4Z7WA

T316 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
total genus 34
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wA01
3W9DB 3T0EC 5CUSH 4MQSB 1JGEB 4HS3A 3IDJB 1LDPH 1IT9L 3V5KA 3DX8A 3TF7C 3KYOB 5HD8C 2DM3A 1MCWM 3Q3GA 2FX7L 1CFSA 3PQYB 4Z95H 3QXAB 4FFWC 3C5ZC 4LLUA 1J7VR 1UH4A 5D7IB 2C5DC 3IXTA 1FFQA 1DR9A 4HUUB 4ZTPL 5DF0A 4AEFA 2Z35B 1V7ML 5DQ9A 4U1SA 3MV7A 1JNLL 2A74B 4Z7WB 2Q3AA 4HC1H 1AGDA 3AXLB 1IEAA 5DC0A 5TE6H 1BECA 2A73B 2WBJD 4YXKH 1HHJB 2YRLA 2NXZD 4LLYB 4U31A 5CJQL 2J3SA 3EDFA 1NAMH 5J9PB 2NYYD 4LLMA 2CDEA 1G7QA 1I3UA 3PGFL 5D2NC 4LFHD 1FNGB 3H3PL 4R26H 3UJIL 3LD8B 4K3JL 3IDYB 1IC4H 4RRPG 3HG1B 4QTIL 2DQUL 3FQWB 3I84A 5DJXB 3MRRA 5IHBA 5F9DC 3KYMB 4BSJA 2DTMH 3EBAA 2UZIL 5SWQA 1MUJB 2IH3A 5INCA 4FMFA 4OZHA 4MCZB 4PJ8D 5EU6A 1EVUA 2X4QA 3VRIA 4MVBD 3WXVH 1EAPA 3NPSC 3KLHD 3OR7B 3WXWL 3WHE0 4Y4FC 3E6FA 1N0XH 3AY4C 3MBEA 2H9GA 3EFFA 5KAQG 2FX9L 2DLFL 2A1WH 3LS5L 6FABL 1EFQA 1JNHB 1JPST 3O2VL 4WEMB 5CINL 4ZXBB 3BX7C 4RMSA 5L8LB 3KYKL 2QQQA 1I4FB 3KYAA 4HG4J 1J0IA 2H26A 1MAKA 4XGZA 2HN7A 1MRDH 3MBEC 1HXYB 1HEZA 3EOYG 1P69B 3G6JB 2LU3A 1NUGA 4RAUA 5KVEH 1EFXD 4XP6H 2EDTA 1I7TB 2DN7A 2FGWH 3IRZA 4M1GL 5HGBB 5JW3L 3DTXA 1DZBA 5DRNB 4JRXE 3VFVB 1LQSR 5GSRA 2BDNH 4OM0L 4OCYL 4ZODA 3PHSA 1GOGA 4YZFE 3UTTA 1ZAGA 3C5ZB 4QXGH 3MLSH 1JUFA 1B4JL 3PDDA 3DUUB 3T0AA 5IQ9B 3QHFL 4FQHA 4LEXH 2KL6A 3IRPX 4RFNC 3GSQB 3U2SA 1ORQB 2FEDC 3D0LB 3DARA 3HI5H 1N5AB 1U9KA 4JKKA 4S11A 3P4OA 3CH1B 1JGLL 4GBXB 2J8UB 3QQ3A 3THMH 1CD9B 1C5CL 1CFTA 2DQJH 5CBAB 4AYFA 1KEMH 2XN9A 2NQCA 1OGAA 1NC2D 2DYPD 4WWKA 3ROLB 4G3YL 5GRUH 3L3GB 3QFJA 4OTXL 4EDWL 2YXFA 4LLQA 5KVDH 2FECL 1N64H 3L3HB 4P2OD 4JZNA 4OZHE 4QTIH 3WHXA 4QYOB 4X6DB 2C4FU 3M8OL 4Z7WE 1RUPL 3DUSB 1L4IA 1SMAA 4RDQG 1TENA 4J8RB 3CXHK 4K71B 1MF2H 1K2DA 3ZSSA 4P4RA 3GMLB 3KWWB 2C4XA 4R2GB 3SDAA 4HUVB 4O02H 2DTSA 1AI1L 3W81A 2QQKH 5T1MA 3U7WH 5IVXB 3D3VE 4PUBH 2BNRB 3FTGA 1A9EA 5HHNA 1F58L 1IGIL 1EJOH 2EEAA 3SDCA 1I3VA 2ITCB 2D7NA 3HC0A 3L5IA 3OAYK 2LVEA 5T1DL 3PP4L 5I8KL 4JFFB 5AZ2L 3RPIA 5CLWA 2GI7A 4XCCH 5H37H 4K71C 2N7AA 3U46B 5CJQH 2WNGA 4W6XB 1A7QH 4QXTB 2GJ6E 2Z93A 3S88H 4OI7A 2YBRA 4BH7B 4F58L 2FL5B 4I3SH 4QHNA 2O5ZH 1B0RA 5E99L 4LSTH 1AGBB 4PRDB 2VZ3A 1EHLL 3UAJC 4WI6A 3VFMA 4TUKH 1MI5B 3S4SB 2BC4A 2HWZL 2YHGA 5DK2A 3FMGL 5J1AA 3VA2C 1FDLL 5IT2H 4PTTB 3ZSTA 3WDIA 4H0GA 3MV11 3O6FC 1GZPB 2V9TA 3SOBH 5L8JB 1CN4A 4ZUUB 2EDRA 2K7QA 1LO5B 5DMJB 1OCWL 2VDMH 3TH3T 5B38G 3F7VA 3BMVA 1A14L 5EZIL 4ZYKB 2GCYA 3VG0L 5IBTH 3BAEL 3GSQA 4JFFD 3U2SB 3H0TA 5BCAA 3R06B 1PYWA 4JFDE 4R96B 4WFGD 5KS9E 3HE7C 3NAAL 4N0UB 2EDEA 1K9TA 2EO9A 1CFVL 4JVPA 4GRWE 4OLVL 4D0BA 1U6AL 4F3FA 5T3ZL 2I9LB 3KS0J 3TV3H 3C5SB 1XGRB 2X4SB 4FQIL 4FZEH 1IJ9A 1SM3L 2VJXA 2OL3A 2OK0H 3A6BH 4KWUA 1FGVH 3ULUD 4CMMA 3CXDL 2UYLA 3W2DL 4LQFH 1I8IB 1KB5A 2D0GA 4GRLC 4MJIB 5JHDB 4QGTA 3UDWC 2HT3C 4JZJB 5L88H 1AQDA 3CFDB 2NXYD 1S7UB 2NXZC 4PJEB 1DLHB 1IEBB 1MCWW 2E27H 3TO4A 2IADA 4AIXA 5DJAB 3GO1L 4NC2B 1IAKB 1E6OL 3TZVA 1F6AB 1WCQA 3QIUC 1UWGL 4M5YH 5HGGS 3DO7A 1CZ8L 1J8HE 1NLDH 4Y1AE 3LH2H 2GFBB 4JO2L 2R2BB 3VXUD 5CEZD 2X10A 4QRUA 2W91A 3ABZA 3QI9C 3ARGC 1G0YR 3UC0L 4HHAB 1H3PH 2WBWB 3SKUD 1J5OL 1RJLB 5C3LD 2B1HL 1PSKL 1WZ1H 5I1IH 4PGEA 4LCWE 5JUEL 2XNAA 3O3BB 3PWVB 1LEGA 4ZTOH 1KXQE 1UXWA 3TP4A 4F37K 3BPCB 2X70A 2A0LC 4OM0H 1H3UA 3H9HB 2XG4A 5F6IB 4OD1H 3HC3H 3L3IB 1JF5A 5KANI 1FGNL 1ZHLB 5C0FB 1X6NA 4M93C 1W0WB 3DX7B 4Y2DA 1QFUH 1G6VK 1F42A 1F90L 1T89A 3FRPA 2CLVA 1YYLH 3VFSA 5GISH 4EJ1C 2FZ3B 3CK0H 3FQXA 3WEXB 4P99A 2V2TA 4YDVB 1NGQH 4YIQB 2A9NH 3F58L 4KJQC 5I74B 4ISVB 4KK8D 1MY7A 4Q6YA 4F33B 5IQ7L 3WSQL 2GITA 3W82A 4Y5XB 4P2YA 5AZEH 1O0VA 3RTQC 3IDUA 4PJCF 4KTDH 4Y19D 2UZIH 5JIPA 3F7VB 3MQIA 4OV6F 4QNPE 1KEGL 5D1XB 3KYNB 1MCSA 4HLZH 4BQBA 4WY7L 2OMNA 1MCQA 5GHWL 5DYOB 5CGYC 2VZOA 4QRTA 3FOLA 2VC2H 4D2NA 3V0VB 1TQCB 3ZE0E 1F45A 4HUUA 3MRLA 4YNYA 4I1NB 5C86A 4HH8A 4MNQD 1UKTA 1NAKL 4H88L 2FX7H 4PP2B 2DQDL 1G9NL 2UYLB 1S9XA 1IGCH 1R3IL 4HJJH 4C83A 4OCNC 1OARH 4I2XE 5D7JD 5DFWH 1XF2B 3BIKB 5TPWH 5F7DB 1KB5L 3T1FB 4TNVF 3TCXA 3GSNH 5F7FA 3GK8H 4R4FH 1DBBH 4XI5C 2NY0B 3PWUA 5E8NA 2PYEA 4R4NC 4YHIA 1NGPH 4MB3A 3NCJH 3ULVL 3QFDA 2YD2A 5KSBB 4RFEB 3E1F1 2ZP0T 5GS0L 1NLBL 1KBGH 4Z5RB 4WW2C 4OGAC 4OF6A 3QG6A 4JM2F 1EO8H 2F19H 3LVEA 4JFQB 4WFED 5GJTH 1J8HD 4DN4L 4M61A 4JY6B 3TN0C 4PD4K 3MRMB 4XNQB 4HEPG 2HMIC 2IPTH 2N4IA 3PHOB 1FL3A 2D7PA 3W39B 2AJSL 3FT3B 4WHCA 1D5ZA 1F5WA 5D7KE 1KCUH 5TE7H 4DFHA 3AMKA 3QFJD 3BE1H 1YECL 2H2PD 1A6WH 5KOVC 4JM4H 2APWA 4ZPVA 4KQ3H 5KANG 5JW4Q 5GGRY 3I6GA 4ELKA 3MO1A 2VLJE 2CDEB 1KSRA 3LS4L 3WV0A 4N5ED 2VLJD 3EZJB 1FC2D 4FFYH 3U0PA 1YMMB 3QZWG 4OZFB 4YDVA 2K7PA 4UNTA 1KXTB 4LSVH 4N8CL 5EFIA 4FFZL 3MYZA 1QP1A 4CGTA 2D3VA 1ZSDA 1CIDA 3STZB 4YHNA 4IIQB 4ELMF 1I7UA 4Q2ZB 2F74A 2NCMA 2OJEA 5CMAB 1Q38A 1A22B 3FRUA 3T09A 2H3NA 5J6GA 3IGAA 3KPRB 2Q76B 2EDOA 1EIBA 1MJ7L 1LE9B 2EYSA 1IGFL 2APFA 1KT2A 1AE6H 3DWTA 3QXWA 2APTA 4M43H 1KIRB 1J1OH 3SGKC 