4Z7QB

Integrin alphaiibbeta3 in complex with agdv-nh2 peptide
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 114
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4z7qB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4z7qB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4z7qB03
1MHPA 4HQNA 3VI3B 1M2VA 1NA5A 3EGDB 3OL2B 1V7PC 1M2OA 4NEHB 2VDRB 2VC2B 1JLMA 1N3YA 1M10A 3HXQA 2P28A 3BQNB 4C2BA 4NENB 4G1EB 3EH1A 4XW2A 2VDKB 3NIDB 3EG9A 2VDNB 4UM9D 4Z7NB 4C2AA 4DMUB 5HJ2A 4F1KA 3ZE2B 4MMXA 2ODQA 1IJBA 3K72A 4Z7QB 1FNSA 4FX5A 1JEQA 2UZYB 4G1MB 3TXAA 4WK2B 5KYWA 3ZQKA 4PN7A 1DGQA 4MMZB 4JX0A 1AOXA 4GZ8A 3N2NA 1M1UA 4CN8A 1ATZA 5ES4B 1M1XA 1SQ0A 3PPVA 2IUEA 2I6SA 3PPYA 1RD4A 3ZDXB 1YVRA 3EOBI 3QA3E 4HQFA 2VDMB 3OKYB 1ZOOA 3AFCA 4HQLA 1SHUX 2VDQB 5E6RA 5E6UB 4IGIA 3BN3A 3NIGB 2P26A 3F74A 3AL8B 1BHQ1 3T3MB 2NUTB 3EGXA 1T0PA 3TW0A 3EOAI 4MMYA 3V4VB 1JEQB 2NVOA 1UEXC 3OKWA 1U8CB 3EH2A 4MMZA 4FWWA 4CN9A 2X5NA 3IJEB 4HQOA 4O3UB 4UM9B 1M1XB 1YVPA 3TCXB 1XDDA 2ODPA 2NUPA 1SHTX 1JV2A 2XWJI 3FCSA 3EFOA 1U0OC 3PPXA 2M32A 5E6RB 5E6SA 1SSLA 3IBSA 5E6UA 1ZOPA 1L5GA 1MQ9A 1ZONA 5LN1A 3HXOA 3AL8A 1XDGA 1CK4A 3PPWA 3T3PB 3K6SA 3EGXB 2NUTA 5BV8A 1AO3A 1OAKA 4MMYB 1QC5B 3GXBA 1U8CA 3E2MA 3FCUB 4CNBA 1FE8A 1AUQA 2QTVA 2ICAA 4JDUA 3NIFB 1OLZA 2I91A 2WW8A 1PD1A 4IXDA 3BQMB 4K3JB 3IJEA 1CQPA 2XGGA 5KYNA 1N9ZA 3NVQA 5HGJA 4O02B 4M76B 2NUPB 3EFOB 1JV2B 2O7NA 3FCSB 3AL9A 1PT6A 4WK0B 1DZIA 3V4PB 3K71A 5E6SB 5KYYB 1L5GB 1MQAA 4HQKA 4O3TB 3K6SB 2B2XA 3ZE1B 4A0QA 5KYUA 1MJNA 1QC5A 1YUKA 5KYXA 3RAGA 5HDBB 1IDN1 1RRKA 1JEYB 1BHO1 1IJKA 2VDOB 4IHKA 4C29A 1TYEB 3VI4B 4Z7OB 1RTKA 4O02A 1IDOA 1LFAA 1M2VB 3F78A 3EGDA 2VDPB 3OL2A 1JEYA 3TVYA 3K71B 1SHYB 5KYYA 4NENA 4G1EA 1MF7A 4F1JA 1T6BY 3EG9B 3M6FA 4WK4B 1QCYA 4WJKB 2ADFA 3Q3GE 3ZE0B 1U0NA 1Q0PA 1PD0A 2WINI 5KYUB 2VDLB 1PCXA 4MMXB 5KYXB 4WFQA 1RS0A 3K72B 2I6QA 4G1MA 3HI6A 3ZDZB 5KYWB 1MQ8B 4BJ3A 2XWBF 4UM8B 3ZDYB 1XUOA
chains in the Genus database with same CATH superfamily
2VCYA 3GFRA 4BJ1A 4DPRA 5F5NA 3KYNA 5KSBF 1OZUA 3BEWB 4WA7A 1HYHA 4JE4B 2OB2A 4WY2A 1KXTB 2QX4A 4CF7A 4F92B 2F3UA 1HURA 4QIRA 1GAJA 3EZ7A 1ODKA 5E6YA 3KELA 4GX1A 3GJFK 5CFQA 3MCZA 3KB2A 4YWHA 4CFSA 2EEFA 2D7TL 4NRZB 5JDSA 2UUOA 2IBZX 4TQEH 4DK6A 1WV0A 3GWJA 4EKGA 1ZANH 1ED3A 2BNQD 4GO6B 1BFOB 4EG0A 1DQJA 1WIUA 1NHGA 2OFWA 1PZ2A 2ZWYA 2EJVA 3G5VB 1RJGA 4OCXH 4OUKX 4K3JH 3KB6A 3G8BA 4RAVA 1I8AA 2B1GA 4RHFA 1JZ4A 1OH7A 3DYPA 4FE7A 3LC0A 5AZEH 3CUSA 1WCQA 4DJMA 1AGDA 2RGNA 2KI6A 3QEHB 4QHMA 4YJGA 4PC3A 5FUZL 2HH9A 4JGUA 4DT1A 4R2JA 2YD7A 4ACPA 3VD2A 1KAHA 1YLBB 4URVR 4FWTA 4FQJL 1QBKC 3ARXA 1B8UA 2FLVA 4XB3A 3VXSA 4M1MA 1JDAA 4PAMA 5IJBC 4M5TA 2PCPB 2K45A 3MRBB 4UE3S 4KJWD 2ECPA 2AZXA 4EHBA 1UOLA 3P4OA 3WKYA 1BVLB 4ABUA 3NBYC 3P5SA 2XJLA 2M2DA 5CEFA 3D8SA 4MVBC 4RV9A 3GHEH 5HJBA 3ZR6A 4DSOA 4BK5A 1VDGA 3UTSD 1W0WB 1G60A 4CMAA 5LCVL 4G1VA 3OA0A 5JVDB 1MCCA 4WXMA 2N47A 1X8KA 3K5SA 5GONF 5FOJA 4LXHA 5DZVA 1RI3A 3W11C 4IDHA 3PKZA 3T7RA 1U8QB 5TFSL 4L5AA 4ND2A 4JPVH 2FMTA 3O4RA 5EJ6A 1SQFA 3RS2A 3QZWB 1SU6A 1GMEA 2GO7A 4PX2A 4DZRA 2VRNA 2QZQA 4M00A 2VPPA 2FX7L 5EFOA 1MC5A 5M95B 1GG2A 4WBNA 3SCMA 3ZJ5A 5JHMA 4MLSA 3TM5A 3MV9D 1D9KC 3K81A 3VR3A 2FATL 3N44F 3NSCA 1CICB 4E4TA 4LRNL 3JQGA 3ARFB 4TV8B 4NQSA 2H2GA 1H9DA 1GJWA 1XEDA 3UTDA 4BO6A 5DH9A 4ZQBA 1I2AA 3ROOA 5CINH 3EPJA 1DCTA 4KPYA 2HMWA 5FO9B 2HSZA 3BLPX 5JYBA 3S37L 2LRHA 3RU2A 2DH5A 1I9RH 1URIA 2ZXFA 1Y6QA 3Q48A 1E3QA 4WLVA 3UT6A 2BCEA 3BS4A 1FDWA 3MYZA 4F04A 4RNRA 3WMXA 1AGRA 2ZP9A 4OZIB 3SR3A 3MLVL 5D7BA 1F8UA 2AFHA 4HH3C 4ENPA 4JJAA 4RELA 1JWUB 3TIFA 1UBSB 3G9UA 3PD7A 1CE6A 4QA9A 1KYDA 1SEPA 1VA4A 1X7XB 4Q56A 3GP3A 1HQ4B 3O84A 4AG4H 2H29A 2BOCA 2DG2A 6CGTA 1H4VB 2ZM6B 1E1CA 4O63O 3CMGA 3VGBA 4IJ5A 3CV5A 1NSNL 5SZHB 3W3AD 4L4VB 4DH2A 4FMFA 2A9NL 5AOBA 3IVXA 1JHVA 1ZVMA 1XMIA 3BN9C 1TQCC 4X54A 2GJRA 1DB3A 1JDUA 1TM7E 2VHEA 3EPKA 5JOFA 4LEBA 5EQDA 1KQPA 1EDZA 4NCDA 1WAAE 1PT5A 4G8GD 3HR8A 2WT9A 1TRHA 4RDHA 2Y05A 2H8PA 2EXWD 1DJPA 4A1FA 4IKNA 3GT6A 3CV3A 3OAAD 1E4XL 2P80D 3WZMA 2ZQ5A 3PR3A 4JKYA 1M71A 4J3OD 3M4XA 1QO3B 4ZAGA 4Y4KB 5E7IA 3BMNA 4UU9B 4TXMA 2BM1A 2J7PD 5KWVA 3AWIA 1X0VA 4X6XA 2PXHA 4YR6A 5HFJA 4IBWA 3OLYA 4EJFA 2XN9B 3TVMB 4M1GH 3X1JA 1E3FA 4Y5VC 3RWCA 1D8AA 3H8JA 3KPQB 2Y2VA 1U6AL 4URTB 2A5JA 4WNAB 3HB3B 2I7VA 4XHQA 1X1BA 2J32A 3JD1A 2B4CC 2ZZMA 3LVFO 5CA1A 5E9AA 1KFGA 4JENA 4ZIRB 1CJVC 3VXNA 3PXHA 4PRBB 3O0LA 5C53B 4RC9A 2Y3NA 2DQHL 4RYDA 2JH2A 4RVHA 4BN4A 4NQDB 4E6PA 4JJ8A 4DV7B 3WIHH 4HALA 4Y0NA 4ZMRA 1K8DA 3GO1H 1THTA 1O54A 3S96A 5KYYA 1PZMA 4QGSA 3HFMH 4OA8A 2WJHA 1DBVO 3I39X 3ARUA 4OQ4A 43CAB 4XZ3A 3EYOB 1RJLA 2FQFA 4MAYD 4A9AA 1RKRA 3ATDA 5KSUB 4TQAA 1AH1A 4LHJB 4HQNA 3CHRA 1R5JA 4D57A 4ON9A 1HHJB 4TKVA 3C5XA 4ONHB 3RB5A 3E9RA 4K81B 4S1SH 4DJ5X 2DWTA 4F58H 5A7BA 2A7XA 3HGMA 2JK5A 4KMOA 3H3BC 1CDCA 4K03A 3KEOA 5D7JC 4DHWA 3PHLA 4MAMA 4WNYA 2DQUL 1JXAA 4DV1B 5HBBA 2OSYA 1QACA 2BFBA 3LE8A 3I3DA 4HH0A 3T54A 3HACA 3FPSA 3BKWA 3D6FA 