4Z7UF

S13 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
244
structure length
244
Chain Sequence
b'DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSTTPGTGTETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 244
sequence length 244
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uF01
2O5XL 1PX4A 4WUKL 2PTTB 4HT1L 1ORQB 2VAJA 5T5FL 4RAVB 3TO4A 4HIJA 1EZVY 1BJMA 2OTUB 4LRIA 4U1MA 2F8VA 3MXWH 5DURD 2EC9U 3SN6N 2IAND 2E7MA 1CFTA 1TTGA 4LCYB 4EUPH 3FAWA 1MY7A 2W0KA 3C09B 2W60A 1E4XI 3GSRA 2DIBA 1S7SB 5SWQA 3QP3A 4U33A 3W9EA 5D9SA 1F5WA 3IDJA 3LN9A 1HHHB 1HXYB 5HGHB 4JFDD 5SV3A 3IGAA 4O4YH 4D8PB 3WDIA 5J12B 4X8XA 3CUPB 3MRBB 2F58L 3FO1B 4MNQD 3NFSL 2ZOLA 3QG6B 1BBDL 3LKPA 4XPBL 4OM1H 3T0WA 1IE5A 3LQAL 4XP5L 1OT1A 1A1OA 1I9JL 1KIQB 3C8DA 5E03A 3A67H 3HNSH 3MOQA 3VXRB 2PXYD 5GRWA 3LQZB 3QDMB 3U46B 3H8NA 4XCYA 2UZIH 1NFDE 3S3JA 4GXUN 3GEWB 3RX8A 3CDFA 4HUXB 2RB8A 1JGDB 3MNZB 1YEDB 4JG1H 3QIBD 1FL3A 2ICEB 2V2TB 3S7GA 1OQXA 5C0AA 3BKJL 4OIBA 4F7TB 3TO2B 1XZ0B 2XY2A 2NX5A 4NQCA 5J89A 4YHOH 4HEPG 3RWCB 4BSWB 4ZFFA 4P23B 4Z7NE 4HKJB 2Q20A 1RUAL 3QNZA 4IRSC 1MFAH 3B9KB 4N8CH 4KKBC 4X9BA 4HC1A 3MRNA 2V7NB 4RBPH 4RIRB 1OP5K 3WD5L 4CMHC 5D5MB 2OK0H 5I71B 4K8RC 4M5ZH 1VFAB 2XFXA 1GZQA 1TQCB 1B88A 3ZDYE 4YWGL 2VDPH 1Q0XH 1IC7H 5CJOH 3TBWA 4P4KD 3C9NA 1Q9OA 1QBMH 3VFWB 3E2HB 4F58L 2LU7A 4J4PC 1MCFA 4M03A 3V2AR 4WFED 5LCVH 3RVUC 4BQBA 4WDIB 1I3RB 3UDWC 3RJDA 3BEWA 2AEIT 35C8H 1CDHA 5TQ0L 3K80A 1WWWX 1G7QA 4QXUH 4ZD3L 2YOCA 2JLLA 4EDWL 3KLAB 4I48A 5H94A 4BFIB 4JFFA 3VXSB 2DQDH 4ELKA 5IB1A 4YXKL 4OM0H 3D6GA 2YUWA 3EOAA 3GGWB 3LN4A 4M43L 3U48A 2AV1B 3HI5L 1TPXC 1ADQL 3T1FA 5DJXA 3UJIL 4YZFF 1BQHA 1A6WH 5DD5H 4UQ3B 5D7KE 2W0LA 2FYYA 3OGOE 4F2MB 3KXFD 4I9WE 4KVNH 4NUGH 1ND0B 3ZL4H 4S1SL 1OQOA 1EBPA 1WT5A 4WUUE 4JZNA 2AQ1A 2Z93A 1BBJA 4X7CC 5DRNB 2FO4A 2Z31A 3RWJA 3BIKB 2AABH 1KNOB 2E7CA 3RGVB 2DYPA 5MERA 5BW7C 1A8JH 5ILTH 3JWOC 2VOTA 1EEUA 1G7LA 1CFVL 1F13A 1I7RA 3BE1L 3L3GA 4RMSA 4FQPA 3STZA 4ZG1A 5C0BE 4MS8D 1U8HA 3KPRA 4M7KL 3OXRA 2NZ9C 2YUZA 3K1DA 3QUZA 5DJYA 4G6MH 4HDIB 1HEZB 1C16A 1MI5B 4K9EH 4MMXC 3HRZB 2WIIB 4XTRD 1H8OA 1JYNA 1RJLB 3KNBB 4BZ2L 2PF6A 3MRHB 4UNUA 1Q9WA 3G5YB 4JRXE 1XF2A 3SQOL 1EFQA 1N8ZA 4NDMA 2YPLD 4AIZB 5JIIA 3G5ZB 5FYJH 4YQXL 3EZJB 2YZ1A 4MDJB 3RNKB 2Q8AH 5GGTH 2PR4H 3MCKB 5DHXB 4HWBL 2R69L 3AS3A 2FGWH 4NRXB 4YXLH 5DQ9A 5CJXC 3NN8B 1D9KD 4JFEA 3BH8B 1G7IA 1HKFA 3IKCA 4KK9C 3U30B 1DQQB 1MJJA 3UO1H 1FAIH 5J1AB 3WN5B 3OKEA 1DUYA 1ZVYA 4N5UA 2ITDB 3CSYB 3VXNA 5SX4H 3WIIL 5IHZA 5CINH 4QXGH 1CXIA 1IGIH 5IVOA 1HOCB 3GHBH 3VFPB 1N0XH 2BOBB 4NHCL 3OZ9L 2IPKA 4JO1H 3EUUA 5D5MF 3QI9C 1KJVA 4IS6B 3F5WB 4MD5B 4AENA 1ZK9A 3ZE1F 2P8LB 4JQVC 2WBJC 3B4NA 3U4EB 3ARUA 4WHYH 3PWPA 2P45B 1KENH 1JZ5A 4PUBH 3W0WA 5D96B 5KN5B 1NCCL 2XN9B 1DN0B 2Q86B 4NQDD 3UBXG 1OD7A 2R0ZH 4HS3B 1T66C 3VD3A 4Y19B 4QOKD 3O3UN 3U7WL 4AEIL 3LKQA 4KV5F 1YC8A 2QR0A 4N0UE 2IFFL 1TJGH 2DM7A 5C0ND 1TZGH 5LAXA 1BFVL 4OZHE 3TO4B 4MAUL 1ZHLA 5DHYA 3S37H 3EOTL 3B9DA 1QO3A 4Q9RL 3OXSA 1FNLA 4U1MB 4DZBA 5I73C 2V17L 4Z7UA 3RTQA 1CFTB 4WY7H 1YC7A 2XQBL 2J4WL 3ME0A 3IRZA 2W60B 3GSRB 4Z0XA 4GRLA 5SWQB 1CG9A 3O3EA 3W9EB 1AXSA 5D9SB 2IMNA 1E4XH 4WI3A 2WLYA 3IDJB 4ZAKC 4Z7OF 4L8DB 5CGYD 3PWLA 4V1DA 1F4XL 5EBGA 3IGAB 4R26H 4OUUA 1FC2D 3BGMA 4WCYH 5E9DD 3ARED 4EIGB 4RFNB 3KJ4B 2OZ4A 2B1HH 3NIGF 4TUKL 2ZOLB 1UB5A 4G3YH 3LKPB 2DLIA 1F3RB 2P4AB 3BAEH 1A1OB 3MRGA 4LASL 3MYZA 1WZMA 1B0WA 3BIAX 1MCLA 3RBGA 5DHVH 2BRRL 3RL1A 5CEYA 2JELH 4X80L 4LPVA 4XCNA 4XCYB 1TZHA 1A0QL 4AEHH 4KJPD 5F9OL 3AY4C 5HI4D 2BP3A 1FSKC 2EO9A 1WBZA 1NMBL 1S3KH 2JE8A 3SCMD 1FL3B 1FYHB 4LSQH 2BVQA 2NMSA 5BV7H 5B3JF 3C8KA 4NRYA 2C5DC 5C0AB 4D3CL 1TQBB 2DLGA 4FFVD 3MGOB 3LS4H 4RMQA 5I1GL 4AIOA 3MUY1 3VXMD 5GHWL 2NX5B 4PV9A 1B3JA 1P84J 5MENA 2DQGH 3I50H 4HPYH 4NQCB 1IBGL 1EMTH 2Q7YB 3RKPA 5EG6C 3L7FA 2X9YA 5CLTA 3IS0X 3C6LD 4I5BA 5EULV 2P47B 4ZFFB 2AI0L 2OI9C 5HHXL 3QNZB 4IIQC 4RGNB 4X9IA 1NC4A 2MOVA 1OGAD 3MRNB 4G8IA 1JI2A 1TNMA 5D1QC 3FCTA 1CD9B 2XFXB 4P2QD 1GZQB 4JFQA 1EERB 5CZKA 1E6JH 2R15A 3RZWA 3GSXA 2DM2A 1F97A 3QFJD 4U7MA 4K94C 3TBWB 5J13C 3C9NB 1Q9OB 4XT1C 3TLRA 4XVSH 5DJAA 2CIKB 3BEWB 3GRWH 3KYNA 1MSPA 3ZYOA 2F53D 3QNYA 1JGLL 1G7QB 1IFHL 2FNBA 2OX5A 1WVZA 2APXA 1XF5A 3B9AA 4JDTL 5CJQL 4OLUH 3SDCB 4I48B 5H94B 4JFFB 3D25A 3AS2A 4ELKB 5IB1B 3BQUD 5F1KC 2MKWA 4UB0H 3EOAB 5LQBL 1NCBL 4POZD 4WHCA 1IT9L 3LN4B 1U2HA 5D2LA 4XP6L 4GW5B 1QFHA 1RULL 3T1FB 4OBRA 4XXCC 5DJXB 1HHKA 1MWAH 3DI2B 1HILA 1BQHB 3O9WD 2ZCLH 3WDJA 4HQQL 3QEGH 2FYYB 2BNRA 3GNMH 4UT9L 3FFCD 1EPFA 3CVHA 4K7FA 1AO7D 1QSFD 2OL3H 3OG4B 2AERT 4JZNB 2E5EA 3TPKA 2P46B 4P0DA 3ULUH 4URTB 3O3DA 1P7QD 1BBJB 2Z93B 4JB9L 1MREH 2FO4B 2YR3A 2Z31B 5EZOH 4WW2F 3RWJB 1IMHC 3ARGA 5IMMA 2DYPB 4NZTL 5MERB 3ZKXC 3I6KA 2VISA 1H5BC 1EHNA 3QXAA 1D3CA 1G7LB 3L3GB 1I7RB 4P5KA 3STZB 3IFOA 5CEZH 3CXHJ 4L3AA 1U8HB 5GS0H 5J9PA 3OXRB 4LCUA 2ZZUT 2ZUYA 3QUZB 3WDHA 1C7TA 3A0OA 5DJYB 5CBEA 4OSUL 1C16B 4YBQC 1DBAH 4JN1L 3D1MC 5L9DL 4RNRA 