI3 A;  5EAL A;  4ERY A;  5FA5 B;  5EAR A;  2VDR A;  2YMU A;  1N6F A;  5FQD A;  5TDH B;  3K26 A;  2YNP A;  3EMH A;  4CY1 A;  2EID A;  2HU8 A;  1H2X A;  3F3G A;  4AEZ A;  4Z7Q A;  4PXW A;  2UZX B;  3PVW B;  5H1M A;  4E54 A;  3EI4 B;  3K72 A;  3BG1 A;  2GNQ A;  4A0A B;  5FKR A;  3SN6 B;  2OJY A;  4ZOX A;  4EWR A;  3IUN A;  3JZG A;  4PC0 A;  3NVX A;  4QRJ A;  1OLZ A;  1SQJ A;  4U1E I;  3ULE C;  3F3P A;  3GFC A;  3SVW D;  2HU5 A;  3MZL A;  5H17 A;  3UVK A;  1JTD B;  1T2X A;  1U8C A;  1H2Z A;  2EIB A;  3N0E A;  4ESG A;  2H3X A;  1YFQ A;  4BL0 A;  1E8N A;  3PE7 A;  1QFM A;  3CIK B;  4GQB B;  3ZE0 A;  4GM3 A;  4OZU A;  2IUR A;  4XYH A;  3EWE A;  2HXC A;  2I3T A;  3DSM A;  4QAM A;  2XL2 A;  1P22 A;  5EMK B;  2IAA A;  4O2W A;  4L1M A;  1QNI A;  1PGU A;  3O4J A;  2WQ8 A;  4JSN C;  3T3M A;  1K3I A;  3J80 g;  4JHP C;  3UVL A;  3AFC A;  4L3H D;  3K71 A;  3FCU A;  3IIY A;  1OMW B;  4IRZ A;  3IUM A;  2G9A A;  3F3F A;  4BCD A;  3MZK A;  5C2W B;  3SCY A;  2YBA A;  4MMZ A;  4CZX A;  5M61 A;  3GC3 B;  2I0T A;  4GM8 A;  2EIC A;  3N0D A;  4LG9 A;  4AMY A;  3SMR A;  4J0W A;  4E5Z B;  3IUJ A;  4L9O A;  3NIG A;  3EI2 B;  4CZV A;  3I7P A;  4R7A B;  2J57 G;  3I8C A;  4WK4 A;  4XEI C;  3I7K A;  4I79 A;  5EMJ B;  3EI4 A;  5M5R A;  4H5I A;  5EAP A;  4CI1 A;  3NVN A;  4G1M A;  1L5G A;  1XHM A;  2XU7 A;  4TZ4 A;  4JHN A;  3V4P A;  1L0Q A;  4K3J B;  2YNO A;  2CN3 A;  1PEV A;  3NID A;  4H5J A;  4L3G D;  4FAN D;  1U4C A;  4GMB A;  3A0F A;  2XYI A;  1K32 A;  5HQG A;  3SJL D;  2CE8 A;  4PBY A;  2H9M A;  3AL8 B;  3QI0 A;  1GXR A;  3J81 g;  3P4F A;  5EMM B;  5M5S A;  2P9P C;  2VDM A;  3C9C A;  4YVD A;  2I0R A;  5IT9 g;  2B5M A;  1O6F A;  4U7A A;  5I5I A;  3MXX A;  4Y5R D;  4O3T B;  1JV2 A;  4GQ1 A;  2AGW A;  2P9K C;  4AN1 A;  4J87 A;  2H47 A;  2AQ5 A;  4MMY A;  5I5M A;  3SFZ A;  1B9X A;  3EI2 A;  4ZOZ A;  3VH0 A;  1JMX B;  3DDU A;  3EI3 B;  3EQ9 A;  4NEN A;  4XYI A;  3C75 H;  1GP2 B;  4IA9 A;  3QHY B;  5TEF A;  1M1X A;  3MKQ A;  4X3E A;  3RSE C;  5IGQ A;  1UOO A;  4CC9 A;  2CNX A;  3IUL A;  5CYK B;  4A09 A;  3GRE A;  3EU7 A;  2VDN A;  4PNK B;  5M5V A;  4PBZ A;  4A0A A;  2VDL A;  1UOQ A;  5IGO A;  3UR4 A;  5M5U A;  3FCS A;  2H68 A;  2VZ3 A;  4ERZ A;  1Q47 A;  3IJ0 A;  3RFH A;  3RRM C;  5HDB A;  4ZN4 A;  3DXM C;  2OVQ B;  3V4V A;  2HKM A;  2CO0 C;  1H2W A;  5CXB B;  3OTT A;  3U4Y A;  4J78 A;  4PSX B;  2UZY B;  3OKY B;  4RE5 A;  4BP9 A;  2B5N A;  3L4O D;  2XZG A;  4CY2 A;  2AGL A;  3C99 A;  2IUP A;  3RN0 D;  1XIP A;  1VE7 A;  3IJC A;  3PXS D;  4A09 