4Z7WA

T316 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wA01
1DBAH 4P46D 5E94A 1MEXL 5MHSD 2EEDA 4G6MH 4MJIE 4ZFOA 4CGTA 2VDKH 4HUXB 2AJSH 3F5WB 3LKNB 1MELA 1QBMH 4OSUH 1WWCA 2HWZL 4IRZL 1WIOA 1TFHA 3T65B 3SDXB 3UPRA 5DJZB 3OTTA 1Q8MA 4H8WC 3S36X 3RY6C 4MXWL 2G75B 5GGQL 3QXTA 2XNAA 5J13C 2YUVA 3L1OH 2YD1A 1KCRL 3DXAB 4QO1A 4PJFF 4KTDL 3PDDA 1BP3B 3FO0L 3V8OA 3O81A 5JIPA 3OWEA 4H25B 1BJ1J 5ICYA 5DJAB 2AEPH 4L8DB 2P24A 3QUZB 4NFDA 1E4WH 5IB4A 1SJHA 4MA3A 4OZGA 3BPCB 3I75A 4MNGB 4PS4L 4AEIL 5FYKL 1MCOL 5DMYA 5I74C 4RBPH 1CDGA 3IDXH 3LKOB 5L2KB 3HN3A 4KUCF 1Q9KA 3NA9L 3BN9C 2QR0A 3AS0A 4GRWB 4ELKB 4F7MA 4FFWC 4E41A 4MB4A 3B8YA 5A2KH 1U8MB 4P2QB 2H1PH 1I3UA 1OCWL 1ZLVK 4RMTA 4R4FH 4AL8H 4XP9L 1MFCL 1T83C 4TUOA 1V3JA 3B6SA 5KOMC 1N64L 5C0JB 25C8L 4RAVA 1JYNA 3PWPD 2A73A 4B7LA 3GI8L 4X6EB 5AZ2H 1QSFB 3PIQB 1PAMA 5EC1A 4WHCA 2VQTA 3SJVB 3L7FA 1D6EA 4D9QE 3KR3L 1D5BB 3QXAA 1G7IB 2Z31D 5ESVB 4UNVA 5DVNA 3C5ZA 2WQRA 3HNTH 4Y89A 1KULA 4MS8C 3TN0B 4X7TA 5I19L 4KK6C 3K46A 4HT1H 4PY7B 3TH2T 3CMOH 1NMAH 4PB9L 4HS8H 3FB6B 3VXSA 1MCRA 2BZDA 1ZLWH 3C08H 4Q9QL 5DJDB 4XCCH 2LAAA 1VHPA 6FABH 5HHVL 4X83A 3UEZA 1UYWL 4G9DB 1U6AL 2ZCLL 3FT4B 4UB0L 3T0EA 2EE6A 4JG0H 4NM4H 2WIIA 5GGTH 4FQLL 3T2NH 3FZUC 4LPVA 1OY3B 1HINL 3D69B 3IXTB 4NM8L 2J8HA 4E42A 2XTJB 4U7MA 3IETA 3S98A 1CFSA 1BJ1H 2VLJB 3DX8B 2GJ6E 3PGCB 2YXMA 4U2ZA 4D9RD 1NSNL 3QYCA 2R23B 3U2SB 3TC9A 1RVFL 5C6WH 3LY6A 2HVJA 5DI8B 5T5FH 2VUOA 2WANA 2J3SA 3F7VA 4YBLB 3G04B 1XCQB 3GEWB 2ZWLT 2A77L 1XF3B 4ZOAA 4GS7C 3GSRB 2X05A 1LP9A 4HUWA 3WFBL 4YE4L 4PJIE 2DIBA 4RWYL 3QNZA 5ISZB 3QQ9D 4FRWA 3VXRD 5EZLA 3T3PF 4UNUA 4OGAC 3D3VB 1KCKA 5DWUL 1TZIA 4JRXA 2AJUH 5CP3A 3LS4H 3WFHB 5CMAB 2O61A 2KH2B 5CZKA 3HUJB 3H9SA 3P0YH 2I24N 5GRXG 2V2TB 4R97B 1QA9B 4FFVD 5E8NB 5KVDH 2QHLA 3VG0L 5BXFB 4L3ED 1H9VA 2QADC 2AV1B 1OQXA 1GZQA 2X4RB 2GSIB 1OM3H 3BJ91 2BJMH 2BMKA 4PD4J 1R3JB 1P4IH 4K3DL 3GBNL 2M8XA 1J0HA 1JHLH 5IHZB 3WJJC 1FL3B 1D5ZA 1LE5B 1T66D 2VTFA 5EN2B 5E9DE 4KI5E 3GBML 2HVKB 3I6KA 2X70B 3U9UB 2F54A 5CKAA 4Y5XB 1JV5A 1AGDB 2VDOH 1WVZA 1VB9A 3RWCB 1A3LL 3MRNA 2JCCE 4G80B 4WU7A 3MO1A 3NIDE 3RGVD 1V7NL 2CIIA 1AP2A 2NXZB 4G8FA 1PKQB 5H35A 4PJ5A 2HLFD 4XVTH 2JB6A 4K07A 4ZTOL 4J3OC 3UROR 4JANA 5JDJA 4PJBE 4Z7OE 3LEXA 1T89C 2HKFL 3RVXC 5KVGH 3KXFE 2YUXA 3TVMD 1X5JA 3EYOA 1WUNT 1QO3A 1CTOA 2VLMD 1XIWB 3LV3A 3V5DB 2X7LA 4K3JH 3AY4C 1YYLL 2AXFB 3KLAB 3VD5A 3O0RH 2X4SB 1KJ2H 3MCKB 3TO4D 4CJ1A 4ZFZB 2ZPKL 1FDLH 3SGDI 3H42H 3VD7A 4OF3A 1S7QB 4AENA 5GGVL 3CFIC 1XR9B 4QT5A 2AABH 3JUZA 5C08B 3VWKC 1A7PH 1TNNA 4JPVH 1RK0A 2D03L 3VXUB 3QHFH 1FG2B 4QRRD 4PJAB 4WI6A 4BH7B 4JKPL 1NUDA 3HNSH 1EFXB 3LB6D 5KOVC 5ILTL 5GJTH 3WEXA 3U4BH 2ZJSH 2XA3A 4LGRB 1IC5H 2OZ4L 2FHCA 5B3JE 2CPCA 4WFGD 3KWWB 3H3BC 4TVPD 5ANMB 5F96H 2VLLB 5CJXC 4UILL 4LVHB 1T20A 5GGSA 4GKZB 4KPHH 4NZRH 4B0MM 4DEPB 1PKOA 1G0XA 1DANT 3W81A 4MD0A 3BD5A 4Y4HD 1T5XB 3BVNB 4X9FA 1DDHA 4DW2L 5I75C 3WXWH 3MLVH 4I0PD 4X6CB 1FL5B 1C5CL 4FTVE 1GSMA 2XWJB 4Z7VB 4GW1A 4ZSOB 4F33A 5C0EA 4HGWA 1BECA 4GQ9H 3HI5H 4FS0A 4G8IA 4LOUD 4EQ2A 3GMOB 5HY9A 4TSCL 1KLGB 1BQLH 5I16A 1FVEA 4Y5VB 2JE8A 3AXLA 3P30L 1DBKH 1WC7B 4JFYB 3DX7A 4BH8A 5C0FA 2GI7A 5J1TC 5FYJU 1YYML 1WIUA 4KRNA 5B39A 1I1YB 1K8DA 2F74B 4MDJA 4ZS7H 3VXQA 3UPAA 3ULVF 2BSTB 2VL4A 3SDXF 2FL5B 3C8HA 3VGHA 2BDNH 2MPAL 3CFEB 2D4DA 4NHCH 5C0AA 1KIRB 2VDNH 1DQDL 4UV7H 3KAAA 1IT9H 2G2RB 3L3JA 5BRZD 1KGCD 2Q3AA 4KKCD 1JCKA 5H37G 3FQNB 3FO1A 4NRZB 4S2SA 1MI5D 2ITDA 3U79A 5DJYB 4OZHB 3OKLA 4R0LA 2P7TB 1LDSA 3PV7A 3WN5A 5E5RB 2CKBA 1ORSA 3P0VH 3ULUE 5FYKD 5IFAH 