1WYJA 5A4JA 1KI6B 2XVYA 2FJFA 2BW0A 4OB7A 2GSWA 5KSZA 4HK4A 2PCXA 3SJVE 5T3ZE 4R4FH 4XO9A 5D1ZD 1GR7A 3GSWB 1Y4UA 3L6FA 3LHKA 5ADOH 8PAZA 1H5UA 3T9WA 2SKDA 1I9JH 5E1BA 3HXLA 2J71A 1IOVA 4IWYA 1U2RA 2W2MA 1WPCA 1D9KA 3SYQA 3ULVL 4LKRA 2X1HA 2DTXA 1E6WA 3K4PA 5FYJU 2FHFA 3LFHA 4JLDA 1VMKA 4FGZA 4MV7A 2XE7A 3MRHB 3RVTD 2C9OA 3ETSA 1PCXA 3CCBA 3RRQA 4C58B 4YGVA 2BH0A 1TM5E 4C5AA 3RC2A 2WMPA 4GRMB 1H4QA 4MW4A 4HNSA 4DYDA 4I4IA 4ODTL 2X38A 3VPGA 4UV4H 4DRXA 4ZHQF 3WUWG 4S2UA 1C9JA 3KXKA 3SDYL 1BZQK 3S3BB 2IYYA 2ZRIA 4WKOA 2ZKYA 4FNLH 2EDBA 4WU7A 1LLUA 2P9TA 3VSVA 3CCHA 5H9WA 3GSVA 5EBWB 3HG7A 2O8VA 3OEYA 5GGRA 4QDTA 1UXSB 5A2QA 3IEKA 3U46A 4XFJA 5J13B 2YD3A 5HA5A 4BZPA 3H6KA 2VJKA 3PXJA 5TGBA 4LIQL 4MOWA 3NJ8A 4B5ZA 4G9DB 3H2HA 2OMNA 4F5ZA 2ZP1A 1IG3A 3B6EA 4J4PA 1NXSA 4ZFOL 4ZJZA 5EG6C 1DC6A 3FPGA 1O6SB 3AY7A 4JG9A 2QLVB 3ZN2A 2BDNL 5JSHA 5E9JA 3B5HA 4E2OA 4PJAE 3WEXB 3MU3A 4WT7A 3ROXA 3HZZA 2XX0A 4IBUA 1OAUL 3STWA 1YGPA 1IILE 2FX7H 4JDZA 3EVGA 1R6BX 5T1JA 4WEBL 4N26A 1BXAA 1JZTA 1Y5NA 1CF4A 3KVNA 4A2DA 2ZUTA 3DXFA 5JYEA 2F1KA 4PZYA 1P84K 2Y1KA 1THCA 4F8QA 2IBBA 2GJ9A 3C09C 2GABA 4Z6AT 4OFZA 2F8TA 2GN6A 1KO4A 2AYZA 1KK2A 2X4UA 1JLSA 5LC1A 4L8LA 1Z3RA 9PCYA 3ZIAA 5ER6A 1RAAA 1H6DA 1WXDA 5T1DH 5GS1B 4UAUA 2JJ1A 2GJSA 1K8IA 1O95C 1JMYA 4Q6IC 4OHVA 3CXRA 3BD3A 1KDIA 4LQFH 4FFWA 3CBQA 1LO0L 1KPUA 4OJNA 2R1YA 4M9QA 4HKBA 2GQ0A 2ASEA 1K3FA 1RMYA 2CE6A 2BM3A 2TSYB 4C4OA 3GXUB 4NMWA 5F7YC 1K3UB 4XBPA 3GPCA 4R0VA 1XTZA 5KREA 1B4JL 3UACA 2Z4SA 2OSWA 3U9TA 5JH7F 2DJIA 4DTGL 2NY0D 4G89A 1K6QL 1A5FH 4POYA 2FO8A 3LPAA 2XZTA 3R0VA 1U0RA 4X5RA 4QGTA 4B74A 5GGQL 1XC7A 3GB7B 1GWNA 3RSGA 2CXGA 1Z0KA 4ZFZB 1KC3A 4P53A 3SXUA 2C9MA 1J0KA 1KZ9A 5EVJA 1UGKA 4L22A 3DD5A 3RTQB 3JSXA 2XVZA 1H4SA 5IS2A 1KIUA 1H6AA 2NACA 4YDLC 3K8YA 3VR5A 3F71A 5FOXA 2O1WA 1LP9B 3DZFA 4WFJA 2ZXBA 4JZKA 4IU2A 1TL7C 1E2PA 2W6CX 5CR9A 1HESA 1ZBDA 1OGAA 3D1VA 3AVXA 5DN6A 2ZBFA 2V59A 2PPAA 1OLSA 3ILXA 4JVUA 2C4UA 3PUKA 1DXYA 4Z9BA 3H65A 5JCPA 4EA8A 1LTKA 3PI6A 3KWFA 1Q1NA 2COKA 4M56A 2B36A 3AREA 1JXOA 3KBPA 4H0GA 3CNLA 3UFXB 1G6HA 1R5NA 5L9AA 2CGRL 2O5ZL 4N0FA 2FVXA 4TTJA 2OQVA 3DHPA 4JFFB 2GDJA 4R1OA 4UBJA 5TDHA 1RXVA 3MERA 1PNRA 2OCJA 1LJMA 5GVRA 4ZGWA 2NXEA 3MGTB 2Z5FA 1ULHA 3RNQA 2VL5B 2FPKA 5JMRA 4JLKA 2X6MA 5IR1B 4XXDB 1GGUA 2AX4A 3QU5A 2ZZKA 3OR7A 1GAEO 4IRJB 3BXZA 3TB4A 3A6CL 2OAGA 4UD6A 2GPSA 2D1SA 4Q1AA 4Z4EA 5ID1A 3MRGA 1OP4A 1U8ZA 4AF6A 3ROLB 5I15H 4GO1A 3D39B 3FNEA 4BDVA 1QG2A 4LQLA 3IDXL 1LEGA 4KXLA 4EB0A 4MJ5B 2OTCA 1NIBA 1V9SA 2WN2A 2Z8WC 4D6XA 4FOTA 1HQRA 1LLAA 1DJMA 3AHCA 4D98A 5BR4A 3EYSH 1H2EA 3OD5A 4MGKR 5SV4A 4NC1C 2XWXA 5K3FA 3DE3X 1SCQA 1YMMD 3DEIA 2O30A 4M61A 4ZX3A 5GZ1A 5JH7B 3OWOA 1KZYC 1U3TA 5CBKA 3WB0A 4XXHA 1VMEA 3EOAB 2VJOA 3DC2A 4PRYA 4K7PL 2LPMA 4OFKA 3KVPA 3D6JA 1M33A 3K9LA 3IPBA 4GI8A 1UKEA 3IJ7A 1CETA 4NHOA 1IAVA 4WACA 3C87A 4WCYL 3TVMC 3MMPA 2RGRA 1I7ZB 2R84A 1PVHA 2QMOA 4KK3A 2GVDC 4X4XB 4QRPA 1AIPA 3KS9A 4WA8A 5FIEA 2NR6D 3WAJA 2XW6A 5DMGD 1XCBA 3BA1A 1XKTA 1OAYL 2GHWB 3MAJA 5EJ5A 4XMKL 2D2EA 4ZFOB 2HSDA 3TZQA 2O8FB 2XZCH 3S68A 4KPEC 3MODH 4FTVD 4WHTB 3V55A 2QQEA 2DWSA 3E3OA 2IIJA 1G4AE 4G6KL 4H15A 2CXKA 5B5SA 3CR8A 4OZIF 4CKYA 4C1NA 3UEOA 4DP2X 3D0VB 4IDJL 3V0WL 4MQ7B 4DE5A 1Z2PX 4F4HA 2UVFA 4X6FB 2Y1VA 5BRZA 1NN3A 3HN2A 1GOHA 4BCCA 1P44A 3W1EA 3FU8A 1O0SA 1QV9A 1AS0A 1WDKA 3PP3K 4DBZA 1FNFA 4J3VA 3BIFA 1SEQL 4YT4A 2CJSA 3N50A 4JYAB 2E76C 5E5MB 4CCAA 4OUDB 4EELA 3P0GB 4E3WA 4QOIA 5I1IL 4CCYB 1J8HE 3LH2H 2CDEB 1REQA 3BT7A 1WAPA 5HS6A 1YC7A 2I2FA 3RFZB 3FPLA 2NZIA 1OX6A 3RROA 1WUKS 2GJAA 5IM7A 4S1RL 1PS0A 2VXQL 4OZFG 4AEHL 1KZHA 1SQ6A 3R9KA 3V5DB 2C3VB 1RZ8A 5KSAA 2IMMA 2FBJL 4E33A 1KQ3A 4PPTA 4XX0B 4P46A 3GC6A 3P77A 4EABA 4YCCA 2OE2A 3AT8A 4R8WL 3WL3A 1VSCA 8FABB 1KU0A 1Y42X 3DROA 3G5WA 1NKTA 4GICA 1TOXA 1FTWA 2ZB4A 4KUZH 3ARFA 4TV9F 3OU2A 2WAAA 3NH7L 3TZVC 1TVEA 4JR1A 3CJJA 1IMOA 4PHTA 5F6HI 3D69B 3MWYW 1L1RA 4OSUL 2CGEA 2DIEA 3ROGA 4TNFA 5L8KB 1NHWA 1OY3B 1V16A 1IM3A 1A25A 3NJ4A 4C4PA 3GI8L 5EGNA 3DPBB 4CCSA 1TTAA 4CM9A 3GJXC 3NYKA 3RVUD 4UB0L 4QTIH 2BIPA 4KZCA 3GMPA 4OU3A 1LF0A 3HCDA 3QM1A 4MJ2A 2MPAH 5GRJL 1NTOA 3BH9A 3KJHA 4BRSA 3SOBL 2EC8A 2CFSA 2UYOA 3OKAA 4CLOA 2FWSA 2OZPA 3RW9A 3QXAB 4XX5A 3SE0A 1GZHB 1UD2A 3B7YA 1M05A 3QQ4A 1U58A 2JBWA 3PE9A 4UU7A 5HJGA 4IMLB 4JL8A 1KOFA 1P69B 1J12A 4LVNB 4XR4A 4ZHQA 4BJ3A 2IH4A 1MVNA 4AUUA 5DR5L 4MJ6B 1N9KA 4D9RE 1QH8A 5IJVB 1N3YA 2RGUA 2CKDA 3RTDA 1MAMH 1AKWA 3PDCA 3RVJA 5K69A 3WZ2A 4ISVB 5D4IA 3HSSA 2HRLA 2R0ZH 2AZDA 1JAEA 4TQIA 3WXVL 3ZOKA 3HPJB 1GSIA 1MLBA 1Q0XL 1XZFA 4I85A 4BLRA 3OZCA 4JCWA 1W6RA 3ZHVA 2F54D 1J8KA 1LHZA 3HB3C 3LB6D 3DVNB 1FVEB 4RORA 3SE8L 3WYDA 3T4EA 4JXKA 1PQ4A 1XB6A 2WWNA 2JI7A 1RURL 1UDXA 2VK8A 2W9XA 4YALA 1SJEB 5JD6A 1C8PA 2FDXA 3N7UA 1ODSA 3HLAB 1DYZA 3A06A 1G8AA 3GNMH 4ZEOA 2C1OB 5AYVA 4AN0A 4K3UA 4Q1VA 3OQBA 3DOHA 3U5TA 1XZJA 1UINA 5KJRL 1IVLA 2W48A 1I01A 4PZUA 1F1JA 3WIOA 5ENWB 2C0CA 1T03L 4PR5B 1FP1D 4ISBA 1XQ6A 4R9HA 4X8JB 1RZJC 