4JFXA 3RNKA 4FQLH 3K8LA 2PW2A 5IVZA 1YEHH 4PGCA 1KJ3H 3QWOB 5CBAA 2UV3A 2P5WE 1UCTA 4MA7H 3T3MF 3OB0H 3I75B 3L1OH 5J06A 3MRIA 3ZDYE 4ONFL 5CBEB 2KKQA 3MGOB 1RJYB 3EHBD 4XH2A 3O6MH 4XWOD 4I9WD 5C9JB 2BNUB 3FN0H 4N1HB 4X9BA 2VWEC 1ZLVK 3RNQB 2VDLL 4WUUD 3MREB 4IRZH 4Z7OE 1LO4H 3ARFB 2AJXL 4ZSOE 2G60H 3BPLC 5BOZG 5DSCB 1U8PA 5GGRB 3NFSH 3PWNA 1N2RA 3EO0A 4PJBB 4YHIB 5MENA 4RFEA 2BOCB 3CLEH 5HYFA 2XWTA 2MQCA 4NKIH 4LP5A 2DQEL 3B8YA 1UH3A 1WC7B 4HUXA 3SN6N 5C07B 4MJID 4P48A 4GW5B 1MF2L 4ZXBD 4JB9H 2VR4A 3SKOA 1KC5H 3OSKA 5JPMB 4CADB 4AIZB 3WMSA 5E2UL 1NC4B 3MRMA 4XX1E 4M7KH 3HI1A 4JO1L 4HPYL 4WDIB 4OCSH 2FD6L 5E4EC 5GXBB 4FQ2H 2AABH 5E4IA 1D5ZB 1T1YA 4MAUL 4YAQA 2OZ4L 1MWAH 2ESVE 5D5MB 3N50A 2C3GA 4KROC 4G8GB 3JWOC 4OD1L 3O3EA 4Q6IA 1XEDA 3HE6A 4X9HA 4EUPA 3ARGA 1MEXL 3RVTD 1RZ8B 2HKFL 2AJ3B 1YEIL 1QFOA 4O5LH 4OFVA 2JJWA 2X9YA 4UDUB 4OUUA 3U1SL 4HWBH 3UPCA 4D8PA 3DJ9A 4HIIA 4XP6L 1CICC 5KZCB 4N9GB 4I18A 5KVMC 2YZ1A 4IHOB 2EIZB 1H3PL 5I8OH 2DJ4A 5DFVC 4M62H 1IRAY 3ORJA 3TBWA 1NAMB 4EI6A 3UYOD 2Q8BL 1X5ZA 3ZE1E 1UZ8B 4UILL 1NLDL 4GS7C 5CZVH 2OX5A 5DRXA 1KT2B 3GKZA 3TJEL 4PJ9C 1VGKB 5E24E 5I8CB 1OAXH 4Y4KC 4QHKI 2MCPH 4JM2C 2XZZA 5BZWA 2HYMA 4QXTA 1X4ZA 2EH8H 4YFDB 5F7MC 1PZUB 1XGRA 3F7QA 4BH7A 1B0GB 2X4PB 2VXSL 2OR9L 4PJXE 1ROWA 5EZLA 2WP3O 3DUHA 4Y2DD 2GYSA 5EIVA 5D1QB 1GPOH 4PJ5A 1I8IA 4LCYA 1XIWD 1Q94B 3LEVL 5DC4B 5AAWA 4NQCE 4F80A 3L95B 4GLRH 3RA7H 4I0PB 3NA9L 3PL6A 3U7YL 1LO2L 1NCUA 3UJTH 2ICWA 2CH8A 4JO3L 3D69B 3DHMA 1VFMA 1QNZL 3VWJD 2P5EA 2E6QA 4DKDC 4LNRA 3VFNA 2JK5A 3O8XD 5DK0B 1UEYA 3RRQA 4JHWH 3OPZH 1NDMA 1H5BA 3CIQA 1KUMA 3C2SA 3VXSA 3MLWH 3U30C 4AG4H 5H94A 1P84K 5B21A 4NZRH 4L4JA 3L1OL 3EYOA 1RJZA 1JGDB 4PBVC 4P46D 4Y4HD 1UXWB 4URTB 2EXWC 5FYKL 5DD3L 1NH6A 1KNOB 2Z92B 4D0CB 4JREC 1CL7I 2O5ZL 4Q97A 3CFJA 4EUPB 3IU3B 4MAYB 4OIBA 1JHTA 1XIWB 4PUBL 2V7NA 4G7YL 3UP1A 3LKSA 5K33A 1I1CA 1RAMA 3D0VB 5C0AE 1S7UA 3MV9A 4MD5B 4S1QH 3ZHKA 3ULUF 32C2B 5FB8B 1MNUH 2YD3A 4AG4L 3GHBH 2Z91B 3HMWL 4MSWB 2I27N 3D18B 5DJ2A 4P2QB 4X83A 5CLTA 2IAND 1T66D 2ZG1A 4JZJC 1FZJB 3ARUA 3QYCA 1NCTA 3VXMB 2R0WH 3UZEA 4PLJC 1D6EB 1DFBH 1CK0H 5BRZB 1JV5B 4PRHB 4PRIA 4O9HH 5I9QB 2XYCA 4J6RL 4WJ5B 4NO5A 3FFCD 1R3KA 3TJHC 2VXUH 3PWVA 4LSPL 4HIXH 4YHMH 3MJ9L 2A6JB 3WIHH 1CLYL 3O4OC 2X41A 5HPMB 3SDXE 3QDJA 4GRWF 2RHEA 4Y4FD 4YXLH 1GSMA 3HA0A 2HKHH 5C0IB 3HC4L 5IP4A 2VN7A 2XPGB 4OZGA 2D9CA 2VLJB 4KZDL 1OAUH 5MERB 3TN0A 4L3CB 1E0OB 3SO3C 2A2QT 1T20B 3TPUB 1IL1A 4NQDA 1AQKL 4X4ZA 5HBBA 1HI6B 4XXCC 3PWLA 3O2WH 4JQIL 4N0YL 1G1CA 5MEOA 3CXHJ 1QD0A 2BXZA 1TLKA 2D4DA 2L4OA 5CGMA 5FGBA 1AJ7L 2EE3A 3CDGA 3RL1A 1NCDL 5EOTB 3IFNL 4KVCH 5AYUH 4LSQL 4LHUA 4J1UB 4JFED 2EC8A 4PJ8B 1U8JB 3EYFB 2P24A 1MRDL 3L7FA 1CGSH 1E6JL 3QT2A 3ZZ1A 3INUH 1CL7L 1YA5A 5T33H 3N9GH 4BH8A 3U1SH 4PJAA 3T2PA 4ZUTB 3ZDXE 5HHVH 3SDAD 1HSBB 4L8BB 5EUOB 1CGYA 2ZKHL 2DWDA 1FLTX 1AHWB 3QIWC 4MJ6B 1BPVA 3B9VA 3C6LB 5F9JB 2XA8H 3OKNB 5LBSH 1ZEAH 1JGEA 3LKSB 3ALXA 3PQYE 2P5ED 2OSLB 5E70A 1OAKH 1QVOA 3U36A 5HGAB 5GIRA 4KKAD 5A1AA 2QEJA 1CDCA 1SJHB 1H0DA 3V6OE 2Y1VA 5SWSD 4Y8DC 1FZOB 3SDDC 3ZKND 2DQHL 3NCYP 4PJIB 5JTWA 3NOIA 2BMKB 2HFEA 1QUNA 1N6QH 5FIEA 2XOTA 5E8DL 3PGCB 1ED3A 2JCCE 4QGYA 1U8HA 3BZFA 3HAEG 3C5ZD 1BF2A 5J1TC 5EIIA 2XA8L 4GMSL 5FCUL 3HC3L 5I1LA 3MFFB 3BRGC 3ZTNH 3LCYA 4R9HA 4LNVA 5L2KE 4HFUH 4UTBH 4JRXD 1DBJL 4Y2DC 3TPKA 4FABL 2AGJH 2VRAA 1VPOH 2FHBA 2PXYA 5DD5L 4ZO6A 3GSVA 5F7NC 4H5SA 2I9TA 4R7DB 3GSXA 1QQDA 1IGMH 3FB7B 3TFKD 3QWOA 1U95A 5IMMA 2ESVA 3QDJB 3QNYA 5DLML 5FGCE 3VRLE 2O93L 1MLBB 3SY0B 3OXRA 1DANT 3EOBB 1L0QA 5BVJA 1JGVH 4NO3B 1UWEH 4XNUL 1AJ7H 3BDYH 5T1LD 3UYPA 5I1HL 3Q5TA 3MLXH 4XH2B 5I9QC 3T0EA 2NY6C 4JGMA 1G7LB 1U8QB 3VDAA 1U3HC 3TVMC 1P4BL 1S8DA 5HGDB 3MBEB 1XGUA 3GJEB 2EO1A 1U8NB 1UB6A 3UX9B 2QSQA 3PF2A 3LQZB 2ZG2A 3LQAH 1I1FA 5TDNA 5DEGA 1S78C 2BOCA 1OD7A 3EOTL 2MQ3A 3HMXH 1JPSH 1KG0B 3MLUH 2Q8AH 3TO2B 1CD1B 3IDJA 1VFAB 4LQ1A 4G80B 3I3EA 4NM4L 5IF0A 4GLRI 4GXUN 4I0PC 2HP4A 5BO1L 3CFCH 1Y0LB 4OGXL 1TJHL 1QRKA 3RVTC 2L0DA 3TYGH 3RVXC 2EIDA 1XF3A 2AEIT 1IGTA 4OM1L 1RJCA 2MNUA 3MRQB 1Q9WA 1AD0B 2RFXA 4JR9L 5F7HA 3V0WH 2NY4D 4YXLL 4YDJB 5BZDA 3O6KL 3MV7B 4PGCB 5ENWA 1V8HA 5E5UB 3GM8A 4HFWA 1DVFB 1EBPA 4FZEL 1T1ZA 4ODHH 1A6WL 2OSLA 3OAUL 3IXAB 1S9YA 3FB8B 1RJYA 4EXPX 3DUUA 3JSSA 5L0QB 3BN9C 1RZ8A 5F96L 1QRNE 4GRLD 1CVRA 1KTDB 4HKZB 4QRSB 1OAZH 4MD4A 4OLUH 3ARFA 2V17L 3DSFH 2HVJA 4FNLL 4GRLB 4P3CH 1BREA 1RURH 4WW1A 5DJXA 3H42H 4TSBH 4HKJB 2LU4A 1CDUA 3VA6A 5F1NA 2OZ4A 4JKPL 3QQ9D 5BQ7B 3S6CA 2F15A 1XGQA 3RI5K 4P3WA 3IJHA 5CD3B 2CIIA 4FG6C 2E3VA 4LVHC 4C58B 3S96B 4ZAKD 1HYRC 4B7IA 3ECBA 4OZGE 4MXVE 3QUYD 4H1LA 1KIPA 4U1IA 1VFUA 2XQYG 3VJ6A 1NUFA 1TJIL 4O2CA 1UWEL 3P9MA 2AV1B 3U4BH 1EJOL 4LHUD 1T4KB 3M45A 1HHKA 5HHMD 1HH6A 3U48A 4ZFFA 3U7AA 1FE8L 1L0YA 3BD3A 2DQCH 3RZCB 3AMLA 3T4YA 4K8RH 4NKMB 4PJ7A 2VLLB 1NMBH 3KVQA 4KHTH 3O6FB 4MGXA 1WITA 2QBWA 3S4SG 2HAZA 1E28A 3S36L 5KZCD 1D6VH 4FABH 2IMNA 2DQTH 1JF1B 3DVNB 3ZDZE 3D9AL 