3FONA 1Q9WB 3RHWF 1XF2B 1MJ7H 4W4OA 2VXSL 3NTCH 3UTTB 1N8ZB 4NDMB 4BQ8A 2M26A 5F9AC 3T2PA 1JPFA 3LEYL 4HS8L 1E0OB 3PQYE 5DQ9B 4X4MA 3EIFA 4JFEB 1G7IB 5F9DC 2VZVA 3IKCB 2B20A 2MQ3A 1BGXH 4FQHA 1MJJB 4UBDC 4YUEH 4BH7A 2N7AA 4OTXH 1M1SA 3OKEB 1DUYB 1MCOH 5FYJE 5IB3A 1A3RH 1P4BL 3VXNB 3D85A 5C8JA 3KPLA 5BZWB 4PREA 2AGJL 5C92A 3SE4C 2A0LC 4JHZA 1AI1H 4KHTH 4LSPL 1HH9A 2IPKB 5FO9A 4WV1A 4M61A 3RAJH 3S4SA 3VD7A 1CXEA 1KJVB 1CFQA 2IMMA 1H8NA 2RFXA 4AENB 5DQDL 5ENWA 3J7HA 4F7PA 3PWPB 2FJFA 2EH8L 4PS4H 2R4RL 2F15A 5GGRY 5I15L 1ULVA 4LNRA 1MJ8H 4HXBL 1H9VA 1A1NA 3TA3C 4EI6B 3X3GH 1WTGT 3O6FD 3LKQB 1BEYH 2NY0B 2QR0B 3BP4A 3Q3GA 5LAXB 2ADFL 4OLZH 1ZHLB 3Q5YA 5TF0A 1CGSL 2QLVB 1BQSA 3QEQD 5DHYB 5E8OA 4OLWH 1QO3B 3OXSB 4DZBB 1PG7H 2HT3C 4WU5A 4Z7UB 3RTQB 4K3EH 5FCUL 2HTKD 2NY1C 3MRMA 5HSFA 4OF6A 3BN3B 1CR9L 4Z0XB 5GZND 4GRLB 1QLRA 4JFXA 2YD6A 3O3EB 3DOSA 1AXSB 4GUPA 3BT2L 1JNNH 4CL7A 2XA8H 3VWKD 4YE4L 3TFKC 4EBQL 1HQ4A 3IXAA 1FFQA 3PWLB 4V1DB 3O41A 4O2CA 4OUUB 1MF2L 5EBLA 3BGMB 1ITCA 3V8OA 3DO7A 2R2BA 2E7LC 4NQEE 1UB5B 2FDBP 3EYQC 3SGKA 4EDXB 2QSQA 1DFBH 3MRGB 4FA8A 3UJJL 4J8RA 5KJRL 1F58H 2PW2A 1U92A 3RL1B 1DQJA 1L7IH 5CEYB 5JDJA 3NPZB 4XCNB 1TZHB 3ULVF 4HKBA 1KCSL 1QPPA 1JNLL 2QTEA 1ZMYA 4GAJH 1WBZB 3CNKA 1GH7A 1Z9LA 3GBLA 2BVQB 2X89D 1I8MA 1OAKH 4BQCA 3C8KB 4NRYB 1H3GA 4LQFH 1CCZA 4XAKD 5SWSE 4UINL 4U1GB 4GKSA 4PV9B 2YA0A 4MVBC 4ETQA 4Z76A 5MENB 2J8UA 1FZKA 3HZKB 4PJCA 2KL6A 3UXFA 4FP8H 1G9MH 3L7FB 5F44A 3BVNA 4I5BB 3IFPA 1FZOA 1LO4L 4DUWA 5D1ZC 5I1CL 1IILE 1QZ1A 1BD2E 3IU4H 4EN3C 1NC4B 2DBLL 2WLZA 5K93A 3NH7L 3ARDB 4G8IB 2ARWA 1X44A 2E9JA 3K81A 2W9LA 4GJTB 2D31A 3FCTB 4P2RD 1WZ1H 2VDQL 5D7JD 2O5ZH 4JFQB 4N8VA 2OLDA 3Q6FA 3GSXB 1O0VA 1ES0A 3KYMA 3QDJE 1A6ZA 3ARFD 2BY1A 3GSNH 1KN4L 1QFWM 3FB6A 1U8QA 2DB8A 5ADPL 5DJAB 4PB0L 3MCG1 3DJ9A 4LCCC 1R5WB 3BKYH 2CXKA 3KYNB 4PRPE 4AL8H 5GGSY 5F88A 2F8OA 3QNYB 3DHJA 3N1FC 5IT2L 1XF5B 1BECA 1OPGH 4YHKL 2V5YA 3D25B 1N5YL 4Y5YC 5FHBL 3MJ7B 1C5BL 4XGZA 4M7LT 4X4YB 3ARTA 3KPQB 2J5LC 5JXAL 3CMOL 4IMLA 4Z7UF 1UFUA 3SKUD 5D2LB 2CKBA 3MREA 4IRSA 1QEWA 5ALCH 1FE8H 3CGTA 3HA0A 1MHCA 2F54A 5DF0A 1T7XA 1HHKB 3RU8L 1HILB 2BHYA 4L9DA 2BNRB 1NBQA 4PY7A 3CVHB 4K7FB 1KB5A 1GC1L 5CGTA 3AGVA 2VMFA 4P99A 3O3DB 4J4PA 4QHKI 1I3GH 3VDAA 3ARGB 5IMMB 3UDWA 1Y6MR 3I6KB 5CSBA 2VISB 5FUOL 1YNTA 4LAQL 3TBVA 2NXZC 3QXAB 4K7PX 2ZPKL 4P5KB 3TCXA 3IFOB 1W72L 3ULUE 4G7YL 4BJLA 3VDBA 4LDLB 5J9PB 2NYYD 1JPTL 4LCUB 5D72L 1Q0YH 2ESVD 4PP1D 2VDNH 5E95B 3RIFF 5CBEB 3SDXE 1OLZA 4F9LC 3B9VA 4S1DD 4RNRB 1ZLWH 4DK3A 2YD3A 5D70H 3BDBA 3FONB 4DKDC 5CEZE 1DQTA 1WIUA 3ECBB 4L4TD 4O58H 3GMRA 4A2MA 1CICD 3MXWL 4PJHA 2UWEE 1JPFB 3MLZH 4ZUTA 3LHPH 1SBSL 4MJIA 2GJ6A 1Y0LA 1FL6A 3CIQA 1FZMA 4FQHB 2ED8A 3QWRA 4KDVA 1FORL 4L3EA 5DFVC 2BVYA 4N9GA 4BH7B 4M7JH 5IB3B 5FA3A 4ZOEA 2ICWJ 3D85B 4NQSB 5C8JB 2OR9H 3O81A 2OP4L 3IAPA 4LHUA 1RVFH 4PREB 43C9A 5FGBC 4O4YL 5E8DH 2EDQA 3HNVH 2VITA 1OTUC 5BW7A 1HH9B 4U4BA 5FO9B 2CKNA 4M61B 4WV1B 3S4SB 4UUJA 1IM3B 2NY3B 5IJVA 1CFQB 5EORH 1U95A 1VGKA 4OM1L 4U3CA 3KPNA 4C59B 2D4DA 4F7PB 4HKZA 4CADA 2WWMD 3CFKA 3ES6A 2FJFB 3T3PF 3A6CL 3CDCA 1FO0H 1F4AA 4S10A 4HXAH 2YMXH 4FTVD 4LNRB 4P9HH 2UZIL 5I1HH 2YRZA 3C5SA 2KDGA 1A1NB 3VFGH 4JG1L 4KK8C 5HVHC 3U1SH 4RRPA 1T7WA 3ULSA 5CJXA 1CGTA 1AE6H 3BP4B 1U6AH 3MRIA 1U3HA 4AK1A 4RMVA 2Y5TA 5FUCE 5FM5M 3MLRH 5E8OB 4PJ5E 1UENA 5IROC 3UTOA 3H6JA 3UTSD 1UKQA 4WU5B 3VGEA 4H0HB 1PSKL 3FN0H 5E2WH 1NBZA 3MRMB 5FV1L 1MFAL 3QI9A 4N8CL 1S9XB 2LTQB 3QCVL 1G6VK 3OAZH 1TJIH 1G7HA 1QLRB 2Y23A 4JFXB 4JPIA 4A6YH 4GUPB 4Y4HC 3B2UC 4HHAA 4JQVA 2WBJA 2OK0L 5KAQG 4HC1L 2JCCA 1HQ4B 4FFZH 1BWWA 3IXAB 4M5ZL 4EXKA 5C6WH 3O41B 4O2CB 3BYTA 4YDLC 3ZHDA 3NCEB 5EBLB 1HXMA 2VDPL 1Q0XL 3TBYA 1IC7L 5CJOL 3DO7B 2ZUWA 3LZFH 2R2BB 4MXVE 2NR6D 2FB4H 1WITA 2APFA 1D5IL 3QPXL 4P3DA 35C8L 1CK0L 4XMPH 4J8RB 3JV4A 3AS0A 2GITA 2E7BA 4DKEH 2JJSC 3QYCA 1IKNA 4QXUL 1U92B 1DQJB 3VXQA 4KVCH 4HKBB 2K1MA 2DQDL 5L0QC 1XIWD 4L4VB 1BF2A 2XWJA 5L8LB 2CGRH 4OM0L 1KLFA 2UVEA 1UEYA 3U82B 1I8MB 2PKDA 2NY2D 4LSSH 5IBUG 5T3ZH 5LWYH 1YY9D 1VB9A 3GBNH 2YBRA 4GKSB 1A6WL 3HMWH 5DD5L 3CC5A 4ZAKA 4Z76B 2X44D 2J8UB 1FZKB 4OGAC 4PJCB 5GGVH 4I2XE 2WZPD 4KVNL 2ZUXA 1JTPA 2ZUVA 4NYLA 4KGJA 4NUGL 3BVNB 3ROOA 4Y5VC 3IFPB 1J1OL 1FZOB 2EDRA 3ZL4L 4X9HA 4WUUA 2F19H 4LPUA 2WBWB 4XP4L 4M6AA 1AKJA 1OWRM 1NCDH 2AABL 3E0GA 5E6ID 4RWYH 2D31B 2RGSA 5I1DA 4N8VB 2C7UA 3DETD 1X5IA 3Q6FB 1NQBA 1ES0B 2D0HA 3KYMB 3JWDC 5C0BA 3OKNA 3BZEB 3MPCA 1A6ZB 5DTFA 5ACMA 2XZZA 3L9RA 4TQEL 5JHDA 4JAMA 4PRBB 1U8QB 5GS2D 3AY4A 5CKAA 4K9EL 1AD0A 1RFDL 4HF5H 2X1PA 4BZ1L 2JJWA 5EZJA 4ZXBC 1MAMH 2E8YA 2Z9TA 5F88B 3WFHA 1FL5A 3SQBA 3GMMA 3I2CL 1MFCH 4NWTH 5FYJL 4NKIH 5E8PA 1M7DA 5HHME 3WXWL 5GGTL 2DD8H 1E27A 2FGWL 3MGTB 5I1JL 1SEBA 2A6IA 4XGZB 1FAIL 4B0MM 5CZXC 3S5LA 4P57A 2CKBB 3LY6A 3MREB 4IRSB 1QEWB 4IIQA 5CINL 3EOBA 1MHCB 2F54B 4ZUUA 4QXGL 1UWEL 4RX4A 4WWID 1AC0A 4CMHB 1UB6A 4U1JA 5D1QA 1J1XH 3U7AA 5A2LH 4U0RC 4PY7B 4GRMA 1QFWH 5HGBA 1KB5B 2X4SA 3IJHA 3G6DH 