4Z7UF

S13 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
244
structure length
244
Chain Sequence
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSTTPGTGTETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
total genus 62
structure length 244
sequence length 244
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uF01
1T4KB 3M17B 4NHUB 5D2NC 1UH3A 1ORQA 1QFWL 2X4NA 1FZKB 4OQ1A 1I85A 5ITFA 1U8KA 1G7PB 1P6AB 4HLZH 4LHUG 3MJ9L 1MOEA 3ETBF 1AO7A 4QRUA 5T3ZE 1I1RA 3LY6A 4ZAKB 2Y4SA 3U30C 4B7IA 2V2TA 4EBQH 4PY7A 4IRJB 3I6GA 1GIGH 1NAKL 4HCRH 4ZYKA 1QLEL 3I6LE 3DECA 1B88A 3O8XD 5IVXF 3VDAA 4URTB 1FH5H 2LTQC 4KHXL 4UDUB 3MV8D 4N0YH 4I48A 3AAZB 5TE7L 1G1CA 2GTWB 2RGSA 3KPSD 4JO1L 1L0XA 2RQ8A 3KXFD 3O9WB 3K2UH 1N6QH 2F5AL 5FO7A 1YNKH 4HS3A 5J6HB 1WC7A 1AD9A 3OF6A 1JVKA 2IMNA 1YY8A 2EXYC 1MPAL 2P24B 4XHJD 1RHHB 4OAWA 3ZE1E 4QOKD 3MJ7B 4G43B 1ONQB 3UBXG 1WZLA 1CI5A 3QUMA 1UG9A 4OCSH 4HIEA 2V7HB 3E0GA 4D8PB 1A4KA 2PYEE 1HH9B 3SDXF 5DDHA 2ICES 3QDGD 2EDOA 1U0QA 5E9DE 4OFDA 1WGOA 5MEOA 5DD3H 3D85D 1JPFB 3QCUL 3I84A 3HE7B 4PG2C 4DOHB 3SOBL 1T0MB 3L1OH 3FQXB 3SDXE 1DANU 4ZO7A 2DQHL 1AXSA 3HLAA 5JA8B 2VUYA 1CICB 3S9DB 5C0CD 3TT1H 4CDGC 4F7MA 4ZD3L 1I3GL 2JK5A 2PXYB 2NR6C 4EI5A 4LKCB 5FYJU 1E4WH 4HHAB 1I1AA 3CJJA 5BOZG 1CGSL 3MCG1 2FR4A 3SDDD 4M62H 4ZAKA 5IB5A 3MREA 2P5WD 3N1FC 1HHIA 3EYSH 5CKGA 3DURA 3DV4B 4HFUH 5L6YH 1YYLL 1B6UA 1J11A 2YPKB 3LRGA 3OGCB 4JHBA 2NY3D 4ZPVA 4ZFZB 1KTKE 5IM7B 4LK4A 1HOCB 3A67L 3I3DA 4ELMB 2JELL 4R2GB 4MD0A 4MXWL 1AJ7L 4F37K 5J11B 5J6HA 4FABL 4XP1H 2WMPA 2VR5A 1I7ZA 2Z8WC 5E2UH 1L7IL 4J4PC 3WIHA 1NCUA 4IM8A 4PBVC 4NO2A 2AK4D 4XI5C 4FZ8L 3L3GB 2BSTB 5MHSE 4YHNA 3V79C 2QQLH 3ARED 2X40A 3OKYA 3G6AA 2X4RB 2YPLA 5DQDH 1RURL 4KRMB 3DGGB 1ZHBA 3GUTA 3QB7C 3ZE2E 5DJ8A 5A2FA 1JGVL 5TPWH 2NTSP 3D0LA 1NGXB 5I9QB 3ZKXB 5JR1L 2NY0B 3ZDZF 2ZP0T 3S6CA 4OLXL 5EA0H 1G84A 4PGBA 3UAJD 3NIFF 2CDFA 4YXKL 2BNQB 3T8XA 4M02A 3CCHB 3OKKA 4PTTB 1KELL 1GOFA 3EO1B 4KVCH 3VXTB 1ZS8B 4N8VA 3BT2L 5EOQL 3MRRB 1U3ZA 2WM0A 1BD2E 3BPCB 2UWEE 1XF2B 2AGJL 3CX2A 2YS4A 2OL3A 1SJVA 1MCIA 2ORBL 4H88L 1U2CA 1A6AB 5MEPA 4MAYD 2VLKB 5EU7E 3QHZH 1KIQA 1WF5A 3WV0A 3IGAA 5B4MC 3NFSH 4GG6E 3VGBA 4R90L 4HC1H 2A73A 1G9EA 4HIIA 3F7PC 4JPIA 2X4TA 3BGFB 4I2XE 4NQXA 3TZVC 4FQIL 4PGZA 3TO4A 2XWBA 2H6PA 4OZFH 3DTXB 1RIUH 2ZJSL 4QT5A 5ITBL 2I25N 3VFPB 1C5DB 3V6FB 5C0DA 1X6NA 3GMLA 3UJIL 4WFEE 1E4XH 1U91B 8FABA 3IU3B 3QFJD 3NCEB 3LEVL 3Q5OA 4KAQH 4X4XB 4PRHD 3BD3A 3OSKA 2VDQL 3VMPA 4MJIB 4MNQD 1T03H 2HJLA 1MVFA 1RZKH 3B5TA 3OB0K 4PJXA 1CDBA 4HZLB 1KGCD 3TJHD 3WIFB 2X70B 3HC0B 3NCCB 3W5NA 3UZEA 5DZNA 1P7KA 3VGDA 3EDEA 4KKLC 4KKBD 1K4CA 4AEHH 2PYEB 3NZHH 1CGXA 3ZHDA 4XP9H 3AS1A 1C5CH 5DK0B 2DL2A 4WEMB 3V6OA 5IF0A 5KSBF 2WK2A 2IBZX 3LCYA 5CJQL 5IROA 1AO7B 4QRUB 5BS0D 3WS6C 3IXTA 4QWWC 5KVEL 2AJSH 2QEJA 3RVTC 3DUSB 1T0NB 1TPXC 1I9IH 1MHCB 3RWGA 1KCKA 4GLRH 1PX3A 1KPUB 1UM5H 3HAEA 2IQ9H 3RWIA 5ICXB 1RK0A 3DYOA 4WV1C 1MCDA 4FQLL 5IWLA 3DO7B 2DKMA 1JN6A 4BH8A 3B9KD 3IDYB 1TVDA 1GGBH 3HUJF 4XCYB 1F2XK 3BX7C 3PL6A 3D85B 3F12B 2H32H 4P9ML 4Y4HC 4G6MH 4XPBH 3UBXI 4JFXA 3ZO0A 2DIAA 4P9HC 1CLOH 4RX4D 1R6VA 4LNRB 4NFCA 3TBSB 3QIUC 3SKJL 5FCUH 4K2UL 5JMOC 3O0RH 1KCSH 2BOCA 1QR1A 2AI0L 4ZMAT 2J3SA 1MIEL 3OXSB 1P69B 3D0VA 2O61B 3KDMB 4XNZC 3U2SB 3MBEA 5GGTH 5BZDA 4GQ9H 1ZT4A 5J11C 2VZ1A 3GMOB 3UTSD 4NRXA 1IGCL 4EJ1C 3QPQD 2X89A 2JJTA 3PGFH 5D6CB 5K9OB 2VTFA 1B9ZA 1FFPA 4OCMC 5D1ZB 1SHMA 3ZYJA 3MV11 2R39A 4HIXH 3VE0A 4XBEL 4MVBD 3H9YA 4GKSB 4B0MM 5BS0A 1BFOB 1JHKL 43C9A 5IB2A 2W0PA 2A9MH 3ULVL 3SGKC 1A0QH 1U36A 4AENB 3GSNA 5HGAB 3VXSA 4ODUB 1H15A 1DJSA 1OQOA 1Z3GL 5DFVC 3BZFA 4IOFD 5GS1B 2ZG1A 4BZ2L 3EYFA 5LGJB 1VADA 3B9VA 3L3HB 3SKNB 5D7JC 3FQWA 1RSFA 4WU7B 5IBTH 4JHZA 3MA9L 3NOIA 4GAJH 1KCUL 2HG5B 3CXHJ 4KK5C 1UXWB 4KJWD 1W8OA 3DTXA 3KXFB 1U8JA 1RIHL 4LDEB 5SWSE 2X7LA 4NHCH 4HS3B 4LAQH 4HWNA 1JRHH 1A3QA 5CHNA 5T1KD 1IGTB 3P2TA 5HYJE 3MV9D 3PIQA 3NIGE 3UPAA 4YDIH 4NO2B 12E8L 3OJDA 2D03L 1CFTA 3QUML 1R5VB 1WJ3A 5JW5A 3ISWA 1A21A 4QY8B 1DQJB 3WHXB 5JPNB 3L5XH 3C5ZC 4HG4J 3FZUD 5SWZA 1JNLL 3DRQA 2FEDD 3C9NA 3HHRB 3KPRB 3T4AA 4M93C 4EDWL 1MH5A 3TIDB 4MJ5A 1S7TB 1J18A 4HLJA 1X6LA 4CN6A 1FFRA 1EEUA 3L7EB 4JPIB 3PWJB 1NCWL 3TCXA 5FGBA 3VXPB 2IANA 3FKUS 4JFDE 4ZDHA 3MRGB 2BHUA 1DVFC 3QHFH 5IK3B 3ORJA 2RBLA 4JQVA 3ZKQD 4B7LA 4C54A 4HS8H 4MDJA 3RVTD 3CH8A 5CAYB 3PV6A 3VD7A 2Y36L 3VRIA 3R8QA 1D5MA 2BSTA 4NO5A 1QQDA 3VRLE 1UA6L 3T77A 2CIKA 4PJ9B 1G9MH 2Z31A 4Q74A 4ODXA 4NUGH 4KUZH 3RWEB 1EFXD 1S9KC 5C08B 2GUOA 5IBUG 3PP3H 5FYLL 3GSQB 4V2CB 2BX5A 4OM1L 1LP9F 3IDJB 4JFQB 2DD8L 2PCPA 2C3GA 3BP4A 1BD2B 1KTLB 3RGHA 3VG9C 1W72L 2PW1A 4HF5L 4ZO8A 2V7NB 4K8RL 5TQ2H 1FL6B 2ZUXA 4YHNB 2NXYB 2DMBA 3JTTA 1TNMA 3A6BH 1T7XA 5A16A 4X5WB 4H1LB 3V6OE 4LPTA 3HB3D 4I18A 3MXVH 3VFRA 5ISZB 3JWOL 4OCWH 1NGXA 1RV6X 3ULSB 2Z35A 4PJ8B 1IC7H 1KG0A 3GMMA 5TDPB 3G5XB 4CVUA 5B8CC 4U1GB 2DWDA 4F7TA 4AMKL 5F88B 1U8MB 5F3HA 3VXQB 3OR6B 4NM8L 2DLFH 3UTPE 3HZVB 4L9LB 2F58L 3MC0A 5IHUH 4XNZB 