2IAMB 2VXTL 1U93B 3BD3A 4PFEA 3VWJD 3SE8L 5I9QB 3ILPB 3K4AA 4JJ5B 2VRAA 3E2HB 3G6DL 1XGUA 1KG0B 4J8RA 3FZUD 4M1GL 4UQ2B 3RY6A 5F9AC 2J12B 3RL1B 1KB5A 3OKMB 3E6FB 3NFPB 3V6BR 3GUTA 4P4RB 4WENB 1X5KA 1F11A 3DROB 3HZKB 4P5TB 4XVSL 5E94B 3SQOH 3L3HA 4DUWA 5LJYH 1QFWL 2BXYA 2Z92A 2HMIC 5D1ZD 3UZVB 1QYGL 4ZFOB 4Z18A 5DUPH 3D39A 3ARBC 4ZQKA 1WBYA 2NYYD 3M07A 3V5HA 5LGJA 4YFDB 3UPRB 1IAIH 1ED3A 4IRSC 3BAEL 4OCSH 4DFIA 1C08A 1VENA 3UCRA 4Y1AD 2Y7QA 3ZKNC 4EKXA 2IANE 4EDXA 1F6LL 3U7YL 1PSKL 1QZ1A 4JFHE 4J4PC 3OJDA 1C8PA 2B2XH 2QADD 5TQ2L 1FZKA 5BOPA 3DWTA 1JNNL 5IUSA 3PABA 5ICYB 4RMWA 5E2TH 2P24B 5EO9A 3QHZH 5IM7A 4LPCA 2WUCH 4UBDC 3REVA 4HPYH 3BUYA 5IB4B 1SJHB 2FX8L 3X14A 4MA3B 1MCQA 4OZGB 2CDGA 3I75B 2JJTA 1RZGA 3M45A 3C60A 4LQFH 3IFPA 2HYMA 2P48B 2P5WA 3TT3L 5IB2A 3D85D 2CRYA 1Q9KB 1RD6A 5F72S 2QR0B 4YWGH 3QAZC 4PTUA 4NCC2 3JWNC 4FQHA 4F7MB 3I2CH 1B4JL 1J8HD 3NGBB 4X5LA 5DHXB 4E41B 3V79C 1A6VH 3O4OC 3SPVA 1Q94A 3TT1L 5JHDD 2EO9A 3FO9A 2W91A 2A9NL 4DGIL 3QDJD 3RVXD 5EC2A 5F6IB 4TUOB 4Y5YC 5L9DL 3B6SB 5E1HB 4YUEH 4KDWA 3VU2A 3G9AB 4U6YA 3HUJF 5GQBA 1HSAA 4RAVB 2AJVH 2A73B 4NZUL 3MUZ1 2BP3A 4WFFE 4PTTA 3KPSA 5EC1B 4M62H 3L7FB 5FGCE 1D6EB 3HKFA 2F58H 2FZ3A 5HYEA 7FABH 1F4YH 4HBCL 3QUXC 2QQLH 3S5LG 3QXAB 1JPSL 2B7DT 5EOTA 3C5ZB 1MRDL 4LEXH 1Q0XH 4M48H 3TYGH 3INUH 4X7TB 2FWOA 4FXKA 3DXAD 3WHE1 2YHGA 4PJGF 4FZEL 3ZE2E 3VXSB 4XNMA 1T1WA 2YPLE 3WLWC 3BD4A 1YEDA 1EV2E 2D7NA 2VDLH 5KSAD 2EIZA 4DTGL 4JHWH 4GMTL 2IFFH 4TUKL 4LNVA 4V2BA 4N0UA 3HRPA 3T0EB 1INDH 1QQDA 1BQHG 3PF2A 4PRID 5DMGD 4NNXA 3RU8L 1P4LA 3WL9B 4OM0H 2E3VA 2YEZA 4RBPK 4E42B 3RRQA 3IETB 1CFSB 2VQ1A 4FABH 3IB4A 4X4YA 3HMXH 2JKXA 2PUQT 2WQ8A 4XC1H 1OD9A 5EIVA 1TTUA 4OI7A 5IB1A 2EIBA 2HVJB 5CILH 1AI1H 2F5AH 2DIAA 3F7VB 4P2QD 4J3UA 3LAFA 5EUOE 5AAWA 4LSPL 1LP9B 4HUWB 4OLWL 4OFYD 3WJJA 4JQVC 5D72L 5HHOD 2OYPA 3QNZB 5EZLB 4ZFFA 1T1ZA 1TZIB 4JRXB 1A0QH 2E7LA 4ZFOL 1PVHA 2O61B 4AMKL 5BV7L 1QSFD 1OAXL 1OT2A 2AEQH 4U1IA 3H9SB 4RMUA 3QHTC 1A5FL 3QT2A 4L8CA 1F58H 3TN0D 1GZQB 1H0DA 4O4YH 1OAQH 3U30B 1AIFA 5JW4R 3ARFC 2BMKB 2Y1VA 1CLOL 3F58H 2BCKA 4HQQL 5JW3L 4OCXH 1TZGH 2ZNXA 1NLBH 1ZLWK 3RI5F 1D5ZB 4EI5C 3UTSA 2D7TL 4TNVF 1N7MH 5DD3H 4XPGH 4J2XA 5J9PA 5I0ZA 3PQYE 2J8UF 1BOYA 4RZCA 3I6KB 2NZIA 1OQOA 3MV7E 5FYLL 2F54B 4CDHA 1IRAY 1IC7H 1RFDL 2DRUA 1JV5B 4M7KH 4M61A 4POZD 5KW9L 3KYKL 4GXUM 1MH5B 3BPNC 1I8KA 4PUBL 3MRNB 2VLKD 4WU7B 3WIIL 1G7QA 4J12A 2VLJD 3MO1B 1SMOA 3C87A 2CIIB 1N26A 3HLAA 1M7IA 1AP2B 1TQBB 1OAKL 4G8FB 5H35B 2MCPL 4E5XA 1BPVA 1UACL 4PJ5B 1J1OL 2JB6B 2ZUYA 3VWKA 4JANB 2K1MA 3DYMA 3LEXB 1NANH 2VIRA 1J0JA 4WWKD 1NGXA 5I8KH 5BV7C 1E6JL 3P4MA 5F1SA 3EYOB 1QO3B 1KUMA 4GG6A 4HEME 3F7YA 3DYOA 4Z95H 3ZYIA 2GITA 2MTPA 3LV3B 3RVTD 2X7LB 3DTXA 1XFPA 4J3XA 2PO6D 1AO7E 5ALCH 3RTQA 1WCQA 3WFCL 4NT6A 5E8OA 1IAOA 3CGTA 2XXCB 3UXFA 2ADFH 5CJXA 1CDCA 1T7ZA 1A2YA 1NGPH 1BVZA 4O00A 4AENB 3K7UA 5C0IA 2BK8A 4QT5B 4YK4C 5DD5L 1RK0B 4ELMF 1PYWA 3QWOA 3NVQA 3BMVA 3QDME 1YC7A 3HC0A 1B0RA 3ARBD 4OCNC 5JO5A 4XNUL 1FNLA 4WUUE 3WEXB 2E27L 4I2XE 1AE6H 2PYFA 5IFHL 2NY4C 3QI9C 4HGMA 5E2VL 3V7MA 3TBVA 4CU7A 4LSRL 4PJDE 5A2JH 5GXBB 1T20B 5GGSB 4J6RL 4FQCH 1BQUA 3PV6A 5F8RC 5D2NE 3WNPA 4MD0B 2JIXA 1JPTH 3V6OC 1W72H 1DDHB 3CFBA 3OB8A 3S8WA 3LS5H 3MLZH 5EZIL 2PYEE 5F7EH 4F33B 1FIGL 4GW1B 4QWWC 5C0EB 3TNMA 4HGWB 5CGMA 5F1NA 4NDMB 2Q8BL 4UBDD 3VXNA 4G8IB 3MLTA 1MNUL 2D9QB 2PTVA 1XIWD 3W9EA 4OB5H 5HY9B 3CNKA 5E2JA 4J3WA 5I16B 1FVEB 4XXCA 1UJ3A 3AXLB 5JOEA 2OK0L 3CSYA 1AHWC 2EDLA 1XGQA 3L5JA 3DX7B 4LSVL 1QLFA 4BH8B 2B1AH 4Y8DC 1U8NA 3LQAH 4RFNC 5C0FB 