2VB5A 4P2OC 1NCAH 3T0BA 3OJ2C 4RA3A 4WGVB 4P4RA 1RI8A 3H3KA 1X6NA 3QWQB 4WI2A 1YNTB 2EDOA 3D69A 4GMSL 3U9PL 3TBVB 5CLWA 2VYRE 1WWBX 4G5ZH 4E9LA 5JHLH 5JA8B 2RHEA 4XWOD 1TVDA 1FVCB 1Q1JH 1TJGL 1TZGL 2PO6C 5HYJE 4KC3B 5JW3H 4LSDA 4M00A 3UPRA 2EDYA 3VE0B 4PTTA 5B8CC 4U6YA 3FO9A 3GMRB 1TPXB 2AEWA 4PJHB 4WI7A 1IC1A 4XXCA 4ZUTB 4WY7L 4MJIB 2GJ6B 3I02A 2HT4C 1MCJA 1N3NA 1Y0LB 1FL6B 5DDHA 1CDIA 5DMIH 1FZMB 4L3EB 4N9GB 2P5ED 1IAII 2J8UF 2XQYG 4PJCF 4YPJA 3RDTD 5FA3B 3HE7C 1E4XL 4PRIE 4X98A 1AGDB 4LHUB 3T0ED 4TNWF 4UQ2A 43C9B 5FM8A 2YA2A 5EB9A 2DF3A 4R26L 1I1CA 5I8EA 2VITB 4WCYL 1H5BA 2AKRA 2ZSVA 4UUJB 2B1HL 3TBSA 5IJVB 3HUJA 1CTOA 4G3YL 1L6XA 1VGKB 2VWEE 2K9UA 3ZYJA 3KPNB 1VSCA 4E41D 4HKZB 1OTSC 4CADB 3CFKB 3ES6B 2IH3A 3O2DH 3HFMH 4KUCF 1J7VR 5DRXA 3P40A 2LFGA 1TXKA 3ALPA 3MV8A 4Z7VE 2JELL 1X5KA 1OSZA 2PN5A 4AEHL 3C5SB 2EE6A 4X4XA 4HAGA 4P5TD 1CN4A 4ZSOA 3ULSB 5DD3H 4LSQL 5K9QG 5KSBE 3MRIB 3BD3A 1U3HB 5BV7L 2VKWA 4NKMA 2Y5TB 3RKDD 3LS4L 1NGWA 4D9RE 4X7TA 4HJ0D 4YR6A 2DQGL 3QDGA 3I50L 4HPYL 4PRDA 2C1OB 4Y1AA 3LCYA 5ITBL 1ZXQA 1EMTL 3SE4A 4PJIE 1INQA 1BVLA 3OF6A 4HZAA 1F2XK 1NBZB 1J86A 4FQ2H 3H9SA 4CDHA 3IDGA 3ZKSD 4XB8A 3QI9B 4KI5F 1G7HB 4JPIB 5H37G 4HHAB 5FYKH 2WBJB 3CFJA 43CAA 1UH4A 2JCCB 4H1LG 5BS0E 1E6JL 8CGTA 2X1QA 5FYLD 2P43B 1HXMB 2EDDA 1IGMH 4X83A 4M3KB 3TBYB 4PY8J 4TN9A 3U2SA 4XVSL 2M1KA 4PD4J 3B83A 5IGXH 4P3DB 3TA3A 3GRWL 3HPLB 3JV4B 2GITB 1QFUH 2XWTA 3AB0C 3BRGC 1PZ5A 3HRPA 3MACH 3IDIA 3VXQB 5DC4B 5I9QC 2XT1B 3ABZA 4JM2F 5LJYH 3VXRD 2HFTA 4P46C 4YDVB 5I73B 4NJAH 1U8NA 2A38A 2XWJB 4UB0L 3QDMD 5JOPE 1HSBA 4WWKC 1ZLVH 4AYFA 3ALWA 2YD7A 2G5BA 3LVEA 1GXEA 4TSAH 1MWAL 2YBRB 4RWHA 4UV7H 2MQ0A 4ZAKB 4M6OH 3GNML 4NYLB 1EEZA 4KKCC 3RIAK 5T3ZE 1YA5A 4HUUA 4WUUB 5KSAC 5L6YH 2DMBA 2E7LA 1AKJB 1MREL 5EZOL 3G6AA 1PKOA 2VC2H 4H25A 4P23D 5I1DB 4RMUA 4D0BA 3CVIH 2H32A 3ALXA 1YN7A 3B9KD 2C7UB 1U8IB 2XOTA 5CEZL 3RL2B 2VWEC 1CLYH 5C0BB 5GS0L 4NNPL 5DTFB 3L9RB 3TZVC 4X6DE 5JHDB 4JAMB 1S8DA 1P7HL 1L9NA 4KI1A 1DBAL 3EYUH 4OZFG 3UBXI 1AD0B 4UIMA 1NFDF 4KJWC 1J8KA 1FSKB 5EZJB 1N2RA 3WFHB 5DC0A 5BRZE 1FL5B 3GMMB 3VFRA 5E8PB 1VPOH 3EDJA 2J88H 5DMJB 2E6QA 1XGQA 3GHEH 1E27B 3PQYA 3MX0A 3X3FL 1SEBB 2A6IB 1BGXL 4OJFH 4YUEL 4OTXL 3S5LB 1MCOL 1A3RL 5D1ZA 2OI9B 2SEBB 3VXSD 3QFDA 1WIPA 4IIQB 3EOBB 4EN3A 4ZUUB 3WSQL 3T0DA 1I8LC 3TIEA 3O4LE 4KPHH 1LNUA 1QRNE 3QNXA 1AI1L 4KHTL 4Y7MA 1UB6B 4U1JB 5D1QB 2GUOA 3DSNA 4RMWA 3RAJL 4LCIH 4GRMB 3PXJA 5HGBB 2X4SB 3IJHB 3BZDA 4PJ8C 4QHMB 5DMKA 5I1AA 1XGYH 2BNUA 3DVNA 2ATKA 5J13B 2NTSP 3ZDYF 2PYEE 2EDXA 4P4RB 4PS4L 3M8OL 4LCCA 3KPTA 1U8OA 1CVSC 1CT8A 3D69B 3O3AA 5F9JA 1C1EH 4B7IA 2KPNA 3OSKA 3D39E 3FB8A 1RZFH 2VDOH 3X3GL 1ZSDB 1R24A 4N0UB 1BEYL 5FDWA 4ELME 3CFCL 4Y5YA 3MRDA 4OLZL 1F11A 1YMME 4OF3A 4PTTB 4OLWL 3A6BH 4U6YB 1MI5D 2EC8A 2H3NB 3FO9B 1PG7L 3OKOA 3RIAF 2WIMA 3WKMH 2JIXB 4K3EL 4LOUD 4LFHG 1N3NB 5DDHB 1KG0A 4BKLA 3DUSA 4DCQA 1NUFA 4PJBA 2XI9A 4ZDHA 2B4CH 1JNNL 1QLFA 2XA8L 5I74C 1IAIH 3NZHH 1N5AA 5DR5H 1U58A 4OZ4A 4UQ2B 5DC9B 1MNUH 4NM8H 5I8EB 3ZKXB 3H2WA 4X99A 2VO5A 1B2WH 1H5BB 2AKRB 2ZSVB 4FQQA 5INDA 3TBSB 2AXGA 3HUJB 1QFOA 2VTFA 4Z8FH 2R0KL 3DX7A 3K2UL 2NCMA 1DFBL 4NN6C 1BQUA 5AG9A 3UJTH 1LEGA 4FXLA 2IH3B 4RQQA 5EU7C 4F9LA 1XCTA 1F58L 4P5MA 3DGGB 5DRXB 3VRJA 1RIHH 1XT5A 3MV8B 1L7IL 2GI7A 1W0WA 4HUWB 2ID5A 3BHBA 3MZGB 4X4XB 4H0IA 3T65A 2H2SC 1FJ1A 4GAJL 2XN9D 3AXLA 1T1XA 2YWZA 4ZSOB 2N56A 1X5XA 1AHWC 5GSVA 4NKMB 4S0TD 2XICA 4Y19D 5SWSA 2GQHA 3T09A 3FHAA 1NGWB 2X42A 3MLUH 4X7TB 4L8SC 2WANA 2J12B 4YR6B 3R0NA 3QDGB 1E28A 4PRDB 5FGBA 4Y1AB 1DANT 3IRPX 3TO4D 5I8KH 4FP8L 1G9ML 1INQB 1P53A 1BVLB 1C5CL 4Y89A 3HS0A 3H9SB 3DURA 1BD2A 3IU4L 4E0RA 5F1IA 3GJFH 3CFJB 3O2VL 43CAB 4NBYB 5AAMA 1WZ1L 2O5ZL 4X4ZA 1FG2A 1PZUB 3QDJA 3GSUA 4ZFOL 2UY6A 4F37K 4NRZA 3U2SB 3GSNL 1U41A 1WAAE 5DQJA 5JOFA 3DXAE 3NCMA 3TA3B 2CK0H 1NMAH 3BKYL 4PRPA 2XWTB 2Z8WC 2M8XA 3HKFA 1PZ5B 3BWAA 3IDIB 4XX1G 4OZHF 1OPGL 1S5IH 1U8PA 2XY1A 5IROA 4OLYL 5J7CC 1KCRH 1LQSR 3QQ4A 4R4ND 1U8NB 4FFYH 4OT1H 3NVQA 2D9CA 3EYOA 2NY1B 1HSBB 4MWFA 5ALCL 3CK0H 1BZ9A 4PGEA 1FE8L 3FZUD 2G5BB 3RA7H 4OCYL 1I1YA 4Y4HA 5F93C 4XP1H 4CBPA 1H15A 5F1OB 5FFLA 4MCYA 2ZJSH 2YD4A 1J11A 1EEZB 5IQ9A 5C0AD 4KRPC 3QXDA 5C3TA 5SWZA 4JRYA 2E6JA 4HUUB 1JNHA 1RUQH 5DLMH 3GJEA 2NX5D 4U31A 1EIBA 4NQCD 3CSPA 4MD0A 3G6AB 4MQ7A 2FECI 5EO9A 4H25B 3C5ZC 3QQ9C 1S7QA 3W11C 4D0BB 2H32B 1LO3L 1YN7B 4ODTH 4RGND 3W5MA 3QRGL 2JJSA 3R0MA 4FQCH 4BSJA 1Q0YL 1S8DB 3OB0H 3SDXA 5CJ5A 5FV2A 3UBXA 4UIMB 3VH8A 3QUML 1N6UA 3TF7C 4KKLD 3EO1A 2DKSA 1N2RB 3RVTC 3VFRB 1OAZH 4GMTH 2UWEA 1A3LH 4UOW1 3MLZL 5ISZD 5GRXG 1A7PH 1XGQB 4QT5A 3LHPL 3PQYB 3FO0H 3TJHC 4XNZB 3LKSA 1V3JA 4WGWB 4NOFA 3X14B 3TVMC 3X11A 4Y5VA 4WI9A 1NLBH 4KQ4H 4B41A 1T2JA 1UWXH 5D1ZB 2H8PB 4JFFD 3QFDB 2OR9L 4KQ3H 2MNUA 3ET9F 1ZA3A 4A2LA 3F12A 3SJVE 1C08A 3UAJD 4EN3B 3TIEB 1FBIH 2FH6A 1LNUB 5E8DL 3V4PH 3QNXB 5IMLB 2XPGA 1EHLH 3HHRB 3HNVL 4J3SA 5CILH 1F02I 9CGTA 1K9TA 5AAWA 3CU1A 4YAQA 5DMKB 5I1AB 2BNUB 5KSUB 3DVNB 4N0RA 2ATKB 3EJZD 