B;  3IUQ A;  3I89 A;  3BWS A;  3I7H A;  3OKT A;  5IC7 A;  1A12 A;  1JOF A;  1E8M A;  2PM7 B;  1H2Y A;  3ZDZ A;  5GMK n;  4KFM B;  4BCB A;  5SXM A;  2VC2 A;  4CI2 A;  4Z8L A;  3MVD K;  4J0X A;  2HES X;  3BG0 A;  2H6Q A;  4JT5 C;  5HE1 B;  1N6D A;  3JZH A;  1ERJ A;  4MMX A;  3OF7 A;  2Z2O A;  3V9F A;  4A7J A;  5EM2 A;  3JPX A;  4WK0 A;  3PXW D;  3PVU B;  3V7D B;  5TEE A;  4GGA A;  4A11 A;  3MMY A;  5H14 A;  5CYK A;  3EQ7 A;  4AX4 A;  2H9L A;  1NEX B;  2P9U C;  3OL2 A;  4GM9 A;  2H9P A;  5C9Z B;  5FXY A;  5IJ8 E;  3KRX B;  3UVO A;  5M5T A;  4IMM A;  3MUO A;  1S4U X;  2CE9 A;  3NVQ A;  4O3U B;  1SQ9 A;  4A2L A;  2GC7 A;  4DNV A;  2XL3 A;  4CI8 A;  5FLX g;  3ZWL B;  1O6G A;  3SLE D;  1B9Y A;  3JRO A;  4LGN A;  2IUV A;  1TYE A;  2HJB A;  3MUN A;  5EM2 B;  1NR0 A;  2VDK A;  3OKW A;  5AFU 3;  4JSV C;  5CXC A;  3HFQ A;  3EI1 A;  2B5L A;  1VZ3 A;  3ORV D;  3UVN A;  4X63 B;  5TF2 A;  3OL2 B;  2GC4 A;  5HE3 B;  2QC5 A;  3SBR A;  4FHL A;  1UOP A;  4JT6 C;  4RE6 A;  4A11 B;  2Z2P A;  4AOW A;  2O9K A;  4BP8 A;  4GZ8 A;  4JXM A;  5C2V B;  4Z7O A;  2PM9 A;  3EQ8 A;  2HKR A;  5K19 A;  3KRW B;  3K6S A;  3DM0 A;  2OVR B;  1YR2 A;  3PSL A;  3E0C A;  3IJE A;  5GSA A;  4AN0 A;  3RLM D;  2J55 H;  1RI6 A;  4G56 B;  1E5T A;  3JRP A;  3UKU C;  4X60 B;  3RN1 D;  3PSC B;  1R5M A;  2OK4 A;  4GGD A;  4FA4 D;  1TYQ C;  4A08 B;  4FA9 D;  5JWZ A;  3IUR A;  1C9I A;  2HJ4 A;  4D0K A;  2OIZ A;  2P9L C;  3VI4 A;  4G1E A;  3I2N A;  3VI3 A;  4QT8 A;  2PM6 B;  3I8E A;  4K3I D;  4A2M A;  3W15 A;  4CI3 A;  3VGZ A;  4J77 A;  4CZY A;  4PSW B;  3SWS D;  3KCI A;  1BPO A;  5CXB A;  5K1C C;  2I3S A;  5A2Q g;  5E6S A;  3ZE1 A;  5GXH A;  3FM0 A;  2B4E A;  4QL1 A;  4Y7R A;  2QR5 A;  4DNU A;  2VDO A;  2BKL A;  3I7O A;  3OW8 A;  4X61 B;  3EI1 B;  3IKO A;  5C86 A;  1XKS A;  4AMZ A;  3CFS B;  2TRC B;  4J8B A;  4Z7N A;  5HYN B;  4FA5 D;  3SBQ A; 
#chains in the Genus database with same CATH homology
 5FFG A;  3IJE A;  3FCS A;  4UM9 A;  2VDK A;  4UM8 A;  4MMZ A;  3ZE2 A;  3NID A;  5HDB A;  5E6S A;  3ZE1 A;  4WJK A;  3ZDZ A;  3V4V A;  5E6R A;  3T3P A;  4NEN A;  2VC2 A;  2VDQ A;  2VDO A;  4O02 A;  1M1X A;  2VDM A;  3ZDY A;  3T3M A;  3NIG A;  3ZDX A;  1U8C A;  2VDR A;  4WK4 A;  3NIF A;  4MMX A;  4WK2 A;  5FFO A;  4Z7O A;  3K71 A;  3VI4 A;  3FCU A;  4G1M A;  4G1E A;  1JV2 A;  2VDN A;  2VDP A;  3VI3 A;  4WK0 A;  4Z7Q A;  1L5G A;  4IRZ A;  3K6S A;  2VDL A;  3ZE0 A;  1TYE A;  4MMY A;  4Z7N A;  3V4P A;  5E6U A;  3K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...