1GC1L 1ZHKA 1F4WH 2GTWA 4NC1E 4KRPD 4K7PX 3RZCC 5B39B 1NFKA 2MQ0A 2BY1A 2D9CA 1K8DB 4MDJB 3B9KA 2YPVH 1KEML 3VFGL 1Q72L 3VXQB 5I76A 2FX9L 4PGEA 1BD2D 3HB3D 1SVCP 4X4XA 3AUVA 1HYRC 1IBGH 3LKQA 1W0WA 4QRPD 5C0AB 4RMRA 5B38A 1P5VA 5CSBA 3GMLA 3W2DH 5KTEH 3L3JB 4MCZA 4RGOL 3FQUA 2HT3C 2DDQL 2R39A 5CJQH 3FO1B 1I3GL 3BXNA 4MNHA 3DUHA 4JPKL 4S2SB 1BBJA 2ITDB 4PD4K 3CSPA 3L3OA 4L4JA 1LEKA 3RIAK 4ONOA 3L3GA 2VC2H 2F5BL 4G6KH 3OKLB 4R0LB 1YNLH 4U1KA 5GRZA 3WN5B 2B0SL 4GUPA 2CKBB 5CJOH 4P48A 1ORSB 3MA7A 3QFDA 4I3SL 3FRUA 4HXAL 3VRLE 2VXSL 5DEZA 1S8DA 3UTOA 5GS3A 2WWKT 1GC1C 3O2VL 3BZEA 2WBKA 1RZJH 4TQEH 3I6GA 1XGUB 5F1KC 4J8RB 3DRQA 3RZWA 4LLDA 4XBEH 2NX5A 1SYSA 1KB5B 3FB8A 2NY5H 2W0KA 5JPMA 2DLFH 2R1YA 3IFOA 3RAJL 3PWPE 4KROC 1NC2A 3GUTB 1CICA 5J13B 1F11B 2ESVD 2ICWA 5GRUL 4ZFGL 3VGFA 2DWDA 3L3HB 2Z92B 1FH5H 1QKZH 1RZFL 5DMJB 3P2TA 1KEGL 4HWZA 3UDWC 1GXEA 4MNQA 3D39B 4ZQKB 4X7DC 1WBYB 3BKCL 4S0TD 4S1RH 4NN6B 3V5HB 1FNSH 5LGJB 3RDTC 1DE4A 1ED3B 3CC5B 4PREA 3JTSA 2R0LH 3BWAB 1C08B 4A2MA 4DGVH 3BQUC 4HUKB 2EICA 1DP0A 2Y7QB 1FVCA 4EDXB 1HHGA 3TJHC 1XGPA 4K9EL 3CX2A 1JPGA 5EO1A 2YZ1A 3E8UH 4MLIA 3DPBA 2NXYC 2XN9A 3BKYH 1VFAA 3OJDB 4OIIL 1T03L 1V3KA 3T4YA 3HNVL 5DD0L 1FZKB 4P9MH 3BP7A 4H1LB 3Q6GH 2OCFD 4EZMA 3ARFD 3PABB 4HH8A 4NQEA 3VH8A 5DRXA 3FL7A 5D7JA 1G6RA 1GGCH 3KYOA 5EO9B 5IM7B 4NKIL 2E8YA 4Y5YA 4EI5D 3REVB 1INEL 3BUYB 4KV5E 1KBGH 3X14B 5EFIA 2CDGB 5T1KA 3SDAD 4NP4H 1RZGB 3C60B 1HZHL 2GYSA 1J0KA 4L4VD 3ALPA 1BWMA 3IFPB 5FFLA 5J8OA 2P5WB 1EH9A 5T1DL 3ZE0E 5IB2B 2IPUK 1PZ5A 4JO2L 3N1MC 3QUXA 2HT2D 1UM6L 4PTUB 4MVBC 2BOCA 4FQHB 4AEHH 4MDIA 3VXMB 2A38A 3SPVB 1Q94B 4P5TD 3FO9B 5ADOL 3MV8D 5HYIA 3O6FC 3QPXL 5EC2B 1ACZA 1TIUA 2KZWA 4L3EE 2I9LA 1NMBL 3C2AL 4BFIA 4K9EC 4M6OL 4RGMB 5E8DL 4U6YB 1MFBH 1LK2A 1J0YA 1HSAB 4NIKB 3TM6A 1JE6A 4PTTB 3O6KL 3KPSB 5DHVH 2FZ3B 4XPAH 3FMGL 1Z2KA 3MR9A 4OTXL 1J1XH 1NCBH 1K8IA 4G3YL 4Y16A 5EOTB 5I1CL 5CGYC 4WV1A 2FWOB 2K7PA 4FXKB 4XNZC 1ADQH 2QQNH 2DYPA 4X99A 1T1WB 2WWMD 3IJYA 5FYLD 5F9DC 2NY0C 2W07A 3BKML 1YEDB 3CCHA 4K23H 5KJRL 4KHXL 4X6DA 1XF5A 4UAOC 4GS7B 5FV1L 2EIZB 1A7RL 4NWTL 2HFEA 4JQVA 4MCYA 3F7RA 2VERN 1IEHA 4N0UB 3QI9D 1QQDB 3BKJH 1A14L 1MREL 2MQ3A 5DZOA 3MUY1 5F7WC 1P4LB 2YEZB 2VO5A 4HC1A 2VLME 1FGNH 2VQ1B 5F9WB 4K7PY 3W11D 4X4YB 1CL7H 5JQHC 1NBVL 4UT7L 3DI3B 5B21A 1IGCH 1XF2A 5IB1B 4WEBL 1CR9L 4OIAA 1F97A 3DECA 5E99H 3IXAA 2BVTA 1KB5L 4JFED 2AJYL 5AG8A 2W38A 4QWWD 2VE6A 3N9GH 2EXWC 3MRLA 1D5IL 4OM1H 3ZL4H 4BZYA 4MJ6A 4ZFFB 1T1ZB 4LRIC 4YZFE 4ZODA 4WI2A 3WFDH 4PLOB 1F42A 1K3ZA 3BRDA 5F3BA 4RRPA 2C3HA 3RGHA 2BVYA 3VE0A 4U1IB 2IQAB 4K7PH 1MCPL 3S7GA 2DTMH 4WNQA 5B4MC 5JNYA 1H8OA 3LRSA 4L8CB 4QYOA 1K6QH 4Z78A 1EHLH 1H0DB 3ZLQC 1YEHH 3RWGA 1AIFB 4TVPE 3BFOA 4P0DA 1L0YA 1MHEA 2BCKB 2WSKA 1JGEA 5CINH 4HKJA 4DAGH 3UTSB 4X6FA 5J9PB 1IGTA 4Q97A 4GT7A 3RPIA 4RZCB 4QXUL 2NY2B 2DQJH 3JSSA 1JVKA 3OL2A 2MCG1 3AMKA 1Y6MR 4M61B 2DBLL 1I8KB 4KUZH 4LGSB 3H3PH 1G7QB 1UM4L 2KZ1B 1X7QA 3KPQA 2AI0H 3HLAB 3O4LA 1M7IB 1NPUA 4E5XB 2RIKA 1EJOH 3DO3A 3GRWA 1URLA 5EDXA 3VWKB 2X4NA 4XWGH 3C5JA 1FLRH 2BNQA 2VIRB 5SWSA 1NGXB 3F6IA 3P4MB 4PP1D 4YXLH 4BQBA 4LIQH 4GG6B 5DQDL 5J1AA 4H5SA 3F7YB 1A3RL 2GITB 1JRHH 1U8OA 3R4DA 3EO9L 3GSXA 1RSFA 3HZYA 2H9GA 3ARGA 3DTXB 5D7SH 3T0WA 5E7BA 1ACYL 3LPFA 3RTQB 3TBSA 4NT6B 5E8OB 3H9SD 1IAOB 3W0WA 4AT6A 1U0QA 3IDUA 2FCBA 2DKSA 3RJQB 2FDBP 1A2YB 3NTCH 4TUJA 1KGCE 5C0IB 3IDGA 5BVJA 1X44A 1JWUA 5FEBA 5I75B 1HWHB 2Q8AH 1PYWB 2FO4A 3QWOB 5I71B 2VZSA 1SHMA 4WTWA 3HC0B 1B0RB 4N90E 2ATPA 5JO5B 1EEYA 4QRUA 3MODH 4KK9C 3B2UD 5DK0A 2PYFB 4OUOA 