5FUOL 4NZDA 4RFOH 1MY7A 5EU5A 2G60H 3VRJB 5KVFH 4OSUL 3PHOB 3D2UD 1A9BA 3ZTJH 1MQ8A 2D31B 4ZS7H 2P5ED 3O4LD 2CDEB 1BAFL 3REWB 4AEIL 2BJMH 3O6LH 5I1DB 2GTZA 5EPMA 2EDFA 1U58A 4FQXC 1TJGL 4M00A 1HI6B 2AEIT 1J0KA 2GJ6D 4P2QD 2NX5A 3SJVB 1SJEB 2OX5A 5B39A 1S78C 4LBEB 4M3JA 5E4EC 4JHWL 2CKBH 5HDBF 1P7QB 3HKFA 4Y8DC 4Q9RH 4N68A 3IKCB 3NIDF 1WTLA 1F4XL 1FNHA 3CH1A 3IB4A 3RDTC 4YBLB 3GK8H 4PJIA 5GS0D 1T2XA 1MQKL 4PYGA 1QFUH 1OLZA 1UH4A 1CGYA 4ZFFA 1HXYA 3V95A 5BRZE 1B4RA 1QLFB 1TZHA 1LK2A 3KPNA 4Y16A 1OT1A 2XV6B 4P5MB 4WTZG 2VE6A 4YZFE 1MHCA 1KEML 4BJLA 5AUMA 5CD3B 1AQDB 4HMDA 1V5JA 4GRLD 4K3JL 1T83A 3GEWB 3PWPA 2VDML 5DF0A 5BVJA 4RAVB 2DBJA 3DX6B 4QTIH 4ESKA 3EW3B 2VDQH 3LN5B 3OX8A 5EO9B 5AYUL 3WXVH 1KB5H 1BZ9B 3F7YA 1FLRH 4OCXH 2XKNB 4YHOL 4XC3H 2GITA 5M95B 1HHKB 4P23C 4XAKD 4S0SD 4DGYH 4M3KB 2VABA 3PF2A 1FV1B 5KW9H 1D9KD 4I5BA 5KVFL 4WUUB 4HSQA 3RX8A 2W92A 1EGJL 1ZT1A 4MJIA 1KPRA 1CE6A 5E9DA 3ILQC 4LU5L 1FGVL 1QR1B 4X9BA 1A2YA 2OM5A 3MNZA 3P9WB 4R3SB 3B83A 4P46D 1SJHA 3EOTL 5C0ND 4PG9A 4JRYD 4PD4J 4U1JB 4GMTL 4Z7OE 3RQ3A 1MELA 3AUVA 3KPSB 5F7EL 3CK0H 4MA8H 4IDJL 3ARDA 2VZUA 5C0JB 4JFXB 1KN2L 1F4XH 1U8PA 1XIWA 2VXUL 1NFDA 3OAUH 2H2SC 1ZLUH 5FOBA 1TIUA 1AR1C 4HFUL 5HI5D 1H5BC 3JSSA 4I1NB 5KANI 1GAFL 3OR7A 4I0CC 3NCJH 2E27L 3SDXB 4PGDB 1I4FA 2VIRB 5DZLA 1EO8L 1IILE 5EN2A 1YQVH 2Z92B 3MRIB 2VQ1B 4RRPA 1UZ8A 3DVNB 1MWAL 1Q9KA 3IDUA 1VFBB 3VXUD 5BVPH 4GRMB 3TYGH 4I18B 3U46B 3ULUL 3IFNL 4XBPA 1LQSR 4GRLC 4H1LH 3MLWH 5I1HL 4AEEA 1OAXL 1UKSA 1NKRA 5T3ZD 1NMBL 5IB3A 1HYSC 3MUGA 2AABL 5KOMC 4AJ0A 4OGYL 1BX2A 2ZOLA 1ZANH 4NQEE 4X4XA 5LVEA 1P9MA 3HZYB 5FM5M 1A3LH 1QRND 4O2EB 3BO8A 4WHDA 3MRJB 3L7FB 2IPKB 4X5XA 4O58H 5C09D 5IHUL 1NFIA 4KI1A 3LKOB 5B22A 3CSGA 5EOCH 5AEAA 4HS8L 3CXDH 3KG5A 1W2KT 2C1OA 1ZV5A 4OZIE 5DMJB 3EHBC 4OIIL 2DLHA 3OZ9L 3DX9B 5D9SA 4Y1AA 5T33H 4Q0XL 1J1OH 4JR9H 3D3VB 3L6FA 4EN3B 1BM3L 1ADQL 4PP2B 2X4PB 3OHXB 1LO3H 3QO0B 1MFCH 5F7DB 4NUGL 5ABDE 2AKRB 4P46A 4HPOH 1FYTB 1S7UA 3TBYB 2W9LA 3LKRB 4U1NB 1D3CA 1CVSC 1NCDL 1MLCA 2FLBT 1HH6A 3OJ2C 4CAGA 3QQ4B 3BKYL 4JG1H 3QUYA 5C0JA 1XCTA 4FMFA 2AK4E 4KI5F 3IJHB 4P4KA 5FFLA 1OAQH 1WZKA 3VXTA 2OYPA 1FH5L 2Y07L 1FAKT 4LP5A 4JY6B 2ZSVA 2NTFB 1BGXH 5FA3B 1NGZB 4I77L 5IBUB 2MCG1 2DQGH 4OF5A 3B9AA 3SGJA 1NBVH 5C2BH 4F57H 1HQ4B 2N7BA 3M8OH 1YNKL 3ULSA 3QRGH 1QRNA 1HDMA 5DC9B 5TF1H 3FMGL 4Z7NF 2G75A 2Y7QB 3FQRB 1UZ6E 1EO5A 4QHNA 4H1LA 1X5FA 3BZEB 2DDQL 4Z0BH 3ZT6A 1MCQA 5H94A 3X3FH 1I8KA 4HC1A 3R1GH 5DVNA 4WWKB 2EDXA 1NEZG 3WJLC 1A3LL 2EYRB 2DN7A 1INEL 2JB6B 3WFHB 5F7HA 4WO4D 5INDA 3FO9A 3QUMH 4UB0L 2VXSH 5K9JH 4PRBB 4U1IA 5HJ3B 1Q0XH 4PP1C 1CFBA 4K9EH 5JDSA 4I3RH 4GKNA 3ZT7A 3RL2A 5KS9B 2X44D 5T5FL 1S5HB 5BW7C 5I15H 5DFVD 1KJ2L 5F96H 1FN4B 3HN3A 5ALCH 1PG7W 4P59L 4AL8L 4K8RC 2DI9A 4FOMA 1F4WH 4MXVE 2CIKB 4PJ9A 4EKXA 4Z7NE 3B3IA 4LPVA 5ADPL 2OR8A 4X7FC 3QPXH 4MS8D 15C8H 2VXUH 4FTVA 4Z7VB 4YE4H 2CO7B 1MLCB 2Z35B 2Q7NA 3HMXL 3MNWA 3O45B 4NKIH 1DUYA 5F3BA 5DA4A 3A6OA 5EIVA 3TN0B 4J7RA 3AVEA 4JFEE 3BUTA 4X6DE 4OF0A 4XVSH 3EFFB 3S8WA 5D6DC 5EBLA 4XMPL 4CU6A 3SKOA 3IETA 4RGOL 5FB8A 2AK4B 3TT3H 1FNLA 4ZOEA 5E8PA 5I18H 3BVNB 3WKML 3IDXL 1R5WA 1L7IH 1E4XI 3VD5A 1Z2KA 1T66C 3C6SB 5MEND 4LVNB 1O0VA 1Q72L 2GQHA 3BI9X 1NGPH 4U49A 5DUPL 1NAML 1BEYL 3B8SA 4L4TA 1IGTA 2R0ZL 3DURB 5E99L 3PDOA 1XFPA 4Y89A 3OKLB 1MIEH 4Y5YA 1K8IB 5D1QA 3BPLC 4TNWK 1MFEL 1XR8B 4TSCH 2GTWA 1H8NA 1WWBX 4XBGB 3VD3A 2AXJA 1B0RB 4XCCL 1I8MB 3MX0A 5DJ0A 4HH9A 3AY4C 1QD0A 3ILPA 3BRDA 2VDOL 1RUKH 2XWTA 4CU8A 2EE9A 1ND0A 3KPQB 1XGTB 4YIQA 4MZ3A 2CK2A 1RUAH 3DXAE 3KYNB 2LABA 3FL7A 3IT8D 3N9GL 5BZWA 5HHOE 3O6FC 1CG9B 5FGRA 2BK8A 3WNLA 1RMFH 4UT7L 3WUZA 4M1GL 1YQ2A 4TVPH 3AS3A 1BBJB 1NBVL 5FYKD 4Z18A 3IDNB 3W82A 4NCC2 3GFUA 4UIMB 1NGYA 3U0PB 2F5BL 2HLAA 3VI4F 4XP1L 1LMKA 3SCMA 3PP4L 4KMTL 2XRAH 3BP6B 2X9XA 5KTEL 3SO3C 5IBLD 1YN7A 4EVNB 1EHXA 4O9HH 4I5BB 4NNXA 3MRIA 4YDVA 4KQ4H 3KR3L 1IAIL 5HHOB 1IC5L 2EC9U 4UAOC 5I1DA 2WW8A 2D0HA 3I6LD 4PRPD 4D0BB 5C8JB 3IFOB 3T0EE 1UCBL 3RWDA 3FCTB 1U91A 8FABB 4U1MA 1N59A 4YXKH 2FGZA 1ACYH 1OAUL 2C1PA 4APQB 2XWBB 1P1ZA 2CUIA 43CAA 1GPOH 1IAOB 3TZVD 2YBRB 4WRLA 2DBLH 3ARVA 1Y18B 3VXMD 3ABZA 2ZZUT 3A6CH 2ZCKH 2QQQA 1GZQB 3FFCB 3D48R 4W70A 3EHBD 4S1RH 4EI6B 1WFTA 1TVBB 2R1WB 1PLGL 1YC7A 1XGQA 1BOYA 2NY0C 1TJHL 2YMXH 1F3DH 3QNXA 2F9BT 2Q8BH 4HKBB 3PJSB 5A2LH 3QG6A 4PJBE 3MV7D 4P3CL 4GLRI 2LU7A 3QH3A 2BHZA 1OP9A 2HA1A 5GRVL 3VWJA 3BAEL 4NO3A 2DJUA 2UVEA 3GBML 4G7YH 3DYPA 1C08A 3FRUA 3V4PH 3X14A 5C0AD 2H2PC 4D0DB 1G9NC 2C7UB 3BVNA 4ZFOL 4YHIB 2XNAB 5HHMB 2MKWA 3SQBA 4LLDA 1YMMB 2CRYA 3B2VL 1QLRA 4XXCC 4GW4B 3V7AG 1S8DB 1QLEH 2Z31B 2VITB 4YO0B 1IFHH 3EDKA 3FB6A 2W9DL 4U2ZA 1LEKA 3ARUA 4QRRA 4QHNB 4OV6F 5DSCA 4I8DA 4LOUC 5DD3L 2D7TL 1HXMA 2R0WH 4OI8A 3GNML 1QFWM 3INUL 4XCCH 5IT2L 1NEZB 2B4CL 1CE1H 3KVQA 2SEBA 4JQIL 2Q1EA 4GG6A 5SWSD 1AE6L 1JNHB 3O41B 1CWVA 1KEGL 3NIDE 4NNPL 1OARL 3B9KC 3HE6A 4ZD3H 5E6IA 1KCVH 3U36B 4IMKC 5GZNC 1Z9MA 3QCVH 3F7VB 1RAMA 1CT8B 1VENA 3SDCA 4WCYL 2XFXB 3WXVL 