3HU1A 1N8OE 1G5PA 1JXDA 1EGAA 1L4FA 3BIKA 5TPZA 5DTFA 1EM8B 1YJDL 1VKJA 3N87A 3DOEA 3CONA 1LDGA 2D9CA 3DMMA 3NGBB 3TBVB 4FYYA 4BN5A 3NYIA 1B14A 1WXFA 2CMKA 1EWQA 4G8FA 4Z77B 4CDMA 5IAGA 2Y7NA 3VXOA 2WQZA 1YZZA 3D0LB 2EBUA 5D7JA 1MRDL 1YMHB 3SZUA 2JKWA 2NMSA 3RIMA 3N3EA 1PQUA 2GTWB 4GH7B 1T7YA 2B5WA 3AUJB 2ATVA 1CY6A 4ZAWA 1RKBA 3ZPDA 2WSSD 1BD2D 3WR5A 1ESDA 2D5LA 2XN9E 1TZGL 2P8LB 2F7SA 5AW9B 4HJ1A 4DW2H 1DX9A 2PGJA 2CKBB 5HHNB 4RPJA 4RGOH 4PJEE 2EDJA 3IJEB 4PJ7A 2DY2A 3N1PC 4PEEA 1MCRA 1LC0A 5AKRA 4YI3A 3UGEA 2QSUA 4EJSB 4LMRA 1AC0A 2FPPB 4I0PD 1THMA 1D9KB 3V7YA 2EEXA 3NACL 1H3FA 1L4KA 1QH1B 5H4GA 4A7TA 2OZVA 3C1AA 2FZKA 4IJ3B 2GF9A 2QB5A 1NFDF 5F1PA 3TLGA 2C1ZA 1ZEMA 3QU7A 4GKBA 2VQ3A 3QWQB 3VR4H 4OW6A 3GUHA 1DDHA 2J5LB 4ZDWA 1ZIDA 1BWPA 2K7FA 1FL3B 2J46A 1N4AA 2JFYA 4J29A 4J12A 1A9VA 1Z5WA 2YNMD 1YRLA 3F47A 5CB0A 5HW0A 4S11A 3LVBA 1BEXA 2W42A 4W9NA 3L3GB 4JM2B 2O5RA 4AX8A 1I4LD 4FN4A 1Q8MA 4U6TA 2BL4A 4YRSA 4ODXA 1DKPA 1FYFA 1PV1A 1UKSA 3CNQS 1PZDA 5GIOE 3FH8A 3H05A 5EEZA 2HT2C 3OV6A 2VW4A 5F97E 1L9TA 1QSEB 5B1CA 5ALRA 4HCRH 2Z6AA 4X1YA 5EOTA 4ESOA 3CLEH 2UV8A 1JI0A 5KYWA 4KJPC 5GGXA 3KBEA 5LVEA 1PF7E 4DRZA 5CNJA 3MXVL 1FF5A 3OPMA 1I9IH 3O4OB 1EFQA 1ZA2A 2AN9A 2JKZA 4IIQA 4N5LA 3OCUA 1PJ4A 3MWLA 2H18A 5L2JB 3P0YL 4K5PA 2P9YA 2NADA 1HKLH 2ADGA 4XVQA 3AROA 1SIUA 4ZX5A 5EO0B 5AEAA 4HIJA 1CEQA 3KT8A 1FP2A 4IGEA 1K72A 5IVNA 3SBDA 1OYYA 4UF7C 1G7LB 1KSHA 4R2LA 4FIDA 2EKSB 1IY0A 2GYSA 3FFDA 3E9QA 4HQ0A 1K8RA 4ZI7B 4RETA 1OI7A 3SQWA 2HRZA 3G9XA 2C78A 1WFNA 1RRGA 4UNIA 2VXUH 2PYFB 5CYFA 2GG1A 1DBAL 5FYLE 1P7PA 1SM3L 2DIJA 2M6LA 4I7EA 2G5TA 1RMTA 3GQVA 4RPCA 3F04A 1RRKA 1JLLA 4KN6A 1F3JA 4QHNA 3K6OA 1FNSH 2ODAA 5GS2H 1PW7A 3W0WB 4BJ5A 3E1SA 2IXQB 2C2XA 3WJLC 1T3HA 1QTPA 5AYUH 1DT3A 2OXGA 2XG5B 2I7OA 5C07A 3JALB 4TL6A 2HRPL 1FQ9C 2I33A 3CZNA 4PGZA 4BSJA 1PUXA 3TLMA 4TMPA 1GNVA 3T0EB 1VESA 1NCBL 1D4OA 2RHHA 3T9DA 5K7SA 4N5NA 1RW4A 3GN1A 4CWAA 3PGXA 4Q14A 4YH1A 3N0XA 3B5TA 4UTXA 2J9FB 2R0QC 1WTLA 2FW7A 2IPTL 2OGTA 4OBEA 4YJ3A 4G3YH 3BRCA 3X11A 2P30A 3W1ZA 1GHTA 1RZPA 1ZLUK 3L9XA 4OFYD 3PVCA 3PWZA 3ZZUA 1U42A 5HDOA 2H48A 4KQ4H 4MLIA 2I9LA 2QSYA 5KOJA 4V0MA 2DLFH 2D03H 3UBXA 2DU8A 2Z31C 3PAVA 3QARA 4D0CA 3FKSA 2IIVA 5DOZA 5I7EA 1QHPA 1BYOA 3E3QC 4ZEXA 2IYTA 3DNMA 4BXOB 3VXNB 4BO4A 5E6SA 1KZYA 1M74A 1U2GC 1O9VA 2IGTA 3E9CA 3WHIA 5AI9A 5SY9A 2DB8A 1TT6A 4HV8A 1PR1A 3ROFA 2Z3WA 1UWXK 1YQVH 2C3YA 2C3GA 1FNEB 3UWMA 4HN4B 3P73B 1UM5L 2ARWA 1C7SA 1TQ4A 2X41A 3NG5A 1DIRA 3ZTJH 2R0LH 1SOSA 4Z7NE 1Z5HA 1KNXA 3B43A 2JA2A 4F86A 1MQ8A 2QTAA 2DBRA 1M2EA 1GU7A 1P2VA 1O5OA 5JZOA 3MRKA 2VZSA 3QIUA 1WDAA 3H42B 1XO1A 3RX7A 5K8JB 1AI1L 4IQGA 2PZMA 2CD9A 4TMTA 3O2DL 3NO4A 1QMUA 1QPXA 1AKEA 3RAJH 1T0IA 4QJ5A 1FMCA 1UPXA 4D02A 2L0DA 3CIFA 1L4IA 1Q7BA 4J4PD 3UJPA 4Q15A 5J0BA 2WAMA 3K7UA 4UFNA 4S1RH 4NJEB 2RHWA 3KLAA 2QN7A 3REOA 4R6UA 1DFGA 3MJ6A 2Z93B 2GCIA 5JMPA 3ZQJA 1H6CA 4QC2A 3UAJA 5ADPH 3V2UA 1Q0HA 4L1HA 2JIXB 2DSNA 4XBMA 1N57A 1RABA 5IFHL 2G2NA 2KZBA 3OF6A 2EO7A 2PANA 5TXGA 2Q8NA 1NDQA 3QDMA 1P7BA 1US8A 3DLHA 4YHYC 3IBYA 4X24A 3CF6R 1QHNA 2O52A 5DNEA 2QS9A 3PS9A 4B2IA 1HL3A 1AMNA 1F45A 4MYPA 2H4WA 4DBLC 3K4QA 2BGMA 5F9MA 1H8HD 1ZD4A 2C2ZA 5J1AA 3P9ZA 4G09A 1ZLYA 3BP7B 3O3NB 4DNLA 2ETWA 4LZOA 4KQ1A 3SICE 3POHA 1KLGA 4ZYKA 5F6IB 3L3IA 1ESMA 2PTUA 4CF5A 1X7YB 3HRKA 4PLYA 4HXGA 5JYMA 1DSWA 4H88L 4FMCF 1T8TA 2FZGA 3Q0HA 3WKDA 2UY7B 3NV7A 3BH8A 2M6KA 2IIQA 3BF7A 4P2OB 5AQ0A 3BXNB 1TYBE 3I2HA 3S81A 1KTJA 4NI5A 3TF7C 3UYOD 1IVNA 4R97C 3GUCA 5E2WH 2X4SA 1G6RA 2OR9H 3B85A 4JN6B 3OP4A 5L8VA 2X8BA 4WU7B 5FOVA 3W4KA 4ZEVA 1HZHH 4O3FA 4COOA 1VI6A 4HW6A 4J1UA 5I23A 3RRYA 1JR4A 1NU6A 1PHPA 2CY0A 4PB9H 3BD5A 4RMQA 1TA0A 4P84A 3SJ7A 2WMPB 1U0GA 3JAWB 2NZVG 4D9JA 1W19A 2I6GA 3LUPA 5EUOB 2ZVPX 1OW3B 3UIZA 5ALKA 2EIEA 4I46A 1U91B 5JLJA 2O2XA 1X5AA 1MENA 1JZ7A 3KPLB 5I30H 1HNZB 2BXZA 1OT4A 3RYMA 3MRIB 3KPMA 1M76A 2IX9A 4HUVB 3DHEA 2FD6H 4R8VA 1ZHNB 2B2XL 3DEFA 4M7ZB 3LVTA 1ZZEA 5D6DA 1NVVQ 4LPTA 4K7FA 3DKRA 1I2MA 5U9CA 4NN7B 1FSKC 4M5SA 5C0RL 1QFMA 1H05A 3CEPB 2WJ6A 4HC1H 3Q5OA 2AZMA 3KL0A 1N8SA 1IBSA 2UZ4A 3JZYA 1FFWA 1ML4A 3LZFL 3KQTA 5DS2A 4W9RA 2XHEA 1KB5L 3P77B 4JJIA 4FFOA 3ZGXA 3GWZA 3W57A 2BMJA 2FFRA 2F58H 2W8ZA 4OZIA 4ZS6D 2O05A 3U80A 3LUCA 4MA8L 2BN4A 4D8PA 1HFJA 4FXKA 4GS5A 5MERB 2B16A 2Z9TA 1C30A 5T1MA 1XSJA 2H8GA 5F6HJ 3BJEA 2QLBA 4F2MA 5M94B 4ZYXA 1QLJA 5J2TF 1SD2A 4N2AA 4HIIB 3BMXA 2H1FA 4WWKD 2XDWA 4NRYB 5E1MA 4BATA 3ZDZF 2G0KA 1UC8A 1WWBX 2NVBA 5FI3A 5U4QA 3HG0A 5DHRA 3TR5A 1A7AA 2HNAA 2C8JA 2V2XA 4AMKL 1RJZA 5FLVA 3K8MA 4IX9A 3DKVA 1OWNA 4YT2A 4AIZB 3FUEA 1JN6A 1D2NA 3P30H 4YHKH 3SJUA 4UMDA 3SCMD 3IE4A 1R9NA 1IMJA 1T1ZB 4RYLA 3R4VA 4X5PA 1UBOS 4YFLI 4I0KA 3DX6B 4LSPH 3F2VA 3WUZA 1ZLSL 1PZAA 3ABSB 4XVSL 4L9SA 1OX4A 3EC1A 5I30L 2YA1A 5I2IB 5AQEA 1GC1L 3HR4A 2Y0EA 1QKZH 1DZIA 1AHPA 3IPRA 5JCXA 1MFUA 1ZLWH 2WSSA 1R0RE 1NCTA 2E56A 5AVTA 1P5ZB 1E5XA 2FFQA 3HG3A 3BSZA 4YSEA 4UQEA 2Y6UA 4PYLA 5AKTA 1SPDA 1HEUA 2BMVA 2PPLA 3HLTA 3UHFA 