1OOAA 1EO7A 4JFYA 3K1KC 3CXDH 4C56E 4I13B 1F8TH 4LCCB 4YXHH 1RIVH 1U8OB 4ZXBA 1CT8B 3O3AB 3FT4A 4NP4L 2IADA 2V5RA 5F9JB 2PNDA 4P9HL 1FQ9C 5I1HL 4P9MH 5T3XD 3SO3C 2Z31D 3BPOC 5J11B 5LGJB 2DYPD 3FB8B 3V0WH 4HFWA 3U1SL 1CBVH 4YPGB 5FDWB 1AE6L 1U6AL 2EXYD 4Y5YB 4KZEH 3MRDB 1BQHG 4QRRA 3LSOA 1F11B 4J6RL 3KPRD 4XWGH 3MLRL 4OD2B 3QUZD 3VD5A 1A7RH 4TOYL 3OKOB 4ODHH 3ULVD 2VZTA 3FN0L 2R2EA 1KG0B 4BKLB 2VLLA 1XAUA 3DHMA 4Q0XH 4JFDE 4M62H 1QUNA 3DUSB 2DQEH 4DCQB 1TJIL 4WW1A 1JUFA 4ZDHB 4DUVA 1QLFB 2DRUA 4JFED 2I9TA 1BHGA 4P2OA 1N5AB 1U58B 1W2KT 4OZ4B 4MNQE 2DJ4A 4MJ4A 4LVHC 5E5RB 1T6WA 4X99B 4FQQB 1G1YA 3LZFL 5INDB 4MNGE 1IAOA 2NXZB 2AXGB 3Q2CA 4GAFB 3B5GA 3DX7B 1QR1A 1SYSA 3MLWH 4QY8A 3NABH 4XMPL 2J2ZA 1MCWW 1JHTA 1XCTB 3MLSL 3VCLA 2PO6A 4DKEL 1UH2A 4KK5C 4GKOA 3VRJB 3GI9H 1B0RA 1MIMH 1TCMA 1W0WB 4KVCL 2FHBA 3EHBD 3PWPD 4F80A 3BHBB 1XGPA 5CSZA 1DQDH 3T65B 3TGXA 1FJ1B 5EOCJ 3W0WD 1C7SA 2AW2A 2J6EA 2KKQA 2HH0H 1OTTD 1T1XB 1GAFH 4O5LH 5KW9L 2CGRL 4X5WA 4QHNA 4JPWH 2V5SA 4HPOH 4LPCA 3L5IA 5F70A 4YHIA 4KROC 5T3ZL 4LSSL 1QACA 5GSVB 4S2SA 1AIFA 5LWYL 5SWSB 3GBNL 1EGJH 3HE7A 3O6ML 3HMWL 2J8HA 4NQTA 5CUSH 3MBEC 3PABA 1E28B 5GGVL 3BD5A 4S1RH 2X4RA 2HFEA 5EFIA 1LK3H 3MA7A 1HYSD 3HS0B 2IGFH 3DURB 1BD2B 4TSCH 4Y4FC 4OB5H 3CZFA 1NCDL 4E0RB 5F1IB 4Y4KC 2XZQH 4N1EA 4WFEE 1FG2B 4GRLD 3QDJB 3UCRA 1LK2A 2AJXH 3GSUB 4ZMAT 3RGHA 3DO3A 4NRZB 3RJQB 4R2GC 1LO5A 3IDUA 5JOFB 5DQJB 4V1DD 3GB7A 4HF5L 5C07A 2CR6A 2VUYA 3EJYC 4WTWA 5L8JB 4PRPB 4JJ5A 5HVHB 1MAML 5LKNA 4K71C 1JMXA 4JFPA 1YEEH 4ZS6C 1YPZA 1MFCL 4NKIL 2R0WH 1VDGA 3BWAB 3GZKA 5DK3A 1HINH 3CDGA 2PTVA 4G80A 2DD8L 1U8PB 2EEBA 2WV3A 3QQ4B 1AGBA 1O5DT 3EYOB 3J8F7 4MWFB 3KXFE 1BZ9B 4PGEB 3QUYC 3LB6D 2QQQA 5F3BA 1I1YB 4Y4HB 3WFEH 1DVFC 3I3BA 1UM6L 3ZE0E 4X8JA 1H15B 2MHAB 1J1XL 3LS5H 2XV6B 5GQBA 4DN4L 4MCYB 4TVPE 4XH2A 5IQ9B 4LEXH 5ERWA 5K9KA 5KS9F 4NM4L 3QXDB 5SWZB 5F97E 4JRYB 3O6KH 1E4WL 1N26A 2XTJC 3GJEB 3QEHA 1U8KA 1NCAL 5MEND 4Y2DC 4MD0B 5E5UB 4MQ7B 5EO9B 1S7QB 1JP5A 1OVZA 1F6LL 4HUNB 5SV4A 4JPKH 5IMOA 4G5ZL 5IWLC 5JHLL 1DLHA 5MHSD 4KV5E 4YDJA 1SHMA 5KVGH 2PCPB 3SDXB 2YPLE 4Z6AT 5L0QB 1Q1JL 3VH8B 2R1YA 5HYJA 4P46A 2CDFB 5JW3L 3EO1B 3ZTNH 3V79C 2W9DH 3TH2T 3OB0K 1IC5H 2XZAL 4WWKA 2DL2A 2UWEB 3S9DB 4QT5B 4N5ED 2VDKH 1N64L 3HG1E 3MMEB 4FZ8L 2NW3A 2AV7A 2H2PD 3LKSB 2EXWC 2CSPA 2B8OT 4Y5VB 2DN7A 3HAEG 3VWJC 4ERSH 4DTGH 5KSAA 1E6OH 2CRZA 1ZA3B 3F12B 1C08B 2Q8BL 4W6WB 1ACZA 1UWXK 5J12C 4YHZH 1NH6A 1FYTA 3S88H 4GRWE 4U6VH 3MYJA 4KH2A 4YAQB 5A40E 4NQDE 1Q94A 5KBNC 5FKPA 4KMQA 4JFYB 3TZVA 2BNRD 5F89A 5JW4M 5KSVA 3O2DL 3P9LA 4MA3A 3EOYG 4QOKE 2UUDK 2WUCH 2X4TA 3GM0A 4ZXBB 3FT4B 3JWNC 2IADB 2OQJA 4N1HB 4MGXA 1X4YA 5DWUH 1NSNH 1EBAA 1B4RA 3ARGD 4HFWB 1BVZA 4U6XA 3BMVA 3I9GH 5EBWA 5IBTH 2HTLC 4F9PC 5TE7H 4QRRB 1X5FA 3LSOB 1VERA 2E9IA 2X1WL 4MXWL 2HT2C 1NPUA 4RDQF 4NN7C 5C6TH 4U6HA 3T2QA 5ICYA 5HVGB 1MCEA 1I8LA 5D7LA 5AYQA 4PYGA 2R2EB 2D7PA 2VLLB 3P77A 2UYLA 4U0RB 1K4DA 3QB7C 4WW1B 4EZMA 4PJ8A 1JUFB 5E9DE 5MI0C 5FYKL 2I9TB 4P2OB 3OWEA 3P3YA 2VXTH 4LKCA 5JMOC 4DWHA 2GT9A 5F72S 3FQXA 3BKMH 3WE6A 2VZUA 2IALA 1IGML 1OAYH 3D85D 1IAOB 4OF0A 3K2MC 4YEEA 3BESR 3L1OH 1RAMA 2QL1A 1A14H 1T0MA 5IGXL 1QR1B 3X13A 1QHOA 2NLJA 1SYSB 4K7PH 5D1XC 1VFOA 3ULUF 4KMLB 2I07A 3BP5A 3EYSL 1CU4H 4JN2A 4H8WH 1MH5A 2NY3D 1JHTB 3VCLB 3T08A 3SDXF 2PO6B 5T5FH 3GMLA 1HE7A 4K55A 1WZLA 1DDHA 1B0RB 5ETUA 3CPLA 3C60C 1RPQA 2W92A 2EICA 4OZGE 1IGTA 4FG6D 1XGPB 4LBEA 5CSZB 1PQZA 4NJAL 4JY4A 5F7MC 4X5WB 1G9EA 4QHNB 2UWEF 3ILQC 1V05A 4YHIB 5T5NF 3UC0L 2PETA 4PRHA 4NPYA 4S2SB 1AIFB 4D9QD 3S4SG 3QJFA 3HE7B 4LDOB 3D9AH 5HI3D 4UV7L 1KB9J 1K2DA 4LLWA 5DEFA 5E2UH 3RNQA 1AP2B 1MQKH 3PABB 4M6OL 1F3DJ 2KZWA 3TT3H 1OGAE 4LVOC 2X4RB 3MLVH 2HFEB 5EFIB 2VAAA 3MA7B 1E4KC 5L6YL 4XB7A 3T4AA 2F58H 3P73A 4P2QE 3RVWC 3FMGH 3MLTA 3NFSH 4N8PA 2EDNA 4NCC1 1CQYA 3LEVH 3CZFB 4G8FA 1PD6A 1I9JH 1J0KA 1DJSA 3QFJE 1HSAA 3GSOA 2VC2L 4S1QL 3V7AE 3MV7A 5CP3A 3CVIL 1L0YA 4DGVH 3KLDA 1CLYL 4ZTOL 1LK2B 1M7XA 8FABA 1WIOA 3E8UH 5IHBA 4X6DA 2F53E 1LO5B 4UILH 3EYUL 3GB7B 2CRYA 5C07B 4W6XB 4DFHA 2IWGA 4JFPB 1YPZB 1JRHI 1AHWA 3ZDZE 4UOW0 1VPOL 2DQCH 3ARBC 5AG8A 3CDGB 1T21A 2VSCA 4G80B 3GHEL 4WFGD 4QEGA 4L8SA 1TTFA 5EC2A 1KXTB 3Q48A 1RZJC 4OJFL 1AGBB 1X4ZA 2VQTA 3NAAH 3FFCE 3SE8H 1JHKL 1XR8A 3EBAA 1QSFE 1TZIB 4PJ9B 5F3BB 1QRNA 2ICWI 3IFNH 4X8JB 2DJUA 3D0LA 1MCCA 4XH2B 4BQ6A 5ERWB 5K9KB 1I7UA 1G9NH 5BMFH 1H3UA 4LF3A 1XGYL 3L7EA 3QEHB 1U8KB 2PYEA 5DD6A 4KGLA 3U4AA 4MXVF 2VDML 1MAKA 3FQRA 5C2BH 4F57H 3TJEL 1Q38A 4PGBA 1RU9H 4AG4H 2B0SL 3OX8A 3AB0B 2DQHL 1CTNA 5IMOB 3BI9X 5GS1C 3QBTB 5IKCB 3D39A 1DLHB 4YDJB 1RZFL 2VDOL 2CXGA 1KJ2A 4XI5C 4YXKH 2R1YB 2ADGA 4UTAH 4HIXL 5HYJB 4P46B 2IQ9H 2XKUA 3NACH 3EDKA 1Q72H 4WWKB 2BFVL 4JO3L 4PJXE 3TESA 1ADQH 1DQLH 1OARL 4NKQB 1QYGH 2DM3A 5IFJB 3WKML 4GXUM 5JZ7C 2NW3B 2EIDA 4OZIA 4O2EA 4AJ0A 3QQNA 5KSAB 3GSQB 2B4CL 4PRIB 4UOJA 1FVEA 2DM4A 1IAIL 4EKXA 3NZHL 5DR5L 4LGPB 4XVTH 1A21A 2E6PA 4G9DA 4NQUA 1IM9A 2O61B 1MNUL 4XC1H 1AR2A 3C5ZA 5IV2A 