1X5XA 3ZKND 1A1OB 5E94B 3V7MA 2RAMA 4TVPL 1MCEA 3P4LA 1HHHB 4MXQC 4QCIA 4K94L 2VDNL 5C09A 3MRHB 1S7XB 4N9GA 4PJ5B 4HMEA 1CXLA 3PP4H 4DAGH 2EKJA 1CD0A 3QCTL 4NP4L 4BFIB 3EBAA 3O45A 4FABH 3EJYD 4EOWH 4HJJH 5FA3A 4QNPE 1VEMA 4DCQA 2VOTA 5D2NB 2QHLA 1NDMA 3D18B 2CK0L 1U8JB 1I9EA 1TZIA 5L2KE 1HWGB 4JY5H 4H26B 4PR5B 3MV7E 4S11A 4QNPF 3ZHLA 2C3VA 4TQEL 2ATPB 5C08E 3I50L 1HYSD 1RZIB 4NOFA 3IJYB 5AYQA 1U92A 5I76A 5HHQB 1IL1A 5H94B 3QO1B 5EDXA 4OZHB 2V17L 5FF6A 4U3HA 5BS0E 3S36L 2QQNL 3MQIA 2QHRL 1DBAH 4PJFF 4U1HB 2WWKO 5ACZA 2P42B 5F89A 4GS7C 4LSPL 4CJ0A 1FFNA 2G5BB 3LRSA 1YDPA 1KJ2B 2P5EB 1MJJB 4OCYL 3X3GL 3BPNB 3CC5B 4OKVB 4GO6B 5DJ2B 4F9PA 4XWGH 1IJ9A 4LCUA 3UTTE 5DWUL 3QQ9C 4J23A 4Q9CA 3F58H 1HZHH 5HPMB 3LS5L 3LH2L 3KPRE 4HGKC 3KLHD 4FFZL 4LF3A 4R26L 5FAAA 1ZA6B 2VO5A 4HWEH 4XNUL 3EOYG 1D5BB 5BXFA 2YRPA 1I8LC 2FX9H 3RY6A 1GZPA 4HQQL 3JWDH 2QQKH 2R69H 3MNVA 5ETUB 3LEYH 4FQ1H 3GBMH 3OAYH 3DX8A 1KSRA 1VB9A 3VWJB 2VH5L 5F7YC 2X4PA 1FG9C 3HS0A 5C6WH 4Z78A 3AM8C 1RIHH 1GHFH 4RAUB 4Z7WF 3WBDA 4NRZB 1RZFH 3VFGL 1YMHB 3O81A 3B6SB 4YDLB 2O5ZL 5I0DA 5L7XH 3A0OA 1HIMH 4QF1A 3MGTB 5JOFA 2J2ZA 3G5ZB 3QDJB 5D93C 1DDHB 1AXTL 2AS5M 4XMKH 2XY2A 3FB8B 4AIOA 1KC5L 3JVGA 5F1NB 4CUCA 2PTVA 1MFDH 2VLJD 2BY2A 1K6QH 1TQCB 3A6BL 1RJLA 3QXAB 3BDYL 4OLWH 3RY6C 2W07A 2PCPB 4NM4H 4EXKA 3KXFA 3Q5TA 4LLWA 2OR9H 1VGKA 2P1YA 5MHSD 2FJHB 4LCYB 4GG6B 4HG4K 3DIFB 2JTDA 3VWKA 3RVWD 4U6VH 2HT3D 4ZFFB 5T1KB 4KI5D 3VE0B 2XTJE 1H3PH 4LCUB 4HWBA 3U0PA 4YHZH 3K7UA 5JUEH 1IQDA 2X1OA 4Z5RB 3RFZC 5E8NA 4EEEA 1S7SA 4MGXA 3MOQA 1HK6A 3AXLA 2FB4H 3QI9C 2EDJA 4MD4B 4HAGA 4L4VD 2IQAA 2CMRH 4NWUH 4DGIL 2AJXH 1UA6H 1OSPL 1TETH 4BQBA 5HYJB 1CTNA 1G7HA 3GSVB 4O2FA 5C0GA 1MCHA 2Y23A 5DVLA 1MNUH 3MXWL 3O3UN 3MA9H 4XPGL 3L7FA 2FHCA 1BBJA 4RZCB 2QSQA 1RK1B 2BSED 4OF3A 4HPOL 3AU1B 2XZQL 3MLTA 1JWUB 3O3BB 1T80A 4PJ7E 5EBMA 3VXUB 5C0BA 4KDTA 2F54D 1F58L 3EGSA 1EERB 1TFHA 3C2AH 1MCOL 3S36X 1RMFL 1PKQB 3HG1B 4N0UB 3T4YA 3HI1A 4P2OA 1Q9OB 1AD9B 4AK1A 5K9QG 4HWZA 3CDCA 1DBBH 1Y0LB 3UDWC 5I1AA 2XPGB 1T20B 3FOLA 2VN7A 1RZJC 3PIQB 5B39B 1F4YH 1ZHNA 1KOAA 4LPUA 3MLRH 1JTTA 12E8H 3ULUE 3DVGB 2I9TB 3MO1A 2J6EH 1MFBH 4P9MH 4UQ3A 3P0YH 1BQHA 2HH0L 4PJDA 2APXA 5GZOD 1A1NB 3JZ7A 1WISA 1ZA3A 3L5WB 4XC1L 5DJXA 1NCBL 2GY7B 1KACB 4NRYB 4C83A 4LBEA 4H8WH 4RBPH 3QEHB 1DQMH 1MF2L 3S3PA 2DDQH 3QIUB 4NQTA 4DK6A 3IDNA 4YEFA 4RGNC 4FZEL 4ETQB 3X3FL 3HRPA 4MD5B 4LLQB 4L4TB 5KVGL 2BERA 1KTDA 3H9SB 4IMKA 4RMSA 4YQXL 1OW0A 1AQDA 2YPLE 4QHKJ 5E6IC 5IW1A 3S7GA 3B9KA 3HE6C 1NC2D 1ORSA 1BD2D 1RZKL 4H20L 5C9JB 3UYRH 1GC1H 4NKMA 2P5WB 5C3LD 4ZFGL 4PUBH 5HGGS 5AZEL 4HFWA 2BP3A 4GKZA 3K2MC 2OJEB 2VDLH 5HHVH 1U3YA 5KAQG 4OJFL 2Z8RA 3MOAL 3W2DH 1HI6A 3MXWH 1W0YT 3UBXA 4N5ED 3QEQB 3O3EA 1W0WA 1FL3A 2D9QB 4AQOA 3WN5C 2B2XH 2GK0A 1X44A 4ODVH 1NBZA 1I1YB 4Y5VA 3STLA 3QFDA 4PREB 1JPGA 3KYKH 3QDMD 4TOYH 4ZUVB 1MLBA 3IU3A 3GRWH 2DM4A 2GW5A 2NY1C 2VDPL 3ARBC 3DGCR 4X99B 2WQ8A 4Y19D 5JHDB 5IMLB 5F21B 3U83A 1OP3K 3DSFL 3MRMB 5CKAA 3QO1A 1IGMH 5J9PA 2AERT 2DF3A 1QLFA 4LCWA 5MENE 3P4MA 3WLWC 1CXKA 3VWJC 3AREB 2BRRH 1ED3B 5A3ID 5BRZA 3U82B 4NNYA 2CXGA 1CCZA 5DD0H 1XGRA 3UTPD 2ZJSH 3ULUH 1P7QD 4NZTH 4XBPB 5EZIL 1AHWC 1U3HD 4P5TD 4JGUA 3NABL 4OQTH 5DJDA 3HPJA 5A3IC 4Z0XB 1CDCA 4IOSD 1A8JH 3VWJD 4C4KO 1Q72H 2DWDB 4F7TB 2FYYA 5D1ZC 2F15A 3RWHA 3S3SA 1OTUC 4P5KA 3R06B 1T5WA 3F7VA 2PTUA 3LS5H 5EFIB 2K7QA 4E0RB 4R4NC 1KJMA 2EC9T 1ZTXL 2WUBL 2G60L 3GSUB 1EX0A 4LL9A 5J89A 2FH6A 1GGTA 5IMMA 2R2CA 3U4EA 3V5DB 4S10A 1TQBB 3LQZB 5EO1A 2R29L 2V9QA 4QRRD 1INDH 2X4RA 2YPLB 4LASL 2ZUTA 4JM2D 4LPCA 3VFVA 3P9LB 5ESQB 3BKCH 3RIAF 2MQ3A 1E4WL 4JFFE 2DD8H 5L2JA 1DANT 4Y1AB 1HIML 5EU4B 3GI8L 4Q2ZA 2HTLC 3LRSB 3CVIL 1PEWA 1U8NA 2CKBB 1BHGA 5LWYL 4ZXBC 2YOCA 2PO6C 3OR7B 3SDXA 3MRQB 3SCMC 4A2LA 3PABB 4IIQB 1FZMB 4WEBL 2DQJL 2MCPH 3G5YB 2QADC 4BSVA 1N6QL 4F7CB 5FK9B 3BAEH 4XAKE 1EHLH 5JHDE 2RJMA 2ZCHL 1N0LA 4WI9A 1OT2A 4O9HL 3C08L 1OB1A 5GGSY 3ZE0E 4HPYL 5TE4L 4POZD 3SDAD 4G7VL 4WWKD 5IQ7H 4Y4FB 4D9RD 1JCKA 1AY1L 2R23B 5IM7A 1KIRB 3PWLA 4FFYL 1M1SA 5C6TL 4JRYB 3QUMB 4O2FB 4LLQA 3IJHA 2NW2A 4FNLH 4PGDA 2NNAB 4GXVH 4JZJB 5DHYA 1UWGL 3STZB 5CBAB 4NNXB 1JGEB 4JG0L 1J8HA 3AY4A 2VXVH 4LVOB 5KW9L 2FX7L 5I6XB 3ARPA 3ZKSD 1KPVB 2HTKC 1GGIL 1TJGH 3JBG7 3T1FA 4ZUWB 1I1FB 5D1QC 1AE6H 5EOTA 4JLRB 1SJHB 1KPUA 1VFUA 4OZFG 3J8F7 3DV6B 3S35X 5SWSB 2X4QA 3RA7L 5GGTA 1FGNL 3V0AC 3J7HA 2RFXB 3O3BA 4PYHA 4WI3A 1TCRA 1M71A 2VMFA 1B6DA 1KIUA 3V7AE 2UV3A 4GUPA 4HUNB 4PJAE 3F7YB 1BJ1H 3BPOC 1UWXH 3OKDA 4XPFH 1F3JA 4XHJC 1EHLL 3NABH 2C3XA 2R8SH 1NH6A 4PJIF 5I18L 1J8KA 2KUTA 3R4DA 4U6HB 2JJWA 1IT9H 3WHE1 2VLRE 2HAZA 3WNMA 1YPZB 1U3HC 3GJFA 1ZANL 2FO4A 3RWCB 2IAMC 1N64H 3P9MB 1MREH 1RJZA 5IEHB 1C16B 2F74A 3FT3A 2PETA 5D72H 2NY2B 1MCLA 5DC4B 1GH7A 4WNQB 5T1KA 3AREC 5SWQA 3SQOL 2BVEA 3GMLB 2XN9D 5T1LB 3WKNA 1HILA 5SX4H 5BW7A 2D7OA 3Q1SH 1T04A 4DVRL 3FOMA 3RWGB 2M2DA 2P7TB 2UVFA 2GT9A 2DYPA 4LASH 3F12A 4K3JH 1LDPH 3GSNB 4JN1L 4V1DD 5FHAL 4PLKD 4PBWD 4TVPE 1VEPA 4RWYH 1JF6A 