5JS7A 3LA6A 3FBKA 4HB0A 2JGFA 4Y5XA 1RPKA 5JTUA 1UANA 4OO3A 1K7SN 4A04A 1Z4LA 4PS7A 1WQ4A 4K5NA 3QR2A 4NDZA 1JGDB 1J99A 2XYRA 2EH8L 1E7YA 4QTYA 4PGDB 2HKFH 2FSVA 2J3IA 2WYIA 3AETB 4PICA 3O2NA 2BRUA 2Y7OA 1T2UA 2FRVA 5AB2A 1DQNA 1QQDB 5E2UL 3PX2A 3SQBB 3LQYA 2JZCA 1SGKA 1IULA 3MJEA 2XNAB 2BFCA 5JFGA 1LYQA 4H88H 4CN4A 3L6OO 1UOKA 1DS6A 4IMIB 4L5YA 2KZWA 2OL3B 3DPSA 1BW9B 4I6EA 4G83A 2O6HA 1G6RL 1WX1A 3K9HA 2XUJA 3LMKA 4I3SH 4PG8A 3VRHA 2HFJA 1QHEA 1E9RA 5K4AA 4NM8L 3DECA 2O6PA 5AW5B 1ZGGA 4BZ2H 3H11A 5TVGA 4U1JB 3DQPA 1YGYA 1Z4IA 1LI7A 1I1QB 2UX6A 2D4AA 5H81A 4EMTA 1KXJA 1P7QD 2PJRA 2OMUB 1EZVY 1KBGH 5AW6A 3BIWA 3K46A 1KTIA 1KBPA 3LQQA 1O94A 3F7VA 3SOTA 1U1DA 4ZQKA 4LEXH 4OI2A 5GZND 4B3VA 1U8JB 2IH1B 4IHQA 4EZEA 4FNOA 4EGCB 3WA7A 2BHUA 1BVUA 1MEEA 2RB5A 4JQSA 4FLRA 3HDHA 1KI7A 4JLWA 4LGVA 3F58L 3VR4A 5C80A 2N0MA 4IIDA 1B76A 1KEUA 2X0KA 3RWMB 2DSTA 3P0JA 3TX6A 3JTEA 2AOUA 4GMTL 3P11H 2JFXA 4JM0A 4FLHA 4U3JB 2C8LA 4TWIA 3DE6X 2HJFB 4N2LA 5BRPA 3TQIA 2XBLA 4JB9L 5EUMA 3E70C 2BEKA 43CAA 1QABA 3EYOA 1EG7A 5EUBA 2YWRA 4HSEA 4TLSA 4KAFA 2WTNA 2ECKA 2ODTX 4LXFA 2Y1ZA 1JHAA 5HE8A 5HPMA 1U7UA 1PZFA 1IWOA 3VDRA 4DKEL 4YRFA 1DBSA 5HPOA 1EFVB 1RWBA 2W6IA 3OF5A 3AZQA 1EB9A 1MV5A 1PBNA 6AT1A 3CVUA 4HGOA 3HWWA 4NGHL 4R4FL 4LSZA 1FYDA 4OGQC 1MO2A 2QGFA 3S97C 4IO0A 4ZCLA 3BHMA 4G85A 4KDEA 3B2DC 1P4LA 1N1DA 2ZYTX 1ZHKB 4DA7A 3ZWXA 1XRQA 2EJWA 1N67A 4FFNA 3WGZA 4FZVA 5ICEA 2EIXA 3V4PH 2WT8A 1YEWA 2CAKA 2GCEA 1T6WA 1HYSC 1E9PB 1UPUA 3EDDA 3EG5A 4TRNA 1JNNL 4M9SA 2YPKA 4OLWH 2A5FA 5C86A 2Y4OA 3F1KA 4JHAL 5I15L 4R7LA 4EO5A 1U0JA 3GGOA 4EJ1C 5JC8A 4LWOA 2FPMA 4XH2B 3FN4A 1FOEB 2AEPL 4HXYA 2ZRDA 2J6EA 1D0IA 4CW1A 5HGBB 5LMZA 2BIMA 2E48A 1A9EA 2KT6A 2ZSFA 3LX5A 3SK0A 1UK7A 3ORFA 1DIOB 1NC4B 3ARZA 4KREA 1NAMA 3X1KA 1TUIA 4KXBA 1KS2A 4WQOA 4FN5A 4Z7WE 4CMEA 5FOBA 1NV9A 2WO4A 1JJVA 4PH8A 3QMMA 4HTFA 2DQKA 4X9FA 3QZWA 5EGSA 3FYEB 4MDIA 1URZA 3CQ9A 4WFEE 5GGRB 1KO8A 5CDUA 3VHRA 3PF9A 1KO5A 1IM9B 3P2TA 3L8DA 2NYKA 1DLFL 4H4CA 4I14A 1F3RB 1C9DB 2ORED 4HBZA 4TV8A 1QBAA 3T2OA 2VAAA 1BXUA 1OU0A 3KOYA 1EUCB 5HXMA 1SYVA 3STZA 2YD0A 4ANWA 5F96H 4ZTUB 4DIFA 1I10A 3IP1A 2WKSA 5K0SA 1CK0H 2XYVA 2IDMA 2SCUB 4NOLA 1MVUB 2R7LA 4GE3A 1Z3IX 4NECA 1BZ7B 4JJ5B 2FBOJ 4M5ZH 4PJXE 3WJ7A 1GN9A 5I18L 4OQNA 1AZZC 1OT5A 2R60A 3ODGA 2VA8A 2WVVA 4UINH 3JWHA 5KVFL 3PWJA 3WFHA 3IKKA 1UENA 4HLEA 4N7BA 1F6WA 3B1XA 4TYNA 4QHSA 2PJZA 1B4JH 1M1SA 4EAEA 1GPAA 3SMVA 4NJAL 4W9NC 3GBPA 3W39B 3ZHNA 2P80A 1WUIS 1W49A 4BBPA 4O51B 1H6UA 3REVB 4FQLH 2FL5B 4ALKA 2VJXA 5D1QB 4MVJP 3Q1KA 3FTQA 5T5NF 4D9RD 1YQQA 3RI3A 1L4NA 5DCUA 7FABL 5CZVH 1ZLXA 1DAFA 3IP3A 4HWBA 3ZKNC 4NZTH 1DSYA 3L3HA 3B8SA 1V3UA 5KSWB 3JQ7B 4AC9A 3ZQXA 4PGHA 5EBMB 3TZVD 1VDZA 1AVAA 2Y7SA 3VXPB 2UXDB 3RWGA 1EP2B 4DAGL 5LNK1 1F1AA 2ZCHH 4OH1A 2OG1A 3A3YA 2AUTA 1T66C 1I1YA 2R9VA 4OD1H 4QYOA 2XWCA 2R00A 1NE7A 2B6HA 3VHQA 4BWFB 2C1OA 2KKQA 3U60B 4YUYA 4O02A 1HYRC 4ZIRA 1L9XA 4RQTA 2HM7A 2PR9A 2JH9A 2ESRA 3II6X 3BDIA 2IYXA 1VKZA 4G41A 4LZZA 3P4UA 3UZQB 1PO7A 4KNTA 2CJ3A 2ZBUA 5HE9A 4GI2A 4LV6A 5DTJA 2Q0XA 4HUQB 2ZWLT 4DCNA 5F93C 2VAXA 4G63A 2WCPA 4AQ8C 1I36A 4INZA 3T5GA 4YUVA 3ZW8A 2LHAA 4OCLC 4D9FA 1MI5A 5C8YF 3ZEIA 3ZR4B 2G4EA 3H0EA 3C7AA 6LDHA 1N2JA 1ETB1 1WJ3A 1TJIL 3HKCA 1MRNA 3K0CC 3UFXA 5T1LD 3VR2A 1IHOA 4TULH 4FQXB 1FB5A 3BAEH 4Q9DA 1TAUA 1I4DD 4W1QA 4XE5B 1JCKA 5CLIA 5AG9A 2IZ5A 2LIVA 2RI1A 4QT5A 5D2NE 2B6NA 4YIQB 3RG1C 4H0LC 2BNQE 3IDGB 2BDEA 3QELB 1FDOA 2BGWA 4QL3A 5JSZA 4NBYB 4QLWA 4BNXA 2BO0A 3DP7A 3NCWA 1RYDA 2AEEA 3WDSA 5I19L 2DPHA 3HYCA 2XHNA 4KHZA 3VO1A 5C7XL 4AZVA 2YFYA 3CNOA 2GK0A 5KQSA 1P7QA 5AYQA 4YHZH 1VJ1A 2BGJA 1PNDA 5ALCH 5EEXA 3LHIA 5KDDA 3EEIA 3FXIC 5AUMB 4REOA 2RH5A 1B00A 4JJFA 1SR8A 1Y81A 3NBQA 1JWMB 2UYLA 4HB3A 2B4CH 3QUZC 4HC1A 5AFAA 3VFTA 1DFHA 3IFNL 5IC6A 5IXJA 3PWNB 4M6AA 1TUEA 1EPUA 5A6SA 4BSWB 5LU9A 1U6JA 1DLFH 1QAWA 1WBYA 2QDVA 3DLTA 2OYCA 1A1OB 4WFIA 4Y2TA 1VLHA 4JHWH 2DM6A 3R3VA 3L7BA 3ZE2F 1X7DA 3JV6A 2H59A 4PRPE 5AW8B 1KGUA 2D62A 2VNSA 2QMHA 1Z36A 1L9PA 1CGYA 2W00A 1JPTH 4L0MA 1LE5B 5F4BA 1NZFA 3HE7C 2MSEB 4E9LA 4IGAA 1CNFA 4FI7A 1AHWC 1NANI 1A5ZA 3CCCA 5ALLA 4Q6BA 3VDBA 1KU6A 4YGVB 1V3QE 4MAZA 3RWHA 4D3DA 4QBHA 1MN6A 3QISA 3RPIB 3I6MA 4X42A 3BWVA 3N6XA 3GN2A 4N3BA 5IBLD 3E3NA 4XA8A 3T95A 1ZTXE 3R41A 3C60A 3I50L 3G2QA 4L3OA 2PETA 3VD3A 2P5PA 3VQLA 2EE6A 1HDYA 4PJCA 3DAGA 2W6OA 1T1IA 3HI6L 1YRHA 1M53A 1P9RA 1ZS8A 4KMLB 1EWVA 2FR0A 5CCGE 3CG0A 3WDLA 4JOQA 4FDLA 2DYSB 2NLJA 3TWCL 3MBIA 4WWNA 5IANA 2GRAA 4Y6LA 3LKSB 2A5LA 4LLVA 3SN6A 4FQQB 3CU7A 5CCKL 3LD9A 4KPHH 3HG1B 4RFSB 2Q41A 4K8RH 1KYWA 5F7LB 4ZZKA 3KXFD 1EG2A 2H7XA 3ZY6A 2DIBA 4Q34A 3KGUA 1GTMA 3C08H 1N8ZA 3NH7H 1W47A 1XX9C 4JKPL 3LC1O 4CLRB 4IIXA 2JGEA 1KFJB 4FJ6A 5F3HA 1M1NA 3D7PA 4MHOA 1BQ3A 5TQ0H 1UQTA 1NNEA 4RBPH 4Y1EA 4JRYA 2CNZA 4KZKA 4YXLH 3OB0K 4EKXA 4HQQH 1Z9MA 5EP3A 3GJ3A 1OCWH 4BFYA 5ICXB 5IU6A 2ZS8A 1P8JA 4J0HA 3ZWWA 5F1OB 3GQBB 5THKA 1VPEA 4XJVA 2FBJH 4PBRA 1NDTA 1WXQA 1XNQB 2ZAHA 4EEXA 5ITWA 