5DD1L 3RDTD 3TBVB 1IE5A 1JFQL 5FYKE 1JF6A 1N0XL 1YY9C 4ODSL 2BNRA 1FFQA 3NFNA 1OAUH 1NGQL 3GKZA 5KG9A 5FB8A 4XVUC 4WFEE 1OGAD 3ZT7A 3PV6B 3WLBA 1NCCH 4V1DD 2FSEA 3SBWC 2YN5A 2JIXB 1MJ8L 2HAZA 3FOLA 4EI6A 1WZ1L 12E8L 3CFBB 4FP8L 4X9BA 2VR5A 1U3ZA 1EO8L 2GKIA 3DHJA 3OR7A 1H3XA 2H41A 2DQHH 3TNMB 2APVA 2SEBA 1Q1JH 2ZG3A 4FZ8H 5F1NB 4AZ8A 1NAMA 3HG1A 4W70A 4WEMB 4QLRA 3MLTB 4LVOB 4OCRL 4KJQD 5JR1L 5HJ3A 3I3EA 3W9EB 3AGVA 3O8XA 5HPOA 1OL0A 3WV0A 3B9EA 5C8JA 3QWRA 1P7QD 4R2GB 5I73C 1UJ3B 4GKSA 5I1GL 3NFSL 5IBLD 1BM3H 2BY0A 5CJ8A 3CSYB 3TJEL 1XGQB 3MCLH 2IH3A 2BFVH 1QLFB 3FRPG 1U8NB 4OFPA 1ZHKB 2GTWB 4KY1L 2IBZX 1KN4L 1QR4A 3SKOA 4Y1AE 3V0WL 1BEYL 1MHHA 3B9KB 4YR6A 2VDQH 5I76B 5DJ8A 3OX8A 2VABA 4PGEB 4UUJA 3S34L 1H5BA 1EAJA 2CMRL 4X4XB 4ZO6A 1YEJH 3O3AB 4L9LA 3MTRA 3LKQB 2IC2A 1W0WB 2AKRA 3RIFF 1JGUL 1RI8A 4MD5A 1SYVA 1PQZA 3GMLB 4M3JA 4TVPH 2AJXH 1GGTA 4ODVL 5A16A 2ORBH 5I1KL 1EGJL 4K3EL 6CGTA 4MCZB 3FQUB 5TE6H 4O02L 4QRSA 3AM8C 5FHAL 2LU3A 3BXNB 4MNHB 2R4SL 1BBJB 3O6LH 2OL3A 3L3OB 1LEKB 3GSQA 5D8JH 3L3GB 1PLGL 2DAVA 1NEZA 2JK5A 5JQ6H 1WAAA 4U1KB 1T0NA 2UZIL 4GUPB 5TE7L 2AQ2A 1TMCB 2CO6B 3MA7B 3MACH 3QFDB 1ZEAL 3FRUB 3UJTL 4JDTH 4NFBA 3OB0H 4PRHB 1VERA 3QG6B 1S8DB 2WWKO 5IVNA 3C6LC 2AS5M 3BZEB 4KTYA 4S11A 3BQUA 2PW1A 1CLCA 3NPSB 3DRQB 4LLDB 1LO4H 1FORL 2NX5B 4IRZH 1SYSB 3FB8B 1OB1A 3UYRH 1EX0A 5KN5A 2R1YB 3IFOB 3OZ9H 3SDXE 1NC2B 1R5WA 1A1OA 1HYSD 1CICB 3D5OF 3VXTA 2ICWB 1AY1H 1CDIA 1VEMA 2DWDB 4JREC 5SX4I 1X5YA 1MCSA 4LSSL 1FIEA 2WLZA 3IKCA 4HWZB 4MXWH 4Q58C 1CDYA 2PKDA 4MNQB 2XI9A 5D7IA 4U1SA 2QSQA 1H3GA 4GLRI 1E4JA 1ZXQA 2L7JA 3DXAE 1KCRH 3CFDB 3G6AA 1C7SA 1DE4B 4KTDH 4WW2C 4PREB 1NUGA 3JTSB 1UCTA 4TTDC 3VI3F 3QIWC 4OCYL 5L88H 5IESH 4QY8A 1FVCB 1HHGB 1XGPB 5FYJL 1JPGB 5EO1B 4XBGA 3FONA 5F7NC 1YNKH 2W1NA 4MXVF 2XN9B 1WTLA 1VFAB 4MNGE 4P2OC 3T4YB 4PS4H 2QTEA 4YEEA 5FYKH 5FOJA 1YJDL 3BP7B 5FF6A 5L2KE 3GMPA 3HTLX 4R4NC 3HZVA 1F6FB 4NQEB 4JN2A 3VH8B 5DRXB 1G6RB 4RGNC 3NA9H 3KYOB 5DVMA 3TV3L 4GRWE 5HHXL 4QHKJ 1M1SA 4Y5YB 1B2WL 1IVLA 3G5VA 4NO0A 2K9UA 5EFIB 4HIIA 4U0RB 3FN0L 4FQJH 4P2QE 5T1KB 4NZTL 5F7LB 1L0QA 5TF0A 3V6FA 1REIA 2VL5A 4PGCA 2R0KH 4PJEA 2X6MA 1PZ5B 3PHOA 2R9HC 1I1FB 4TRPL 3QUXB 4E9LA 1X5AA 5FGSA 1A1NA 4U6VL 4FQXC 4J3SA 4KRLB 2BOCB 1EVUA 1CK0L 4MDIB 5T3ZL 3K8KA 3Q5TA 4AJ0A 5CBAA 1QSFE 4LCCC 1QSZA 3SJVE 2IBBA 5A2LH 5D2LA 1NGWA 3KPMA 3DJ9A 5GRJH 2I9LB 4LPXA 5J6GA 1IAKA 4HAFA 2H2PC 4BFIB 4XCFL 2CRMA 5I19H 5IGXL 1LK2B 2Z35A 2ZZUT 4LAJH 1MIEL 1WCBB 4Q9QH 1MIML 2Y23A 3HMWL 3DSNA 4M7JH 3MR9B 4HUUA 4HGKC 4Y16B 1K8IB 1B9ZA 4HKXA 3K2UL 5HHVH 5DA4A 1UYWH 4KZDH 2ZCLH 4NQCD 1VFMA 4WV1B 4JKWA 3LIZL 4UB0H 3QDGA 4HJ0D 1MJ7L 2DYPB 4L4TB 2B5IB 4X99B 2XTJE 3IJYB 3VFRA 3CCHB 1CGSL 2LU7A 2VLJE 1UXSA 4RAUA 4X6DB 1XF5B 4LLUA 5HVFB 1NSNH 3MLUL 2HFEB 1RVFH 1W0VA 4MCYB 5F93C 4KK9D 5GSVB 2RAMA 1F45A 2XRAH 2ZUWA 4OSUL 4LRIA 5DJ0A 3C60D 5EBGA 2A77H 2P5WD 3BH9A 2NY6B 2IBZY 4YE4H 3WFBH 5IHBA 5BVPL 5ISZE 4MA1C 1UENA 3IDMA 1U91A 1KJ3H 1CT8A 3D3VE 3GJFA 1LEIA 5DWUH 4CADA 5LCVL 2XZCL 1CIDA 1OP3H 1IFHL 5K93A 3TBYA 3HUJE 4BSWA 2Q1EA 3IXAB 3BGAA 3V4PL 2EDTA 1KXVC 2EDJA 3VG0H 2WIMA 2VE6B 3VFOA 3V6ZA 3MRLB 4I1NB 4R8WH 2EIEA 4JRYD 4MJ6B 4MXQD 3C6SA 3GBNH 5F3BB 3VE0B 2W9EL 2E9WA 4JM2A 4WNQB 3OGCA 5JNYB 4LU5L 1ZWIA 3GBMH 3IDXL 3LRSB 4QYOB 4X9IA 4NGHL 4Z78B 3RWGB 3SO3C 2OJZH 3DSFL 1MHEB 5GRYA 5IVZA 1JGEB 1PW3A 4HCRA 4HKJB 4X6FB 4UINH 1V7NH 1IGTB 1PKQE 2O93L 5I1IL 1R5VA 3RPIB 1KIQA 4P2CG 1NLDL 5GGVY 4ZTOH 4LNRA 1JN6A 2GW5A 4JCLA 2ZUXA 3PHSA 2HKFH 4JFOA 4LDLB 4J3TA 4F9PC 4R7DA 4S1QH 3JVGA 1U58A 3KPQB 