1T21A 5B4MC 3RFZC 5JPNB 2PNDA 2HA1A 1JYXA 4OZHF 5DA4A 4NT6A 2NMSA 4QWWC 1V3MA 2Z93B 3RGVB 3RWJB 1A9BB 1JZ6A 1F8TH 5IV2A 4RQQB 4PJFB 2XTJE 4LSRL 4ZFZA 5FYKE 5CZVL 2A83B 3MOAL 4LOUC 5FDYA 5K9KA 1JFQH 1TQBC 2XI9A 1KF9B 2V2XB 4P4KB 1A64A 2CMRL 3G6AB 1Y6MR 4FQHB 3RL2B 3PP3K 1I8KB 2CGRL 3HAEB 1YYLL 3GBMH 2HLAB 2R9HC 4IEFB 3D85A 3T8XB 4YEFA 4NUGH 1IBGL 1I7ZB 5C92A 1F11B 3DXAB 5I75C 3GI9L 1BQHB 4ODSL 5GGUB 5SWZA 5C0CA 1YY8B 5JIIA 2IH1B 2EIEA 5GZOC 4P9MH 4K07A 4KU1A 1DBKL 1E4KA 2Z31C 2EDWA 1PLGH 3X17A 4NJ9L 1KTDA 4HKZA 4LEXL 4ZPTB 3GMMB 1K8IA 1FNAA 4HWBL 3PL6B 3KNBB 4G8IA 4RGND 3S5LB 1CGUA 1HKLH 2OR8A 2R39A 4ETQB 2VN4A 2VNCA 4BKLA 2I9LA 5DR5L 3SE3C 3TFKC 1YY9C 3NIFE 4HUVA 3JWOL 1V7NH 1YNTA 5DC9B 1OP5K 2X4SA 5FF6A 4C56B 4P57A 3G5VB 5DQ9B 5GGVL 2NX5A 4PYHA 4V1DD 4XC3L 4MXQD 3IKCB 4ZUVB 3P73A 4GAYA 1GVIA 1FL6A 4TPRH 4PJDF 3NIGE 3I2CL 5DHYA 2JIXA 3HC0B 2YEZB 1U3HA 3I02A 6CGTA 1VESA 1D9KD 2Y06L 4RAHA 5EPMA 1U41A 4OFPA 3S35L 4QRRA 1F4WH 1FAKT 2ATKA 4YBLB 2NR6C 1XF4B 5IG7A 4KZDH 1A6UH 2X4RB 1KC5L 1YPZF 2ZUQC 3CCHA 1CCZA 3RDTC 2NY3C 2VE6A 1PEWA 4LL9A 3VDBA 4R4BA 1UA6H 2JB6B 5HYJA 3BPNB 5ELIA 4IMKA 5HPMA 1JHTB 4IRJD 1OCWH 4HWZA 4OCSL 1OGAD 1WFNA 3HNTH 4HIXL 1QRNB 3T2QA 3H3BC 4JDVA 1IC4L 1WK0A 5DK2B 1JP5A 3JVGC 3S9DB 3C60B 1I9IL 4G6FB 3RUGF 4BQ9A 4R7NA 2NNAB 3SE9H 3BGAA 3V79C 4KK8C 5GSVA 4O58H 3WNOA 3DXAE 2F5AH 1YEJL 5AEAA 4KTYA 4ZFZB 3MFGB 3EUUA 3VFGL 3VXMA 2FEDD 1I8LA 4YWGH 4M03A 1YEFH 2CLZB 3EDEA 1MH5A 2ESVD 3DECA 2HTKC 2NY2B 3TA3B 5C0AA 3SDDA 3R06A 4G9FB 3S3PA 5F7KC 4QTHA 4H26B 4Z95L 3CSYB 2FO4A 3GKWH 1IGYA 4BZ1H 4LSVL 1U8OB 2FO1A 5D2LE 5ILTL 5GRWA 3UTPE 5ICXB 2FHCA 1JNJA 3RY6C 1BZ7B 3CFKA 4NJAH 1JNLH 4HWNA 1I8MA 2W9DL 1KN4L 1T7XA 5F71A 1H3XA 2X09A 5CP7B 5TF1H 2F54A 1C1EL 2ZCLL 4P5TD 3LD8C 3C5ZA 3Q0HA 3WFDH 1CLZL 4PV9B 5E6IC 1MJ7H 1T20A 2D2OA 3TPUA 2ICEB 2AXFB 3MA7A 1QSVA 4TSAL 3FFCE 4KROD 1JGUH 5MEOB 1IC5H 2BVTA 1CFQA 2BHZA 3ESVF 3FONA 4MQXD 5MHSD 1JPGA 4XP9H 1CE1H 2FJFA 3LSOB 3OG4B 4J1UA 4PJ8A 5EU6D 4RZCB 5IVXF 1S9VB 4N8CH 3PWPE 3ME0A 2AVGA 3GRWL 5C0GB 1AFVL 4WWKB 1U8KB 5DTFA 3OZ9H 5EO1B 1ZLSH 3X3GL 1ZT7A 4OT1L 3EGSB 1SEQH 4JAMB 5DD1L 1TDQA 1A3LH 2I5YH 4AH2A 4NNPH 4UOW1 5HGHB 2NY4B 4XBGB 4XNXL 4KRPB 4P5MA 5IG7B 3ILQD 2V5YA 2ZCKL 4L8BA 1A7PL 2PYEE 3BP6B 5DRWA 4YHPA 1KELL 5HYSG 1G9MH 5E95B 5DJ6A 5CJXC 1N5YH 4GQPH 2ADIB 1JK8B 3CJJA 3BQUD 3IF1A 3KJ6H 3LV3A 5C0NC 4LU5L 3UBXI 1ORSA 4HDIA 3PE9A 4I9WE 4MCYB 2PKDA 3VFUA 2DQFB 3LPGA 4R0LA 3X13A 4QCIB 1KIQA 2WQ8A 3FO9B 3MRBA 4OQTH 3OR6B 1FVEB 4GJTB 5F93C 2FGWL 3VRJB 2C9AA 4NN6B 2D4FA 5DJYB 1KCRH 2AJZB 4LVNC 3V7AE 3VFPA 5EWIL 4Y5XA 2XWJA 2QADC 4XNZC 4HV8A 3RU8L 2YUWA 3QNXA 3WJLA 4ZPVB 1KG0A 5KAQF 4FQQB 2XQYK 2E7BA 2R2HB 4X9FA 1BAFL 5JNYB 2XTJD 3S36X 5E00A 4P5KA 2VDOH 3DIFB 5TPWL 2A77H 3EJJX 3FB6A 5TQ2H 2AGJL 2UZYB 2Z31D 3QQ4A 1DBJH 1AO7A 1RK1B 1YQVL 1GHFH 3TM6A 2LAGB 5E5MA 4JANB 1U36A 1R5WB 1GZPA 3ZTNL 3TVMB 3OB0K 1OB1B 5IFHH 4KKNA 2PTTB 1D7FA 1W72A 5T5FL 3AB0C 2NY3B 5ERWB 4GBXD 4KTDL 2F54B 2YPLE 1KJ2H 5DD5H 5IBLC 3QXUA 3SE8L 1JBJA 1S7VA 2M1KA 5JHLH 3HFMH 3MZTA 5I1JH 2VDRL 2GCYB 3WKMH 1FO0A 3SJVD 3O0RL 3QXAA 4WTXA 3CX5K 4IIQC 3CK0L 2PR4H 2PYED 1GHFL 4JFXB 3RNKB 2Z35A 3NA4A 4M4PA 4NKDA 1ADQH 4HD9A 2A74A 3KPQA 5AZEL 5BOPA 3QNZB 3JUZA 4XPHH 2BK8A 3STBA 3O6LH 5GGVH 1XGQB 2ICES 4GW4B 1MQKL 4XNYL 5CBEA 2DMCA 2J88H 2NXZB 4LFHG 4K3JH 4M62L 2BNUA 5BRZE 5B39G 3PGDB 4Z18A 4F9PC 3F5WA 1M71B 3ZL4L 4Y1AA 4XNQA 2WP3T 4HCRH 3VRLF 3T2NL 4LDOB 4LEOB 5F3BA 5L9DH 4KZEH 1KFAL 5GS0D 5CGTA 4MJ2A 1CGSL 5D4QA 1T4KA 2CR3A 2P44B 3FJTA 4RGNC 2OTWB 5F3HB 2I07A 1UB5A 4M6AA 4QRPA 1RZKL 1MHEB 4X0KA 3GB7A 3MZGB 1KCRL 2EDDA 4NRYB 3DYPA 3R0MA 3SE4A 3C8KA 3OJ2C 1PKOA 1ND0A 1P53A 1LK3H 5BVPH 1EMTH 1EEUA 1R3JB 3FT2B 1JRHL 4WDIA 1ZTXL 2UUDK 2AXHA 2HVJB 4KJWD 5IESL 3IFPA 3WN5B 4G6ML 1PZ5A 2VMFA 5H8DA 3JV4A 3VGDA 3EJZD 4DZBB 4IIQA 1G7MA 1KJVB 5BRZD 2GJ6D 1ZHKB 4PJ5D 2OJEB 4XGZB 3FRUB 3DRQB 3GO1H 4IS6B 2G5RA 2VDML 5L6YH 2JF1A 4NP4H 2UVEA 5IHUL 3VXRE 4ZS7L 1A6AA 3T0XA 3GNML 5LGKA 1I8KA 4XMLH 3RGVC 3V0WL 3LN4A 1BIHA 1R5IB 3HMWH 4IRSB 4KH2A 5DRNA 2AV1A 1OGTA 5HYJD 1TJGH 3PUCA 4EI6B 3SCMB 3QAZB 1BQHA 1J10A 1JHLL 1X4YA 1TZIA 1ZKAA 2C3VB 1OP3K 3I75A 1C1EH 4GAGH 3QPXL 4H25A 3CZJA 1CLOH 1EHLH 1UM4L 1KCSH 3F65A 3NCJL 3VFOA 2QKIA 4MDIA 2P8PB 3C09B 3RNQA 3RTQB 4HIEA 4G7VL 1JF1A 4M43L 4Q9CA 2BSTB 2Y7QB 4NZRL 3EO0B 4PJBA 1HQRB 1DLFL 2GAZB 1RZKC 1RUAH 4GG6F 5CP3A 1HXMB 4N1EA 2YUZA 2SEBA 3O6FD 4WU7A 5ANMA 5E2VH 4PPTA 3M1BA 5DD3H 3FN3A 1SBSL 4ZOBA 4XP1L 4POZD 2V5TA 4X7CC 1YPZA 4PLKC 4OKDA 1P7KA 5HHMB 3D2UB 4R97B 1YMHA 1BD2E 4MA8H 3ZT7A 3GSRB 1FNHA 5D7JB 2YD1A 3HAEA 3RWGA 5HPOA 2R1YB 4JKMA 4MNGA 1K8DA 5EC2A 1M7DA 3HZVB 3WLWC 5IOPA 1KYOJ 3BISA 4Y4HC 2CUIA 4OZIF 4WI8A 2YD6A 2QJDA 5GHWH 5F88B 3VDCA 3OKOA 4LLDB 1I1YA 4PRAB 1YUHB 4YGVB 3LZFL 3PV7A 1YECH 5ITFA 1DQDL 3MROA 2NXYC 4OZIA 3FZUC 2EE9A 1ND0B 4HPOL 3GSWA 5E8PA 4HX1A 2LVCA 3V4VL 1IQWL 4RWHA 1J8HB 4W81A 5MEQB 3MLRH 5F9WB 1TETL 5E8OB 3AB0B 4XNMB 