2DAVA 3GBLA 2ZJ7A 4YHOH 2ZSWA 4HD8A 2CLIB 4PWFA 1NUNB 3OEHA 1A65A 3MLZH 4DPMA 4QLAA 4XGIA 4HK3N 4P05A 1HQKA 5EPMA 3MLYH 3HHEA 3GGGA 3HCVA 1K8IB 1O97D 3ZDYF 3DXAA 1HH6A 3QIBD 1KPUB 1C9NA 1F0LA 4U1GC 3EQZA 3GP5A 1YRBA 4K9LA 2J5QA 3OLZA 4Q1FA 4BFIB 1O1YA 3OSZA 3V9PA 2HA0A 2JD2A 4L1TA 2BWQA 4UMSA 4TL9A 1LWJA 1XZLA 3K5RA 3NZHL 1ASOA 5JA8B 5IDWA 1NTRA 4HDMA 2WPGA 4NUJB 1O6BA 1AKNA 1ITZA 1UDWA 4J0QA 4P2YA 3VRLF 4PPGA 1D4AA 4EWLA 3T0EE 3HO1A 2NUBA 4PZCA 4Y9RA 3JWNG 2V2TA 3ND5A 4BZ2A 2FLBT 1OQXA 3K0YA 4V3BA 5E0QA 2OQJA 4ZO6A 1P4GA 1ID8A 1NFAA 3CX4A 5E9DD 1TJNA 1R0ZA 2XCTB 5B3JA 2GBLA 5KSAC 2C04A 3EMBA 1KBGL 4B2YA 1DSSG 1EFRD 4O6VA 4MGHA 1FYTD 4QHPA 4C0LA 4NCKA 1Q94A 1QBLH 1VJSA 5DC9B 5HTKA 4X8JA 4CLOB 4HP5A 1I7UB 2FEWB 3PU6A 2AA3A 4IK7A 2BTQA 4FJ2A 1VBKA 1YHZA 2JL1A 5A5DA 1QK4A 1UM8A 2Z57A 4DLNA 1L9MA 3AEUA 4FYVA 3SYNA 3RVMA 4HS3A 1TAQA 5IP4A 1B0AA 1LGYA 4FI6A 1E5CA 4PLZA 4WZBB 3RGBA 3MSPA 3ZQKA 1N0UA 1LQUA 4BTVA 2QLMA 3FOCA 5LN4A 1I2DA 1PZGA 1X44A 3E9UA 1DC3A 1M9SA 1H3TA 3V32A 3D54D 2FH5B 2QKSA 3H7AA 5JCOA 2BFWA 3EDEA 5HHPA 3BUBA 2HIHA 4MGXA 1ZN2A 1ZITA 2NY4C 4K8RL 1D8TA 4HGQA 4L1LA 1T1GA 1GNSA 1MA3A 1TJMA 4NFSA 5AW6B 2GCGA 3ABQB 4P9ML 4EZMA 4XC3L 2PY6A 3GDGA 3FB8A 3P54A 1ZPDA 2CKBA 3FUMA 1G1OA 2FQDA 4I8XA 1MW1A 5E08L 4XNYL 2AKAB 2VNIA 4BFUA 4BQIA 5CXPA 4LLUB 2NXYB 5F77A 3NFYA 1YBMA 3D18B 4PC7A 4KUGA 1V3VA 4JVLA 1RI8A 5EWIH 4WASA 2YSTA 5GS0H 5CUQA 5D96C 1O9WA 2H85A 1CTNA 2ZJ2A 3EGDA 4Y9GA 3KFLA 1OK8A 2Q6WA 1BWWA 2GKIA 1EK0A 1SB8A 3RHZA 2HG0A 1QFUH 3EYUH 3AY4A 1QVAA 4MQ6A 3WB1A 3WO4B 2FGWH 3RIHA 3LXXA 4LXUA 4PJIF 1T9GR 1FG9C 1ZC4A 3H7IA 2B99A 3O4IA 2MOGA 5B39A 1SBYA 4E41B 2ZAOA 5EESA 2XOEA 3VTKA 1A9XA 3HO6A 4HLDA 3WTXA 5KW9L 2NY5L 4BWYA 1NC3A 4B3MB 4NAQA 1TO1E 2QLJA 3GMMB 2X4SB 1GUDA 3MWKA 4Y5XC 1CGWA 1EGQA 2YJ3A 2ZUUA 4XSHA 4CKZA 4RX4D 4A6YH 4Y88A 2GAZB 3WXWL 4YX2H 1YZGA 3P19A 5AALA 3UIYA 2AZUA 4B7XA 5J1TC 1TVMA 2NU6B 4F9PA 2H1LM 1R16A 1UXOA 1M2NA 1QYDA 3TSOA 1P4LB 2EZUA 3ZE0F 1QTNA 3E7JA 4HEME 1DXQA 3P3YA 2FZ5A 5DZSA 2RMNA 3O3EA 3V42A 1CF9A 4RVSA 3RUAA 1CK4A 1U1GA 5ITZB 1RHHB 3HBGA 4YSDA 1YR8A 1U1IA 4OCYH 9CGTA 4NS4A 3SDDD 1T0UA 2BSDA 3A0OA 1VIDA 4AY6A 1FFEA 3FVRA 4TLLB 2EIZA 4Q1BA 3CD4A 3PBKA 1EFXA 3F73A 1G6OA 2ZANA 5EIXA 2YN2A 4K7FB 1HI6A 1YUKA 1KY6A 5MERA 1IAIH 4G8DA 2PU7A 3IU4L 3JYHA 5E00B 1E1NA 5D71H 4BLUA 2YC2C 5C0RH 1EXVA 5BS0A 3K94A 2DE0X 2HSIA 3A67H 3GG2A 3Q7RA 4S1TA 2UZYA 2P45B 4YTEA 4Y1AE 3ENZA 2FEMA 1SU7A 5CILL 1MEJA 3O9VA 3M3HA 2HWUA 5JHLL 3CNEA 4H8WC 3QVAA 3ESMA 2ZSDA 1CUJA 1A8QA 3OZ9L 3T4AA 4FNPA 3WS6A 3FAZA 1N2GA 3CISA 2AZAA 3CQPA 4URUR 3OQPA 2A9CA 2QVBA 4H1UA 1YEKH 1R34A 2OM2A 4PV7A 3D9QX 2BM9A 5JWOA 1M7IA 3OD1A 2E4TA 4JVOA 3PXLA 2HBZA 1TJXA 1ITCA 1OAUH 4CI9A 2DQ6A 2LCFA 1S3SA 3R74A 1TKCA 4DDHA 1G9HA 1YPZA 2AI0H 2NYRA 3WGQA 3CH4B 5AKXA 2ZSUA 2KERA 2FGKA 4QELA 4KLNA 1NJ5A 5EMHA 1CBUA 2PWFA 2GX6A 2C59A 3GD5A 4NBRA 1YEDA 3WFBH 4JY5H 2LVBA 3FFBA 3HNRA 3BGMB 5KTYA 3D69A 3LOWA 4P2RB 4MX8A 1F7UA 3A0RB 4YVNA 2LZ0A 4JFEA 4L37B 2FW9A 5JD3A 2W0FA 5EN3A 1VXRA 5IM5A 2HPTA 2BP7A 1WCXA 3LHSA 5JUWA 1K68A 4EIBA 5G2NA 4OI0A 4LHUG 4JFSA 3HUJA 4LSUL 4OF5A 3FJYA 4RETB 3SO5A 3DB1A 4W9FC 1M2HA 3NP7A 3U1SH 4OZ4A 3OPYI 2XI4A 3WO3B 2HB6A 4E5XG 3EO1A 3TD2A 3MYJA 3EZ9A 1EEUA 3WX0A 2VYRE 2CJFA 5G1PA 4DREA 1NCDH 2R9HC 1GDTA 3W8RA 4AY0A 3NEJA 3LCCA 4LXTA 2LU3A 3K31A 4BNLA 2GUOB 3EZYA 4MQ5A 4JGJA 3RS0A 1G5IA 1WWKA 1UJ4A 1AUPA 1LBHA 4FFYA 1U1CA 2D7PA 1V7CA 4WQMA 4YH6A 5T4FA 5AHXA 2GA9A 3EDQA 2EC9U 3L3HB 1V4NA 3EVNA 3H11B 1JGEB 1LPAB 2VZUA 2JRLA 1TTTA 3FQYA 3IAFA 4XMXA 2QRNA 5SWZE 1V7NH 2ZB7A 4JT9A 1BXRA 1CLCA 3GXMA 3AF6A 1CMOA 1UT2A 1NFDA 3MW8A 3WCYA 4PLNC 5ESQA 1KYFA 1MEOA 2CXOA 2XT6A 1H0KA 1MHCA 2CKNA 2G28A 2KBGA 1E28B 1CQPA 2HZHA 2YMXH 2R8RA 1DG3A 1SKYB 3TW8A 5AW5A 2CHXA 2DL9A 4PM1A 4X6LA 3BSZH 1ZGBA 3K6SB 4KH9A 1CGVA 3H42H 1PCSA 4XCCL 5K9JH 5IB1A 2VF5X 1Z7JA 2FQGA 3P0IA 4XX1E 4BNTA 4XPTH 3QUXB 5B6JA 1E0AA 4PNZA 4PRHB 4ZYUA 4NYMR 4ESVA 4I89A 5B3JE 4PQYA 3RBVA 5LD2B 3G9ZA 1CJTC 5C0IB 1NMBH 4BFBD 3NDJA 1N26A 4JSYA 4FZ3A 1HQCA 2W4MA 3GVHA 3M17B 3UG4A 5EFIA 1AXTL 1L1EA 2VQUA 1EJ0A 1EPFA 2HKHH 5MEOA 4CW7A 1ONBA 3RFTA 4F5EA 3GJEB 2IH9A 5J5EA 3HI5L 2EDAA 3QPVA 3ZJYA 3E80A 2BNRB 2H3NB 1KYQA 4AJJA 3KXFE 3BAJA 1Z38A 4OK5A 1E2VA 3I75A 1JE1A 5FHAL 4HX2A 4UU8A 5DT1L 4KYVA 2OXIA 1J97A 1DUZA 3GNLA 1PF3A 3CB2A 3AG4B 4MKMA 1XO8A 3H1EA 5FXMA 1AQ6A 1DWPA 4JHWL 3VU3A 5CFHA 3CE1A 3HG4A 2BMKB 5KHLB 3GRCA 3MRIA 5CXUA 3BWAB 5KYNA 2VFAA 5I73B 1PFWA 1M57B 1YNTF 3QC6X 2X1WL 5A6SB 1DE4B 1LK2B 1CUXA 4HEMA 4P4LA 1EYZA 3VQMA 4YMHA 2G0LA 5KMGA 3L4SO 5D6NA 3S7GA 2FX3A 1K4DA 3GHYA 1ZHKA 4GXTA 5GM1A 2KMLA 2WMYA 3SYMA 4Z3OA 3KE8A 5C0CB 4HSGA 2OX5A 4OZGA 1NSNH 2K1MA 3PFGA 2V97A 4P3CH 4GB9A 4M43H 5DC2A 3CZ9A 3KYCA 1DBJL 4EMBA 5DMHA 1U2SA 3NVKI 4PRZA 1NVVR 1F58H 1U92B 4IQHA 3QG6A 2QX9A 4Q2ZA 1P7ZA 5HCNA 2PG3A 4S1NA 2IYWA 4XH2A 2NSLA 3Q7EA 2BZ7A 1YRQA 2OYPA 4BE9A 4DXAA 1TLMA 2JQAA 1JAXA 4MCZB 4CU6A 1II4E 4Y8VA 5H0IA 3MACH 4D44A 3GOQA 2RJ3A 4IIYA 