1X7QB 5AZ2L 2X9YA 4N5UA 2FX7L 1J5OL 3X17A 3O4LB 5ACMA 1OGTA 4WU5A 2JJSA 2EYSA 1YYLH 3STBA 1P2CA 4BFBD 1JP5A 3O2WH 4CVWA 3UYPA 5J89A 2X4NB 3C5JB 4PJ7A 5DHYB 1P84J 2JB5L 3B4NA 4JHZA 2BNQB 5SWSB 1S78C 1IEAA 2A6IA 3EDEA 4HT1L 2ZPKH 3CMOL 1NMAL 2C1PA 4H5SB 4X9HA 5J1AB 5GGVH 5C08E 2DQTL 3C08L 3GSXB 3HZYB 3VXUE 2H9GB 3ROOA 3HE7C 3VFSA 3ARGB 2NY4B 3C6LD 3HI6H 1J0IA 1KJVA 4PJAE 1I7UA 3TBSB 5HGGS 4ODTL 4WY7H 3W0WB 4AT6B 1G1YA 3QIUA 5D1QC 5KSVA 5ILTH 1U3HC 3QEUA 5C1MB 2YK1L 3P40A 4TUJB 5GGTL 4CMMA 3HS0A 3T2NL 5D6CA 3IDGB 5BVJB 1JWUB 5ANME 5T3ZD 2FO4B 3UC0H 5FKAA 3MFGB 1LE9A 2ATPB 1UWXH 3UTSD 1FZJA 1EEYB 1TJHH 4QRUB 2HTLD 1MCLA 5DK0B 4DW2H 2VWEE 1JGVL 4PLJC 4X6CE 3S37H 4U7KA 3MPCA 5KSBA 4Z7VE 4ZSOE 2BNRB 3NFNB 4LLQA 4L29A 1DQML 1SBSL 5KG9B 5FB8B 1AXSA 4O58L 2NMSA 3WLBB 4RFNB 1H3UA 2FSEB 1MFAH 3MRIA 5C71A 3P0YL 4PRDA 4TSCH 3EHBC 1QFPA 4OLEA 5IR1A 3FOLB 5E70A 2FYYA 4EI6B 3WDHA 1KTDA 5I1HH 4OIBA 4LARL 2VB5A 3OR7B 3U1SL 4LEOA 4RGND 2SEBB 4Z0BL 5JIHA 1BF8A 4EOWL 1OM3L 3KHQA 1NAMB 3HG1B 5FUZH 3K8LA 1JHLL 1YYMH 5HJ3B 4F8QA 4QXWA 5JMOC 5IFJA 1J12A 3O8XB 4UV4L 1J86A 3UAJD 1VA9A 5C8JB 5E0QA 3OQ3B 4YHIA 4GKSB 3RTQD 5B39G 3PUCA 3RWHA 3PG2A 3BT2L 3QCVL 2R2HA 3AM8A 2IH3B 2MPAH 4HX1A 1DVFC 2V7NA 3PWUA 5I1LA 2VDOL 2R0WH 3SKOB 2V2XA 4B5EA 1FFRA 1MHHB 1QFHA 4YR6B 5CD5C 3MOQA 5JOFA 3NIGE 5DJ8B 3OX8B 2VABB 4UUJB 1H5BB 3DVIA 5K9KA 4XVTL 4Y19D 4OZHE 4Q9CA 2YD2A 3I02A 1XH3A 2H2PD 3GO1H 5FYJD 4ZNCD 5E03A 4OZIF 1VSCA 5CSZA 2AKRB 4WDIA 4MD5B 4YHZL 5A16B 1SYVB 1PQZB 4N0CC 3MV01 1MCIA 1UB5A 3IDYC 4QRSB 3HC4L 3B3IA 2VXTH 4M5YH 1CBVH 2PTUA 2OL3B 2AEWA 5C09D 1KCLA 3GSQB 3O0RL 3SCMC 3CMGA 3CU1A 4JLRA 5F8QC 4GH7B 3SE8H 1NEZB 2JK5B 4KROB 5FECA 1RQ5A 3DLQR 2WBJC 1FRGH 1T0NB 3G6DH 1T04A 4OT1H 5J12C 3BGMA 5EU6D 5ID1A 3MJ7A 3H42L 3U82B 2G5BA 1E0OB 4YGVA 4R3SA 3KPRA 3S96A 1IZJA 2AABL 2FJHA 3VD3A 2EE2A 5HYJA 2ZG1A 3OKEA 5BS0A 2Y5EA 4XVSH 5EIQA 4WW2A 5D9SA 1OW0A 2KL6A 4QTHA 4K71C 3BQUB 2PW1B 3QIWA 3QUYA 4R26L 2A0LC 5GJTL 1KELH 4DGYH 3TF7C 4M3KB 5D7KE 1LD9A 2AW2A 4X6BA 1OB1B 3D2UD 3V8CA 5KN5B 1IC5L 2Q76A 2YBRA 1R5WB 1A1OB 4ZAKA 2NXYB 4Y2DC 5L0QB 5EO0A 4IRJC 3VXTB 3BAEH 3HE6D 3CVHA 5C0GA 4P2OA 4D3CL 5MENA 1X3DA 3B9KD 4KPHL 3SDCA 3ESVF 1EPFA 3EJYC 4P4KC 2FO1A 4YDIL 1QLEH 3RVVC 1OVZA 3U7YH 4XNXL 4PIRF 1VGEH 4U1SB 5D7IB 3ARSA 1GRWA 3WXWL 4YBQC 1S7RA 4PJXA 1KOAA 3GMMA 3QNXA 1YMHA 5TQ2H 4YHOH 3G6AB 2HG5A 1EXUA 3SE3A 4HLJA 1JNNH 5LVEA 3HI5L 5SV3A 1XEDA 1EEQA 4QY8B 5TDPA 4H1LG 2XZZA 2B8OT 1A64A 4XBGB 3FONB 3REWA 1BQLL 4OZGE 4FQXA 1UWGH 4G6FB 5FF6B 3GMPB 3TT3H 5IJKC 3HZVB 2H2SC 4PRPA 2IALA 4JN2B 4W4OA 3U9PL 1CGTA 2XY2A 3ARRA 3EYQC 3G5VB 4NN5C 4NO0B 4QHLA 4ZS7L 4E41E 3OB0K 1B4JH 4GBXD 1J05A 4HIIB 1RIHL 3TT1H 3V6FB 2D2OA 2A9NH 2E7BA 2VL5B 4PGCB 4DGIH 4MX7A 4PJEB 1OP5H 3PHOB 5L2JA 5ESAA 1NAML 1NFDA 4K55A 1IGIH 3T4AA 3GSVA 1A1NB 3MA9L 4PBWD 2F15A 4I3GA 2EYTA 1CICD 5CBAB 3DUSA 2UY6A 3VMPA 5EWIH 2EH7L 5D2LB 4JR9H 1NGWB 3KPMB 4HBCH 1JPSH 1MWAA 2NY0B 1LO2H 3F7PC 3QEQD 4MNQD 5CD3A 1IAKB 5J6GB 4KKLC 1K5NA 4OD2A 1KENL 2Z4QA 3DURA 1YQ2A 4Y88A 1CD9B 4GRLA 2Z35B 3VXSE 4FZEH 2DD8L 2GTZA 5LGKA 1E4XH 1LHZA 3TZVA 4WTZA 1ODAA 2BERA 4DTGH 3OPZH 4HUUB 2BC4A 1HCFX 1SBBA 4HKXB 4GMTH 5D1QD 4DN4H 4TUKH 3T0EE 3LD8C 2DI7A 3QDGB 3EGSB 5JXEC 5FA4A 5DQ9B 4X80L 3CFJA 2IPKA 3RU8H 3EUUA 5EULV 3VFRB 4HHAA 4NQED 3T77A 1UVQA 4KAQL 5D7JD 1UXSB 4RAUB 3QQ3A 1FYTD 1P4BH 3SQOL 4LLUB 1MVFA 2UUDH 4ZXBC 3QUKA 1W0VB 3UJJL 4N5EC 5DJ0B 1HEZA 1TENA 4D8PA 3ARDA 1DEEB 4KI5C 1LP9E 1X5IA 1A9BA 3BH9B 3KLSA 4LSPH 5ELIA 3TEUA 2WBWB 5D72H 2OI9C 1U91B 3IDMB 1CT8B 3T0XA 1YN6A 3GJFB 