1M7IA 1A6ZA 4RRPA 3AUVA 3BXNB 4KRNA 5LQBH 4TSCL 5J57B 2COQA 1AGBA 1S5HA 3MXWL 1LEIA 2VXTL 3BKJL 2ICWJ 3L6FB 4YHZH 4GG6A 1NCWH 5DRXB 7FABL 2BC4B 4IDJL 1EO5A 3JUYA 1A0QH 1YMMA 1S7RA 4M1GH 3VXME 1JJUA 2ARJQ 4PJBE 1YDPA 1J9CT 2DQJL 4JFEA 4BZ2H 2F8VA 2MHAA 1CFBA 1LO5A 1N7MH 5DLMH 2Y72A 3D39E 1X5LA 5DD6B 4YDKH 4U6TA 4GRWB 2WUCH 3ULSA 2R56L 4OD3L 3RWCA 5K9JH 1MWAA 1FV1A 4KDTA 1LE5A 3H0TB 3KPMA 3BWAB 4G6AD 4UAOC 5CINH 2ICEA 2HT2C 2XQBL 5BW7C 4X6EB 3OX8A 4TVPL 5IW6B 4LAJH 1J05B 1YEEL 4LLUB 4CVXA 2R29H 4PJDE 3TBSA 1BWMA 3D69A 3UC0H 3QIWD 4PREA 1INDL 5BS0E 3VFRB 1FZKA 5BJTB 1NC2B 3WE6A 3KPSE 3X3FL 5FUOL 4OZ4B 4UOW0 2DMKA 4KK6D 1AP2A 5F7EH 1HE7A 2QR0A 4JQXC 4N0CC 1A7BA 5E8DH 3CFDA 1B90A 5DUBA 1ZHBB 3RDTA 4BQ8A 5BV7H 3HTLX 2NY0D 2P48B 3SEPA 1BZ7A 1QR4A 5MENB 4DZ8A 1T03L 4NGHL 1SQ2N 1WZKA 3EW3B 2OK0L 4LHUB 2R0WL 2BVPB 3V7MA 3T0WA 4BFIB 1FFPB 1S9WA 1I3GH 4F8TA 1AC0A 2CRYA 3MV9B 3JV5A 3KYOA 1TFHA 2HT3D 1KGCD 4K3DH 4LDEB 5DJCA 5J3HD 3ZTJH 3C6LC 4MB4A 4PGEB 2BFVL 3LY6A 4UIMA 4LSUH 1N26A 3MV9D 4MSWA 5D7LA 4JHZA 4UUJA 4G9FD 3MOQA 1BVKA 1BAFH 2IPKB 1WIPA 2X70B 3BYYA 3SDYL 3UTPD 4YAQB 3FQTA 1MHHA 2LAAA 5J12C 3HRZB 1MFBH 3C6LA 5IGXL 1ACYL 5TE6L 1HDMA 3UDWA 3SPVB 3K2MC 4PV8B 1TVHB 4YHOL 4J4PD 4P5KB 4PLJD 5E08L 1KTLA 1P5UA 1C16B 1R3HA 3RWHB 1EUTA 4GXVH 4PJXF 1AO7B 1HWGB 3DSFL 1JHKH 2A6JA 4AEHL 3L3OB 4JFYB 5DT1H 4ORGB 4XRCB 1KJ3L 5BS0B 3HE6D 1BZ9B 5EIIB 4S2SB 4FFWD 4ZUSA 1L9MA 4K8RD 5GGSB 3UTTB 4OZGB 5A16B 1KPRB 5FECB 1PKQA 3WS3B 4L3CA 2NYYC 5GRXG 2BY2A 4F15C 5D7KD 2A6DB 3GSVB 3VRJA 5F97E 4N5UA 1FNSH 3D39B 4Z7UF 5I0ZA 1C12B 3DROA 2DI9A 3RBGA 4ODHL 1BLNA 1M6OB 4TQEL 2VZSA 5D96C 1VA9A 1ZHBA 1HEZB 4Y19E 5E00B 4U4BA 3QXTA 1QG3A 1ES0A 4LGRB 4CJ1A 3BFOA 2KBGA 4NM4H 5IR1B 5KSAC 5KVGH 5TE4L 2R1WB 2VDPH 3B2UD 3RZWA 5CEZE 1JZ7A 4WI3A 3SDAB 4RA3A 5TH2A 4D9RD 4U0RC 4IMLB 4ZMAT 1XCQB 5C08B 1TZHB 3KDMB 4OAWA 3VFNB 2OM5A 1H15A 1JUFB 2ZOKB 3BKYL 5HHNB 2WWKT 5IB2A 2HFFB 2NY7L 1NQBA 1JWMA 1SMOA 4FXGB 1PD6A 1RIUH 5K9QI 4U2ZA 3DRTB 1N5AA 5HTSA 1FQ9C 1NL0H 2NY3D 1R5VA 4POUB 5T3ZD 5E9DE 1NGPL 3HRZA 3G6JF 4NM8L 1MFCH 4DKEL 1UCBH 4Y4KD 1ZHKA 1EZVY 3ARBD 1CG9A 1F00I 3LEYL 4P49A 4R2GD 1BOGB 1JYWA 2GSGA 4JO3H 1TVBB 1F02I 1EHXA 3C5JB 1C16A 2R2CA 3NABL 2BFVH 5D1QD 5ACZB 3VI4E 2G2RB 2BVOA 4WFEE 1N6QL 3MODL 2XZAL 2NX5E 3AS1A 3VXPA 4A6YL 4BYHA 1KCVL 4NWTL 1VFOA 3LB6D 4NBYB 4PJGA 1FIGH 4LCCB 4P2CG 5EZOH 1BQUA 2DD8H 3FFDA 3RKPA 4ZUSB 5IWLC 43C9A 4NNYB 2OR9H 1O7SA 4FQXB 4PLNC 4D3CH 2BNRA 2DQGL 1A6TB 4M5ZH 3DETC 1MHCA 5JXAL 1AXTH 3VWJB 4NRYA 2IJ0C 3SDCB 1UT9A 3VXTA 1CBVL 4Q9RH 4PRHA 4WY7H 2W92A 1F6FB 3QDMB 1F4WL 5I1GH 2OTUA 5I19H 1RV6X 1T0MA 4K8RC 4YDLB 4H0IA 4JJ5B 4P0DA 2PW2B 4MNQB 3S35X 4K7FB 3LQZA 3IDIA 2JCCB 4QWWD 1YY9D 3KJ4C 1CGWA 2ZWLT 1DEDA 5FUCC 4N9OB 4P5TA 2BY1A 1A1OB 1FG2A 1HZHH 2ITDA 3TNMA 1M6OA 5B4MD 1NMCB 3HUJB 1NGQL 3MRIB 4CMMB 4YXKL 4PJ7B 3GUTB 4IOIB 1D5XA 2NX5D 2WWMC 4GS7B 3WNMA 1LNUA 1EEQA 3UTTD 1CICB 4B5EA 4B53A 3IKKA 5F7WC 3WUWG 1XF3B 1QFUL 4WO4A 1XCTA 2WMPA 3OGCB 1T21B 4O2FA 4H0HB 1JWUB 3JV0A 1FSKC 2XZCH 1PJ9A 2R1WA 1MLCA 2EDYA 3FCTB 4WWKC 3MUZ1 2HH0L 1HINH 3AU1B 1J12A 4UBDD 1OWRM 4UDTB 5T3XL 3FO0H 4HUXB 1HHHB 5D2NE 5ALCH 5JPMA 2EKSB 2OZ4H 3G6AA 1Q1JH 3CGTA 3KJ4B 3QPQD 4LKCA 2F8OA 3PQYA 1NCWL 3TIDB 3HN3A 5E8OA 3P11L 3CDYA 5IBTL 1VGEL 2H2SD 3O3EB 4I5BB 4F7EA 3LKRA 3BP4B 3WD5L 4OGYL 4PJGF 4LRIA 4U0QB 4OJFH 4FG6D 5JXEA 3OXSB 1GOFA 3TO4B 4XMLL 1CLCA 4I18B 4BSVB 3WEXA 3D3VA 1B9ZA 3R4DA 1FNGA 4IHOA 1BFVH 3RGHA 2BRQA 4DKFH 2WUBL 4PS4L 3GIZH 4KKCD 2VLRA 3VH8B 1ED3B 2DWEB 3P73B 2J8OA 4GAYB 1N59A 1N8ZA 2X42A 3KLHC 4OZIB 4ZFGL 1JTPA 2IGFH 4Y4KA 2WBJA 4OZHB 1DQQB 3H6JA 4MA1C 1IZJA 1P9MC 5DYOA 2R0ZL 3CC5B 3CX5J 3FOLB 3EIFA 4LRNH 3ARQA 5KG9B 4F8QA 1CGVA 3WFDL 2DBLH 4X9GA 3BP7A 1CGXA 1PY4A 1L7TH 3GSXB 1JNHA 3SKJL 1JNNL 2KH2B 3EOAA 1KACB 2ADGA 1BD2D 2DI7A 5J3HC 3K81A 1CICA 2KQNA 3V4UH 4OKVA 4S1RH 4G5ZH 3IYLW 4O58L 1QNZH 3BIKA 2VQ1A 2HLAA 1UA6L 3BJ91 4MX7A 3DV4A 5KJRH 4WV1C 2HG5B 4EZMA 3UTTE 4QOKE 2I60H 4JCMA 5F1OB 3EO1A 3HPJB 4RBPH 4PR5B 2BNRD 4LF3B 4DGYL 1GIGL 2V7HB 2IAMA 4M8QA 4LARL 1MHPL 1P7QB 4JG0L 4ZFOL 2EKSA 4Z7QF 3QDHA 1RZIB 4HBQA 5ITBH 4G80A 1IZKA 5LAXB 1A5FL 4FQ1H 4X7DC 4U3CA 4H26A 1RIVL 2PR4L 3UTSD 3L5WA 3K2UH 1ZWIA 4PB0H 3FB5A 4XMKH 4UB0H 1BOYA 3FT4B 4L3ED 1NGXB 4GBXA 1FVCA 1AGCA 2XKUA 4I5BA 3I9GL 5MP6H 4C83B 1DN0B 35C8L 2YEZA 3D0VA 3DSNA 3EDDA 5D70L 3Q2CA 4KTEL 3Q6GH 3QCTL 2FECI 3D3VB 1GCFA 1QYGH 3TT1L 3WDJA 4X6DA 5L9DL 4NCC2 3EO9L 1YJDL 5EFIB 5ICYA 3PWUB 1IC1A 4X6FA 4XWGH 4M6ML 3KPSA 4DQOL 2P4AB 3FAXA 3U0TA 4QKXB 2W9LA 1A1MA 1S3KL 2Q8BH 4EI5C 1KTRL 4DGVL 4M3KB 4IRSC 5D7LE 2EDBA 4EDXB 3MNZA 4JDVB 1DQQA 1FO0L 4KI5D 3F7YB 1LO3H 2ZOLA 1W72H 3ARPA 3O3DB 1CFNB 5C0ND 4GBXC 1KIRA 1CQKA 4LCIL 4MQXC 1WEJH 4JFPA 5H37G 1MEXH 2HJLB 5DJ6B 1C12A 3DROB 3ZTJG 5J11C 3U46A 4O2CB 1OAUL 1IM9B 4OCWL 1HZHL 5DDHA 4L4VA 5JW5B 4ZFFB 1BLNB 1MRFH 4XTRC 2XPGA 3TA3A 3IVKA 5MERA 2VABB 2PCPB 5C71A 5E1HB 4L9LC 1EXUB 3D3VD 3TV3L 3FQNA 5CD5D 3C2AL 