5EA0L 2EKBA 2BIQA 3HG1A 1O5TA 3I85A 2JFOA 1EZZA 3X1FA 2D7MA 1EWKA 1XVIA 2BGRA 1QSVA 3GCGA 4QLOA 5HHMD 4Q3OA 5FCDA 1NNUA 1OI2A 3RWEB 4Q1DA 4CE6A 2EYRA 5IVKA 4LRNH 3BG5A 3WNCA 3KEFA 4MVJA 3ROKA 2FMUA 3F7RA 5HYVA 4MJJA 2IQIA 2IADA 5CSZA 3EOYG 3A6KA 4RDQF 4L8WB 4OBBA 2YPVA 2F7QA 3K3QA 4PXSA 3CHSA 3QFGA 4HNRA 1WUZA 2BVQB 3AONB 4KXYA 4KUHA 3E48A 3M1AA 3KHTA 4LSTL 3BH7A 4DUVA 5I16B 4K94C 4BOYA 3UG5A 5GJBA 2XGOA 2Q6IA 4LBVA 5ALJA 3PP3H 5K8IA 4UW9A 3UMJA 4HETA 5IUNC 3R9XB 4YBRA 2APFA 5ANME 1N12A 1JPGB 1J0CA 3GYGA 1WP4A 4WOJA 3BCHA 2V7HA 3EC7A 1ZAGA 4CBPA 5E1DA 3OMWA 3O2JA 2EUWA 4I5EA 4DW2L 1O95D 4Y2GA 3HABA 2WTOA 2XDHA 2EICA 5TX7A 1NBHA 1NUTA 3BTSA 2A9QA 2GHRA 3CX5J 2BGKA 1CUDA 5EO1B 2HCBA 4E07A 1PFVA 2HJ9A 3PL5A 5K5EA 1DKNA 4ZHSA 1IZ9A 4Y6SA 2CF6A 3GLEA 3JTSB 1G0OA 2Q0SA 1VP9A 4UTZA 4Q9KA 4REMA 1PZCA 1ZLSH 4M5ZL 3BB3A 2ZSVB 5EZYA 2E5WA 3LT2A 3H9SE 4DGQA 2CR0A 3H7BA 1IT9H 3AG6A 5CJOL 2F2TA 1CEEA 2BKVA 1N6OA 2IALB 4N9GB 3UV3A 4GLOA 2Y5TA 2CVPA 2PS9A 1LMKA 1ADQH 4AECA 1JVLA 4RD4A 4AQ1B 5EEGA 5B22A 5F9WB 1AB6A 3IQEA 3VWJD 3RT9A 2AGJL 4NMHA 1AR1B 3R20A 3QFDA 1MLDA 1OFUX 4RM3A 4TQEL 4D9IA 3TE6A 1CRPA 4P46C 3CIQA 2QL6A 1OTSC 4MP6A 1GHFL 4XZUB 1DANT 2ESVB 1NPJA 1M67A 3DRTA 3UTTB 1AXSA 3TR0A 1CV2A 3V0VB 4AM8A 3BPLC 1Q9OB 4Y9TA 4A8JC 3BVVA 3TJHD 1USWA 4B4UA 2AV1B 3ALXA 5CLXA 4UIKL 4YRNA 1LO4H 4GQZA 5K4GA 1S8AA 3QRLA 4P5TB 4LJSA 2HXGA 3M7OA 1SF5A 1ACXA 3EYFB 3UKOA 3UAFA 2QSVA 1QE0A 5KZCD 1KYYA 2G0AA 3T0VA 3BP5A 4Q39A 1U8XX 4PJFA 3J80A 3HB4X 2JB6B 4RLFA 2AJYH 3FB8B 5EHGA 1VPTA 1T0PA 1XGTB 4HC1L 3V5HA 2XQYA 1B0WA 5F9DC 1VZIA 3ST7A 5LAXB 4LKXB 3FT3A 4BWVA 3K80A 4YAQB 1D5IL 2VITA 1CF1A 4LSQH 5DWUL 4MSUA 4GMGA 4WSGA 2PYEE 4G86A 5LD2C 3ZJTA 1V7ML 4GP5B 3F00A 1K5WA 3HS8A 2C7VA 3LP5A 4JJZA 1XB3A 2H54A 2PAFA 5DYIA 1H0DB 1QDUA 5K9KB 1CDBA 4QFMA 3CDZA 2ZX5A 3VDXA 3SIXA 2CSUA 1Z08A 3NIDE 1GRNA 1XTLA 4H0FA 1AZCA 3GDBA 3EXEA 1P33A 2VSOA 4PJCE 3QWOB 3AFLA 3UN1A 1HHKA 3KZ8A 3HE6A 4U3CA 2PR2A 3LX6A 4UU0A 3TBHA 3HXMA 2WJVA 1P73A 4Y4HC 4ZS7L 5EKXA 3UK6A 4PSCA 3N43B 5F73A 5E3JA 3CIAA 3RRFA 5IB2B 4IBOA 4I5IA 4LCUA 3A2NA 1HUQA 1TQWA 2YJGA 4W1PA 2G71A 2VXCA 3NVDA 5C0FA 3F9CA 3V4FA 4ZFGH 1OPGH 4BO2A 3L93A 2BUCA 4Y16A 3FQXB 1YQ2A 4R0LB 2PKQP 4P2OA 3LHFA 4TNVF 1OWMA 3F62A 5COQA 4JH0A 5C97A 1HETA 1TQVA 4WJ5A 1JDCA 1G6RB 3CEJA 1MI5D 1L7IL 1R0SA 3DEJA 3WWYA 1O57A 5B53A 2WWKO 1ND0B 3AF0A 4P5DA 2JAXA 3WRYC 5JO0A 4FCCA 1P9MC 3OSVA 4D42A 4XC1H 4JRWA 1Y37A 3HU3A 2O19A 2H32A 1RJDA 2CL0X 1DAKA 3EXJA 5DHEA 3OM1A 4R71A 4KMTH 2XIJA 1KSJA 4QU9A 4G42B 3N41B 3TNMB 2NAPA 2VVTA 1Y5LA 4BRJA 1HAWA 2F5BH 4IFBA 4ND7A 3QW9A 1JB9A 3CDFA 2BMEA 4QPDA 2WZDA 1ZG3A 2QYOA 3RYCB 1U8OB 1PWZA 1O89A 3MTDA 3EWAA 1ZH6A 3DL4A 1ZHNA 2R4SH 2X7LA 4LVEA 1Q1QA 1Z56C 1AQUA 4X90A 3UJJL 1WA2X 4UQ3B 2FUCA 2VDOB 2JHAA 3B1FA 2OPHA 1NE2A 1J7KA 1A6AB 3PGLA 1ZH8A 5J1SB 5KEZA 5JOPD 1E9BA 1U33A 1K5GA 4HF7A 121PA 4AS1A 4QD2E 4DN3L 1SB9A 4NM8H 1MX5A 2X1XR 3UICA 2YYSA 3WE7A 2DI7A 3NAQA 1W5FA 4XNXL 1XWWA 2BI8A 3AOEC 4QPEA 3R1GL 1ZLVH 2IWEA 1BZ7A 3VQ1C 4X6CE 3U39A 1TQ2A 2I4NA 4A68A 4Q9QL 1S7QA 2GPWA 4M87A 4DA4A 4D2NA 4N85A 3UWDA 4HWGA 1L0PA 2GBAA 5BUGA 5DI9A 3K2QA 3QRWA 1XTBA 1MWOA 2JLXA 2Z0BA 3JSAA 2BHTA 4W4OA 2X4TB 2AV7B 3HS9A 3WLMA 2OZLA 1LI5A 5ERXA 4KPHL 4GPVA 2DS4A 5COBA 4UNVA 2A1UA 3I64A 1ORQB 4ZD3H 5K99A 1FP7A 3GMNA 3ZU8A 5CBEB 2HJSA 1KLFB 3RFCA 4IXDA 1P4UA 1SUFA 4XN1A 5AR1A 5C51B 5CAEB 2P1RA 3ZW9A 3LNGA 2Q2NA 5E1AB 3F49S 4ZI7F 4RZCA 4XRGA 2E5EA 3VXPA 5I1KH 4R01A 4XMUA 3UXEA 4EQZA 3VM5A 1EP1B 3N8NA 3X1DA 1OT3A 1VKOA 5MEPB 4BKUA 1RK0A 2V7QA 1I3GL 1W8EA 1E6EA 4NN7C 1TPZA 2P4UA 4AQAB 3FCYA 1VM6A 2JK5B 4M7ZC 1D5IH 1A1SA 2ISCA 1OTHA 4A0SA 1HX0A 4F38A 4IUCS 4NK5A 3NEXA 1S9XA 2ZTLA 3UMBA 4IHJF 2X8AA 2ZWPA 4MW2A 2ZP0T 3TAHA 4LF8B 3QDME 1E7UA 3I2CH 2NTSP 4J4PC 2CKMA 4M7WA 2FX8H 5D7SL 4BEBA 1WK0A 4PGDA 3HMWL 3P9RA 3KG5A 1PJBA 3HM2A 2BGGA 3SQOL 3D64A 4LV5B 5E2VL 3L1UA 1BD3A 2VBCA 3NC0C 4AV5A 1L5HB 2Y07H 3PP4H 1AF4A 4H26B 2QTFA 1KY2A 1NSFA 2KBEA 4L73A 4QJ4B 4OFIA 4E30A 5GXBB 5A0TA 5E6RB 4XN5A 5B21A 1BCRA 1OCEA 3DX8B 4KRPC 4MYWB 4OHMA 2FH6A 3C15C 4WU5A 3RH0A 1IFRA 1AUQA 4NG5A 5IP5A 5CA0A 3QJHB 2O6LA 1O94D 3DVRX 3MGKA 5KAQG 4HN9A 4NU0A 3X12A 3VO9A 1DMRA 1BIIB 1OSEA 1KYOK 1MCLA 4OFQA 2JE8A 1ZLVK 2WUCL 4GRLA 3AO0B 4QKXB 5B7MA 3V7AG 3OTIA 3BDBA 5KWSA 5F6IC 2XXAA 4UVEA 1ISGA 1V55B 2BFVH 3LZLA 1PEKE 4LOJA 2ICCA 3TBWB 1P29A 3F2IA 2GSGA 5TEVA 2VJCA 1RXIA 2CCVA 4ZXBA 3Q40A 3MGAA 1Z4MA 1PG5A 3I4CA 2HFEA 2CXPA 4M62H 1I4FB 3BIJA 3O4LA 3WL6A 1U30A 2H1IA 3B3FA 1DTWB 1A1OA 3USCS 3NHPA 3QVVA 1YDHA 2FHBA 1R3JB 3BPNC 4APXA 2VHZA 2QBYB 2EC5A 2VLLB 4M48L 1BYIA 2A94A 1KCVH 2NW6A 1DQRA 1AS2A 4GX5A 5FYDA 3UJIH 1CD1A 1Z32X 2FO4B 4HDNA 4F2HA 3HUFA 5CIWA 1Z4JA 4NOJA 5CTAA 3JATB 3PNWA 5IVZA 2K5UA 1R3IH 3HBJA 2EDEA 4BFLA 5A3RA 3KPNB 5JTWA 5JCJD 1CC3A 12E8L 1K5PA 3GI9L 1K8QA 3OFND 2J85A 1J9RA 1EIBA 1HHIB 4PYKA 3WK5A 1S7VA 2M83A 4AJ1A 5CB6A 5ECWA 1Z5PA 4Y8AA 1K4DB 2GYVA 5DJZA 3WMPA 3DIVA 4I6GA 4N20A 3DDZX 5D7IE 3H2BA 1M7XA 