4JRXE 1LEIB 5BZWA 4CADB 1XR8A 3RUGA 3QH3A 4DQOH 1PG7H 1OAXH 3TBYB 3MNZA 3H9SE 4Z7WA 4BSWB 4P59H 3WXVH 4YHNB 1A5FH 4KWUA 3RVWC 3L5IA 3QG7L 3VFOB 3V6ZB 4IHOA 3G6JA 2WP3T 3QQ4A 4HKZA 3KNBA 4WO4A 3QHZL 5E4EC 1CLOH 3C6SB 3NCYS 4JFFA 2RGSA 4OGYL 4HQQH 3CDYA 4IOSD 1ITCA 2BHYA 4YFEA 4XP6L 4C56A 5F9JA 3VRIA 4MHHG 1VACA 2R29L 4F9PA 4JM2B 4NN7B 4Y16D 3OGCB 1ZWIB 1KTLB 5DD6A 2F54E 4YDLC 3ZSTA 5FYLH 1RFDH 3EOTH 1EEZA 4YWGL 5HHMD 4PG9A 3KYKH 2DYPD 1UFUA 5IVZB 4YEFA 3I2CL 2WUBL 1L7TL 2NLJA 3DYPA 4ZPVA 1OAKH 4PJ5E 2MCPH 1R5VB 3QZWA 1KIQB 1UACH 1OAZL 4X7CC 2FATH 3Q48A 3LDBB 4LNRB 5C9JA 1JN6B 1H3PH 5F7HA 3HE7A 4JFOB 2YSSA 3QXVA 4JFQA 2BRRL 1E6JH 3LRHA 2EO1A 1WZKA 2NY6D 4R7DB 1GYAA 4WHYH 1U58B 5H8DA 4FMFA 3MFFA 1OGTB 4WU5B 2F58L 4PJFA 2EYSB 7FABL 2QQLL 2LAGB 4OQTA 4RX4D 5F7YC 4F7TA 1OAYH 2DKUA 3WFCH 4L3CA 3QO0B 4PJ7B 4LEXL 4M48L 4H26A 1OP3K 1IEAB 5J11C 2A6IB 3IF1A 2AVGA 3WO4B 2C1PB 1U2CA 1CN4A 3MRFA 5CWSA 2V9RA 4YDJA 5DD5H 5BCAA 3GNMH 3ROOB 1EUTA 3VFSB 1KJVB 2VDLL 1I7UB 5IW3A 4HAGA 1CE1L 2DIJA 4JHWL 1CI5A 5T5NF 2G60L 2IFFL 1EHNA 2MKLC 1WFNA 4M1DH 3QIUB 5KSVB 3QEUB 3ULUL 5FOBA 4CMMB 3HS0B 5BMFL 4U6TA 5D6CB 5E2VH 4OM0L 5AD0A 4IRJD 3U48A 4I18A 4LSRH 4FABL 1IKFH 4OCLC 5FKAB 4K8RL 3V4VL 4XC1L 2XG5A 1LE9B 1VADA 5TH2A 2VUYA 1FZJB 1AI1L 5IMKA 2QJDA 4W68A 5IWLA 4NFCA 2DLEA 1A6TA 4M6NL 5KSBB 2OX5A 5EZIH 4JZNA 4LLQB 4OFIA 1FIGH 4L29B 3EOYG 5I73B 1WAAF 3WDJA 1A0QL 1CL7I 1AXSB 2Q8BH 1HKLL 1DVFA 3ARPA 4Y7MA 3MRIB 4PRDB 4RDQF 5HVHB 1EJ6A 5GZOC 5IR1B 2FYYB 1M71A 2X41A 1HNGA 3G5YA 1VFUA 3MMEA 4LEOB 5SWSD 1QUNA 1OAQL 5LKNA 3PL6C 5CP3H 1IGJA 1TZGL 5IFJB 5F97E 2FHBA 4N9GA 1KEMH 4KZEH 1N7ML 2ADGA 2DQFA 4LLVA 4YHIB 1MCWW 1OPGL 5GS1A 5IEHA 1MF2H 2H26A 3VG9C 2QSTA 3RWHB 2NY1C 2XOTA 4ETQA 2R2HB 5E8EA 3W0WD 4HX1B 5C0AE 1RJLA 3RHWF 2V7NB 3PWUB 4YX2L 2EH8L 5I1LB 4M7KL 3AREA 1D7FA 3FQWA 3JV5A 1AQKL 2V2XB 3CLEH 3BP4A 4RGOH 4TSBL 4M5ZH 1T6WA 2UVFA 5JOFB 5CLTA 5B38G 1U8HA 4EBQL 4Q2ZA 5J1SC 2Y36L 4JPKH 4Q0XH 5FK9A 2WW8A 5K9KB 1G7LB 5I1JH 4G6JL 3TYFA 5E5UB 2F5BH 3I02B 3QO1A 1XH3B 4UIKL 1EIBA 2KPNA 3LKRA 4PJCF 3KJ6L 5CSZB 1UWXK 4WDIB 5I8KL 2AQ3A 3DUUA 1UB5B 4I3SH 1HNFA 1J88A 2BNRD 3FN3A 5FDYA 3B3IB 4HXAH 2X09A 4JFDB 4JLRB 4ZOCA 4F57H 5FECB 1GVIA 1MVUA 3T2PA 1MJJA 3O2VH 4S1SH 2FEEL 1QBAA 3IS0X 4ZUTA 4YBHA 1T04B 4FFZH 3BGMB 3IGAA 5ID1B 2CXGA 3MJ7B 2XA8H 2G5BB 4P3CL 4YGVB 4R3SB 3KPRB 1MY7A 4MZ3A 4OGZA 3S96B 3RAJH 5B3NA 2FJHB 2H45A 4GXVH 5C07A 5HYJB 1U3YA 1KB9J 1HHIA 3OKEB 4MQXD 5BS0B 2EDYA 4ZFGH 4EXKA 2V5RA 1RZFH 2AXGA 3EFDH 4WW2B 5D9SB 3MJ8A 1GPOL 1KJ2A 3O8XD 4MAYA 2P1YA 2X10A 2VDMH 1KEGH 4QTHB 2PXYA 3QIWB 2G9HA 3QUYB 5BW7C 1TTFA 3D39E 4WGVB 4YO0A 5E9DD 1AE6L 1LD9B 4X6BB 5CCKL 5D5MF 3CUPA 5D2LF 5J7CC 2Q76B 2YBRB 1P84K 2OSLA 4N0YH 4ZAKB 5FXCH 2R1WA 5EO0B 3CVHB 5C0GB 4P2OB 1C12A 1TPXC 3QFJA 1AKJA 5F44A 3RWEA 5DEGA 5MENB 5I8EA 3SDCB 1ZGLP 1UKTA 5HTSA 4O2FA 1ZK9A 5KBNC 1S7RB 4PJXB 4Y4FC 3GMMB 4OIIH 1T03H 3QNXB 1YMHB 2BSSA 3HNVH 5DD0H 3MLZL 2HG5B 1EXUB 1H3VA 4EN3A 3KXFD 5DJ2A 3CDGA 4Q9RL 4XP1L 1RJYA 4X4ZA 2Y6SC 3O9WD 5SWZA 3KG5A 1INEH 1A7BA 3VH8G 3REWB 2XPGA 3OHXA 3JBG7 1FL6A 4FQXB 4L9DA 5L7XL 3DX6A 4P23A 2P5WE 5T1DH 4PRPB 1ITBB 2FGZA 2IALB 2CRIA 1E4KC 1KIUA 2V5MA 1UM6H 5EZJA 1I85A 2OS7A 3QA3A 2DQGL 2YPVL 3VXME 4QHLB 1J05B 5C0BA 1CXLA 2XWTA 3TA3A 4QHNA 2J5LB 5T1LD 1NL0H 2J6EA 2LU4A 5ADOH 5FO9A 1P7HL 5EUKB 2XQYG 4MX7B 2YS4A 5HPMA 3QPXH 3MREA 4I9WE 5L2JB 5ESAB 1NFDB 3T4AB 3GSVB 2V5SA 3W2DL 1B90A 2KDGA 4PJ9C 5E8DH 5CBEA 4JCMA 4A2LA 4CVUA 5CIPH 4EEEA 2EYTB 4FA8A 1XAUA 3KPSE 5E6IC 3DUSB 3O6KH 4LPWA 2E6PA 5TDNA 3R1GL 3C8DA 4I13B 