4Y5YB 4BKLB 3DMMC 1QA9B 1XGTA 4YIQB 2XYCA 4FG6C 1ZAGA 2B2XL 3DMMA 1FBIL 3O6ML 3BPNC 3D5OF 3ULVE 1CGTA 3KS0J 3N9GH 3DXAA 4OGXL 1UM6L 4XC3L 2FLRT 4IRJD 5DJ0B 1GIGL 2ZUYA 4M7LL 2FB4L 4ZUSA 3H3KA 1EAJA 2HT2C 2ZUVA 2X4UB 3HNTH 1YY9C 3KAAA 4HX1B 1BQHG 2ESVE 2F58H 4XNXL 5HGBB 5EU6D 3PWUB 4YPGB 5IOPB 4Z6AT 4JFZH 3MRBB 1ZLSL 3AREA 3SGJC 1NGZA 2ZCLH 5AG9A 1G9ML 1PJ9A 3PP3K 5L8KB 5D7KD 3DX8B 4L9DA 5FYJE 5JW3H 3PGDA 2BJML 5EZLB 1T7YA 3EO0B 2YHGA 1BFTA 2CDGA 1U41A 2OXGA 4P4KC 3WIIL 1U3HA 3OKEA 3ZT5A 2FECL 1N8ZA 4S1QL 1GJIA 2V2WA 3BH9A 3TC9A 4P2QB 1VACB 3BP6A 1AP2B 4MWFB 2VLME 5LAXB 2F54A 4KHXH 2G5RA 3G08B 4PTUA 5DHXB 3PV6B 3UTSB 3RGVB 5BJTA 4OIIH 4X6DA 4N8PA 1F6AB 4NDMB 2W0FA 4OFYD 4N90D 5IB1B 3V5DA 1IC4H 3GO1L 3SY0B 2Q8AL 1NEUA 4OF7A 4TRPL 1S7QB 1EVUA 4K7PH 5FYKU 4WFFD 4JY6A 5FCSH 4L4VE 3VFTB 1A64A 1JHTB 1DBML 3QFJE 3FO2B 4F33B 4X83A 3LQZA 2XOTA 5EO1B 2YXMA 1KLGB 3LPGA 1X7QB 4K9EC 3BP4B 4ZO9A 4NQED 5EWIH 2VC2L 1RZJH 4Y4KA 3CFJB 1WCBA 1QHOA 4OBSA 5GISL 1V05A 3RNQA 3HPJB 4X5LA 2C4FT 2EH7L 3WCYA 1C7SA 2FD6L 5E1AA 1WUNT 4JPVL 2H32B 2QR0A 5AZEH 3ZTNL 3VXOB 6FABL 1ZLSH 4Z7UE 5GZND 3S5LB 3MRGA 4WWKA 1RUML 3RZWA 5TF0A 2YC1A 5CBEA 1BJ8A 4QHMB 5ENWB 4PJCA 2YBRA 4HWBL 3O2WL 5K9KB 3CUPB 4X7TB 5GRVK 3D1MC 3K4AA 1S7RA 4NQDE 4YXHH 2GSGB 1A4JB 4L3EE 4TOYL 4WHTB 1Q94B 2O5ZH 1XIWC 1XZ0B 4EDXB 2LVCA 3VGAB 5D70L 5IK3A 4GBXA 1IMHC 4P57A 1ZGLM 2OZ4L 3C2AL 5FYJD 1JGLL 4HXAH 1IGML 5KBNC 3SKNA 3VXMA 3PJSA 2F54B 1PYWA 3IF1B 2D03H 1SVZA 3O8XA 1PSKL 1S9VA 3Q1SL 4MQ7A 3I02A 4M48H 4NUJA 1WQVT 4ZXBA 3ARDD 1CZ8L 2FIRT 4PJHB 1UEMA 2RCSL 2D7PA 3MJ9A 3HE7A 2CKBA 3MRLB 3DI3B 1BF2A 4ONHB 2X7LB 1D7FA 4QHKI 4D0CB 1F4WL 4P23A 5D2LE 2IGFH 4JGMA 1A1MA 5D7JD 2E7HA 3B2UD 3IFLL 1YJDH 2W60B 4JFPB 2EECA 5CHNB 2EZ0D 1PZUB 3ULVF 3SJVD 4CU7A 2V2TB 4ZPTA 3HMXH 2PW1B 4KVNL 3X11B 5SWZB 1T83C 1Y6MR 3S97C 3MREB 5AUMB 2VRAA 3U36A 2VWEE 3MLXH 3KPPA 4MX7B 1RZ7L 1ZLVH 3H9SD 2SEBB 5CCKH 4YGVA 1FG2A 2QADD 3FN3A 1FGVH 1MH5B 2Z92A 1BOGA 2EE3A 5I1KL 1ODAA 1CICA 3ZDYF 2NY5C 4HWBH 5JLZB 4KMTH 5GGSB 5KTEH 3X12B 2IH3B 4LSUL 4ELKB 4CW1A 1MCWW 3W39A 4GUPB 1F58H 1S9XB 3GJFB 2R2EB 4S0TD 3VXNA 2VDPH 2ZKHH 5LG1A 4IRSA 5D72L 1EMTL 5TDOB 1LO5A 3RVUD 2NY3B 2HWZH 5CWSA 1GGCL 4RAVA 5I0ZA 3ARWA 2VSDA 5DMKA 1JPFA 1S9YA 3RTQD 4JKMA 5JNYB 1H9VA 8CGTA 2GT9B 5C9KA 4NC2B 4R4FH 5ITBH 4ZSOA 1H0DA 2AXHA 3DRQB 2HTLD 1HH9A 3M8OL 1KJ3L 3V4UL 5FKPB 1CIDA 3REVA 5ANMA 2VABB 1TNNA 3CLEL 4PG9B 1FZKA 4MDIA 2DM3A 2IAND 3SE9L 5DJAB 4O02L 2DQUL 4KC3B 3O6MH 2AJVH 1CYGA 1CD8A 5DUMH 5MERB 3TWCL 4LKXA 4F9LA 3GGWA 4Q9QH 1Z6JT 4N0RA 2IQ9L 4PY8I 5JIHA 3L3JA 3MLXL 3ZKXC 3MV7A 3Q2CA 2PO6B 1AQKL 4PUBL 4L4VA 4HEME 5DHVH 4KY1H 1D5ZB 4X6EA 1YZZA 3QJFA 1J9CT 4OUOA 4Y2DC 2NY4C 4AEFA 5IFHH 2KBGA 1BQSA 1C5CL 3M1BB 4QRPD 3RX5A 3OBAA 2UZXB 1Q9WA 3QEGL 3MGAA 3BEWA 3QDJD 4BUGA 3MCKA 5I8EA 2R0LL 5D4QA 1QSEE 3K4DA 2HFFA 2DTML 1NCDH 1XZ0A 1I8IA 2ICCA 5DFTA 3QQ3B 4ONFL 4M61B 5J7CC 3WDJA 4YWGH 4KTEL 1BVZA 2A9NH 2EIZB 2YUVA 3QAZC 1YNLH 25C8H 4XMLL 1NMAL 3KJ4B 2PR4L 1NMCC 3PGCB 2QHRH 4G8FB 2UYLB 4MAUL 3ROOB 1Z9SA 3IKKA 3G5ZA 2FX8H 3VFRB 5ILTH 4XNQA 3WJJA 4YFEA 3MSPA 4GG6F 2O5XL 1PKQA 2GCYA 1KEGH 4OLVL 3C60D 1S5IL 5C0DB 2HRPL 3O6KL 5ACMA 4KDTC 5HI4C 2NXZB 5DRNB 1OF2B 1IM9D 4L1HA 2DQFA 5FM4A 4LLMA 1YEHL 4Z9KB 1AGDB 4DJMA 2ESVA 4X80L 4R3SA 2XN9E 5T3ZL 5IIEA 4QRRE 1JF1A 4YUEL 5EC1A 3FZUC 3BMWA 2OMBA 5F7KC 4LCCB 3ULUD 4Q9QL 1HHIB 4RIRB 3MJ8B 3C2SA 4PRIE 1UYWH 3MNWB 5ICYB 1LEIB 2M8XA 4LLAA 4NQCE 4TVPD 1Z9LA 5EU6B 3P4NA 1MI5E 3LKPB 2AEQL 4F8TA 3WDHA 4V2BA 4PB0H 3D9AL 1RD6A 2L4OA 4RAUA 3MUHL 4HIJB 1I3VA 4WY7H 5JLZA 2G75B 2Y7QA 5FA4A 3OG6B 4X7EC 4NPYA 5DS8A 2CKNA 2CK0H 4JAMB 4YNYA 4OM1H 5E8EB 1U3HB 3CVIH 3OKEB 1KN2H 4POYA 1DLFH 5DT1L 5HSFA 2PW2A 3PQYA 4G9FD 5GSRA 1PYWB 3IF1A 3N1MC 4CBPA 3QUKB 2E27H 3QRFM 2DLEA 3UJJL 3V4VH 2B4CH 3MFFB 2YK1L 2YZ8A 2FJFB 5DVMA 5LAXA 3MLUL 3QQ4A 1JNLH 3KPRD 3I6KB 1C8PA 1C5DA 4B53A 3TYFB 3MLVH 2UUDH 1VERA 4YHLH 2NPLX 1ERNA 3TIEA 4RWHA 2DQUH 5JDJA 2X70A 4UTAH 1KN4L 1FNGB 5LJYH 3GKWL 2J88L 5I75C 4OBRA 4FXLA 2IALA 4G8GE 4NO0D 1IAIM 3VFTA 4EQ2A 2DLFL 2P4AB 4P2CG 3QZWB 4K3EH 1UWGH 2JJTC 5CSZA 1I8LA 5GRWA 5DXWA 5IT2H 1RJCA 3D3VD 2NR6D 1EDQA 3D87B 3CD4A 4U4BA 2B39A 4JRXA 3MBEC 4QHUA 5CCKL 1R3LB 4KTYA 1JUFA 2ILLA 2NZ9C 3V9FA 3W2DL 4XP4H 1JWSA 3LB6D 5DJCA 2QKIB 2XN9B 2VZTA 2B8OT 4UT6L 4ZPVB 4HIJA 5CWSB 4XWOD 1XIWD 4J1UB 5C0EA 1ZGLA 4OLYH 4ZTOH 1MEXH 3TVMC 5J12B 3AGVA 2G5BA 3W9DA 5GSVA 2DQDL 3VW3L 5I1IL 1I3RA 4D9RE 3QNYB 1BVKA 4Y4HA 2HLFD 4J3XA 4PRAA 2GK0B 4F37F 4QRQB 1JWMA 4HUWB 2HT4D 4XH2A 3L3GA 3N1QC 1P84K 5IWLC 1NCAH 4K71C 4XC1H 1EA9C 3ARGD 5JQ6L 1LP9B 5C1MB 2FJHA 4LCYA 1LEGA 4JRWA 2MMXA 3ESVF 5TE6L 1OP5H 5CFHA 4H8WC 1SYSA 4NWTL 1C7TA 5ADOL 3C8DA 1HHJB 1XGUA 2OZ4H 1KFAL 3BWUC 4YQXH 3NAAH 1NSNH 4EI6A 2AJVL 1S7SB 2HT2D 5DVKA 1NMCB 2W60A 5IMOA 4Y0GA 3TWCH 1M7XA 3Q3GA 1HSAA 1RZ8B 3LHPL 5GGQH 1BAFH 2O26U 4OZIB 5CZXD 2FBOJ 5EORH 4JY4A 1JN6B 4BH8B 3PDOB 1FE8H 4QXGL 1NJ9B 2YD2A 5E8OA 1YMME 2OMNA 3IFOA 1XT5A 5DYOA 2MJWA 2BVUA 5KG9A 