3RYFA 5I45A 4AZ0B 2VLRA 4TTQA 4OZGB 4M5YH 1SELA 2YNMA 4ZCMA 1H8ED 1VCBC 1T7WA 4ZSOA 1QRKA 3ULAB 4YPVA 1DKMA 2P5WB 4MLPA 2PZBA 1HYSD 3TTVA 5KVFH 5DCYA 1M83A 1E4XI 3FFCB 1H3NA 2PJDA 3R6DA 4UINL 4M8SA 3KFXA 3ESDA 1WBJB 3COJA 4I4LA 1RFDH 4KK8D 3QIWC 5ACMA 2YRLA 1ADJA 4AZ3A 5C8XA 2J3MA 1C1DA 2HVKB 3OJ2C 5H35B 3ETHA 4FXOA 1I85A 4F2FA 3ZS8A 1HL8A 4ZALA 5DP2A 3EEYA 3K2MC 1FVCA 2QIPA 3QCTH 2PYEA 2D5CA 5FOUA 4XEHA 1EV2E 5IF9A 5CKAA 3L8GA 2AJ8A 3IBFA 3MLTA 3U82B 1THGA 3OZSA 3TO4D 2QL5A 4X3CA 4UPDA 1CY4A 1Z6XA 4E5KA 1KEZA 4O02L 3GMPB 3PRJA 4L27A 2P78A 4ZT5A 1CSEE 5FK9A 4EGFA 3RAJL 2XNKA 4E42B 4C0XA 5ELMA 5BQFA 1ZEAH 3SFZA 1QBBA 2EJUA 3X2SA 5CIPB 4OMFG 5I66A 1EAJA 4MMYB 3V4VA 5AIAA 4RKEA 4HMDA 3MCWA 5EEWA 2L8AA 4AURA 4JFRA 4K6FA 2REQA 2DIAA 3MLUL 5A9RA 2NRDA 1F2TA 3KM2A 3K0FA 2VT7A 3WP1B 1L5NA 3GXIA 4R1MA 2QVLA 3GOHA 4TXHA 4G5QA 1IEWA 4PIPA 3ESYA 1MSPA 4UHJA 1KAOA 2FW1A 1P9WA 2RK6A 1UOEA 5E8OA 3FRUA 1J86A 1U8YA 1F5NA 3O0TA 1JA9A 4ICIA 2H6PB 2WO2B 1TZJA 1YQDA 4B47A 2X8JA 3BEDA 1KDTA 2XB2A 2JZOA 4XPGH 3UWSA 2C31A 2FF5A 3DJRA 5EOCH 1QR6A 4GI5A 2FKNA 1Z2AA 3K8QA 4GINA 1RYHA 1URPA 1MIMH 2AXGB 3MTEA 1Q50A 1CQKA 4BV8A 1MIML 1BQSA 3ECWA 3LJKA 1PYWA 3RIKA 2H1VA 2W90A 4MEBA 3PWJB 2ICWI 3WFHB 4Y2VA 2WRZA 1BPLB 2UZ1B 2ZJOA 5AOJA 1I1OA 4TF4A 4MGYR 4KRPB 2ZTHA 1K0FA 1C80A 3JTTB 4AQ1A 3JWEA 1YAIA 4ZW3A 5JYDA 3SZLA 3UBGA 3LYRA 3OPYA 4HJEA 4MCYA 4AGNA 2TS1A 3MLXH 5HJ3B 5ICZA 1AACA 1ODTC 4ZMAT 1OE3A 4Q52A 1VIAA 4I48A 2EECA 1KTCA 3MA7A 3EOAA 4MCJA 1R0AL 2IU0A 2ILTA 1L3NA 3Q6FB 5FTWA 2QTWB 4B0OA 4CADA 2PGOA 1TQTA 1ZTXL 3W5JA 4XKJA 4BEJA 3NJMA 1QRDA 2PWDA 5GPBA 4KRNA 1M2VB 4JITA 1C50A 4KK6D 4QYIB 2N42A 4TPKA 4D3CH 3M17A 1H2WA 4ECAA 4EJ0A 4U7PB 2HBRA 3LB6C 1E6MA 3JQBA 2H0QA 5HCUA 2Y8EA 2ZNXA 4D9BA 4Z23A 5LMNB 3TQSA 1NAML 5F3DA 4R3SA 4GLRI 1MC1A 2ORYA 1XRJA 3T4XA 1O0CA 3UYPA 3G85A 1QNZH 1A3QA 3TDKA 3HYLA 4CL3A 5DD0H 2XZAL 1YR3A 1FFBA 4ND3A 1YIAA 2WBLC 2CIIA 3MJ4A 4MP3A 4Y98A 3ZDAA 4NHCH 3CBRA 3QVMA 2RBEA 3QCTL 3T0GA 2O7QA 3ARGB 5BSTA 1K5HA 4D8XA 2C83A 3FTWA 1FZKA 1FC0A 5HKOA 4B3JA 4AM0Q 5ESRA 1AKMA 3KBFA 4ZOAA 2BH9A 4WN9B 2MJWA 4KZPA 2P9HA 5IQ9B 3DE0X 1PR4A 1O58A 5DRZA 4QYAA 1A2YB 5FWXB 1JLHA 1A9ZA 4A15A 2YXVA 3ABKB 5I5GA 5IMBA 5JFOA 7MDHA 4FQXA 4Z7UE 1UOOA 4UHBA 5CFPA 1MFNA 2H6OA 4DO4A 2M1XA 4FKKA 3T6WA 2OP0A 1ODCA 1NBYB 3SFTA 2PP8A 1E6LA 1VL1A 3RSZA 4MA1B 3QZLA 5EINA 5JQHC 2RH9B 3QLUA 2Q4RA 1KEGH 5IB2A 4C30A 1E8WA 1NTDA 4YMIA 4Q4AB 3BZ4A 3O3CA 4WLOA 5HDBB 2Y23A 3LWNA 1MO3A 5KJ6A 1HFWA 3IT2A 4UILL 4U0RC 5G4OA 3WRXC 1W15A 3AL2A 3FOAA 4QXTB 2QAGC 4PN6A 3MDJA 1MF2L 4MNQD 2WP8J 4GQRA 2QPLA 4LKCB 2LLGA 1EJOL 2M6SA 1BZOA 1WB4A 4FI3F 4HEPG 3LKPA 3C3XA 1O5IA 1F0PA 3D1LA 2WWKT 2Q2OA 1MCPH 2K9UA 5BOPA 5AOAA 1JZ3A 2ATPB 2ROQA 4RGOL 3FZUD 4KBFA 1FNGA 2EIMB 1NGYB 2ATAA 4IJTA 5C0CA 4L9DA 3G7UA 3W3BA 3LZQA 2WQ6A 4K7JA 1OW0C 4QQRA 4OB6A 2BE7A 2VI5A 1A9XB 3EOBI 3LK7A 1ZYUA 1Z7EA 2C4FU 2CYAA 4D8TA 3R8CA 1RY7B 5DUMH 4WH0A 3N3AC 4Q6WA 3E0XA 4LNVA 3AQIA 1W6WA 1SXJB 1I8LC 2J0SA 4XVSH 4ZI7A 3KJQA 4M1KA 1W1IA 5I4CA 1WEHA 1QMPA 2Q8BL 2X4QA 1WZCA 5B4TA 3S7TA 1NCAL 3CX5K 1VLMA 5CLTA 5DWUH 2VHUA 2BVEA 4J91A 4D0DA 4Y9FA 2MCPL 4LVOC 2ITFA 4XUGB 1EWRA 2Q76A 2Y27A 3SVTA 3TGLA 1Q6ZA 2NO6A 5LJYH 1IAIL 5IV2A 4B81A 4CM6A 1RUKL 1HN1A 5HRAA 4EOWH 2II6A 2QVCA 1I1AB 4G6MH 3GEMA 2ICEC 1UKQA 3PNPA 2IXTA 3OKEA 2VOEA 5FL7D 3QDMD 3UGXA 5J4MA 1IGML 3G6JF 1L7QA 2OL3L 2WJWA 2H9GB 1Y7IA 4NCJA 5E4OA 1E4KA 3SGDH 3KYDA 4LMAA 4MMXB 2XQGA 1CI5A 4I3FA 3CJQA 5DLPA 4K3JL 4L6IA 3BVNB 2IV2X 5AT1A 2NUAA 2WPDD 4PO8A 3SE8H 3TBCA 1BMGA 5EJ4A 1D5CA 2QR0B 3JZMA 3OURA 2FWRA 4EY4A 1L6XA 2QRZA 1R9FA 2C4TA 1DDGA 1F5WA 1RPAA 2DMKA 2FX9L 5DMKB 3HVUA 2FG6C 2QMJA 5I01A 3I73A 4QE3A 4ZT7A 5EJ7A 2DULA 2VXBA 2JAWA 3DAFA 1TOAA 4HYTB 5AVWB 5BN1A 3VD5A 5KWJA 2NUTB 3X3GL 2KE5A 5BNIA 4KROD 3EEBA 2C8KA 1E9EA 4H7PA 3RPEA 1HDGO 1WKVA 2A8YA 1I82A 4U7WA 2IXBA 1A7UA 4OJFL 4M7KL 3WRYA 1MUUA 3E8MA 1G8YA 2OCXA 3D8NA 3HFGA 1P3DA 3B12A 4LNUB 4PYMA 4YWGH 2KB0A 3N2KA 3CG4A 3FB5B 1NDUA 4PTUA 2O2HA 3RWCB 5C0NC 3EARA 4GRWH 3DKKA 3RUGF 3HCPA 3LDAA 3V0VA 3WHPA 4GSXA 1XZDA 1DZ3A 3MWEB 5CBAB 2D1YA 3L84A 1Q9LB 3KLPX 2M2IA 3L0SA 2W07A 1JHLH 3AKZA 3H9SD 2QRKA 3FKSD 2HH0H 5G4KB 3AY4C 5BSWA 3DBLA 2PT9A 3PQEA 1NGWA 1IUKA 2GUGA 2E3VA 3QJYA 5EUKB 2GBLC 3WTUA 5EC8A 4LBAA 2R48A 1XWIA 3ZYIA 3TEYA 1QR1B 1DELA 1K9VF 3GJFH 4YAIA 3WLEA 2OXHB 4D9QE 3HY3A 4AZTA 2X2OA 4LBZA 3US9A 4I1NB 2GWHA 3MGOB 3CGGA 4OGXH 1JK8B 3QG7H 2RFLA 1T1SA 3G2PA 4R6WA 3IEVA 5D84A 5T8KC 3NHBA 3S27A 3V1LA 4A8JA 4WI4A 2JLCA 5TQ2L 4RPHA 1AR1C 5JAMA 2OI9B 4M54A 5CB4B 3RU7A 1NBZA 3VYUB 2PLFA 4UDOA 5F9WC 2QVIA 3QWHA 1LE9B 3H04A 4CKCA 4PCLA 1GG5A 1NL0L 2NU7B 2VPQA 3ASZA 1N5JA 2DUNA 2O1SA 4HADA 3EYFA 4OLXH 1XYYA 4FJ1A 1QYWA 3NDZE 4RE6A 4A4DA 1KXHA 4DT2A 2FPIB 1UK9A 5B2EA 2QTGA 4Z8YA 5ECDA 4MW7A 2G1KA 1FAKT 4HUXB 5FAAA 3A1FA 1KLGB 4ZYKB 2XMDA 3VR6A 1DJQA 3D30A 2VQDA 3HB1A 4S05A 4BZ1A 1O7DE 4RAUA 2OLJA 4NN5C 2EJ1A 4R9UC 5CNKA 1XEWY 4IOFC 1HJBC 2HSJA 3CW2A 4XB8A 4RRPA 4PJ5E 2ZT5A 