2AK4A 2BHZA 2VC2L 4G6KL 4LP4A 3VI3E 5FA3A 4H0GA 2EDWA 1MWAB 4OTXH 4PBVC 5CD3B 1G1CA 1CQKA 1MCNA 4DK3A 1K5NB 1RZ7H 4OD2B 2Z4QB 1WICA 3DURB 5JXAH 4GRLB 4LFHD 4MXVE 2GTZB 3Q0HA 4ENEC 3SGJC 4M4RA 3BKMH 3TZVB 1N5AA 5KJRH 4KHXH 1S7UA 4X4MA 3K4DA 3QUMA 1WWWX 2BC4B 1A7RH 5DURB 4NWTH 2W9LA 3WYRA 1RZJL 2CKBH 4KKNA 4N0UE 4GSDL 3TESA 1A14H 1MREH 5B22A 2NY5L 5FA4B 4P99A 3CFJB 2IPKB 4GAFB 3OXRA 3SDXA 4FG6C 4HHAB 3T77B 1UVQB 3BIKA 4WHTA 2MQCA 3QQ3B 3CU7A 5I1EH 4UT7H 3FKUS 1UZ6F 4RMVA 3QUKB 3NACH 3SE4C 1N6QL 1I1CA 1CR9H 4Z7NE 2V5TA 1HEZB 1KB5H 4NRXA 2AJYH 4D8PB 1A9BB 1KXTB 4KKBC 1KCVL 3T3MF 2ZUUA 2R0LL 1OP5K 5TPWL 4DGVL 1C16A 1D5IH 1NCTA 1WJ3A 3CDCA 3GMNA 1OSZB 1YN6B 1WV7T 5BZWB 1XR8B 3RUGB 5A2FA 3QH3B 4OF6A 1HHHA 1F2QA 2Y4SA 3MNZB 4Z7WB 3BKYL 4NO3A 4XI5D 3MRMA 3Q3GA 4QNPF 5J06A 4P9ML 2R4RL 3Q6GL 1JWSA 4IHOB 5GIRA 3PL6D 5C0NC 3G6JB 3MLPA 2WP3O 3UX9B 3KGRA 3QQ4B 1GGCL 1RZJC 4HKZB 3KNBB 4WO4B 5T3ZE 3ULUD 2X9WA 4JFFB 1JUFA 4OLYL 3TLRA 2VLRA 4U3CA 4XVJH 1O7VA 2NY5C 1ZA3A 1RY7B 4C56B 3UTSE 5F9JB 4HMDA 3VRIB 1VACB 1X5XA 4G9FA 5T33H 3T08A 4K8RD 5J0BA 5DD6B 4QXUH 3N1QC 4K94L 1HHKA 1KJMA 1EEZB 2DBLH 4PG9B 2CD0A 4PJ8C 2QQQA 4IOFD 3UZEA 5D1XC 2NLJB 4JN1L 5C0DA 4P2YA 3AB0C 4ZPVB 5SX5H 3QZWB 3WS3A 2UUDK 3JZ7A 5C9JB 1J7VR 3MROA 1CDHA 3HE7B 4JFQB 2YSSB 1LDPL 4IJ3B 4JZJC 2CDFA 4FN0A 4YC2B 2DQIH 4GG6E 1E6OH 3P4NA 3F7QA 1A3RH 5HDBE 1UH3A 3MFFB 3EO9H 1BWWA 4PJFB 5EU7E 4LLYA 1MLBA 3T0AA 5FHBL 5TQ0H 1ACYH 4F7TB 3PDOA 2MJWA 2M26A 4L3CB 2OTUA 4JFHD 5D2NC 1T4KA 2VR9A 3IF1B 3DVNA 5KVMC 1OTTD 1ADQL 3OR6A 2QQNL 1YEFH 3MRFB 5CWSB 4YDJB 1Q9OA 1IKNC 1JMZA 4P46C 4GAYA 4F3FA 2CGRL 1A4JA 3L95A 4U1MA 3T0VA 3ZKSD 3STLA 1ERNA 5FOBB 1G9ML 2P42B 5DD1H 4YPGA 5D96B 5AD0B 1D9KC 3GSRA 4C57C 5DJCB 4I18B 4MMZC 5C3LD 4ODSH 3WBDA 3SGKA 1HK6A 3MOAH 1WSST 1KNOA 1NGQH 3SN6N 4ZYKA 4Y4KA 4NC1C 4PJHF 3SGEH 3TPUA 1VADB 5TH2B 5IMKB 4Y4FD 1MJ8H 1SEQL 1CZ8H 12E8H 5EB9A 4XCEA 1A6TB 4DOHE 3ECBA 1EO8H 4JZNB 4LRNL 3AVEA 4NC0B 1MHPL 3U83A 2VAAA 1ZVSA 3HMXA 3WFDL 4HV8A 1HCVA 4BUGA 3HFML 4OCRH 4GQPH 4LF3A 1DVFB 5E2WL 4CVXA 5L8KB 4HWBA 1Y6KR 1IQDA 4PJGA 1LE5A 1M71B 4U0QB 4JZOA 1BMGA 2DTML 3G5YB 4P2RA 3NFSH 4O2CA 4JJHA 1YMMA 3MMEB 1EBPA 1K6QL 3OSKA 4BFEA 2XTLA 4F7CA 3VI4F 2MNUA 1KN4H 3ZE1E 8FABA 1IGJB 4XMLL 1BEYH 2C9AA 2YPLD 3PP4L 4N9GB 1BZ7B 5T3XE 5T5NG 3S34H 4LLVB 2JELH 5GS1B 5IEHB 2CMRH 2YD5A 1L9MA 2H26B 2XWBA 3IDYB 5GS0H 4JO1L 4ETQB 2ZUTA 5DC9B 5E8EB 3O3EA 5CEYA 1RJLB 4F9LA 2DQJL 2GQHA 3MXWH 4LSUL 2DI9A 3AREB 2FR4A 4U1GC 1JGUH 3FQWB 5T3ZH 5I1KH 4ODVH 2IQ9L 1MY5A 3BP4B 5C2UB 3M8OL 1RZKL 4FQ2H 4O02H 4PJXF 5HGAA 1Z9MA 2AI0L 1U8HB 4WI5A 4Q2ZB 5FHAH 3WE6A 2R4SH 5BJTA 4RISH 5FK9B 3KLAA 3TYFB 2B1HL 1PLGH 3QO1B 1A02N 3LKRB 5C2BL 5IQ9A 5TE7H 2WZPD 3DUUB 2ENYA 4YXLL 1FSKB 1S9WA 3H7BA 1NEZG 1ZEAH 2ZCKL 4ODHH 1VFBA 2YRZA 3UJTH 3TO2A 4PRHE 4KXZH 1JRHL 1NQBA 1F4XH 5K9OA 3BPLC 1UCBL 4RDQG 5D93C 1IGML 1MVUB 3N85H 1MJJB 2EC9T 3OF6A 3GFUA 5HYQA 2ERJC 3LEYH 3IGAB 2NX5E 5GGRY 2CSPA 4LKCA 2XKNA 2YWZA 1DUZA 5JLZA 5C07B 2J8UA 1HHIB 1ZKAA 2Q8AL 3NCCB 4OQTL 2NR6D 1FHGA 2AXGB 4LSSH 3MJ8B 1KJ2B 4MAYB 1CD0A 4RQQA 2E7MA 4GRMA 2PXYB 2G9HB 4MNQE 4YO0B 1KCSL 3CUPB 3MV7D 1DBBL 3HAEA 2OSLB 4AM0A 5HYSA 4NCDA 1XT5A 2R1WB 1OAUL 1ND0A 3K80A 1C12B 3QFJB 4OCYH 1AKJB 3RWEB 5DEGB 3QQ9C 5I8EB 1HN1A 4KQ3H 2ZUQC 2HFGH 2JJVA 5FYJH 4XTRD 1ULVA 1J87A 1E4KA 2KUTA 5I8OL 4O2FB 2XN9E 4XMPH 2ZOLA 3SDDA 2BSSB 1IEBA 3LVEA 4FFVC 5KVFH 1YJDH 4LASL 3LKPA 4NQEE 1I1AC 5DJ2B 3CDGB 1RJYB 1EHAA 5SWZB 2X4PB 2ICES 1B2WH 4WI8A 3WNLA 5JOPE 4JQIH 2QSVA 2XPGB 3OHXB 4NHUA 3P9WB 1FL6B 2YA2A 1W72A 4HWUA 