2AJUL 1DBML 5IKCA 2R4RH 3CSYA 3EYUH 1CGTA 1C7SA 5KW9H 4XPBL 5JXAH 5I74C 4M93B 1DCLA 3WXVL 3CFKB 1U8IA 2XKNA 1FJ1B 1I8MB 5H2BB 4P2RD 2C26A 4YQXL 1OTUC 3VE0B 1E4JA 3NCYS 1RZIA 2BY3A 4JG1H 3D1MC 3NFSL 1AKJA 3KPRA 3OHXB 1NCAL 3WIIL 4Z77A 3C60D 1S9KC 1VEMA 4ZYKA 4BH8B 4OLWH 4U1JB 3G5ZA 4QHKJ 2YKLL 4L4VE 3GBLA 4MDJB 3LN5B 4U6VL 4MAYC 1NMBL 2ARWA 4FQJL 4JHAH 2M26A 3V4UL 4HJ0D 2GUOA 3VI3F 1NEZA 1HNGA 5F9OL 2HJFB 4LSQH 3AREA 3NFPB 2H32B 3LEXA 4NQEB 1EDQA 3T3PE 2NY5L 5EO1A 4ZFGH 1CLOL 2NXYB 4X5WB 4Q9QL 1CI5A 4PRIE 3NZ8B 1C5BH 4B50A 3LKQB 4P5MB 2VIRB 5I1AA 1J0KA 4CU8A 4ZPTA 5LKNA 4GFTB 5ADOL 4W4OC 5DJAA 1OF2B 3O6KH 1IAKA 1T5WA 1JK8A 4WCYL 2YZ8A 3TNNA 5FO8B 1V7MH 2F53A 5JXEC 1RSFA 1N3NA 4YO0A 3OAYH 4KQ3L 4U6YB 3HAEH 4PJHE 1C08A 1DQML 5LVEA 4NP4L 3SKOB 3HE7B 5I15H 2JIXB 4XP5H 1HWHB 2WWMD 4Y5VC 1U3HB 1VGEH 3I02B 4DVBA 1BQSA 2J8UF 3N06B 1CXHA 4J6RH 2OTUB 3DRTA 1I9IH 2CJUH 4TSAH 3DX6B 5DFTA 5GS2H 1K5NA 1KCKA 2XNAB 3O3BA 1INQA 3L3JB 1CE6B 1IM9A 3EJZC 1A14H 4NCC1 1DSFH 4GKNB 3VD3A 5B3JF 4S10A 3N1PC 5A2FA 3BEVB 2AW2A 1DDHA 3VGBA 4Z76B 4Y16D 3MLYH 2PCPA 1JE6A 4ONGH 2VAAB 2IPTL 5CP3H 1BD2A 4LKXA 2XACC 4Y19B 5E5RB 5IB1A 4NZJA 12E8H 5ACZA 5HVHC 2J8HA 4PJ7E 1HSAA 3B9KD 3SCMC 2F53E 3HI5L 1EH9A 5DQDL 4I3GA 4YHLH 4GKZA 5KOMC 1SJXA 1U8IB 1OB1A 3MLPA 2X4TB 2YMXL 2NNAA 3T0VA 5I8EA 1U8LA 4PJ9B 4JFDB 1LEKA 1EZVX 5FFLA 1HOCB 1Z9SA 4YK4B 4UILH 1A2YB 3QJFB 4G6MH 5AD0A 5T5NF 5JQHC 1OPGL 2CQVA 2E7LA 4L5FL 1MPAL 4RAVA 5CEYA 4LOUD 3SDDB 1ONQB 2R0LH 3RIAF 4LSSL 2FB4L 3VXSB 1RIHL 1K3ZA 4UQ3A 1OM3H 2APVA 1BVLB 4AMKL 3MBXL 4E42A 3O3AA 3QUKB 1LK2B 5KSUB 5DURD 5DJ8A 4BQ6A 3ZE2F 2H32A 3MACH 5ETUB 4R90L 3LRSB 2ZSVB 4D0CA 3IU3A 4MAYA 4PJ5B 4ZNEE 1X7QB 4LCYB 3F12A 4OIIH 3UYRH 3AM8A 3LKQA 1MIML 3QUXC 4OLWL 4QYOA 3NN8A 1QKZH 3QAZC 4RGNB 32C2A 5FB8A 4LEOA 5F3BB 3GEWB 2BSTA 3Q5OA 2RGSA 3A67H 3UTQB 4HSQA 4RCAA 3LN9A 3QBTB 5TFSL 2X5PA 2UVFA 2VLRB 4CW1B 4NGHH 4GOSA 5J6HA 2B4CC 1FZJA 1ZXQA 2JK5B 4JE4B 1T1XB 1WBXB 5EU5B 4EN3B 5C0BE 3HE7A 4PJAE 4OGZA 4WV1B 1ZVHA 3IAGC 4MVBC 5JR1L 5KSVA 3RU8H 2IQAA 2XY1A 8FABA 4QNPF 2HFTA 3M17B 1JWSA 3CD4A 3EFDL 2W65A 3GMPB 1AGFB 1CL7H 2VL5A 4LK4A 3PIQB 3FQWA 4HW6A 4OB5H 2Z92A 1AQKH 4LLWB 3CFJB 2NTFA 3MV7D 4JY5L 4AK1A 1OY3B 3TH2T 3C60C 1FLRH 2AEWA 2YD8A 2HFGH 1NCBL 4ODVH 3GMNB 1FVDB 1A1NB 4NN7B 4G6JH 1CYGA 2EYRB 4W68A 4CL7A 4L4TA 5HJ3A 3GMRB 3DV4B 3KPSD 2E8YA 3OR7A 4DUWA 3ARZA 3ZKSD 5I17A 1YEGH 1OGTB 2BP3A 2P46B 4P2QA 1KLGA 5C0RL 3GMQB 3UTSE 3GJFA 4RSVA 5CEXB 4HCRA 1ZSDB 3STZA 3K4DA 1PW3A 1UGNA 4HLZG 4M8QB 2Q7YA 4OF5A 2JKXA 1E4WL 2ZJSL 3CU7A 3VXQB 5CMAA 2FX9H 4FQQA 5TE4H 3QO0B 5FYJD 3C08H 5J6GB 4HC1A 3CC5A 4OF3A 4PJXA 4TYUA 5HHOD 4ZFOA 1VEOA 4QXUH 4WNQB 4M48L 2ZUUA 3KPNB 3BP7B 1OW0A 4B41A 3BRFA 2AV7A 3JTSA 2UY7A 8CGTA 5FO9A 3TWCL 1FN4A 1CLYH 1T89C 4S1SL 2AI0H 2EC9T 3P40A 1XGPB 3P0VH 3PJSB 5D5MF 1UVQA 5CD5C 1MI5E 1F97A 1OD9A 4ENEC 1LE5B 1KCUL 1X5YA 3NFNA 5I1KL 2R0KL 4ERSH 4NNPL 1QSFA 5EA0L 2I5YL 3WUWA 1A7RH 1FZOA 4MNGB 3KNBA 2MPAL 4KAQL 3KG5A 3OGOE 3MYJB 4KRPD 4PREB 2HLFC 5BO1H 1YNLH 3BW9A 5GGRA 4EBQH 3RWDB 5ICZB 1I1YB 1A1MB 2R2BA 2IAMB 2J6EH 5IM7B 5MHSE 3VMNA 3B5TA 2NY0C 1P7QA 3ZDZF 4XP1H 4D9QE 5BV7B 1NGYB 1SBSH 5AG9A 3T0DA 4QRRE 5C07A 4YX2L 4QO1A 4WV1A 4GW4A 2OLDA 4QRRD 5DT1L 2E6JA 1UACH 1MCJA 3QRGH 4NC1E 3OKEB 4UT7L 2FYYA 1H3GA 3BSZL 3F8UB 4X6CA 4LRNL 2B5IC 1M71A 1GOHA 4JZOA 2AJVL 1EAJA 3PWPB 4M6OL 2H9GB 1S7TA 4TUKL 4RMUA 1A6ZB 1UXSA 3BDYL 3V6FA 4C4KO 5B8CB 1K4CA 4KKBC 5A40E 4RWYH 3C8HA 2NTFB 4PYGA 1NFKA 5HI4D 4J23A 2QQKL 4R3SA 4UQ2B 4JPKH 4FFZH 1CS6A 2D7OA 4DAGH 1P9MA 4E0RA 2C1OB 3EYSL 3FT2A 3NA9H 5IB4A 3U7YH 1MCHA 3MUJA 1A6UL 1XGUB 4Z7QE 4BFBD 2IPUK 3IFPB 5AAMA 3JV4B 2CR6A 4RMQA 3GBNH 3QEQD 2QHRH 4PGBA 4UV7H 2APBA 2Y06H 2E9IA 1LO0L 2X89A 1BFTA 1F6LL 4YR6B 3VXQA 1CDHA 2MPAH 4KAQH 2FBJL 5C0AB 3RVWD 4PGZA 2YK1H 5CZKA 4HUKB 1QLFB 5I16A 3G6DL 2GJJA 4LRIC 3V6OC 4G43A 2VSDA 4NN5B 3QFJE 1AD0A 2RFXB 4H5SB 5T1KA 4BELD 3JTSB 1WF5A 3SO5A 5D72H 5EORH 4UV4L 2ESVB 5E6IB 1NLBH 1Z6JT 2VKWA 4XAWH 3GFUA 2EXYC 5C09A 5CGYD 5K9JL 5CIPA 1X4XA 5EU4B 4U1LA 5DUBB 1S9YB 4HJGA 1HILB 2C1PB 4XXDA 4L8CB 4RDQF 1ZLUH 2P5WA 1KENL 5EUKA 2QKIB 4MDIB 3C6SB 1M05A 1JCKA 4MD4B 3T2NH 1P1ZB 3D39A 4TUJA 1GZQA 3BW9B 1JGVL 4NOFA 2NY5C 5EC1B 1LP9A 3FONB 2GAZA 2XICA 3QFDB 5KSBA 1YEIH 4KJQD 5EB9A 3JTTA 4NBXB 1I1RA 2DQDH 4ZSOA 4HG4K 2VLMD 4L3AA 3QDGD 1BQLL 2WIIB 2P5WD 3OHXA 4Z77B 3UPAA 1MOEA 5CJ5A 2FH8A 3L3KB 4F9LA 5LQBL 4X6CB 1WTGT 4UTBL 3W0WE 5IEHB 5ABDE 1Q9WB 3MRQA 4K7PL 3ULUC 3GBML 5T3XD 5HI3D 3ULVE 5KSAB 1V3LA 3IDNB 5IR1A 3CMGA 5IOPB 5ENWB 4M7JL 4WVRA 5ISZB 1MFNA 2VLKA 1D6VL 2VDLH 4I77H 4IMLA 4F9LC 2EDHA 1QFWL 4ZO9A 3B3IA 4XPFH 4U1NA 3UTZA 4UB0L 3ESUF 5F89A 4YHML 4CMHC 3LAFA 1CVSC 4GRWH 4HBCH 1JI1A 5LGHH 3HNVL 1OSPL 3MOBH 4DN3H 2ED8A 2ATPB 2FBJH 1L7IH 3OKKB 4PRPA 2LTQB 2R0LL 1Q0XL 1AH1A 1CDBA 1FRGL 3EYQC 3TT3H 3H9HA 1YC7A 3BDXA 3FQRA 4UINL 1NBVH 3MODH 4X7TA 3MBXH 4JGUA 2YRPA 3BN9D 4X4YB 5E03A 2XTJB 1IAII 1KJMB 3ETBF 4R96A 1YEDB 1I1AC 