1CFQA 2ITDA 4JG1L 4JVWA 2IH1A 2X4SB 3QJFB 4OZ4A 5FYLD 4C58B 3TBSA 5ID0B 5F1IB 2W38A 4QO1A 4JFDA 4AY0A 4ONGH 4XX1G 4XMLH 3CFCL 3TO4C 1JZ5A 4F57L 5BV7L 1K4DB 3DRTB 1YN6B 4YDKH 2XG4A 4S1DC 3L3DB 1AFVL 2I07B 1BBDL 1WBZA 5EU7C 1P4BH 3TYGL 4OQTL 2Y1VA 5ICZA 2ZG2A 4BYHA 1BWMA 3LSOB 5IESH 2QBWA 1IARB 3BUYB 4HIHA 3N0PB 3QNZA 1E27A 3RL1A 4NGHH 1SM3L 4X80H 5HTSA 1QNZH 1K9TA 4NO3B 5E7BA 4OLZH 4WUUD 2Q7YB 4FQXD 4M6OL 5DD6B 1X4XA 5A2KH 5BOPA 1VADB 4G6JL 5IVNA 1EHNA 3MLZL 2P24A 4X4YB 3TF7C 5GJTH 2PYFA 2OR9L 5D7IB 3T0EB 4C59B 1DP0A 4LVEA 1B4JH 4OUUA 2FZ3B 5CZVL 4TTDD 1EXUA 2GIYA 1EJ6A 1ZEAH 1SEBB 1GCFA 3KJ6H 1P5VA 3TCLB 3RHWK 1QOKA 3OJVC 1QQDB 3RPIB 4X6CE 1SMOA 3EOBA 4AIZA 1NBYB 5FO9B 3D39E 5CEZD 1Q0YH 5C0AB 3BKYH 4WI6A 1AGEB 2KH2B 5CEZH 1WIPA 3TNMA 1CLZH 1QFPA 4O2CB 4RFEB 3B43A 5ANMB 1OSPH 1D9KA 2Y36H 1K3IA 4L3ED 4M7KL 5HVHC 2OJZH 3MRKA 1AD0B 1JK8B 1DZBA 4NCDA 5FF6B 1YEDA 3JWDL 4HQQH 4H0HB 3BQUA 1LK2B 3KPNB 4LIQE 4JRYE 3WEXB 2B5IC 4YXLH 4NQVB 4K07A 2ARJA 1NMBH 5CMAA 2XZAH 2VZVA 4OGYH 5CJ8A 4G42A 2EE2A 4QY8A 4ZAKC 1KUMA 1AO7D 2VR4A 4L4TD 5MP6L 4UTAL 3VXNB 2W9EL 3IKCA 1LVEA 1N64L 2V2XA 4JKKA 2FECI 4O58L 4EI5C 2R2BB 2ZNWA 2D2OA 4WW2F 3SCMB 1T5WB 5E08L 1F4YL 5CBEB 1YNTA 4U2YA 4UIMA 5J3HD 1OWWA 4Z7UB 3S37L 5DK2A 3D69B 3QI9B 5CS7A 4JFYB 3RIFF 1I1AD 4PG2A 5KSUA 3SDAB 1FSKB 3QSKB 4JR9L 3E6HB 4R4FL 3G9VA 5E94A 4IMLA 2AP2A 2V7HA 3H7BB 5D5ME 4Y2DB 5GGRB 1A7OL 3LQAL 5CEXA 1ZEAL 5SWQB 2I60L 3P77B 1FNEB 1R0AL 3UTSA 2D7NA 5BJTB 3Q6GL 3O4OB 2C3VB 2VKWA 4LPWA 4X6FA 2E9JA 1G7LA 3FB6B 1YY8B 3FRPG 5GGVL 4OLYL 4ZTOL 4HV8B 1XAUA 3WO3B 4J6RH 2VUOA 1DEDA 4LLUB 2DI7A 1TTUA 2IFGA 4DOHE 1J0HA 2DRUA 1FRGL 4Z95L 3C5JA 1NLDL 3VFMA 4TNWF 3IJSB 1FO0L 1J1OL 2X6MA 4IJ3C 3OKDB 1F4HA 3S34H 1Y18A 3DRTA 4RDQG 4MNQE 5EC1B 4PD4K 3L95A 4JM2C 1JE6A 3CXHK 2WIIB 4W81A 3V4PL 1HHHA 1VPOL 4QCIB 1X4ZA 1LE9B 3FFCD 4GG8A 5B39G 1CQKA 3O11A 4NWTH 5D71L 1AIFA 3FO0H 4TSAH 5CGYC 3QNXB 5C0IA 5ID1B 1I85C 1QEWA 4IRJC 3TO4B 1S7TA 3VI3E 1AH1A 3QAZB 1JFQH 1JI2A 4BFGA 2NY1D 5K9KA 2JJUA 5HYSG 1IGYB 5HGAA 3VXSB 3C6LB 4NZUH 5ERWB 4D9LH 2FBJH 4LMQE 3RDTD 1O7VA 4QXWA 4G9FA 4OZHE 1AHWB 43CAB 4GAFB 4ODSL 4QXTA 1WLHA 2PN5A 2ZOKA 2DQIL 4R2GD 3BEVB 1FE8L 4QRRB 4WFED 4KUCD 5I8OH 1UB5B 3QEUB 4IRSD 5EH1A 4YHZL 3TCLA 4UILL 4YBQD 4YHOH 3MYJB 4FQJL 4F33A 4M43L 1OOAA 1G7JB 2Q8BL 3HR5B 4PJIE 1H8OA 5E6IB 3T0AA 5HVGB 3QUZD 2UWEA 4PRHA 1T4KA 1UZ8B 3DVNA 4N8CL 4KQ3L 1PBYA 2ITCB 3C60C 4BZYA 3V8OA 5T1LD 3THMH 3VI3F 5DLML 1JRHI 1KYOK 4FQPA 3RY4A 2XWJA 1LO0L 3QQNA 1F90L 3X13B 1D5XA 3BUYA 1JPSH 3V0VA 3HC0A 1EZVY 1WV7T 1YMMA 3LOWA 1DE4B 3VFOB 1LK3L 1VGKB 2IMMA 2GSIB 1G0XA 1CFNB 2EO1A 2HN7A 2ICWB 4FHBD 5DHVA 5IBLC 5TQ2L 3DXAD 1MHEB 4KZDH 4M6MH 3S35H 2E5EA 3WFDL 3DUUA 4OCNC 2I9LA 4P3DA 3PV7A 4Y4HD 3O41A 2ICWJ 2XI9A 4PIRF 4QT5B 5D7LA 4NN7B 4P2RE 5LQBH 4LEXH 1IGFL 5C7XL 5IJKC 4PJ7B 5DUPH 2H9GB 1EUTA 5IVOA 4EI5B 1MCRA 5JW4M 4KPHL 4P9HL 5DWUH 4KXZI 3T08A 4WO4B 5JIIA 5CINH 5JIKA 3P73A 2WBJC 4NKOA 4I4WB 3DSNA 1DSFL 2A9ML 3ULVH 4TPRL 5C0RL 4G6KH 3BIKA 3FOLB 2JJVA 1D6EB 4PJBF 3HMXA 5KOVC 4HZLA 3SEPA 5ACZB 5JOFB 5K9OA 5EUOA 2YZ1A 4M5ZH 5E9DD 4DFHA 3KPPB 4MX7A 5GRUH 3CFDB 3G5VB 3WFZA 5IBTL 4EOWL 3GSXA 3QXUA 5FYLE 4G7YL 1OCWH 2DKUA 4QRTB 2CKBL 1A6WH 4HUUA 2EDQA 3EYFB 1OAZL 5DD1H 2DKSA 1NANI 5KANG 3O11B 1YEGL 3I9GL 5GSVB 5C0FB 2X89D 4L8DB 5GGUB 1IFHL 1JV5A 5KSBA 3G6AB 3KHQA 3JV6B 4LLYA 1PG7H 3S5LA 3GSRB 1FL3B 1CZ8H 5DEGA 1HE7A 1RZKC 1RZGB 4I3SH 4Z5RA 4ZAKD 4OCWL 5HPOA 2QTEA 1P7HL 2OJEA 4GKZB 4QLRA 4RGMB 4JDVB 5CIPH 1ETZB 1UXSB 2A6IA 4ONHA 4JQIH 1T1ZB 4KKCC 3TA3B 3N85L 5SWZE 3A6CL 3DROA 2XIDA 3RX7A 3KPTA 4JN2B 4N1HB 2IAMB 1WZ1H 4PJEA 1ZLVK 4DZBA 3I75A 2DTSA 4K7PY 1JZ6A 3NA9H 1DBJH 3LDBB 1CDGA 2EEBA 4HK0A 5DQ9B 7FABL 3BH8B 5FGCB 4JDZB 1CF8H 3ARQA 3HC3H 2CR6A 4XVTL 3RVXC 4KFZC 4R96B 5E5UB 1T1XB 4RMTA 3HTLX 1JGDB 5GJSH 2GCYB 4GKNB 1K8DB 4FTVB 4OQTA 5I6XC 4U1SA 5CP3A 1CQYA 5IV2A 4G80A 4KK9D 1J05A 2MHAB 4PJCB 3BRGC 2IALB 2HLAB 2X1QA 3BPCA 4RCAA 2FJGA 3WD5L 1RUPH 2F53A 2ZPKL 3MRCA 5I2IB 3TP4A 3L5IA 1CS6A 3IJSA 4HD9A 1S3KH 2P5WA 5FYLH 4JPKH 3HAEB 2JF1A 2OCFD 1BPVA 2IFFL 1TJHH 2CUHA 3JTSB 4IMLB 3C8KB 3NGBC 1YEJL 2BCKA 4TSAL 1SY6L 5E6ZA 1JUFB 2O5YL 3FO1A 1V3JA 3VXSE 2DQCL 4WVRA 2BC4B 1EBAA 1FCGA 1MI5D 4NN6B 3V5HB 4MJ2A 4KI5C 4GG8B 4MD5A 1JJUA 3MLRL 3HZYA 4PREA 5F9WC 4J12A 1TMCB 5FA4B 3DUHA 3KPLA 1G7QB 3BWAB 3SPVB 2APFA 4HUVA 3PXHA 3RDTA 3IDMA 3IU4L 5JHDA 2P8LA 3QIUD 3NPSB 4K55A 2IPTH 5F7FA 1IZJA 5KVDL 3T09A 1I3RB 3DROB 3SDAA 3QQ9D 1G7MA 3VFMB 4ZUVA 3QIBD 3MACH 5JUEL 3D2UA 4Q6IC 4RA0C 4FQXA 4X5WA 3QO0A 3Q5YA 4F15B 4X6BB 3K1DA 5IIEB 1FNSL 3LH2H 1HN1A 2XQBH 4X8XA 1X5AA 4ZUTB 5FGSA 2Y6SC 1I7RA 5D7SL 1L9MA 4LVHB 2F53D 5ICYA 1H0DB 2VXQL 3FAWA 1LEIA 5HVHB 3T0EA 2F54E 1DQJA 3PXJA 5HHVL 4J8RA 1R3HA 1FO0B 4WFHD 1ACZA 2FGWH 1MHPL 3VJ6B 3VXQA 1MFCL 3L3OB 3MR9A 1ZVYA 3G6JA 2A6KA 4PRNB 3GMNA 3KPSE 4ORGA 1RUPL 4LSUH 4KDWA 3KYKL 3ARSA 2WBJB 1FBIH 5KSAA 1QBAA 1YPZF 1R3KA 4NQUA 1Q9OA 1Q0YL 4U0RC 1UWXK 4PJGE 1JBJA 1GAFH 2AJ3B 4JFOB 3PQYD 3ZTJG 