3P2TA 3K7UA 4IRSD 4WW2C 1FYTB 4DZ8A 1F45A 4KK6C 4Z8FL 2F54D 5CD3A 1LD9A 4M7KH 4QRSB 1Q94B 3P0GB 3TZVB 4JFZH 5KSVB 5F89B 1JWUB 1KTDA 4PGDA 4MA3B 2HMIC 3ILPA 2CUIA 2HJLA 4BZ2H 1IL1A 2X4TB 3OJMB 1D5MA 5EUOA 2OQJB 5E2JA 4J4PD 4CKVX 3TH3T 2FEDC 1ZANH 3RVUD 4C83A 4U6XB 3KS0J 4I0PC 4OCXH 4U1LA 5M95B 1B6DA 5EBWB 4ZO7A 2QBWA 4GLRH 4OFYD 2C4XA 3TVMA 2DI9A 1SY6H 4QRPA 3MLUL 5C2UB 1NUGA 4HJGA 4U6HB 1T5WA 5HYIA 1FN4A 5E6ZA 5ICYB 2DWEA 3L5HA 1FRGH 5JPMA 5I8KL 4LSVL 5D7LB 3SE9H 3WCYA 1BJ1J 1MHPL 4NHCH 3OZ9H 3MRPA 3P77B 4NWUH 2UYLB 4OI7A 4PG2C 1OCWH 1K4DB 4PJ8B 4Z7QE 4MJID 3RRQA 2Z0BA 2GJ6D 1JPGA 5A2FA 5I2IB 2EC9T 3FT3A 3BOVA 3HZYA 4LKCB 5HGAA 1S9VA 3NGBB 3QWRD 4L3ED 1P84K 5GPRA 1YYLL 4PRNA 2GT9B 3FQXB 2HP4A 4G6FB 3V8CA 3WE6B 2IALB 5D4QA 1X3DA 1LP9E 5FEBA 1GGIH 1GGBH 5KOMC 4HH9A 4LHUD 1VHPA 1WAAA 1T0MB 3FQTA 1KT2A 3X13B 5IEHA 2NLJB 3GI8L 3OV6A 2CK0L 3U7WH 2I07B 3BP5B 4WJ5A 4JN2B 4Y88A 1MH5B 1FFPA 3GMLB 1NC2A 2A1WH 1DDHB 4APQC 1LEIA 5ETUB 3SDCC 1F3JA 2NZ9D 3CPLB 1S5IL 5CIPA 4Q9RH 1YUHA 4LBEB 2Q76A 3FFDA 1X5JA 4XAKE 1PQZB 1KCRL 3GFUA 4JY4B 3DROA 1MFBH 4OKVA 4LHUG 4OT1L 1IGFL 5HDOA 4LLYA 5DD1H 3CK0L 4NPYB 4G9FD 1JV5A 5INCA 2VL5B 3RA7L 3QJFB 1P4LB 3MGAA 3C5JA 4Z7WE 3PP4H 1K2DB 4XP1L 2KBGA 1KXQE 4LLWB 5DEFB 3RNQB 2AJUL 3OKMA 3MRRA 4KK9D 5KZCD 2XKSA 1F4XH 2ZJSL 3WS3A 3RWFA 2VAAB 5GS2H 5D7IE 5DLML 3PGCA 4P2RE 3T4AB 3P73B 4MQXC 1T7VA 3MLTB 5DGQA 1UCTA 1HH6A 4JDZA 3BSZH 4G8FB 1FNGB 1HSAB 3GSOB 3I75B 4NN6B 3S6CA 4L1DA 3MV7B 3HMXH 3QI9D 2BRRH 4ODTL 4F15B 1H3VA 2E8ZA 5CZVH 1AR1C 3HE6C 1INEH 4FQCL 5DJZA 1NFKA 2WBJD 4X6DB 4Z7VF 1PG7W 5TDOA 1S9YA 4LCWA 2DICA 4X5LA 5DT1H 2F5AL 1G6RA 1AHWB 3CAFA 4M1CC 1T66D 1OAZL 1CDBA 2CMRH 4GMTL 5KSBF 2HVKA 1T21B 1A3LL 25C8H 3CXHK 5E94A 5IVXE 4M7LH 1A7PL 5CWSA 5I1GH 5GHWH 3FO0L 2H1PL 1J88A 3N1GC 4L8SB 1S78C 3LH2H 1N4XH 1U3YA 3MBEA 1PYWA 1YZZA 2HKFH 1MCWM 1D6VH 1NLBL 2QEJA 3GUTB 1I7ZA 4PJIF 3WUWA 2EYSA 1ZGLM 3RI5F 4YC2C 1XR8B 4PLOB 3V5HA 4Y4FA 1FBIL 1QRNB 3V4PL 2JTDA 1HHIB 3NIDE 2QKIA 3U0WH 5CILL 3PWNA 1ZTXH 4HWEH 1YEGL 1DBJH 2L7JA 5J06A 3D0LB 1R0AL 4U05A 1YEIH 1I7UB 1HK6A 4N0FA 4LF3B 32C2A 3L7EB 4JZOA 4OQ1A 2G75B 2PYEB 5DD6B 4ZAKD 4K23L 3CXDL 1Z9MA 3MROA 3KWWA 3FQRB 4L1HA 4YXHL 1RIVL 2ORBH 4WUUD 2ESVE 2ZUTA 2VLKA 4PGBB 3SEPA 2R8SL 4P9ML 1AKJD 3EFDH 5BQ7A 3TIDA 2O5YH 3D39B 2BDNH 3VFSA 3V0WL 1G84A 4Y16C 5D93C 4L4TE 2ADGB 4KZEL 2NXYC 5C0BD 4DK6A 4CVUA 4XWGL 2CUHA 1PLGH 4FQXB 3QDAA 5LQBH 1NCBH 5JHDD 3WL9A 4XP6H 5DEZA 1A7RL 4OF8A 3QUYA 4ODHL 1VACA 2ZKHH 3WJLC 1DVFA 1S9KC 4NQXA 1LHZA 1HN1A 4OZIB 3QSKB 4O2EB 4Q0XL 4M62L 2DQEL 4KRPB 4QRQA 5E8NA 4ODBD 4JHWL 1FVEB 1NGYA 3GIVA 4Y2DA 4G9DB 2EZ0C 1NAMA 2Y4SA 3PV6A 2DDQH 3C5ZB 2F5BL 5IV2B 4H88H 4MNGA 4R0LC 4DZ8B 4HK0A 1UZ8A 5EU4A 5CD3B 1LD9B 4RX4D 5H37H 1AXTH 1CF8L 1QSED 5IWLA 3MLWL 4FTVE 4IMKC 5D1QD 5FM5O 4JN1H 1KTDB 4X6DF 4PGDB 2BSED 5EIVA 1DBBL 1FV1A 3ILPB 2HJLB 4JY6A 1IL1B 5IBLC 3GI9L 1D5MB 2HKHH 5FGSA 5C08A 2VXSH 1MIML 5EUOB 3LQAC 1I3VA 1V5JA 3S5LG 1DQDL 1KULA 4V2BA 2HH0L 3LEYH 2GIYA 4NUJA 1GAFL 1XGRB 4O5LL 4JPWL 4U1LB 5HGGS 5F7HA 4FQLH 4HPOL 4OFDA 5ICZA 3MQIA 3LPGA 1IQDA 3TVMB 2HRPH 1S7SA 2GTWA 4Q9CA 4LLQA 3P30H 3VWJA 1EGJL 3SPVA 4QRPB 3BFOA 4HJGB 5CUSL 1HHHA 5FYLH 2AGJH 1FN4B 4AMKL 2DWEB 3NCYP 4GG6E 5JPMB 2YD2A 4HD9A 5E56A 5C0EA 3FT2A 4J3VA 5IBUB 4Q9QH 3MJGX 2LU4A 3CUPA 3MRPB 2C3GA 3MJ9A 3MZTA 4NO2A 3VFUA 4TSCL 3ARDC 4OB5L 4M93C 5DQDH 5AEAA 1CXKA 5TPWH 1JPGB 3JV5A 4E42A 4LGSB 3FT3B 3HZYB 5HGAB 1NANI 1S9VB 4XCEA 3ZKMC 4XNUH 2GFBA 2EDFA 2AJXL 3V52H 3GBMH 2EDBA 3WIHA 4HH9B 1WGOA 4HXBH 1JHLL 4X6CE 1XH3A 3SO3B 3BPOB 3FQTB 1KT2B 5IEHB 4XC3H 2CQVA 3HI1A 4WJ5B 1MFDH 1YEEL 3K4AA 5MP6H 4F9PA 1FFPB 1XF3A 3QIUC 2V2TA 2R0WL 4ELMF 4OZFA 3OAUH 1HINL 1YDPA 3U83A 1F3JB 3GM8A 3KLHC 5CIPB 1YUHB 4YBQD 2Q76B 1T89C 4Q97A 3DROB 3MV8D 4OKVB 4PJGE 4EUPG 1R3JA 2Q87A 2AJSH 1MRFH 4LLYB 1VA9A 1CR9H 1HCFX 3BUYA 1JV5B 3OL2A 5INCB 3K4DA 2AXJA 3KPMB 3BDYH 1C5DA 1I9IH 1FGNH 3C5JB 1NGXA 3T2OA 4ZUWA 5TGBA 4EBQH 3LS5L 3MRRB 3OKMB 4LEXL 4UBDD 2A77H 3WS3B 3RWFB 4LVHB 1INDH 3O6KL 5IR1A 2BY0A 3PGCB 1H3WM 3QDGD 2BVPA 4Y1AD 1HH6B 4JDZB 2FR4A 2A0LD 2LV4A 3OF6D 5D1XA 4LDEB 3UJJH 1RZKH 2YXFA 5KJRH 1JZ6A 5FXCH 1BOYA 3SKNA 3H9SD 1TVHA 1C12A 2EDKA 2FECL 4Y0GA 5DJZB 5KVGL 4BFIA 1FVDA 3C60A 2YPLA 5TDOB 4LCWB 4KXZI 4OIIH 3BGAA 4JCMA 3BIBX 4HJJH 4EVNA 4Z0BH 3ZTNL 1L0QA 4X7DC 2W9DL 3GIZL 1IC5L 1GOFA 2QSCH 4KROB 5JORA 2B1AH 1MLCA 3TH4T 2HVKB 1S7WA 4UINH 3TA3D 5E94B 4JREC 5CWSB 4LLVA 3THMH 2VDKL 3HG1A 4M02A 5ANME 2B5IC 3MBEB 3L5WA 1KPUA 2D0GA 2YKLH 1PYWB 3L3KB 1WC7A 4ERSL 4DTGL 1I7ZB 5IOPA 1E4KA 2YN5A 3WUWB 2EYSB 4BUGA 4QHLA 1IRAY 1R5IB 5DRNA 3D3VE 3V5HB 4Y4FB 2FX7H 2QKIB 4YHZL 3PWNB 2VDQH 2QQNH 3P9WB 1A7NH 1ZA6A 4U6VL 4N0FB 4Z18A 4JKMA 3AMKA 4NQDA 4NT6A 1AJ7H 4JZOB 4R2GB 2P5WE 3TFKD 1HEZA 5ADPH 3MROB 1L7TL 2A9MH 3KWWB 2LQRA 2YD8A 1S7UA 5HY9A 3MRHA 2VLKB 5EWIH 4K71B 1EHXA 1WCBA 3QZWB 3OHXA 1NJ9A 2RQ8A 3EYQD 5BQ7B 1S5HA 5DWUL 1NSNL 3TIDB 4YH6A 3ARBA 4HBCL 1HZHL 3VFSB 3TT1H 1RSFA 2EDWA 4NRXA 4YHKH 3NN8A 