1R5WA 3ZKMD 3BKMH 5HYJE 1BJ1H 2R1XB 1MQ8A 3PV6B 5GJSL 4HKXB 3K1KC 3S34L 3BJLA 4WENB 3SKJH 4CKVX 3RZCA 3QDME 4U1LB 1A6TA 3OJDB 2VAAA 3MLYL 1E27A 2Z31B 4QHLA 2ZUWA 5C0IA 3DMMA 3NCFB 4I4WB 2R8SL 1RIUL 3N1FC 4K3HA 3TN0B 1LWRA 1OL0A 2Q87A 3BWAA 3SBWA 9CGTA 5C07E 1T0MB 3CZFA 1OAZL 4PJ5E 4KFZC 2FSEA 1QFWI 3KPTA 4GUPB 1J05A 1T2JA 3GI8H 4XPTL 1MFDL 2DICA 3MRLB 4F57L 5KBNC 1BX2A 2YD4A 5D7IE 2GTWB 2JJSA 1XH3A 3V5DB 1A21A 1UJ3A 3SDDD 3ZKNC 4KJPD 1U58A 1J1PL 4LDLB 1JWMB 1UG9A 4M7ZB 5IEHA 3EZ8A 3ZYOA 2BERA 4QRRB 4NZUL 3N85L 4PJAB 1F4YH 1T1YB 3MRHB 3L5XH 1CK0L 4P3DB 4AT6B 3ILPB 3CFCL 2E7HA 4OGXH 3IDMB 4FA8A 3HUJE 2GK0B 5FYLH 4F2MA 4HZAA 2I07B 1EMTL 4PRPE 2E6PA 4DZ8B 2AXJA 5L7XL 1GC1C 4JPVH 5TF1L 3UTZB 5FDWB 2AXGA 3F12B 1TVBA 4OF8A 5EN2A 3R1GH 4Q6IC 1MVFA 4NDMB 1FVDA 5I30L 1Q9KA 3T4AB 1OAXL 3ULUL 3IT8D 43CAB 5FHBL 4G7YH 5JDSA 4RBPK 4NNYA 4FTVB 3FQTB 2LFGA 4F9PA 3F6IA 1WSST 1TCRA 1ZVSA 5ADOH 1DBBL 3H9SE 4X4YA 4CMHB 4PB9L 1MSPA 4PV8A 1DQJB 4F7PB 1PGRB 5SV4A 3K1DA 3QULB 1TTFA 4QHUA 1AXIB 5IMKB 3P4NA 3UMTA 4QTHB 1WLHA 4JJ5A 2AERT 2PO6D 4DN3L 3IDIB 3R0NA 1A4JA 5CJOH 4X4XA 4N0UE 1UENA 5H35A 4YNYB 5ICXA 5E8EB 3QXDB 4H88H 1HQ4A 4Z0XB 2YRZA 1I7UB 4Q2ZA 1QFHA 4HWZB 5FCUH 4I18C 3W11C 3UJTL 3HRPA 3E3QE 6FABH 4ZXBC 1QBML 5M94B 4HWEL 4HFUL 2GT9A 1HIML 1T0NB 4ZD3L 2A6DA 5I19L 3EYQD 2DIBA 1RFDL 5D7IF 3QDJE 1NUDA 3GGWA 2XZAH 2CLRB 4IOSD 4WI7A 3GM0A 4LCIH 4LLVB 1T3FB 5CSGA 5E8NB 3D85D 2X4OA 1DN2A 4LNRB 3V52L 5JORA 4L8SB 3CH8A 4N8VB 2P1YA 3TBVA 1C5DA 3BO8A 1VFAA 1AO7D 3CAFA 4NQTA 4ODWA 3WJLC 4DKEH 1S3KH 4NHUA 5H94B 2DKMA 1CZ8H 4XMPL 3HZVA 3TIDA 3MREA 5JQ6L 2YOCA 1OAQL 4JQVC 2YPLB 3EO9H 3MNWA 1GAFL 4YHPB 3TEUA 4KJYB 1RHHB 1J5OH 1SYVA 4PB9H 4O5LL 2Z0BA 3FN9A 4Y7MA 4O4YH 4YGVA 4HFWB 5AUMA 4WHDA 1QBLH 1XGPA 1FSKB 4HT1L 3TBYB 4KI5F 5DMYA 4ZG1A 1RZFL 4X9IA 2BX5A 5JW3H 4NQSA 5ESQB 3ZKXB 2X4QB 1CT8A 1XGTB 4Y16B 3FB8A 3GI9H 1Q0YH 3UBXG 1EAPB 4XHJC 5E2WH 3Q3GB 5KVFH 4E0RB 4OLEA 2J4WL 1DQLH 4WEBL 1DL7L 4TRPL 5D7SH 2CKBH 5IBUG 5J1SC 2BRRH 2CK2A 1WVZA 2AP2A 2FBOJ 4TVSa 4U3HA 3TJHD 4JY4B 5CAYB 2DAVA 2QQLH 3PNWB 5EH1A 4Z7OF 5CILH 4Y4KB 1JV5A 1AFVH 2AABL 5J9PA 4MLIA 3RVUC 5CD3A 5KVGL 4LLMB 3IGAB 3MJ9H 4PJ8C 4MQ7A 3OKEA 4AIOA 4DWHA 5KG9A 3K8MA 4U6HA 3MV8E 1A4JB 4WI5A 5TQ0H 1XR9A 1J1XH 1I7TA 3MOAH 4JB9L 4JANA 2FWOB 4K2UH 3NCCB 1KN2H 2MHAB 1AR2A 4KMTH 2DM2A 1N6UA 2DTML 4OF7A 3D87B 2BVYA 1MCOL 4M7LH 3SO3B 4TOYL 2DQCL 4FTVD 1RY7B 3SQOH 5CIPB 4KUZL 4P9HL 2YA2A 4XXDB 3MRGB 4D9LL 3I50L 2PYFA 3K74B 1KIQB 1E28B 4I3SL 3BEWA 1ORQA 3E6FB 1FAIH 3GGWB 5ID1A 2ARJB 1GGCH 1TITA 1K4DB 5DJYA 3EO1B 5C6WH 2IF7A 2ILLA 3GBNL 2DLIA 2JCCA 4NFDA 4PGDB 1Q8MA 1I4FA 1MY5A 4WFFD 4OD2B 1GGBH 1YN6A 1AGEA 4ZNEA 1I8LC 1V3JA 3UCRA 1ZANH 5ID0A 4IRJC 3VGHA 2DLGA 5C0CE 4G8FB 3MNWB 4OLUL 5IIEB 2G5BA 4AEIH 3A6OA 1H9VA 3TBTA 4MJ6A 4OQ1A 2HJKB 2ADJA 3KPOA 1YNKH 1ZOXA 4PJGE 1EX0A 3FO1B 5H2BA 2KZ1B 2IBGA 4TTGA 2BNQE 1IGCL 2ZCHH 5F3HA 1I7RA 2A9ML 3CU1A 3B9KC 3BPLB 1IC7L 1TPXC 5FOBB 4U7KA 3IS0X 5M95B 5HGAA 5C2BH 1XIWC 4Y1AD 3V2AR 2WUBH 1Y6KR 4HIHA 5TE7L 2FJHA 1R3JA 1QLEH 1M05B 4OUUB 2NLJB 5IMLB 3RBSA 5EU3B 1IM9D 2BVEA 3QPXH 4X6FB 2NW2A 3REVB 3BIBX 3OAUH 3HMXA 3THML 1JGLH 3PGCA 1ZA6A 2VB5A 4MA3B 3CVHA 4JY4A 3K4ZA 4S1DC 3QDGB 3MXVH 5CSBA 5I76A 3B83A 1HDMB 2XFXA 1UM6H 4YE4H 4ALAH 4LPTA 4WUUE 4OLZL 3MUY1 4YUEL 1P6FA 2W0KA 3JWNC 1QACA 2W9EL 1U2HA 3REWB 1Q9OB 3UO1H 4WI2A 3VFMB 1N4XL 4X99B 3F5WB 5T3XH 5D6DA 5EO9B 5I75B 3GIVA 4FFVC 1EV2E 3F62A 5L6YL 1WAAE 4MWFA 4FXKB 4XRCA 3PDOB 2P47B 3E6HB 2J5LB 4KY1L 4K23L 1A7OH 4JDZB 1F3DJ 1ULVA 4XC3H 5L2KB 2YWZA 3WJJA 4MJ5A 1T5XB 1MHEA 1CDJA 2VABA 4K3EH 2WUCL 1WFUA 4QHLB 2OL3H 1ITBB 3O4LD 2X1XR 2F54E 5BVPL 4NO2B 1KB5H 1BFOB 1ETZA 2Z8VC 2ERJB 4UU9A 2QQNL 4UOJA 3C8DA 3ES6A 2VR5A 3I85A 4NUGL 1PG7L 5EOCL 4DZBA 1MFAH 4C57C 5JOPE 3C5SA 3X12B 3TT3L 2QHLA 3SJVE 3TO2A 4OB5L 3H7BA 3O6LL 5TGBB 1A6VL 4HXBH 2FEEI 1PKQE 2XZQL 5HYQB 1GH7A 1R3LB 2X1OA 4PIRF 4EQ3A 1MWAL 3QUXB 5IQ7H 1IGTB 1NCBH 1R24B 1DUYA 4ODVL 5IHZA 5D2NB 3GMOA 4G9FA 1VSCA 3MNVA 1IQDA 3GJFH 3RY4A 5DMKB 1RUQH 5HHME 3HI6L 1KULA 2A0LD 4UBDC 5T5NG 3TZVB 1F6AA 4HWEH 4EQ2A 2GK0A 3QIUA 3NABH 2NY4C 1LD9A 5HDQH 1I7RB 5LXGL 1G0DA 4NC1C 3KDMA 4JGJA 4QOKD 5AWNH 1XT5A 5GRVL 5C6TH 3TZVC 1F3JA 1U3HD 5FDWA 2Y4SA 1FZMA 2P24B 2QTEA 3O2DA 4NWTH 3L7FB 4CVZB 5CEYB 3DETD 1MFCL 4HIEB 1HIMH 5E9DD 5L2JB 3CZFB 4U2YA 1R5VB 1OF2A 4ZUTA 1TJIH 4FN0A 5JOEA 1MCCA 4F3FB 2W59A 4OIIL 1KIUA 5GS1A 5DJ2B 1LK2A 3JV6A 5DHVB 3RX7A 3B5HA 1VFBB 3BPCA 5HHQA 2Y07H 4L3EB 4TUOA 1G7PA 2VISB 2VKXA 1PVHA 3SDCC 3K80A 3L6FA 1LDPL 4G8GD 2D7MA 3KPLA 5DWUL 4K3GA 4YC2C 5EWIH 2C7UB 4KXZI 2A77L 1MRCL 4LCCC 1IEBA 3VJ6B 5B8CC 2DKSA 4WJ5A 3DMMC 1A4KB 1FDLH 2HTLD 5IT2L 1HCVA 3T0ED 3O9WA 3DVIA 3DI2B 2OL3L 3ARFC 4U1GC 4WRLA 2H1PH 4ISVA 3CVHL 3RIFK 4OBRA 2HMID 4GMTL 1W0VB 2J5LC 3KYMA 3VI4F 4QRUB 1FPTH 2AEPL 4JFHD 3VWJA 5JIHA 4P2RA 4Y19A 4KKAC 3MNZB 4Y5VB 3CFIC 4MCYA 5I1DA 1Q9KB 1IGFH 5JMRA 2GT9B 4LPUA 4EKXA 1MCNA 1BBDL 4HXAL 1OAYL 3O45B 2F9BT 3D6GA 