1GSMA 3V2AR 3VCLB 1KC5H 4WFGE 3RGVC 5CILH 2AJZB 3WEXA 4Z77B 3IYLW 1EFXA 2BVPB 3ZKNC 4ACPA 3X17A 5L2KD 4NJ9H 4JFDB 1AKJD 4H0IA 3DBXA 2JJSA 4TNVF 2CPCA 5D1XA 2AJUH 4N1EA 5JHLH 4M1CC 4DQOH 3MLSL 4MNHA 2W9EH 3WXWH 4ZNEE 2XXMB 3LKRA 4ZQKA 2Z31C 3L3DA 4QTHB 3UEZA 1F3JB 1W0VB 5GJSL 1G6RB 4ALAH 1DQQB 5H35A 5HY9A 1KYOJ 3OV6A 2WP3T 2P5WE 3I2CL 1FYHB 2VXQH 4NRXB 1QZ1A 3QUXA 4JQVC 2ZSWB 5EU3A 1UEYA 4MLIA 4WI7A 4FA8A 3CDGA 2YA2A 4LLVA 2LE9A 2VLJE 3TNNB 3GMNB 4HIXL 3PWJA 5IMOB 4G8EB 2BXYA 1ZLUK 4LARH 4NN5B 4J3VA 3EJZD 5CD5D 4RA3A 4KJPC 3LD8C 4JANB 1LD9A 4P23D 4H26A 4PR5A 4ZXBD 4L9LA 1Z3GH 5CD3A 1H3TA 2E9IA 3GSUA 3EKCA 2Q3AA 2B20A 1KTRL 5HHXL 2KL6A 5F6IC 3DV6A 3QEQD 1OAKH 2NY2D 1A6TA 2IPUK 3GKZA 1NBQA 5FO9A 2XKUA 5D7LD 3RJQB 5F7LB 1BVLA 4DKAA 2OBGA 4M4RA 2OL3H 1EAPA 1GGYA 2VLMD 3MOBH 5E4EB 3QDJE 4XCEB 4YDLC 3KYMB 4IRZL 3MRNB 2OI9C 2Q6WB 3EZJB 5A2IH 1SYSB 4EQ3A 4OLUH 2J88H 1PFCA 4QOKA 5TFSH 1T1YA 2VE6B 5DQDL 5TGBB 1QYGL 2AJYL 3QZWG 1NGWB 1BREA 1JGVH 2EXWC 2O61A 3QBTB 3CX5K 1Q9WB 1LE5A 2DQEL 1OTUD 4BSVB 4CKVX 3INUH 1WITA 2NXYC 5HYJD 3I2CH 5D2LF 3UYPA 3CH1B 1D5BA 3U1SH 3QCUH 5BXFB 3NPSC 4A2MA 2GJZB 5C07E 3GM8A 5EORL 5I8KL 1CR9H 3U0WH 2AQ1A 4JY4B 5FHBL 1SYVA 3E6FA 2VSCA 1V7ML 3PWPD 3K8LA 1CXFA 1YNTB 3AAZA 5ESAB 4G5ZL 4NO0B 4PBXA 3MRHA 2EKSA 3TV3H 2H8PA 3NTCH 4ORGB 4XAWL 5CUSH 5T3XL 3KHOA 5IV2B 3KPLB 1DQLH 1F45A 1IGJA 1UCTA 1QRNE 3CDFA 5C0RH 4GMSH 3RTQA 1T7WA 2CJUL 3PHOA 5BVJB 4U3CA 3LEXB 1ZA6A 3UZQA 1P4LA 2CD0A 4X8JA 5K59F 1SJEA 3RNKA 1TZIB 1U9KA 3BP5B 2VERN 5CJ5A 3GI9H 1WBYB 2YD5A 1F3RB 5BV7C 4I77H 2ESVB 1JTPA 2FJFA 2NY7L 3N06B 4NP4H 1RJLB 4XPFL 4MXWH 1PKQE 2BVQA 4JHAH 3RHWF 4LRIC 1U92B 4ZO6A 1EEYA 3DO3A 3BOVA 4ODBD 5E70A 3U0TB 1KT2B 1KFAH 2P43B 1MCOH 4FFWC 2A6IB 2J8OA 1OGTA 3WHE0 4MNGE 4YWGL 1IM3B 3PL6C 3H7LA 3VXRB 5MEQB 1L0YA 3OXRA 3EFDH 2DICA 4NGHL 3TBTA 3ZL4L 4GRWF 4PP2A 4JJ5A 4OZHA 2DOCA 1FL6A 3MRCB 2R1YB 2NNAA 3MRRA 2YRZA 3U7YL 4WV1A 1GGCH 4MAUH 1JHTA 2QQNH 3U6RA 5ILTL 1NFDF 3SDDA 4HGMA 3REWA 5I19L 5MEOB 3CLFL 2VAJA 5E2WL 5SX4I 1SEQL 1NFIB 3NIGF 4MAYA 4MA1C 1K85A 3WS6A 2NY4B 2DQIH 3G04A 3BT2H 4MVBC 3W11D 4OKDA 1XEDA 2ID5A 4E41D 4RZCA 3O9WD 1AGFB 1HXMB 5IF0B 4XAWH 4PJFB 4K7FB 5GRYA 4H5SB 3EOBB 3L9RA 4AIZB 1TVHB 2Y9RT 1AP2A 1CF8L 3HC3L 4QHMA 5ENWA 5JDSB 4WO4C 4M5YL 4YDVB 5KS9E 1F8TL 2V5MA 3OL2A 4QWWD 3QNYA 5HDOA 2YD8A 2XNAA 3IRPX 2P45B 4PPTA 2VDRL 2KKQA 4KJWC 2EXWD 5IKCB 1D6VL 1NFDE 3UTQA 4ZFZA 5LXGL 3VXMB 2VLKE 4JKPH 4HJGB 2Y5TB 3DV4A 3QXTA 1FFOA 5FKPA 5HHME 1XR9A 5TFSL 3MRBA 3EGSB 3LEVH 4JRXB 1E28A 5DT1H 5KS9A 1S7QA 1NAMH 5I17A 1EEZB 3GK8L 1ITBB 2H3NB 3QI9D 5EZLA 4PJ8D 3I9GH 3H9SA 5F1NA 3FFDB 1S7RB 3U79A 25C8L 1UM4L 5J13C 3BYYA 4UOW1 4YH6A 5DK2B 2A73B 2LU4A 1BX2B 2ZOLB 4V1DA 3QUXB 1GPOL 1MCPH 2R29H 2IG2H 2FZ3A 1CDYA 5E1AB 3T0DA 4KJPD 4OV5A 5FGCE 5I1GL 1Q1JH 3D39B 4UV4L 4ELKA 3TV3L 4OT1H 3LN5A 3O4LB 1OY3B 3BO8B 1HQ4A 5I75B 2DLGA 4MD0B 3HRZA 2ERJC 2A6KB 2J8UB 5E2VH 2CJUH 5DQ9A 2X05A 4TPRH 1IBGL 2G2RA 4HWZB 3W0WB 2IWGA 5H2BA 2NXZD 3QJHA 5E56A 5DMIL 1SY6A 2MFNA 3P30L 1Z9OA 1IAMA 1ZT7A 2EZ0C 4JPWH 3SY0A 2EYSB 2GK2A 3RZCD 2R4SH 3FB7A 5DRZB 1GVIA 3EDDA 2X9WA 3HAEH 4KKNA 4QRSA 3EDFA 2OP4L 3D85A 5HDLA 2Q86B 1Z5LB 4ZFOB 1YECL 3P73B 1UJ3B 1L6XA 3RAJH 1DQQA 4WI8A 1OTTC 3IS0X 5H35B 3Q3GB 4UNTA 4DUXA 3QULA 3W9EA 4KZEH 3T0ED 1OPGL 1A6WL 1P7KB 4J4PA 1JRHL 4Y5XB 5HGHA 1AXSB 4KQ4L 1FLTX 3MODH 1AXIB 4Z7VA 2A83A 1O5DT 3BZDA 1T89C 5I16B 4K2UH 2AJYH 3VA2C 5FXCH 4IIQC 5BV7B 4P5MA 3GJFK 4R8WH 2VLKD 5FO8A 4PJBB 3QDMA 5FDWB 1GRWA 5ICXA 3MRFA 2FX8L 3QWRD 5HDBE 5B3JF 1DE4A 3QEHA 4MAYC 1RQ5A 3MUGB 4MA7L 1QSEB 4PRID 3TO2B 4JFOA 1TDQA 4R97B 4D3CH 4Z76A 3RI5K 3SKMA 1R0AH 3O2DA 2H26B 2R2EA 1NLBL 3SDDC 1YEHH 4CVXB 2XTJD 4DKEH 4OM0H 2ZCKL 5DMKB 1BQUA 5INCA 2Z4QB 4AMKH 5B3JE 1INQB 4JDTH 1BVLB 5IW3A 1PEZA 4U7MA 5ECJE 4BSJA 5TDOA 1Q9LB 4XPTL 5ALBH 1R5IB 3KXFE 3QDGB 4LLUA 1T20A 3CFCH 4P23B 1ZWIA 1GC1L 3CVHA 4BZ2H 3MGTA 5DJAA 4MQXC 4IEFB 3TBVA 3L1OL 3SE8L 5DRZA 4LDOB 4KUZL 3O2VH 5DJYB 3IXTB 2GJ6E 4U1KB 4PB0L 4PGJA 1N5YL 4N8VB 1EEYB 3NH7H 3RJDA 5J9PB 2CDFB 4HULB 1NKOA 2LV4A 1NC4A 1P4IH 3FHQA 3MRPA 4PRDA 3TJHC 1HCVA 4X99A 3H3PH 3SE4C 3T2NH 5CSBA 3C09C 4GOSA 4RMWA 1MCSA 1QNZL 3ARYA 4W4OA 4EUPA 2UZIH 5F9JB 4LGRB 1UCBH 4UQ2A 3D25B 1WIOA 4S2SA 4PJHE 4M48L 5KAQF 1BLNA 1WAAA 1OVZA 4GQ9L 2FL5A 4QEGA 1YEIL 4G8IA 1IQDB 2GFBB 1AFVH 2QADB 5ESVA 4OFPA 5I30H 3ZE1F 4Y88A 1DLHB 1LO4L 3L5XL 4G8GD 5CJXA 1LNUA 1MHHB 4PY7B 3G04B 4ODHL 2AEWA 3BYTA 3CFBB 4K7PL 1A7OH 3LQAH 5TE6H 4HKJB 1F00I 5F72S 3OKOB 5JNYA 4Z8FL 4M7LH 4P2RB 3V8CA 1U6AL 4R26H 3LD8B 2CR3A 4XPTH 3EJZC 3NFSL 5CD5C 1ITCA 5JR1H 3W5MA 4XNMB 1YEKH 5EU5B 1EBPA 4NO5B 1FZMA 3ALPA 3TIEB 3QDHA 3W0WE 2IF7A 5F6IB 3SO3B 5HYSA 2J8UE 5EUKB 2AKRA 3RWEA 3SO5A 2E8ZA 2AEPL 2HFGH 3WIFA 5BCAA 3WO4C 1QFWI 2XZQH 1FZOB 3KPMB 3GSWA 3BIBX 1UM6H 4NFDA 3QDME 3AROA 4IDJH 4R0LA 1KIQB 4TTDC 4Y19A 3QEQE 1P1ZB 1AR1D 3MV9A 4XZUA 1E4JA 1Q38A 5E08H 5GS1C 1FO0A 1JNHA 1U8LB 1PZ5B 1KT2A 5GRZA 3DYMA 4KV5F 4JFZL 1RIVL 4XRCB 1D5IL 3MROA 1F4AA 1GXEA 