4MRPA 1DBBL 2VT6A 1I9EA 4JY6A 1PD6A 2R4SL 3NNNA 5ILQA 3DA8A 5F1YA 4HXAH 3BCDA 3QWNA 3JASB 1XD8A 4K6MA 2I9KA 2K3TA 1KDPA 1QP0A 5C0AD 1ZICA 2DERA 1J11A 4N39A 2V8OA 3FQXA 4NL4H 1U65A 1LK2A 3JZ7A 2J6WA 2M98A 3RTCA 1QNZL 3SM3A 3WL9B 3WYFA 3ZDYE 3VYTB 4FMDF 4TS4A 5JH7A 1FDRA 1CO1A 1SHXA 1LO3L 2G9NA 1SRDA 2LQRA 3MODL 1AGXA 3S36X 2X4PB 4NWUL 3S99A 5EFZA 2VUIB 2EZ8A 2P3OA 2YW9A 5FOWA 1SQ0A 2PKWA 1DANU 2CCLA 1VJRA 3R8BB 3CNBA 4MLDA 5FXCH 3KLBA 2ZTMA 1G41A 1CRZA 4QYXA 2W0LA 3NETA 1EEXB 2ZIAA 5B1SA 3LV8A 1ESNA 3MLXL 2MNWA 2FP4A 3NH6A 3QOXA 3ZVNA 1EE2A 1CL7L 2UZ0A 5TDOA 3SDAC 1N0HA 4IQ8A 2NV6A 4G9FA 3RZCD 5KU1A 1MI5E 3MRCA 3V6FA 3HJGA 4V0NA 4C14A 3H9QA 5TT0A 1EIWA 3KM0A 5E8RA 4CVNA 4CDHA 4J4TA 2J48A 2XYQA 2EDMA 1BQKA 5TQ0L 3GFUA 3TGWA 1RQXA 4EIUA 3O1HB 3ABIA 4I0PA 4BLWA 5BSGA 3IMGA 2YH2A 2BUAA 4QRBA 5G4MA 1EXHA 3E9MA 4C0QC 1I8LA 1KIPB 3GQFA 5T3YA 1OSNA 4K8RC 3EHBB 3HVDA 3Q9UA 5T5FA 5DGDA 3UCQA 1B41A 1B90A 2IANB 4NRXA 1TCUA 3VFWA 3KZXA 4YJFB 5ANMA 1BG9A 4TROA 4KVFA 3R7DA 2DLDA 1ZFNA 2OESA 1BROA 3KB8A 1T6BY 1DHTA 1IGCH 2QW0X 2R68A 1F0NA 1KJYA 2Q2WA 1PK9A 1WZLA 2OP1A 5JG7A 2KDYA 5EEUA 5FPTA 4CBVA 1TO6A 4APQD 2D2FA 3WLWC 4RHYA 1GRCA 5AVOA 4E1BA 4KV5F 1FWXA 1RXEA 5CGQB 2XQBH 1E2JA 3VB8A 4R7NA 4CVZB 4XR9A 4HUMB 5D2NA 1T9GS 4TS3A 2O2EA 5DQDL 2SNIE 2GPZA 3D2UA 4EEEA 2HWKA 4EHDA 3G2HA 1XWFA 1ODUA 2ZB2A 2R1VB 2HNBA 3SSAA 3ZVRA 3MLUH 3AP1A 2VKWA 4J39A 1AGBA 2JGAA 3PXCX 4HDIA 2O3TA 1KGIA 1LA2A 4HJIA 4FABL 1ZSVA 4W5TA 3DVQX 1BN7A 3S3SA 2A99A 1TZ2A 1AMUA 3KDPB 2O6FA 2XJKA 2QMQA 5C4IA 1RYBA 5LNDA 1PEDA 4J0JA 2WYWA 3H6GA 4KQGA 1ET8A 1OXUA 1Z2DA 3FCUB 4W9IC 1MJ8H 4BMPB 1V7NL 4DSYA 1T2CA 4YP6A 3Q2LA 4H31A 2C3WA 1B1AA 1LSOA 4D94A 4MS4A 2IGFL 2FE0A 3TOPA 1KJ8A 5KYUA 4Q0XL 1BAFL 1IJEA 1H22A 2P4HX 2OT3B 4NC0B 1DUYB 4QMEA 5C1BA 2CGYA 1X5MA 2WIFA 3B6SB 3OPZH 2EKJA 4FQ1H 4F3CA 3WJLA 4LL1A 4OQ1A 2ARKA 4NJOA 2X1QA 1UXHA 2RAFA 4NNPL 1GQ2A 1JV5B 3OM3B 3VX1A 4LTMA 1V1MA 2P5TB 3S55A 2ZYHA 2K70A 3WLTA 4U2DA 2V4MA 4ELMB 5AVUA 1IU1A 2X7HA 3QUXC 3E8UH 1QYVA 1Z82A 1RR6A 4ZEWA 4IYJA 5FA8A 1RK1B 4IFIA 4P57A 5F9AC 3AYXB 1LEIA 4FCWA 1ZZGA 1BFKA 1U3HB 4A92A 2W4IA 3BTVA 1C1HA 1XA3A 4PG6A 1OFUA 3VXUD 1FNNA 3KOOA 3A1UA 4BEVA 2AHRA 2QN8A 3CFBB 1FBTA 1X5FA 1V3MA 1J21A 2V3VA 4G9FD 2NY2B 1NIJA 2JLWA 3G6JB 2EEBA 3WSTA 3BP7A 1DBWA 4KJYB 3ZCRA 2ZCZA 5T3ZL 1K85A 4LRUA 3HJHA 2G60H 4LWQA 4JQIH 5DJCA 1MD9A 5BV7A 4IMKC 5FO8B 1BVNT 3VFUA 2ENPA 4MW0A 4W81A 5CNHA 3BSSA 3LPCA 5FFGA 4PS8A 3H7BB 4XT1C 4AYMC 5EU7E 1Q1ZA 5CO1A 1HHGB 4EKDA 3CDCA 1U3DA 1NC2D 2ODNA 4TKLA 1IN4A 2OV6A 2Y1AA 3Q7PA 3TN0C 5L2KB 3HRZC 2FMHA 4FQ8A 3CO0S 2HTFA 4U3JA 1ZT7B 2WVHA 3IAGC 1N9GB 4HFUL 3WGVB 3E6HA 3MPOA 4X6DF 3V9EA 2BDUA 4RIGA 5HS4A 4G8BA 4JZYA 2WVSA 3EYQC 4MJIA 4W99A 2QBYA 1RZFL 4JDVA 2CK3A 2X3UA 2WXQA 3FPCA 3TE7A 4DLZA 4Z49A 1VYTA 3ZK9A 4FYQA 1CIPA 3BKYH 4NNOA 1DBRA 1VBNA 3CLTC 3HXPA 5A40E 4BNDA 3MACL 3HHSB 3KU4A 3NCYP 3JWNE 3EW7A 4YAFA 1T3FB 3GPBA 4J6EA 4XWYA 3MC0A 4HWSA 3Q8XB 2Y7QB 3ZWQA 2GD1O 5D7JB 5E6UB 2A1TS 3SKNB 4TWJA 4XTRA 5B58C 4WJ5B 1XGPA 3GJEA 1NRJB 1OREA 5ULLA 2AVFA 3K09A 2R1WA 4DJJA 4PAGA 3SEQA 1AXEA 4JVNA 4LE8A 3OMZA 4NUQA 4TRMA 4E9SA 1EB8A 1ACYL 1AKYA 1UK8A 1IGJA 2A2ZA 1RURH 3NXSA 1B93A 4KI5E 3IJEA 4PJ7B 4JJ4A 5DQ9B 1LP9F 3JCZA 2D9QB 5JT1A 2AL7A 4DG5A 1CYXA 3SQOH 3TKYA 1N7GA 3PDUA 5D4JA 2BVPA 5IEKB 3QJFB 2Z31A 1F2VA 1S7VB 4N8VG 4EFKA 3CM0A 3T99A 4QWMA 3G5XB 2Y1OA 3L8HA 1K5NB 3HZMA 3MWDB 3FZQA 3IDYC 1K98A 1ZNZA 1A4IA 3QQ9D 2YLKA 2HUNA 3DVSX 4EN3D 2IJGX 3CFUA 5DBOA 1VEMA 5TMPA 3VXSE 1CURA 4OZFB 1BPVA 5EY5B 1GSMA 3AJDA 5JDIA 5BYAA 4E9RA 2F59A 4H6PA 4GAFB 1SN5A 3P02A 3PUHA 1P5VB 1JTEA 1GAQA 1XZAA 2F8VA 3NYQA 5FOBB 3UZUA 3T5PA 1QRND 1JSZA 3UB3A 2CLZB 3AERA 1DU4A 3BJMA 3UJNA 3RWDB 4ENZA 4DXHA 1Q7RA 3FMGL 1T5BA 2H0PA 2LIPA 2VK2A 5HQ3B 3EH5B 1N2OA 4XVJL 3DBOB 4WW1B 4ILDA 2C26A 3RVXC 4U3SA 2YMLA 3S28A 4HDKA 4DP6X 2AEPH 4CF3A 1MG0A 2NY6D 4QTIL 2C4VA 2FIRT 1FZMA 4PJDA 4N6NA 1YJCA 2X9ZA 1Z9SB 3T71A 2P8JA 1U02A 3PYXA 3BWXA 4JZNA 5B58T 5DHFA 3NIBA 4HJGA 3K5HA 3LRHA 1SJVA 2EDTA 2P41A 3WIHL 43C9A 3ESQA 2J73A 3PEFA 5C6PB 5EE0A 1ZIYA 4MKFA 1LDNA 3SGEI 3MTJA 1MXFA 3Q8BA 1FEZA 3EA5A 3IPCA 3FQNA 4NN6B 3OZIA 2W5PA 2EG9A 2LGJA 2JLAA 2OBGA 1YA5A 4N40A 2HNKA 4OYRA 2FJ0A 3SEFA 3SQBA 1IOWA 3KPTA 2A0KA 3NH9A 1OOEA 3F8SA 2E7LA 3RR2A 4NKDA 3WO4C 4P2OC 3HJRA 4QHLB 4JD5A 4K9NA 3O94A 1S2LA 1MFEH 2HEGA 1AKUA 1VERA 4IM8A 4DGVH 1R66A 5D1QA 1JIKA 1GYRA 3MSXA 1BLNB 3BBLA 1NKVA 4TQ8A 5JFTA 1MWAA 3GU3A 3QFTA 3TONA 3IPEA 2WAHA 1E2EA 2JFWA 3KXLA 3O3OB 3BUIA 3IXTA 2YRWA 3ZVVA 1UCFA 2AK4A 4L9WA 4HXEB 2LCQA 5DSCA 3WNMA 1GGBH 3EWIA 3VFSB 2J20A 3U9UA 1AC5A 3C70A 2GTPA 2VDRL 3RABA 1Y3FE 1JHTB 3TPUA 4QKQA 3FTCA 2ZT7A 2PUEA 5DFWH 1K6XA 4IDJH 1T29A 1SOKA 2QN9A 1C8QA 1NVAA 1NVBA 1BSIA 1ORTA 2O0JA 1E2LA 2Y06L 3KV3O 1CS6A 4KVZA 2ZKHH 3JTTA 3X1GA 4AEFA 1YQUA 3K2UL 1KLUA 2AD5A 3SX2A 4A27A 4OAPA 1GKOA 2X6CA 2PXYA 5FKPB 4H6WA 3FB6B 4RX4A 1DBBH 5CZXD 2H3KA 3ZHCA 3FZNA 5C1MB 5DGCA 4HV8B 4B7IA 3X14B 1UCTA 3L3KA 1JR3D 4F7CB