4XCEA 3CDFA 1FAIL 3CNKA 5DUPH 3HB3D 4NT6B 3QEQA 2R2EA 4DFIA 4PJDA 4X7SL 4EI5A 2JJTA 1F58H 1IGIH 2BSSB 2JELH 2R0KH 2AJZA 1A1OA 1FG2B 3VFPB 2XWJB 3HUJA 5GS0C 2QSTA 1OLLA 3TYGL 4WHYG 2E9BA 3B6SB 3U6RA 4ZXBA 4YEEA 1WT5A 3L3IA 4PRPD 3TVMD 2GTZB 2QR0B 1BJ8A 1VCAA 4RMRA 4NZTL 2G9HA 4NQEE 4RAVB 3RVWC 3P11H 3ROOB 2EYRA 3P4NB 4LSDA 3RDTB 3MLTA 4FS0A 4CUCA 2G75B 5DUPL 1WWWX 3OZ9L 2FX8H 1BVLA 4X4XB 2E9WA 1QEWB 5KVDL 4FZ8H 3MRDB 3QIUB 3DTXB 4YBLC 3SDAC 2VITA 1P4IL 3ULSB 1FFRA 2B2XH 4H1LH 2WLYA 1BEYH 2NY5H 3H3KA 1CD1A 1M4KA 1D5MB 2H1PL 3UPRA 4EIZC 5GJSH 3OG6B 3WIHA 1J86A 4X6EA 2Y07L 1EEYB 1UM5H 3BSZH 4I48B 4YBQD 3RTQD 4XCCL 2CLRA 3ARDA 1VDGA 5T3XE 2X1QA 1BVKB 1VFBA 4G6KL 4WCYH 2OXGA 3MR9A 5D8JH 3QQNA 4OLYH 5E2TH 1URLA 3DYMA 3NH7L 1KPVA 5C0AD 4X8JB 1UVQB 4LPXA 3LEXB 5DHYB 1QSFD 4BZ1L 3DURA 1JYVA 4BZYA 4WO4D 5TDOB 1QSFE 2C7UA 4FQJH 4N0FB 3SDYH 1TVDA 2UWEB 4RISH 3IFLH 1JPFA 4DVRH 3L3DB 5EBMA 1IKFL 4KV5E 4HCRL 1VPOL 2ZNXA 4C54A 1EFXB 2AEQL 4HS8H 4J8RA 4P9HH 4R7DA 4RGOH 3L3OA 4NCDA 5GZNC 2ORBL 1W0VA 1OT2A 5C7XL 4ODXA 2B8OT 4WFGE 4S2SA 4XPHL 1E4XI 4D3CL 5D6CB 1GC1H 5T1MB 1KLUA 1UJ3C 1PKQB 3B2VH 3LS5H 4H8WC 5L2KD 5DJCB 1IAIH 4K3DL 3GMRA 1FBIL 3QEGL 1U8QA 4DVBB 2WBJC 3LKOB 4KK9C 1RFDH 1FYTA 4A6YB 1S7TB 1NJ9A 2X7LB 3DLQR 3GJEA 1UXSB 1K5NB 1MJ8L 5I2IB 1OTTD 3P9MB 3GZKA 3I3BA 3QHFH 1PSKH 5HDQL 2LU7A 1WAAA 1K6QL 2FL5A 1JVKA 3QWRD 3KLSA 4UQ2A 3LEYH 3AS3A 3SPVA 1KCVH 4Z76A 2ICCA 4NQCD 4A6YH 2FRGP 3CFEA 4MX7B 4P5TC 1NCDH 5IB1B 5DD0H 3MRNB 2VR9A 1FGNH 1DBAH 4V2CB 3MLSL 4YHKL 4IOFD 2VOTA 1BJ1J 1QOKA 2V7HA 4MNGE 1LEKB 4HF5L 4JO2H 4PRBA 4HS3B 1MIEH 1HKLL 5HY9A 3ULVF 5HD8D 4M02A 5CWSB 4U1KB 4H25B 3QHZL 4JRYB 4KC3B 1QLFA 1KB9K 2PYFB 5IWLA 3SGJC 3VXRA 2FJHB 3K46A 1NMCC 4X5XA 3L5WB 2DL2A 2JJTC 3SJVB 1K4DA 2P7TA 3BKYH 4U1SB 4D0BB 1P7QD 2GSIB 1FYTD 1U42A 4MA3A 1I7ZA 3WFHA 1UWGH 1CF8H 1FHGA 5DJ8B 1S9VA 1P4IH 2XFXB 1W2KT 3D2UD 3M1BB 4YGAB 3KHOA 4OZFH 4FQ2L 4HJGB 3ARGB 1KELH 4P2OC 4WO4C 1XGYH 4OV5A 1P4LB 4CU6A 2BCKA 3Q48A 5DRZB 3WXWH 2C4FT 2H41A 4P2RE 4G8FA 4NZUH 5GZOD 4PJEA 2G5BB 2MKWA 1NANH 3HG1A 3MCKB 1K4CB 3UTQA 3UYRL 4DEPB 3ULUE 2V5RA 2Y36L 3JTTB 1SM3H 3CLEL 5DUMH 4FQIH 4Z0BL 4AQOA 1HH6B 4P57B 5SWQB 4XCYA 4ODUA 4R3SB 1FE8H 5C1MB 1OW0C 3BZEB 4J3SA 1KLUB 1T1XA 1X44A 2IBZX 2ZCLH 1LILA 1RULL 2ZUXA 3F7YA 4MJ5B 4PJ9D 5FOBA 2VLLA 5IFJA 4AIZA 5D1ZC 5LWYH 1YEHL 1YPZE 1Z2KA 3QR2A 1KXVC 3V95A 3DX9B 3PGFH 1RJLA 1OAYH 3NTCL 4HXAH 3VFTA 3SGDH 2HJLA 3MV7E 4Y5YB 4X7FC 3RI5F 4NRXB 4OCLC 1TXKA 3MRKA 3VU2A 3AGVA 1BIIB 1QRND 1OQXA 4LVNB 1JNNH 1JPTH 2Y25A 2CXKA 5D1QC 2P45B 2VXVH 3GUTA 2GSGB 4MMZC 3RAJH 2AJ3A 3BH9A 4YC2B 3B9KB 1W0WA 3DX7A 3GIZL 4Y2DB 2GJZA 1AE6L 1RK1A 2EDLA 4DUVA 3L95A 1N0LA 4G7VH 3OGCA 4D0DA 3G5YA 3C60A 5F6HJ 3QUZB 4LMQE 4APQC 3WS6C 1NDGB 4JM2D 1S7XB 2EZ0C 4OFIA 3HB3C 4NUJB 1JZ5A 4C56E 3CUPA 2ZPKL 4Y4HB 1DQTA 4Z7UE 4LCWA 4FNLH 1MHCB 1ZLWH 4GRMB 5EUKB 1TNNA 2W60A 4HUWA 3CLFL 4BFEA 4DCQB 2IG2L 5DZLA 1RUPH 4ZAKB 2XRAH 4LKCB 4HGWA 2P7TB 5DO2D 4MNQA 1NKRA 4CJ0A 1VADB 2OQJA 2CDFA 3MV01 1I3GL 5ACMA 2CPCA 3BI9X 1XGYL 1S7QB 4NO0A 1NFDA 4P5TB 4O02L 5FO9B 5HYEA 1ZV5A 1X5KA 1FN4B 4PP2A 1EO7A 2B1AL 3VG9B 2MTPA 3OKDB 4XB7A 1RZKH 2V7NB 2XT1B 5C6PB 2H6PA 2HT4C 3QUYB 1CXFA 4M7JH 5CKAA 5FUZL 1MFEH 3KLDA 1OTUD 3DUSA 3S35H 1JRHH 2H2SC 3QIWB 2BNRE 2XZCL 3QIBD 1T5WB 1GAFH 3CMOL 4JJHA 4RMVA 1OTTC 3RJDA 3D18A 3QHZH 1EERB 4H8WH 1UB5B 3W5NA 4R4BB 5JOFA 1E4XH 1ZHNA 2P8MB 4HQQL 5T1LA 4U1NB 4GKSA 3W5MA 1N59B 1XR8B 5HHXL 1NGYA 2DYPB 4NPYB 4IDLA 2N56A 5DR5H 3HZMA 3EGSA 4JAMA 4MZ2A 2GW5A 5I1DB 5GRVK 3VFTB 1Z5LA 2QQNH 5SWSB 3V5HA 4IBLT 15C8H 5GRJL 4Z8FH 4BK5A 5HI5C 5GRYA 1L0XA 2ADFH 2OCFD 5K59F 4F2MB 3BEVA 1KCLA 3BD4A 5E2UH 2XWBB 2ADIA 3FQRB 5JDJA 1XIWA 3I6LD 1RVFL 1F3DH 4P23D 1I9RH 5IMOB 3B9KA 4MAUH 5EZJB 1HSAB 5I73B 1A4KA 4RNRA 5FK9B 4HIJA 4U05A 1B88A 3U0PB 3MJ8B 1RUQL 3MRBB 2DJUA 5DJZB 1BZQK 2X4TA 2Y9RT 4YHZL 5JHLL 4C4KT 3UO1L 4APQD 5BW7A 3MRDA 2DS4A 4FTVA 4XP4L 4LCWD 1ZT1B 2YPKB 4I77L 4BUGA 4HGKC 2DQEH 1BM3L 4DW2H 2VITB 4JO4L 1G9EA 1D6EA 2A9NL 2J6EA 5A16A 4PP1D 4A2MA 3IDGB 4QHUB 1KV3A 3E3QC 4GUPA 4ODBD 4E41A 1B0WA 1HSBA 2D9QB 3ARDB 5EOCJ 1HYSD 2MJWA 3IFLL 1BX2B 1AHWA 4JREB 4WU7B 5ANMB 1F2XK 2LTQC 4P9HC 2GTWA 2DMBA 4PJEE 1QTYT 3F7PC 5I18L 5JA9A 3QUMB 3L5JA 4FP8L 3NPSB 4PRHE 4K9EC 5C0GA 1PG7H 1Z9LA 5D1ZD 4IRJB 1D5BB 5HVGB 1HHGA 2B1HH 4LSSH 2IADB 1UEMA 1V5JA 1ES0B 4S1DD 1S78D 1EFXA 4QRQA 5HHXH 5D70H 3MRCB 5HYSA 1P6AB 1DTUA 1CU4L 4CW1A 3DO7B 4HS6B 3MPCA 4M5YL 3WLWD 5E2VL 5T1LB 3IF1B 5EG6C 4L8SA 2B1AH 1FFNA 3CXDH 5HDLA 4E9LA 4OCXL 5FHBH 1ACZA 4NDMA 4NHCH 2EDNA 3QDJD 4V1DB 4P23C 2DQFA 1A7NH 2IQAB 3PG2A 3BE1L 4R0LB 1TQBB 4OUOA 4FXGA 1W0YT 2YC1B 2VAJA 1F4YL 4PG2C 4X80L 2CJUL 2EE6A 5C08E 5MEND 1JGUL 1VENA 3S37L 1EHNA 5DD1H 3PIQA 1RUML 4UT6L 3PXJA 3MRFB 1T7ZA 3T65A 1LO0H 1U95B 1AO7E 3WFZA 1KPVB 4HZLB 2XN9D 3UEZA 3DURB 4WWID 1MREH 3OF6D 3WKNA 2X89D 1P7HL 3MJ7A 4WW2A 1WBZA 4CDHA 2DIAA 1Q9LA 5K93A 4ESKA 3ULVH 3VD9A 4LIQL 1A6PA 1KPUA 1ZLWK 2CO7B 2CRMA 