1UH2A 3AB0B 5C70A 2DJSA 4XCFH 5CSGA 5HYIA 5JIPA 5BV7H 5MI0B 2J6EL 5HYQB 1Y6NR 4WW1A 3BPOB 3OB8A 3KGRA 2DM7A 4ODUA 4BQ9A 5LQBL 2NLJB 3WKMH 3GMMB 1UWEH 1VFAA 3KYMA 1P4LB 2W65A 2B1HL 4OCXL 3SHSA 5I73C 3IRZA 4K3DL 4YHYB 2XA8L 1WSST 2X4OA 4WO4A 1JMXA 2VC2H 4YX2L 1W0WB 1UXWA 1FORL 4HIEB 1HKLL 3VFVB 5E24E 4KROB 4DGIH 2F8OA 1I7UA 4A6YB 1YMMD 4N90E 1I7ZB 4OLZL 3RP1A 3RY5A 1J8HD 1FN4A 5D1XC 3DBXB 2D0FA 3PWUA 3OZ9H 5BQ7A 2X1WL 1KBGL 3MRDA 1XCQB 2GJZA 1RUMH 4E42A 1GGIH 2P7TA 1CLCA 5IMLA 2IANB 5D2LA 5GJTL 5I1EL 2YUZA 1X5LA 4HT1H 4WFGD 2I9TA 2XXCB 4LEOA 3VXUE 1GHFL 1HNFA 5EBGA 3DMMB 4ODXB 2CRIA 3K1KC 3B8YA 1DVFB 3NCYP 5EWIL 4HBQA 1N7ML 3CFEB 3WHXA 3ET9F 5JPNA 3P9MA 4PJXE 5J0BA 3S98A 2DLIA 5EUOB 5DJDB 4KGLA 3NCMA 3F5WB 3JV4A 5B3NA 2JK5B 2Y07H 5F9JA 5T1DH 1MI5A 3BP7A 5DA0B 2HVKA 5EC2B 3NFPA 2KZWA 1JTOA 2FEEL 3C5ZB 3Q6FB 2VIRA 5DD6A 1J1PH 2WWMC 1BFSA 3WFDH 4LRIA 3B9KB 2B4CC 1WCQA 1CFQB 2ITDB 3MLUH 2BVOB 5KZCB 4XNYH 2R9HC 1L7TH 4OCRH 4PLJD 4RSVA 1AI1H 4OGAD 3QDAA 4HKZA 4PJEB 1DN0A 4ISVA 1PQZB 2Z91A 3CFBA 4KMLB 3WSQL 1KXTB 3SCMD 3I3BA 3ARGC 3PQYE 3FFCE 3HUJE 2AV7A 4GH7B 1I1YA 1QO3B 1A2YB 5DSCB 2KDGA 3OJDB 5K93A 3ZL4H 5JXAH 5CP7B 1MJJA 2W0LA 3NZ8B 1ES0B 4YC2B 3UJTH 3QFJA 5EUOF 1OAYH 1WC7B 4GS7B 3WLWD 2A83B 3MFGB 4KQ3H 1RI8A 3SDAC 2VAAB 2Y06H 1VSCA 1BFVL 4IOIB 4PS4L 2GKIA 4P5TB 1UJTA 4Y1AE 3L3OA 3MR9B 1TZHB 4Y16B 3RUGB 1L4IA 4FFWD 4NQEB 2Q86A 5CUSL 4LSVL 1XH3A 5F7EH 5T1MB 5T3XH 1RULH 1A9BB 1CXIA 3EOAA 4X4ZA 1U42A 4G43A 4L29A 4JJHA 1TTGA 3HI6H 3VG0L 2EC8A 3MV9B 5C0GB 4LHJB 2HTKD 3S4SA 2AJ3A 3T65B 1N4XL 3K0WA 1K6QL 3S35L 1MJ7H 3NCJL 3R06A 3T2QA 1OP3H 5TE7H 4PJ8C 2FEDC 1J5OL 5A1AA 2NW2B 4LCIH 3S34L 1HSBB 1F02I 3UROR 1D5MB 2UY7A 1C12A 4HPYH 4JM2B 5BMFL 3RRQA 4Y4HB 1KJVB 4G7VH 1MPAH 3QPQC 4H8WL 4D0CA 1CFVH 1U8OA 2Y5EA 3BJ91 2ADFH 1AGBA 2YSSB 4IHOA 4NZJA 1FLRL 1E28B 4L9LC 5KSAB 1KLGA 1FORH 2EDTA 1KLFA 5T3ZH 1N59B 4UAOB 1ZTXH 2WUBH 1EHAA 3S96B 2D9CA 1I9RH 5FYJL 1DEEB 1CD9B 1SVCP 4OZHF 4XPHH 3QG7L 5BQ7B 4M4PA 2EDNA 3QUXC 4NN7C 1TITA 1UACL 4XZUB 4ODWB 1P2CB 3EOTH 5C08D 1QFOA 1FYTA 1UJ3C 4UDUA 4G8IB 4WY7L 1N7MH 2K9UA 1RZGA 4JFPA 4CW1B 1MEXL 1CN4A 1EJOL 1JF5A 3OAUL 4KTEH 3KLSA 3BKML 5E6ID 3W9DB 2A2QT 4MA3A 5EIQA 5HHXH 32C2A 5C07D 4JFEA 1UVQB 4FQQB 4AM0A 1CDJA 4NUJB 3TFKC 4RNRA 3FTGB 2R4RH 2BY3A 1CU4L 5ANME 3ULUF 3DLQR 3RVUC 4MXVF 2PTTB 4HUXA 2EYRA 4U1LB 3RGVA 3SKUD 3T3MF 2APVA 3QUZB 5HI4D 1UQSA 3K81A 5IESL 3T1FB 4ONFH 5D70H 2ADFL 2IPUG 5KVGH 3OAZK 3UTOA 2WUCH 3FT4B 4IOFC 4OD1H 1SBSH 5D5MA 5FOJA 2BNRE 3WFHA 2A6JA 5AD0B 4ALAL 4MHHG 2D4FA 2I07A 2X4TB 3E8UL 1QA9A 4NFBA 2FJGB 1EV2E 1PSKH 3FO2A 4UB0H 5K9JL 4O00A 3FQNB 2H32A 2QR0B 3MXVL 3IVKB 2BNQA 3T8XB 3U1SL 5ETUA 5IJKA 2BSSB 4G9FE 3P0VH 4EUPB 1S5IH 4O4YH 4ODHH 4FTVD 4U33A 4X5XB 5AZ2H 1JNNH 3WNNA 3OXSA 4PJCF 2NY6D 4G5ZH 3PE9A 4NC0B 4LQ1A 5DYOB 4Z8FH 2AV1A 3BKJL 1I9IL 1UADC 3PGDB 3ARFB 1T3FB 4M43H 3U6RB 3S88L 4JFDD 3UXFA 3VFNA 4Q6IA 3WNPA 4RFNC 1LILA 3KPMA 1CLYH 3HI5H 4ONGL 1YPZA 3CGTA 3DSFH 1QSVA 4FQCH 4UNVA 2WWMD 2EIZA 3TEUA 4XPAL 4LHUB 5D96C 1CBVL 4KHTL 4WFHE 3T0XA 1BBDH 5C0AE 1M05A 1NGYB 1U95A 1WZMA 1WT5C 2BMKB 2OK0H 3L9RB 5TQ0H 2HMID 4RGNB 4E41E 3FQXA 1T7VA 5HGDA 1FIGL 4YHPB 1NFKA 2IFFH 1PD6A 1CK0L 4RMUA 3B2UC 1YPZE 1P4IL 1AXTH 3QQ3A 4U05A 1AGBB 3DHJA 4IHOB 1M6OB 4R7NA 3VXME 4E9LA 5I1CH 2AJUL 4WI5A 3GIZL 4D9QD 4ZTPL 1QSZA 4UQ3B 4DN3L 4ELME 1YYML 3LEXA 4OIBA 1XF5A 4GFTB 2Q87A 1A6UL 2BOBA 4N5UA 4N9OB 2EDYA 3CX5J 3MLZH 1UB5A 3QEUA 5E6YA 1QPPA 4WGWB 4YAQB 5FYKL 5J1AA 2ZUSA 4OD3H 4O5LH 1QO3A 3K3QA 4NRYA 4S1SH 3OXRB 2PXYC 5TDNB 4MA7H 2Q6WA 2ARWA 1RUKL 4XCYA 5KN5B 4ODWA 3LKNA 5DJ6A 2YXFA 3CFKB 3QFJB 5E2TH 2X42A 4GKSA 4D2NA 3O3DA 5C9JA 3BD5A 3VXPA 5DUML 1CLZL 5IB4B 1VFOA 5GGVY 1JF1B 1IKFL 3V5KA 3HI1B 4IRJA 2P46B 5CJBA 2EDKA 3S4SB 1E4KC 1FFQA 3GMOA 3BP5A 1MWAB 3BN3B 4FG6D 3SE8H 1TQBC 4FQIH 3OPZL 2VL4A 5F8RC 3D0VB 2WAHA 2BNUA 3NN8B 1MHPH 1F6FB 2ICEA 3WIIH 2G9HB 6CGTA 5IKCA 2J8UA 4P46B 1C12B 4JM2A 3UJIH 3BEVA 3BHBB 2WINA 1VPOH 1I7TB 2I5YL 4G8FA 4G9DB 2J5LC 3RKDC 4F7PB 2HJFA 1SBBA 4X9GA 5HVWA 4BK4A 2EYSA 4U0RB 3SKJH 5E99H 1FJ1B 3QWOB 4HKZB 5I17B 4ZTPH 3B4NA 4YZFF 5GQBA 1U58B 3TN0C 3P9LA 4U6XA 4XXDA 3X12A 5TH2A 1B2WL 3OMZA 1XR9B 3MTRA 2YA0A 3EOAB 4XWOC 3VA6A 1YY9D 4CMHC 5FYKH 4TRPH 5I66A 1AIFB 4CGTA 3LS4L 3UTQB 4ERSL 5HHPB 2AXFA 2IG2L 5MI0C 3TN0D 3N85H 4DWHA 3MRQA 4KJQC 1U8QB 3CSYA 1B0RA 1DQML 1MF2H 4OV5B 4L4VB 1G0DA 4DK3A 3MBED 4E0RA 2W65B 2WSKA 4XWGL 5CEYA 5KVEH 1W8NA 5F9OH 4KTDL 5FK9A 5D2NE 5ERWA 4Y16D 1F97A 5AWNH 3VFNB 4Q58C 1OAQL 2IADB 4BH7A 5JXED 3VFSA 1ZHKB 1CTOA 2R23A 4Z76B 1XGYL 1P5UA 4PLKC 2JELH 5BRZB 4PJXB 4CVZB 4ELMA 4L1DA 2VH5H 2N56A 4GAJL 5JW3L 1WFOA 4JKPL 5EBMB 3QRGL 5LBSL 3FCTA 4PJDE 3LN4B 3BQUC 3O6FB 4JPKL 2CDEA 5I1CL 3CMOH 5B4MD 4LAQL 5IOPA 3FT2A 2HFEA 3R1GL 4M7LT 3B2VH 2NY6B 2A6JB 4GT7A 1D9KC 4JZJC 2BSSA 4P49A 4DUWA 4LFHG 5CIPB 3F5WA 3JV4B 1YYLH 2M1KA 4ZG1A 3EUUA 2Q3ZA 3MJGX 1A7NL 4OTXH 1DVFD 4F7MB 1IM9B 1IKNA 2EKSB 4YDKL 1HSAB 3GNMH 4I9WD 2AQ2A 2LTQB 4NNYB 3VRIB 5T5FH 2VB5A 