3I9GL 1Z0NA 1EFXD 1A6AA 3GMNB 3MRLA 1T1ZA 4HSQA 5TE7L 1C5BH 4HCRA 4KUZH 1XCQA 2DTSA 4NOBA 3ARQA 3WL9B 5C6TL 4ZO9A 3QUYB 2P5EE 4QCIB 3MV9A 1VACB 3MBXH 2WP3O 3JV6A 1DVFB 2Y9RT 1U9KA 4UNVA 4W70A 3T0EE 4NQXB 3DTXA 1LDSA 4RGOH 4JFDB 4QRQB 5E8NB 2V2WA 3TBTA 5JIKA 3FKUS 2I5YH 2XTJB 4DGIH 4MVBD 1NGYB 1MLBA 3GIVB 1QA9A 4Y2DB 2VXTL 3WFDL 3Q6GH 1H3TA 3PV6B 3ISWA 4YNYB 2P48B 5FUOH 3BKML 4LAQH 5D1ZD 1IGJA 1PGRB 4MNGB 3HB3C 3V4UH 4HK0B 3L1OL 2ZPKH 5CGMA 1UZ8B 4EN3D 3GMPA 3SGKC 5GS1A 1JI1A 1A14L 2HWZH 5CJBA 1VCAA 3FRPA 4YIQA 1CU4L 4H8WL 1FNSH 2FD6H 1FV1B 4JY6B 2LAGB 5C08B 1UACH 1FC1A 2WAHA 1YJDH 2IH1A 1DEEA 5FK9B 1X5AA 4NUJB 1SBSH 4GBXC 2CLZA 2ICES 5ICZB 3VI4E 7CGTA 1FORH 1IQDB 2GTWB 4LLQB 2BVOA 3VWJB 1J5OH 1TETH 3MOAH 3SPVB 3D9AL 5ELIA 3DX9A 2OP4H 4L8DA 5E2UL 1KCLA 1MQKL 3TT3L 1RD6A 3MLVL 5C0EB 5BXFA 3FT2B 1GCFA 2E9BA 3U4BH 3CH1A 5DVNA 4WW2A 1CDJA 3FMGL 3OJVC 4NO2B 3VFUB 3PNWA 3LEVL 4M8QB 5MEOA 3RPKA 3JVGC 4E42B 1SBBA 5HYFA 4DGVL 3UROR 4XCEB 3A6CH 5IW1A 2GFBB 3OKDA 1N0LA 5F7KC 2DI7A 1NANH 3E8UL 2F53A 5HD8C 2D7TH 1NAKH 3GJFB 4M7ZC 5T1KD 4JANA 4UILL 1XH3B 2X4NA 4ZODA 3IB4A 2L7UA 5F1SA 3VW3H 4I0PA 3HI1B 4X0KA 2NXZD 2WK2A 1FCGA 2BSTA 3BQUA 1XF3B 2DQCL 4OZFB 3QDME 1YDPB 3MGOA 4K3DH 4NN7B 3ESUF 3H3PL 4MJ2A 2Q7YA 1PSKH 1R3JB 5C09A 1X5LA 2AXHA 1J05A 1QP1A 3NAAL 5EU6D 4E5XA 3BUYB 3QCVH 3SE8L 4PG2A 1QSFA 1C5DB 2A6KA 5D6CA 1NGXB 5MI0B 1W8OA 3IFNL 4ZUWB 4HC1H 4KI5C 4HIIB 3LD8C 1NMCC 5TGBB 3T0EC 2YD9A 1KTKE 4G6AD 1JN6A 4KJQC 4OCSL 5DFVD 1TLKA 4J3UA 5SWSD 4TPRH 1G9NL 5BMFL 5IR1B 2XIDA 4KKNA 4WU7A 1QD0A 5FHAL 3VFVA 5J6HA 4X5XA 3QXWA 2BVPB 3RWIA 1D5IH 5GRVL 2CIKA 3QPXH 2B2XH 2FR4B 1VENA 5D1XB 3AU1A 1DZBA 3LRGA 1CK0H 1RZ8A 3QWOA 5C2BL 1OTUD 4F57L 2FL5A 1RU9L 1TVHB 1C12B 3SKNB 4AG4L 2P42B 1YQ2A 4CN1A 2CO7B 4PLJC 4APQA 3SDCA 1FVDB 3C60B 2YPLB 4B7LA 4C58B 1BLNA 3VGDA 4UTAL 3RY6C 4J1UA 1KJ2L 1MCSA 3HC3H 2IQ9L 3QDJD 4EVNB 2RIKA 3NACL 5ALBL 1PBYA 5A3IC 4JM2C 4PLKC 1Q72L 5FCSH 4GW5A 5JORB 1MLCB 1DQLL 1BFSA 1S7WB 1QYGL 3E6HB 4LLVB 4KK8D 4PRPD 2COQA 3BN9C 3HG1B 3VXSE 2ENYA 4D0DA 2NY5H 12E8H 3L5WB 1KPUB 5E2VH 4LVOB 1WC7B 5DZLA 1J1OH 3KGRA 4TNVF 1A4JA 5IOPB 3FL7A 3BPNC 1U42A 4XP4H 3B2VH 4IBLT 4QHLB 1JTOA 4XVTL 3L3HA 2X1XR 4XC1L 5T3XH 3OTTA 4GO6B 5GSRA 1ZA6B 4GRWB 4LL9A 4M5YH 2FO1A 1F6FB 4NQDB 4NT6B 2EYTA 3HE6A 4Y4HD 3B2UD 5BOPA 3ZT6A 4TQEH 3GMOA 1I9EA 4JFZL 4N0CC 1RFDH 2VNCA 5FYJU 3TEUA 4BZ1H 5SWZD 4JRYD 1S7UB 2W0PA 4LMQE 5F7FA 5HY9B 4F8QA 3PJSA 3UTTA 1WCBB 3ULVH 1AY1H 3I2CH 1OL0A 3OHXB 1NJ9B 1JF1A 1A5FH 2IAMC 1S5HB 1ZANL 3ARBB 3WXWH 5I75B 3RZCC 1R3IH 4OCXL 2JF1A 5I1JH 4GW1B 1A6AB 4P3CL 3MRLB 1T1ZB 1U3HC 5D2NE 3FN3A 1BQLL 1EEQA 1XCQB 3T4YA 5CS7A 4QLRA 1UQSA 1SY6L 3PHQA 3CX5J 2GW5A 5BZWA 3B43A 1I1RA 3MV9B 1FRGL 3R8BB 1UWEH 3SE9L 3JV6B 2YD1A 3CD4A 3VWKA 1JVKA 3EJJX 3DTXB 4NWUL 3ZE0F 4H5SB 3RWEA 1OCWL 4NZRH 3VXUA 2V2WB 5MEPB 3TBTB 5L2KA 3AREB 5DJDA 5IFHH 1MLBB 4DGYL 1QA9B 1UM5H 4OGAD 5DGRA 5JW4R 2OS7A 3BZFA 5D71H 4YHLL 1IGJB 4GMSH 4OF5A 3U9PH 4ODVH 3VH8G 3UTQA 1GGIL 1GGBL 2XA3A 5TFSH 3DRTA 3GMPB 4NIKB 5GS1B 4RMRA 1KTLA 4EI6A 1OP3K 2GCYA 4YIQB 1LEKA 4Y16A 5KTEH 4PBVC 1H0DA 4K3GA 1IKNC 5T5NG 5EN2A 2XN9E 4OKDA 2A1WL 3SCMB 3KPSE 2VRAA 1YEHH 4OZGB 2IH1B 4IOFC 3CLFH 1BWMA 1DEEB 2RR3A 2EEDA 4I0KA 2BXZA 5CHNA 1MFBL 1RK1A 1S7XB 2CLZB 3WJLA 2P7TA 5J57B 2C3WA 5F7NC 5DD1L 1YNLH 2Z4QA 2BVOB 4DAGL 5DVKA 1HHGA 3U36A 1NUDA 2AK4E 3DX9B 4NSKA 1A6PA 4Z7WA 3PP4L 1QQDB 5B38A 3GKWH 3TYFB 2B7DT 4FQIL 4QRRD 1OGAB 4L8CA 5BXFB 3D48R 5D7IA 3WXVH 5CZXD 3CH1B 1A47A 3SOBH 4R0LA 4WW2B 1MEXH 3PNWB 4LPXA 1XF4A 4EDXA 2OZ4H 2EE2A 2VLJA 3BSZL 4GRWF 3FOLA 5MEOB 4IMKA 2QV2A 4PPTA 4F7EA 4GXVL 3HMXL 1LGVA 5IW1B 5I6XC 3HR6A 3UX9B 3OKDB 2YHGA 5CZVL 4I8DA 1INEL 3PHOB 2WBKA 2F53B 4P2OD 3MLYH 3GK8H 4JANB 1JYVA 2AP2A 2X4NB 3D2UA 2VXQL 4KRLB 3T77A 1OWWA 5DT1L 1BAFH 1WV7T 4I0PB 4X0KB 2Z91A 3CLEH 3BQUB 2BSTB 5T33L 2QQKH 1VESA 1OAUL 2CMRL 1G6RL 3G5VA 1JRHL 1PEZA 25C8L 4NC1E 1BZQK 4M7LL 5CMAB 3UP1A 5C0CD 3RHWK 4FXGA 3LH2L 3WHE1 1N4XL 1R3KA 3HZKA 5D2NC 5ITBH 4XCFH 1RJCA 2HKFL 4R6UA 1D6VL 5C09B 1T3FA 3NIFF 1ZT4A 1J05B 4E5XB 3S98A 1QSFB 3ARDA 2A6KB 5D6CB 2CDGA 2NX5E 2HT4D 1UC6A 3HAEA 3U0WL 5JQ6L 4HWEL 1ZTXL 1P7QB 1DBJL 3EDEA 4MHHG 1YEKH 1JN6B 3QPQC 5GIRA 2Y06H 1YEIL 3K8KA 1U3JA 6FABL 5EO0A 1SMAA 2AJZA 3HE7D 4OD3H 5TF1L 2ADJA 3QJHA 4WU7B 4JGMA 2GJJA 5E5MA 1B0GA 3VFVB 5J6HB 4X5XB 2VSDA 3RWIB 4RGNE 2DI8A 4AH2A 1DQMH 3SKMA 1R5WA 3AU1B 3QWOB 1RZ8B 2ORBL 2FL5B 1AQDA 1GC1C 3LQMA 1GIGH 2V5TA 1IQWL 4LP4A 3EFDL 3QIUA 1UKTA 4APQB 2O5YL 2BDNL 2D9QB 3I6GA 2NY4C 1OTSD 4BK4A 3DECA 5J1TC 1BLNB 4OZGF 5B21A 1T89A 3BYYA 3MJ7A 1A1MA 4J1UB 4X4YA 5ISZE 3KPQA 5CFHA 5L2JA 1PLGL 4ZYKA 4OFVA 2IG2L 1H3XA 3TV3L 4EI5C 1ZVHA 2NY6C 2YEZA 5C07D 5I19H 2ZKHL 1F4YH 3CCHA 4JDVA 5FGCE 1CVRA 4JFFE 3QAZC 4D0DB 3DSFH 1DSFH 5IHLB 2XACC 2IFGA 1MIEH 4MCZA 2AEPH 1PKQA 3VRLE 3S3PA 2P24A 3SKOA 1A4JB 3CVHH 3Q5OA 3RX5A 1H8SA 3L3HB 2DDQL 1Y6KR 3PGFH 4O02H 1VKXA 4H88L 1NAML 2ZCHH 4O51A 5GSRB 1EZVX 3WIFA 4MAYC 5C0JA 5AWNL 3QO1A 5IMKA 2EYTB 