3GRWH 5IESH 5ICYB 3Q1SL 4MXWH 3BKML 1CLZH 4G6FD 2F19L 1ZANL 1C5BL 4PRPB 4X5LA 1ERNA 5CJBA 4TULH 5DMIH 1FYTE 1GGBL 1MWAB 3BMWA 1OARL 4B7LA 5HY9B 3WCYA 1S7SA 5IB5A 1JL8A 1G9NC 2GY7B 2DJSA 4PJIE 4LVHB 4PJXB 4ZFOB 4QRTB 3FMGH 1K3IA 2D7QA 4I2XA 3H9ZA 4P46A 4MDJA 4JFPB 1YEDA 5IFAL 4X6BB 3GHEH 3QUMA 1AP2B 1MCEA 3QNZA 4KV5F 5B22A 4FQCL 2HJFA 3Q6FA 2XN9B 1UWXK 1QBLL 1G9NH 1OGAB 3TNMB 2H26B 5HHPA 5SWZD 3C09C 1MQKH 1CIUA 5EZLB 4WUUB 5IW1A 3OJDA 4ENED 4X5WA 3QJHA 4AJ0A 1NKOA 1S8DB 3LMJH 4PRHD 3M8OH 1U8NA 1REIA 1UB6B 4WI9A 4KUZH 3SQOL 4YDLC 3VFVA 4E5XB 3VGFA 1I1AB 2JJVA 2F5AL 1HN1A 1FH5L 2D7TH 2IALB 4N90E 5DO2C 2AI0L 3QIBC 1DANU 2H45A 3RIFF 4ODUB 5F9AC 4CVUA 5C0DB 4O51B 1KJ2L 2X05A 3FTGB 3S7GA 2B5IB 3I6KA 4PJHA 4Z7UA 1C5CH 3SGEH 2FYYB 1QO3B 5BV7L 3V6ZA 2A38A 4JFFA 3RPIB 1MCPL 2IPKA 3P4OB 2EZ0D 2EXWD 4JRXB 1T66C 4P59H 1M7DB 3BIAX 1F4HA 1Z3GL 2IAMC 2IQ9H 3HCVA 2VDOL 1BIIA 3P77B 2A6KA 3AAZB 5LXGH 4GXUM 1HHKB 5F88A 1JTTA 1PX4A 3X11B 1JZ8A 5FCSH 4JM2A 1SEBB 4F7EB 3TLRA 4LLQB 2GY5A 3JWOH 1BF8A 4YJZL 1QLRA 3HLAA 4JZNB 4WTZA 1YYML 1CR9H 1F13A 4HIHB 1KTLB 4HK3J 4K7PX 3ARDD 4BZ2L 4NN7C 2BY0A 1EA9C 2YA0A 4N8VG 3UJJL 4KUCD 5EBGA 4TPRL 3LN4B 4D0DB 2UZXB 2MQ0A 3VXSD 4UIKL 2DLHA 4L5FH 2NY7H 4QOKB 1T1WB 5B39A 5C07D 1M7IB 5BQ7A 1S7XA 5GGSA 2R15A 5AYUL 2WIMA 5I1EL 2DWEA 2NW3A 1KPRA 5FECA 3HC4H 1QSED 1SJVA 4LCWB 1N8ZB 4KUCF 5K9KB 1J87A 4GRMA 5I16B 1ADQL 1H3WM 3D48R 1YN7A 5I66A 1INEH 4F7CB 4Q58C 4H1LB 1KIPB 4LHUG 4AZ8A 3K2UL 4XCNB 4G42B 5E9DA 3HFML 5DFVD 4JPIB 1Y18B 1NFDB 3QO1B 5C0CB 3SBWC 3KJ6L 3V52H 5FA3B 3TESA 5IEKA 3OKDA 5A3IC 4OFKA 4PLOB 4MJIA 5ALBL 5GGTL 3RWCB 4HH9B 1U3JA 4NO2A 2WZPD 2FR4A 1IL1B 1LO4L 2R1YA 1SVZA 3BKCL 5IW6A 4KI5E 1N2RB 2ADJB 2X9XA 3KPOB 4XCFH 1OOAA 2ID5A 1VACA 2AQ2A 1CXEA 5ADPL 4UI2A 4MZ3A 3WFEH 2JB5L 3X12A 2W1NA 4XBPA 3ZKMC 3OKOB 4RX4A 4MD0B 2X4OB 4DGYH 4OZ4A 1BJMA 3O4LE 2CKBB 3QZWB 4OZFG 2HRPL 1H15B 4WUKL 1IMHC 5KS9B 2MCG1 2V2XA 4P4KA 3ET9F 1DUYB 4R2GC 4ODWB 3O9WD 4HX1B 3OMZA 1W8NA 1HHIB 3VXOB 4OQTL 4UQ3B 2NW2B 3REVA 3IDNA 3P30H 2WM0A 4Y2OA 3QB7C 5BMFH 4ZOAA 5I1CL 5D5MA 1F2QA 5FO7A 1OPGH 2QADD 4MNHA 4JFHE 5ESVB 2PF6A 2DIJA 3PP4H 4XHQA 5D8JL 1G7IA 4J3XA 1MCBA 3SCMD 4KHXH 1X7QA 4ZTPH 3VGAC 3H7LA 1UYWL 2B0SH 4RIRB 4CVWA 1RUAL 5ILTH 2XTJC 4X99A 3W9EA 3BVNA 2YXMA 3GMNA 2G2RA 1CXKA 4M1CD 2R0ZH 5HJ3B 3VFSB 3NTCH 2BJML 4FXKA 4NO0D 2BMKA 2F58L 5A2LH 3VG9C 4G8EB 1JZ4A 4YX2H 3RZCC 1PQZA 4Z78A 2XA3A 3EKCA 4QT5A 2WQRA 2VZUA 4U1HA 4JM4L 1WBXA 5EU5A 1GPOL 4EN3A 3BD5A 4X7TB 5D1XC 1RPQA 2WAHA 3IETA 4XZUB 4F57H 1KB9J 2HTKD 5IB3B 2Y5EA 5LGHL 1X5FA 1EJ6A 4XCNA 4MS8D 5E9DB 1BBJB 3KPNA 2BVUA 4HMDA 1U93A 5ALBH 4OGYH 1AXSB 3SQBA 2GK2A 2OP4L 1ZLUK 5FV2A 1IVLA 3CPLA 1IFHH 5E6ZA 3FB7A 4MAYD 3PWJB 2J7LA 3WYRA 4WGWB 3ZT6A 2BVQA 5ALCL 5DQJB 3V6BR 1J1XL 3GI8L 4XPTH 4AENB 5C8JA 1Q72L 1RK0B 2IMMA 4ZS6D 5HVHB 4GW1A 2HH0H 4P23A 1FNLA 5IJKC 2FZ3A 3FQXB 3O45A 4XCEB 4OBSA 1JWUA 3DBXA 4APQB 4EUPG 3T1WA 3BEWB 2FGZA 5DJZA 4R6UA 3BQUB 3MYJA 4NRZB 4L8SC 3WL9B 5F1IB 1MJJA 1NMAH 3IDXL 4XBPB 5HHOB 1LD9B 2HFGL 2CKBA 4PGDA 1HHHA 5DEGB 1DEEB 4CDGC 1XH3B 2DF3A 3ARVA 5IVOA 1MH5B 3U9PH 1S9WB 1G6RH 3ARED 4JVWA 4GSDH 2HVKB 5C0BB 4IMKC 4Z7VF 4BSWA 4NSKB 3QISA 3MRHA 4P3DA 1NPUA 3HR5A 2EKJA 5DMGD 1XF5A 4LP4A 4J3TA 5E7FA 1MCPH 3BP6A 3RUGA 2HKFH 3UTSB 5GZND 3S98A 4RGMB 4NNXA 4LCUB 4TUOB 4Y4FA 5J4MA 4DEPC 4U7SA 3JWDL 4XPAL 2VDNL 4H1LG 4ELMA 1QFWH 4OAWB 4KQ4H 2DDQH 3I6GB 1XF2A 3KXFE 5EZOL 2D7TL 2J1KA 4R90H 5KSBE 4ONHB 4XT1C 5HDOA 4R4ND 2RR3A 3K0WA 2APXA 5JMOC 1MIMH 3RVVD 2X1WL 1IKFH 3TNNB 1IEAB 5T33L 1FORH 3G9VA 3MLVH 2VDNH 3JWDH 1U8KA 5BRZA 4YO0B 3ARRA 4PFEA 3A67L 5ESAA 4GG6E 3V6OA 3ARXA 4RGOL 4V1DA 5JNYA 3BZDA 3JVGA 1G9MC 4EVNA 4AH2B 3MUHL 1VEPA 1NEUA 3H3PH 4R26L 1P84J 3DGGB 3NGBB 3QEQB 2V5MA 3NVQA 1VERA 4N0YH 1FL3B 2BSRB 2W38A 1FO0H 1AR1C 3N1GC 1INQB 3L3JA 1MPAH 2I26N 5FYJE 1MCLA 5I30H 3DOSA 3Q6FB 5ERWA 4MA7L 3RY5A 2G9HB 5D6CA 3MV9E 4FQXA 1BEYL 3MRJB 4XWGL 3BUTA 1S7VB 3VFUB 5IROA 1DE4A 3QWRA 1Q9LB 1T0NA 3QJHB 4OGAD 4EXKA 3PWLB 2Y6SC 3AC0A 1BFOA 1ETZB 4PJAF 4UU9B 4XBEH 3U9PL 5EULV 2FATL 4LSPH 1GZQB 4K3EL 3FFCB 3O81A 1G7JA 5I71C 7FABH 3RL1B 3IB4A 3T2OA 3QH3B 5TH2B 5DMIL 4ZSOB 1FGVL 1HOCA 5E4EB 1X3DA 5JZ7C 3DX8B 4P3CL 1X5XA 5AD0B 2ZOKA 1ZGLB 3I6KB 4PJHB 3E8UH 3FHAA 1XZ0A 5MI0B 3VH8G 2VTFA 5HI4C 4XNXH 1SY6H 3ARTA 2HKHL 4TVPD 4EOWL 5D9SB 3NCBB 1SEQL 1SYVB 4NNXB 4XP5L 1F4XL 3HCVB 3NGBC 4K94L 4ZOEA 1ODAA 3MXVL 4X8JA 4WFHE 3SKMA 1U8MB 3IFOA 3QPQC 5ETUA 4OLVH 2P8LA 5DVMA 2AJSH 4JN1H 4JRYA 1QLRB 3HLAB 1MFDH 4MB5A 2BZDA 3LQAL 4NJAL 4PJIA 1RZ7L 3CLFH 4ONHA 2DBJA 3GSOA 3O4LB 4TUJB 5GGSY 3HR6A 1C8PA 5ANME 5CCKL 1J18A 1AD9B 2RJMA 4ETQA 2R8SH 1Q1JL 4YHOH 3WFBL 1MCIA 1T1WA 2YSSB 3DNKA 3NZHL 4LCCA 4MS8C 3MV8B 2BHYA 1YEKH 3P4LA 5GS0H 5E99H 1G7PB 2VISA 2NX5B 4OZGF 5ESAB 2NW3B 1YEFL 1AC6A 2B4CL 3BP4A 2Z8RA 1ZGLM 3V8CA 4CADA 1RURL 4KDWA 5I0DA 4NWUH 2WLZA 4MA1B 4POZC 1B2WL 3TZVD 3DGGA 1T04A 3RHWK 5J8OA 4N8PA 1XR9B 2FDBP 5GS1C 4KZEL 5EBWB 4Y0GA 5KSAA 5LGJB