4HLZG 3C60A 1LDPL 4JN1H 1Z5LA 5CILL 5IHLB 2HYMA 1U93A 5IR1B 2EDBA 1MJ8L 1X5YA 4OCYH 3RWIB 1MAJA 2W91A 2YD3A 4LDLB 4Q6YA 4XP5H 4AH2B 2YA1A 1FIEA 3QUYD 3WNKA 1KCVL 5CZXC 3QCVL 3F6LA 3L7EA 2GUOB 1N5AB 4LSRH 1JPST 4K7FA 3FO9B 5CINL 5FUOH 2GI7A 2A6DB 5CEZL 2GJ6A 1DSFH 3TH3T 1QUNA 2VNCA 3FB5A 4YHMH 1V8HA 5GSRB 3IGAB 3C5SB 1OP5K 2VQUA 4APQC 4FQ1L 1U8OB 5DFWH 2HMIC 1I8MA 1V7NL 3MBXH 2DS4A 2R1WA 4BQ6A 4P4RB 1Q9LA 1LO0H 1XR8A 3QFDB 5CGMA 1X7QA 2L0DA 2NY5H 4R96A 5GS3A 3MJ8A 4BKLA 1G6RH 1FNAA 1EPFA 5IMKA 2VR9A 1S7VA 5J6GA 4HBCL 2OSLA 3H0TB 5EZOH 1OAZH 5DD1L 1EEZA 4Z7UF 4XTRC 5F1IA 2YUWA 1MIML 3WL9A 4W4NA 2QL1A 5HGBA 1GYAA 2R0WL 1MFEH 4TSCL 1R3JB 4EUPH 4X7DC 3TBVB 4I2XB 1I1AB 4KU1A 4PJBA 1IVLA 1JZ7A 2NY7H 3S36H 3VU2A 5DVOA 2DWEB 3GO1H 4PRIA 3MGOB 4C56E 4R2GC 3IFNH 4WEUD 2IAMD 3CLEH 3MV7B 4YO0A 1HKFA 4LCIL 4BA8A 1AI1L 3HNSH 4YPGA 1VCAA 1KG0B 2NZ9D 4HKBA 4DKEL 3JV6A 4DW2H 4YJZL 1T0MA 1H3WM 4E41B 3OB0H 2CXKA 1AKJA 1REIA 1DR9A 5C6TH 5GS0H 4MJID 4MNQB 1T04B 1F5WA 1K2DB 4WJ5A 2WZPD 1JZ4A 3MRJA 4PY8J 4OFVA 1LD9B 5E5MA 2XZCL 2FHBA 2WBJD 1A7RL 4X0KA 1FRGH 4Z95H 3ZLQC 3TBWB 1F3DJ 4OSUH 2ATPA 1M6OA 4R7NB 4DAGL 3MA7B 3P0VL 3FO1B 3EJJX 4R97C 5LBSH 3V5KB 4JREB 3D0LB 3CFIC 3ES6A 3BN9D 4G9DA 1EK3A 2B0SH 2CLZA 4BFIA 1CL7I 3QUZC 2BMKA 4WWID 1MJUL 1XMWA 1YN6A 1V3MA 1DDHA 3E3QE 4N0CC 4PJ5A 5D7LE 4M5YH 2X4UA 3CVHL 3M07A 4OF8A 1R24A 1CDIA 3L3IA 4JFHD 1NCNA 4DN4L 1QBLH 3NCBB 1JZ2A 3FQTB 3QISA 4J3OC 1T3FA 3EYUL 4ZQKB 3BGMA 2HRPH 3LS4H 4ERSH 2DBLL 1UWEL 3HNSL 3VRJA 4TN9A 4XRCA 5HHOA 1IE5A 4IRSB 1HQRB 5B21A 2P48B 4PFEA 2FCBA 3SE9H 5JORA 1QR4A 5AYUH 4OB5L 5JHDD 1AC0A 1LWRA 3CUPA 4X7TA 4DGVH 1FZJB 4TTGA 1J8HB 5HDQH 1KV3A 1CICD 2VYRE 4M03A 4XVUD 3PWVA 4FTVE 3TFKD 1N6UA 2VQ1A 1J1XL 2FIKB 1DUZA 1UB6A 2P5EA 3C6LC 5D7SH 4ZUWA 3BGFC 4DEPC 1TETL 3MOAH 5E5RB 1ZVSA 4NIKB 1XF3A 1G7PA 2P8PB 1LDSA 4FQHA 5C0CB 3UO1L 1JGUH 2HP4A 3WNOA 5DRXB 2WQRA 3IAPA 5JOEA 4TYUA 3HS0B 2ERJB 3ZMRA 3SE3A 3MRFB 2VLLA 15C8L 4FMKA 4YGVB 2UZYB 2RFXA 2YEZB 2R1XB 2PYEA 4N1CA 3LPFA 4LSTH 4P2OD 2IBBA 4LLVB 4GAGH 4M9PA 2OJZL 4AH2A 1NANH 1T6VN 3IDIA 1IQWL 5FYKE 3O9WA 4RISH 4UU9B 4WV1B 4L8SA 5ESVB 5BS0B 4JHAL 3AXLB 1QSFD 1AGCB 1P84J 3TPKA 3IDMB 2ZCHH 4PRIB 5HY9B 2HH0H 2DIBA 4EDWH 1JPTH 1A14H 4JGJA 1DUYB 5F3BB 2EE6A 4QXTB 3O6KH 5HD8C 3WFCH 4KPHH 4KAQL 1R3KB 4E41A 3HC4H 4P57B 3B5HA 3QYCA 4YX2H 5JORB 3RI5F 2Z31D 2WBWB 2AK4A 4XB7A 4X4ME 4NCC1 5EO0A 3UZVB 1MFAL 2BVQB 3O8XB 1PGRB 3LN4A 2CMRL 4NWUL 2MPAL 1TQCC 4Y2OA 4K9EL 3QWQB 4OZGB 2VXVL 4PGBB 4KK6C 1RZIA 4PJGF 5DRNA 4ZFGH 2EH8L 4UIKH 3BIAX 5DRWA 5IMMB 5T33L 1ZHBB 1FPTL 3QXDB 3ILPB 5DJZB 5MEQA 1IRAY 4Q97A 5HHNA 5IEKA 1WEJL 3WJJC 4L3EB 4YEEA 1AR2A 2DB8A 3U0TA 1G6RL 2DTMH 5ESQA 1NL0H 3Q6GH 4APQD 2P8MB 2CLRA 3RUGF 1KLUB 1BZ7A 2AJSL 2NY3C 4KROC 4MSWB 4NQDA 1CLYL 3HI5L 3MGOA 3GJEA 3DX6A 4OUUB 1KTLA 1FAIL 1IEHA 1XGUB 2PR4H 4DN4H 3L3KA 3RL2B 4FXKA 4L5FL 1BGXL 5I8EB 5J3HC 3VXUA 2E7LA 4RQQA 5GS2H 4O2EA 4LF3B 5HYFA 4DTGH 2O5XH 4PJAF 4I0PD 1B0GA 3PL6D 2R1YA 4L8BA 35C8L 1A14L 5I1LA 2CUMA 4Y2DA 3QEQA 5GGRA 3GMQB 1BEYH 3U9UA 3ELAT 4P2QA 1OPGH 3H42L 4OLUL 4JFFB 1IAII 3SDDB 3P4NB 3BJLA 4LP4A 3VD9A 1SYVB 1IEAB 3TVMA 4P4RA 1MLBB 3OKNB 4MMXC 1U8HA 1HSBA 4X7CC 3TJEL 1TJIL 4XVTH 5E8DH 1PG7L 5HI3D 4I9WE 4F9LC 1HKLH 4UV7L 2NXYD 2Q76B 3WMSA 4PJ7F 1K3ZA 3V6BR 3S96A 5JPMB 4MDIB 3D3VA 1RUQL 1MCPL 1HWHB 1IM3A 4JZOA 1M4KA 3EYVA 3NACL 3REVB 4XHQA 5I15L 4QXGH 2MQ0A 3F62A 3QXDA 1DN2A 1KELH 4KVCL 5FHBH 1RUAL 4R9HA 1G7IB 3PHQB 5CJOH 4EI5D 1NAMA 4JEGB 1ORQB 3OAYK 4U3XA 5JW5B 1U3JA 3LN9A 4NQEA 1CGSH 3T0VA 3WIHH 3BQUB 4NOBA 4B50A 2P47B 4E5XB 1HZHL 1PW3A 3FQNA 3QPXL 4TNVK 1H5BB 4GRWH 5C71A 2NYYC 1A6VH 4FFZH 4NKOB 3C9NB 3KPRA 2YUXA 1IC1A 4TVSa 1H3GA 1YEKL 2DQDH 2EDHA 1IQWH 4NKIL 2NCMA 1MFDL 1DQTA 1NBZB 4Y5VB 3STLB 3G6JE 2R4RL 3UTTD 2HFFB 1QRNB 5IFJA 1NCAL 4X6FB 1N3NB 2BY0A 4CN1A 4P48A 4I3GA 35C8H 2E8YA 5D9SB 5K33A 1JPSL 4NKMB 1DN0B 4ISVB 4J4PD 2XA8H 1KCRL 1RHHA 1RVFH 1KB5L 2FO4B 3RWCA 2WUCL 1PDKA 5HI3C 4PRBA 4K3EL 4U1IB 2XQBL 5CGTA 4M6NH 5C08A 4HJGA 3AFLA 1R5IA 2Q20A 3QIWD 4NKQB 4TULH 3Q48A 4WJ5B 3QT2A 4P2YA 4XPHL 4UIKL 3AS2A 3PABA 3PWNA 5IW6A 4C56A 2ITCA 4XPGH 1OARH 4HK3N 1D6EA 4WU5A 4FN0A 3QIWC 1NL0L 1PLGH 1RU9L 1G9NL 4X6CF 5AAWA 4O51A 4UUJB 5B8CB 4WUKH 4WCYH 3O8XC 3DMMD 1VFMA 5F7MC 4ZFOA 1XF4B 5DMGD 2RHEA 2VISA 1T22B 1FL5B 4G8GA 3UC0L 3QA3B 1F8TH 4FQCL 4LCCC 4P3CH 1CFNA 4ETQA 5GRJL 5SV3A 3L3HA 1PQZA 2Z91B 2LU3A 3FN0L 1T7ZA 1RFDH 3OAZH 5GPRA 3SKOB 1MRCL 3GHBH 3DETC 4MQXD 4KHTH 2HKHH 4EUPG 2I9LB 2EXYD 2F5BH 2G2RB 1V3KA 3BDXA 3T2OA 5CBAA 1E4XL 1K8IA 4BM7A 2XICA 2B0SL 3QDGA 1KCLA 1H3XA 5EOTB 3CMGA 5DEGB 4WWKC 2HVJA 1HEZA 1MVUA 3U4BL 4WUUA 1G7MB 3KR3H 4HH9B 4HBCH 3CVHH 1CGVA 4L8DA 5GGUA 3C87A 3HZKA 2ADIB 1JHLL 1HHKA 2BNUB 3NN8A 3F7RA 4Y4KC 3PDDA 4KK6D 1N2RA 1MFAH 4JQXA 3HMWH 2A0LD 4NN6C 1ZHLA 1FFOB 4ZSOB 3GBLA 1I3UA 5IJVA 4ZUTA 5HD8D 3MYJA 5GIRB 4ENED 1NUDA 2VDOH 3D39D 2DQHH 4KK9C 2Y06L 3MRMA 2YRLA 1CIUA 2FHFA 5CZKA 1UACH 3BXNB 2HN7B 1WWAX 2EDDA 4IS6B 4YHPA 4DW2L 4LOUD 5DJ6