3BEVA 1AXTL 3HE6B 3QIWC 4NNPH 2RCSH 5LVEA 3L6FA 3GMOB 4FTVA 4XMLH 4YEFA 5T3XE 2ICCA 4WO4C 5TJWK 2HKHL 4IRZL 3PJSB 1MFEH 5DUBB 1UVQB 5DVLA 1JF1B 3ECBA 4QXTA 3MNWA 3KPRE 4ZUVA 3ZDZF 3DVIA 1AGCA 4Y8AA 3DVFA 4KDTC 3X3FH 4FQLL 3N06B 2CK2A 1A7OL 4N9OB 2VN4A 2HRPL 3T4YB 3WBDA 1A9EA 3P30L 1UQSB 4BQ9A 2CIIA 3PHQB 5DRZA 4NQSA 3VGFA 1NDMA 4HWBA 5FYLL 3IDMA 4YC2B 3WSQH 5HYJD 4P46D 4GG6A 3QCUH 4G43A 1QBLL 4POYA 4Q9QL 2IC2A 4JFEE 2EH7H 3VWKB 1HIMH 2LU3A 2XTLA 4WWKD 1IM3A 1OAXH 1P1ZA 3RWEB 3VXUB 3RWGA 3RY5A 5L2KB 3MJ9L 5DJDB 5EA0H 5TPWL 3M8OH 3BZFB 4XNUL 1MCDA 4KKCD 4ZFZA 1EDQA 5KSAD 4OGYH 3HC0A 4JPVH 3V52L 3GBML 3UTQB 3W9DA 4EIZC 3DRTB 3M1BA 1KTLB 1YEJH 2GCYB 3BJLA 4XC3L 4L5FH 3PWPE 5I1EH 2BVTA 4LLAA 1LEKB 4Y16B 5IQ7H 1MFDL 1FYTD 2UV3A 3CFCH 5D93B 1H0DB 5MP6L 4F3FA 4GAGH 3W0WE 2NXYB 3NPSC 5EN2B 4N0YH 3OAUL 4RAUA 4XBGA 1ACYH 1FDLH 1I75A 3TZVD 1QG3A 3OR6A 3SGDI 2VE6A 3ZSSA 2D03H 2FBOJ 2ADIA 4DKFH 1J0IA 4KJWD 4QF1A 2Y6SC 4PJXF 5CHNB 1RK1B 1VFMA 1YN6A 2P7TB 2ILLA 2AJSL 1MRFL 1FNFA 5LBSL 4HIHA 1S9XA 1XGTA 2Z4QB 4J3TA 3BDYL 1I9IL 1FGNL 1HHGB 3U36B 1KCVL 3VA2C 4Z7WB 3OQ3B 4NSKB 2EYRA 5B38B 5KS9E 3MUGA 3UAJC 3OJDA 2Y1VA 5TH2A 3PL6C 3CMGA 1D5BA 2A77L 4L8CB 4LSRH 5D7IB 1FIGL 1INDL 5DJ2A 1K85A 3TM6A 4R0LB 2R0KH 1XF4B 4XHJC 4PIRF 2VLJB 5D7LD 3K2UH 3FOLB 4OQTA 5HHOA 3MNVA 3V6FA 3BW9A 1WJ3A 1RZKL 1J0ZA 3DMMC 1T0PB 4F7EB 5IVZA 4P59L 3N85H 4PJ8D 1BP3B 3IKKA 5I1KH 2Z8VC 3EYFA 1IEHA 3GO1H 3HLAA 1A64A 3D2UB 4MJ6A 4OIIL 3T77B 4M6MH 4L4VA 4HJJL 4G6FD 2J3SA 4Z0BL 4GBXA 2VDRH 2WMPA 1HNGA 3DYOA 2Z91B 4JE4B 3RIFK 1CL7I 2QSCL 3PGDA 4LSUH 4RA0C 2B1AL 1CGYA 4K9EC 3G5VB 4XPAH 3THML 4FXGB 3IF1A 1CD8A 5ANMA 2V5MA 4XNZC 1AQKL 1R3KB 4MSWA 2YKLL 2ZNWA 2IBBA 1C5CH 1MVFA 5IFAH 3C6SA 5A1AA 1T3FB 5JLZA 1ZT4B 4YFLF 2FX9H 2GAZA 3D3VA 3ARRA 4M93B 1UYWH 2FX7L 1RY7B 2CDGB 4KFZC 3O2VH 1EXUA 3O3BA 5C71A 4O9HH 3HAEB 3JVGA 4Z7QF 2CO6B 3F7YA 2QQNL 1BFOA 1A7NL 4PRHD 5GIRB 4JEGB 2QJDA 2X4PA 5EO0B 2PW1A 1IAKA 3BZEA 2AJZB 1BREA 4LRNH 1AJ7L 2YUVA 2ADJB 3QJHB 3MRKA 5E5MB 4HMEA 4D9LH 2P5WA 1B0GB 4OIAA 1LP9F 4PRBA 3RVVC 2DL9A 2A9ML 4AH2B 5HPOA 3SKMB 2YWYA 5MHSE 2ESVB 1FNHA 5EWIL 1AQDB 5I8CA 2D3VA 1F4WH 3VA6A 5DEGA 5J11C 3QIUB 4QWWC 2R2CA 3TT1L 3I6GB 3MGTA 3MV7D 4OLYH 1NDGA 4ORGA 3S35X 1A1MB 1KACB 4UAOC 4KUZL 3Q1SH 5L2JB 3LOWA 5F6IC 5DMYA 4ZYKB 4HCRL 1R3LA 3T0AA 2YEZB 1NCTA 4PJ7E 4WI4A 2H2SD 3BUTA 4PJDF 2CKBH 4OCYH 3NFNB 3MBXL 2XXCB 3CCHB 4JDVB 4LLDB 4NKOB 5E08H 1MY5A 3T0EA 3ZSTA 4Z7WF 4MCZB 5IW3A 1PKQB 4RGOL 3MC0A 3VGBA 3D87B 4K8RH 4IDJH 2P24B 3SKOB 4NCDA 1T03H 2I5YL 5D7IF 4DGIL 1KB5H 1RQ5A 3LAFA 1XMWA 4LKXA 2WWKO 3Q6GL 1W8NA 1QKZL 1VKXB 2MJWA 3L3IA 2BNRE 1LO3H 4O51B 3V4UL 3WIFB 3PP3K 3OGCA 4KU1A 5DA0B 5C0JB 3QRGH 3R1GH 3QO1B 1CFNA 5IMKB 1BX2A 1QRND 3BEVB 3L6FB 1UWGL 2HWZL 4FTVB 3C2AH 4JKKA 4CVWA 1FVCA 3PG2A 5B39A 1FLRH 3FRUA 3QUMH 5BVPH 1FNSL 2FD6L 4G6KH 4QRUA 3RY6A 2K7QA 4XRCA 4JM2A 3VE0A 1UACL 2PYED 3V6ZB 4NC2B 4QXTB 1YJDL 3MNWB 4RMTA 4CVXA 2CPCA 4ZUVB 3QXUA 4JREB 3K74B 1AGCB 5IVXF 1JL8A 4CJ0A 2B5IB 1TMCB 1MCNA 1QRKA 3Q5TA 1NBYA 5EBMA 1A9EB 3MUJA 1A9BA 1J5OL 1TETL 2CIIB 3MOAL 4POUB 5DRZB 1GOGA 5BZDB 1NDMB 1AGDA 3IDMB 5FGRA 3S8WA 3V7MA 4GG6B 2N4IA 1J1PH 4G43B 5BV7C 4X4ME 5J8OA 4P2YA 3U4BL 3NIDF 2HG5A 4LAJH 2VLRE 1P1ZB 2ZUQB 2YPVH 3W82A 1ZT7A 3RWGB 2Y07H 1KFAL 3JWOH 5EU3B 4X6BA 3F7RA 4WENB 1SVCP 3MV01 4YGAB 4YBLC 4Q9BA 4KRPD 4ZFZB 3SDDD 1BPVA 5IM7A 3WEXA 3HC0B 1JF6A 3QXVA 4NP4H 1ZT1A 3W9DB 2EO1A 1NFDA 2D7TL 1NAKL 4X6CB 4Z78A 1J87A 2IAMA 1IM9D 1VADA 3M1BB 4WTZA 4NFDA 1ONQA 3RZCA 5HGDA 3W11D 3O4OC 4LVEA 3VW3L 1SVZA 2OXGA 3REVA 4F3FB 3PV7A 2V2XA 4J6RH 3V0VA 4RAUB 4XBGB 5E4EC 2X9XA 2V9TA 3WHE0 2YS4A 1I9RH 4K3DL 3OR6B 4Q6YA 2VE6B 4U1IA 4UDTB 1HI6A 4TOYH 3IAGC 2ADIB 5E8EA 2C1OA 4D9QE 4WI6A 3QG7L 4QF1B 4HK3N 4PG9A 1YN6B 3RVTD 1FAKT 4FNLH 4HIHB 1XGTB 4LGRB 4XPHH 5C70A 1RJYA 2EYRB 3WKNA 3F65A 3MUGB 3TJHD 3OJDB 1AGFA 5TH2B 1I1AC 2OTWB 1D5BB 3TVMD 3L5XH 4HX1A 5KOVC 4TPRL 1Z3GL 4U7KA 1UJ3C 5DJ2B 3I6LD 5JPNA 4QRPD 4J3WA 1T5XA 1I7TA 2J7LA 1MCBA 3K8MA 4KJYA 2B2XL 1NFIA 5HHOB 3MNVB 3V6FB 3HPLA 1MRCH 3BW9B 4UU9A 4I0CC 4W68A 5E7FA 1T22A 5IVZB 1GYAA 3MLSH 3ULUC 2G2RA 3FQNA 1RZGA 3EYFB 2I27N 4BELD 4XBEH 3HLAB 5F1NA 4XVUC 1PEWA 4MJ6B 4YDVA 1T4KA 3HC3L 5KW9H 4GBXB 4WFGE 5GS0C 2CLVA 1AC6A 3PGDB 5C0RH 3B5HA 1CL7H 1YEFL 1UA6L 3O6MH 3IF1B 1GVIA 3FQUA 4U7SA 1QVOA 1PY9A 3I85A 5ANMB 2NY5L 12E8L 1J10A 4MSWB 3MUHL 2GY5A 3IU3A 4MZ3A 4X7SL 5E2VL 1NC2D 4HGKC 1RV6X 3C6SB 4GG6F 4LLMA 5JLZB 3KJ6H 1DCLA 4G42A 1JZ3A 2VABA 3B2VL 3QQ3A 5BOZG 2GAZB 3JTTA 4JQXC 3D3VB 4OGXL 3X12A 4D0CA 5KVEH 2FSEA 1EXUB 2MTPA 3O3BB 4QNPE 5EZLB 5T3XL 1IVLA 3ZKQD 3OAYK 3F7YB 1BFOB 5DJ8A 3MA9H 5IJKC 1U8IA 4TNWK 2AJ3A 4M5YL 2X4PB 3RL2A 2PW1B 1IAKB 3CFBA 3MRKB 2BVEA 2P5WB 3FOMA 2DOCA 3V5DA 4M7ZB 5JOEA 3O2WL 4HULB 4X6CF 1RK0A 4PJEF 5F7EH 4TRPH 4JRXA 1J9CT 5I8CB 4BFBD 3ULVL 1AY1L 3G04A 3SBWC 5DEGB 2OXHA 4Q58C 1A5FL 3MO1A 3KVQA 1U2CA 4KDWA 1R3IL 5BO1L 4ODWA 2EIEA 1NDGB 1NUNB 4ORGB 4C55A 5D2NA 2VXVH 3INUH 4KK5D 4U3HA 3MOBH 4U2YA 5FUCC 3LDBC 4U1HA 1R3LB 3GMQA 2SEBA 4PJGF 2GJZA 4Q6IC 1RURH 4LCWD 4R8WH 2HRLA 3C08H 3L5JA 3ZMRA 4OLVH 2DS4A 2I26N 3RDTB 3BX7C 3SHSA 1ZGLA 2BCKA 1T04B 1UM6H 4HS6A 1TCRA 3T0EB 3VFMA 3LD8B 1NMCB 4DN4H 4KROD 2I60H 4NM4H 4NZRL 1P9MC 1E4WH 4QHMA 2D2OA 4NBXB 1KJ3H 4M9PA 4OAWA 5DYOA 5IFHL 5I0DA 1VEPA 3MBED 4LKXB 1UM5L 4K94H 3S36X 5JXEC 1IAIM 5D71L 4I18C 4MQSB 3L3IB 3DBXA 2FIRT 4ODVL 2XZCH 5TFSL 3BGFC 3OGCB 2IJ0C 5DO2C 3G6JE 2DQUH 1CFNB 1KEGH 1BX2B 4Y4FD 1J8HE 4Y4KD 1ZSDA 1WQVT 4N0UA 4EQ3A 5B39B 3FRUB 5ESQA 5KTEL 4G8GE 4P5TB 4G6JH 4QRUB 2N7BA 4OZHA 4DW2H 5LGKA 4P49A 5HDLA 1W72A 3KPSA 4XRCB 4HBQA 4LK4A 1KLGA 1YEHL 4JM2B 3RX7A 1SJVA 4R2GD 2E27H 2XZAH 4EI5A 2H3NA 2X4QA 4L9LB 4CVXB 3CLFL 3D0VA 4RGMC 3WUWG 3EJYD 2JIXA 2VLKD 1N64H 1JPST 4FZ8H 3M07A 5C1MB 4ZS6D 3U9UA 1YNLL 1NBYB 5EBMB 1A9BB 1BVKB 5JDSA 2AK4A 2VXUH 4M4RA 3BPNB 5I0ZA 2W65A 3GKWL 2GEEA 4EUPA 3QRFM 4PJHE 2Q8BH 3IDXH 3RWDA 3WNPA 1B4JH 3BD4A 4MJIE 3WXVL 5JW4Q 2GJ6E 1P6AB 1XF1A 4LU5H 3SOBL 2HG5B 3OPZL 1MEXL 4L3EE 3QUYD 4MAYA 1ZT7B 1GGCH 1CLZH 2UVFA 2OZ4L 5GZOC 3QZWG 3QIWA 4X6BB 4XNQA 1DVFD 1G9MC 1JTTA 5A2KH 5JW5A 1KB9K 4XVJH 1MJUL 5IM7B 3WEXB 3DGGA 4WO4A 2A9NL 1ZT1B 2XTJD 4HUWA 5IB2A 1NFDB 3MLYL 3AM8C 3GK8L 4Y2DD 4Z78B 4B50A 2IAMB 1VADB 5AZ2H 5IB5A 1ONQB 4JVWA 3RZCB 3UTPD 5HGDB 1BAFL 3VXOA 3IT8D 4KDTA 3REVB 3CLEL 2IPUG 2V2XB 5HJ3B 2QQKL 5J3HC 4GH7B 3V0VB 1K3IA 4MXWH 4ZOAA 3ZYZA 2HN7A 4U1IB 3MODH 1HI6B 4X6FA 4G9FE 5E8EB 3UPAA 1KBGH 2A2QT 4PG9B 4XCFL 1F6AA 3R06A 2CH8A 4RCAA 5C08D 4MX7A 3JUZA 4CVZA 5FYKU 4HMCA 3P4LA 4XZUA 2IBZY 5E2TH 1L9MA 4F7CA 1JJUA 4CJ1A 2J1KA 4G7VH 4PJ9C 5GISH 1RJYB 1UH3A 2XRAH 3IFLL 1AGFB 2EXWD 4XP9L 1YEKL 5EOQH 2Y06L 4HX1B 3VWJD 3H9HA 5JPNB 1RUKL 4OD3L 1T5XB 1I7TB 3QUXC 2D7MA 4JO2L 4BZYA 3LIZH 3H7BB 1UXWB 4KJYB 1N7MH 3V95A 4PRAA 1DQML 1JF5A 1HWHB 1NFIB 4U3XA 4UU9B 1CDGA 2JCCE 3EYSH 1G7MA 4U1KA 1T22B 1GIGL 4JG0H 1A6TA 1Z2KA 4YHNA 2G2RB 4BSVA 3FQNB 1RZGB 3NZ8A 5HI5C 4LHQB 5ESVA 4OCWL 2FBJH 1CYGA 3O45A 5F1NB 2A83A 2LVCA 5JTWA 3H42H 5ISZA 1T4KB 3LN5B 1S7TA 4UT6H 2CLVB 5IIEA 3UC0H 3KR3L 4XAWL 5JMRA 1M05A 2DLTA 4WI8A 5C0FA 3VI4F 2VQUA 2BC4A 3WFCH 5I19L 1D5XB 1F4YL 2R9HC 3FQUB 1QVOB 3QHZH 1XR9A 5C0DA 3DSFL 4HMDA 1DSFL 4RFEA 2HTLD 4JHBA 1MIEL 2AEPL 3IU3B 1P4IH 3PL6A 5DUPL 2A73A 1J0JA 2QADC 1KSRA 2HT2D 1TJHH 4LLMB 1X5HA 3CVHL 4G42B 1JCKA 2VABB 4MB3A 3QQ3B 5BJTA 3HI6H 3JTTB 1JNJA 3MRJA 3X12B 4D0CB 3W39A 5IEKA 1QPXA 2FSEB 3VFNA 2EDHA 3PGFL 4S1QH 4O02L 4MYWB 4FQ1L 5C9JA 5AD0A 5DJ8B 2ZCHL 3DMMA 3X17A 4KKAC 1NEZA 2NY7H 1W0VB 2AJ3B 5I6XB 3P4MB 2H32H 3WLWC 3CFBB 4ZTOH 2RCSL 4OCMC 3FOMB 2BNQE 3V5DB 3I84A 4XMLL 4TVPD 1SEQL 1RK0B 2X1OA 1OF2A 4JRXB 4MA1C 2X4UA 1MFEL 3HCVA 1WISA 1KYOJ 2F8XC 3G04B 3C87A 1NL0H 3WNOA 3MO1B 1MOEA 3P11L 5B4MC 3FB7A 5I1IH 4X9FA 5D1XD 1URLA 4HG4J 5JHDE 4ODWB 2LABA 2ZOKA 5D2NB 4P9HC 3X14A 2H9GA 2DLFH 4TULH 5EOCL 3N1MC 4U1HB 4NHUB 2H8PA 3C60D 3GMQB 1M6OA 5GGTA 2GJZB 2FATH 1FFNB 1IKFL 1JHKH 3KYOA 3NCYS 4P3WA 3QCUL 1T1YA 5IMLA 3UZQA 2JK5A 4ZQKA 1ZGLB 2BCKB 2EH7L 1FH5H 1HIML 1TCRB 3ILQD 1IEAA 3NFPB 4HS6B 3UZVB 3VFMB 1BJ8A 1YNKH 2G60H 1OAXL 2C9AA 3VDCA 1QLEH 2A74B 4LEOA 5KSUA 1EK3A 3HG1D 5EA0L 4OAWB 3O8XC 5DYOB 3KLSA 3WNMA 4GSDH 4LARH 3SDYH 2ZP0T 3NGBC 2VDMH 1QSEE 4ZUSB 4PJFE 2EDTA 1GJIA 4R3SA 3HC4H 1G7JA 4R97C 4OGYL 3TJEH 4JPVL 2DQTH 3DBXB 3P0YH 2YPKA 2B0SH 3RVWD 5T1DH 1PJ9A 2DQHH 4LFHD 5K9JL 4AY0A 5LGJA 3RGVD 1NKOA 1YEJL 3RVXC 3KHQA 4UI2A 4WFFD 2NY4B 2HAZA 4L5FL 4IOIA 5I1EL 4YPGA 5IQ7L 4B5EA 1HQRA 5ESQB 1EAPA 4HIXH 2BSSA 4GAGL 4OZHB 3OKYA 2HLAA 1W72B 3KPSB 4N0YL 4ODUA 1KLGB 1ACYL 1FDLL 4OD2A 4EI5B 2X4QB 2BFVH 2OTPA 2NY6B 4JO3H 3UEZA 2D03L 4KY1H 2AQ3A 4DKFL 4NBZB 1OARH 3D0VB 4AEEA 4ENEC 4FABH 4WFHD 3QAZB 3V6BR 3U9UB 4HIJB 1L4IA 2ZNXA 3ARBD 3ZT7A 5K9OA 5JDSB 5DA4A 4CGTA 2AK4B 4K7PY 1JGUL 2W65B 5KS9A 2MPAL 2FZ3A 4EUPB 1WICA 3RWDB 5ID1A 4LSRL 1D7FA 4MQTB 4XCCH 4NQEA 5DFTA 2Q1EA 4MAYB 5DSCA 3TPUA 4CN6A 3MV9D 1RZ7H 4MHHI 3VMOA 3QIWB 4XNQB 3T04D 3B8YA 2Q6WA 4TTGA 2FHCA 3PUCA 3D5OF 3WMSA 4YFDB 5JW5B 2FCBA 4OQTL 3LEXA 4F15C 3N85L 4WO4B 1ZHKA 3SDAC 5I1KL 1ZEAH 5IB2B 3GO1L 2VUOA 1MFNA 3HUJE 5FIEA 5ICXA 4JCLA 4M6ML 5IB5B 4EQ2A 4HLZG 5DHVA 1SM3L 3KG5A 1DN2A 2VDRL 3VXOB 5KVDH 1SJEA 1NCWH 2YSSA 2JJUA 4LSUL 4XNMA 3MV11 5EO1A 1ZHNA 3MV8E 1X5YA 4XPAL 2HN7B 5JUEH 1EJOL 4XI5D 4X6FB 1K5NA 4HUMB 3U6RA 2OSLA 4LSVH 1F6AB 3R06B 5C0GA 4MX7B 4ZSOE 5IFAL 4CVZB 1QTYT 1MHPH 1A7QL 4XZUB 2ARJA 2FX9L 4F7CB 2ATPA 3VG0H 1RMFH 1UYWL 1ZHBA 4LLUA 3VI3E 5JZ7D 4O9HL 5J1SC 3IDYC 3QDGE 4Y1AE 4S0SD 1YYLH 3FRPG 5EOTA 3H9HB 3QT2A 4LRNL 1QNZH 4ZNEE 3H9SE 4D9LL 1JZ2A 4PP2A 2Y36H 1YYMH 5FYKE 4M9OA 4PRAB 3AAZA 3GI8H 4FS0A 4LHJB 1G7MB 4U1KB 1F4WL 1A6TB 3V0AC 4YHNB 1J12A 4KK6D 4MA7L 4BSVB 4GG8A 3NPSB 2Z8RA 3NZ8B 4RBPK 5ESVB 2X05A 5DD0L 3O45B 3TN0C 2C26A 3GRWA 3QHFH 5F7DA 2A83B 3Q0HA 5DFWH 2MCPH 2HYMA 5L88H 2HMID 5ISZB 2APBA 3Q1SL 1S7TB 4FQXC 1IGFH 2X7LA 5DMGD 5IIEB 3T2NH 3RP1A 2APVA 4XNXH 2P44B 4PJ7A 1M05B 2FEDD 5C6PB 3BJ91 5C0FB 4JKLA 2CKBL 2BC4B 5TE6H 5FGCB 1BF8A 1EUUA 4I0PD 1XR9B