4UOJA 1AR1C 2FL5A 2APBA 1T66C 1GOHA 3DX6B 4JY5L 4UT6L 5E6IA 3MCLL 5CSGA 1JTTA 4ELMA 2ICWJ 1FE8H 4TRPH 5DQJA 5EZJB 1FQ9C 5D7LA 4TOYL 5D6DC 3QA3B 1CK0H 2VDQL 2CJUH 3A6OA 5HYJD 1GGBL 5C0BB 2XWTB 3TA3B 4QHNB 5DSCA 3QDMD 3RGVC 5GZND 2CQVA 5FO9B 5B8CC 3VFWA 1HXMA 2HLFC 3MREB 3QUYD 1YEEH 3SGJA 4WUUD 2RFXA 4TVPL 3EZ8A 2AJXL 2ORBL 4XCFH 4EIZC 5CBEB 5IGXH 4WI4A 3TCLA 3BW9A 1XZ0A 2QV2A 3TVMC 2X1QA 4ZAKD 5T3XH 4M1CD 3SQBA 4LK4A 3UTPE 5AEAA 5TDNB 1MIMH 2AK4B 2FRGP 3OKYA 3G6JF 4CU8A 3E3QC 3AFLA 5FA3B 1W8NA 3FFCA 3TO4C 3OKOA 1BIIA 3LIZH 3MACL 1KTKE 3QJFA 4YH6A 1MCHA 4L4TE 1BOGA 5ADPL 1Z5LA 1CGSH 3GSNA 4HS6A 4X6DE 3O2DA 1S7UB 4N1HB 3QUMB 3MLUH 5DA0B 4FQQA 1JTOA 5CS7A 1YN7A 2F9BT 1GZPA 3ROLA 1LO4L 3CJJA 1D9KD 3LB6C 3UYRL 3OXRB 3OZ9L 5F71A 2VNCA 3SE9L 4NQSA 3JTTA 3BIKB 4WHTB 5BVPH 1BFVH 1QRNB 4B41A 3VGEA 1AY1L 2DBJA 4MA8L 4CDGC 3LH2L 4UIMA 1QFWI 5LCVH 4I0KA 2XZCH 3HRZA 1IFHH 1N2RA 3GSUA 1CU4L 2ED9A 3IAPA 4NRXB 3FOMA 4Y4HC 1C5BL 3V4PH 1LO0H 2M2DA 4HLZG 4I0PC 3A6CH 5I2IA 1C16B 1UXWA 5L88L 3GMNB 5IESL 1ZT4A 5IROA 3VMOA 4NNPH 4XPFL 3PGFH 3MRRA 1HHHB 2W59A 3BX7C 1A6UH 1MFEL 3CPLA 4LOUC 1YNKL 3ES6A 4J3VA 1KB9K 4NO3B 3MRMB 4PJ8A 3Q3GB 2W9EH 3DGCR 4U6HA 2LTQC 1MJUL 3P9MA 3ABZA 4QEGA 4I77L 3M1BA 3CSGA 4LU5H 4DJMA 1JWSB 4Z5RA 5GIRB 4NGHH 1FN4A 2Z93A 2Y5TA 3DSFH 1P6FA 4HF5H 3VGAC 1JUFB 5KAQF 2VLRB 4ZTPL 1ZA3B 4Z7QE 1A7NH 4ESKA 3TZVD 4RIRA 4FQJL 1P53A 3D87B 4LP5A 15C8H 4G9FB 5E08H 2XY1A 5I1IH 5F7UA 2Q7NA 2R0KL 4C59B 5JDSA 5IB5A 1NLDH 3ZDXE 1DCLA 1T22A 2HJLA 1HHKB 1KJMB 3L5HA 3AS2A 1KPVA 5K59E 4XPBL 4APQD 4PRNA 2P45B 4HIEA 4KKCC 5HGDA 2FX7H 1J5OH 3O4LE 3R06A 5C0DB 3BPOB 1JPST 3K8MA 3LOWA 3WS3B 1V3MA 4FOMA 2NY3B 5MI0B 5GRJL 3MROB 2BNQE 2JB5H 4LPTA 5SWSE 1UKQA 1VEOA 4D2NA 2CDFB 3ARDD 2FBOJ 3F12B 1IKNA 3P4NB 3MNWA 1YPZF 2V9QA 3ARXA 2DQTH 5J57B 4LLYB 1MLBB 5DVOA 1NH6A 3JWOL 4M7JL 3Q1SH 3PDOB 1WTGT 3LKSA 4LCYB 3VWJC 4DUXA 1TVBA 2OTUB 4KHTH 3DX9A 4ODTH 3W0WE 4KZDL 1T4KB 3G5XA 1MCFA 5CGTA 3WIHA 3DVNB 2YK1H 3OR6B 3WL9A 1FJ1A 4WO4D 1Q9OB 4UZGA 1J18A 1SY6A 3EO1A 4GAYB 4F3FB 4C56D 1A4JB 3L95B 2XRAL 4U1MB 5D1ZC 2D0GA 3FQTA 3H8NA 3STLB 2PF6A 1HDMA 1JGVH 4YPGB 2NYYC 3CZFA 2BNRE 5CKGA 1DQMH 1KJ3L 3I9GL 3QUML 1SBSH 1KNOB 3GDBA 4ZYKB 5FCSH 4I3RL 4Y4KB 4O58H 1SJXA 4LDOB 3TPUB 1L7IH 3BGFB 5EU5A 3ULVL 5SX5K 4XCEB 3ECBB 1I1AD 4KKAD 4OKDA 4LARH 2R2BA 3U1SH 4BSVA 4R8WL 4JHBA 4Z0BH 2VAAB 4RMSA 4EOWH 3HG1E 1ZVSB 2NTFB 2NY1B 1F90L 2OR8A 4HV8B 3I6LE 4LF3B 3S35H 3QIBC 5DT1L 4CVXB 1AR1D 4IBLT 4AIOA 1JBJA 3ULSA 2AERT 4UV4H 1IQDB 4PJGB 3U7AA 4JZOB 2YKLH 4P2RB 3S88L 5EU4A 4L1HA 4O2CB 3BT2H 3QCVH 1FCGA 1YMMB 1VKXA 1INQA 2VOTA 2HH0L 1P9MA 2CRZA 2OJZL 3B2VL 4F7CB 4KVCL 1XMWA 1MH5A 8FABB 3CLFL 3PWJA 1Z9OA 1IJ9A 4BFGA 4YNYA 2Z31A 1WITA 4JY6B 1H8SA 1D6VH 4UINL 1LK3H 4OZ4A 4KUCD 3DETD 2XWBB 5CEZE 3IDNA 5J3HC 4CAGA 4YHYB 4U2YA 3O3EB 5CEYB 3BE1H 3QNYA 4Z77A 1X9QA 1S7WA 1NJ9A 1I9JH 2OXGA 2FR4B 4YHZH 1CWVA 3KPPA 4NQUA 4S1QL 2X5PA 1ZTXL 5HGAB 3IAGC 3HC4H 5HD8C 5KZCB 3WE6B 2O5ZL 5BJTB 4F37K 4JVPA 2P49B 2XIDA 3O2WL 1WAAE 1JNLH 3UTZA 4IM8A 4RFOL 4NQTA 3RIAF 3JXAA 5IQ9B 1S9WB 2GK2A 1B88A 3FB7A 3H7BB 1VFBB 1GGUA 3TO2B 5K9OB 2VDPL 3HI6L 1UZ8A 2AK1H 3ARUA 1YZZA 2OP4H 4JFZL 5KSAC 4NUGL 3DMMD 1S3KL 4WY7L 5HYQB 5CEXA 4R26H 1WEJH 4X7SL 1CFVL 4LKCB 2XKNB 1DUZB 3EYFA 5DMGC 4KJWD 2Q87A 5JLZB 4YXHL 1P69B 2J8UB 1JGLL 3UC0L 4PJIF 4D3CH 3QCUH 1TDQA 1MCBA 4RQQB 4X7FC 1UH4A 4GRMB 1LNUA 1AD0B 1AXTH 5JHLL 1TJHL 4YDIH 3B9AA 5D7IE 4XNXH 3SGDH 3CFCL 3H9ZA 2LFGA 3S37L 2E9BA 1S5HA 3HAEB 4KDTC 3ARED 4AM0B 5HYSB 2J1KA 1ND0B 1S7SA 1MCJA 5AUMA 4NDMA 3MJ9A 3MBEA 2I07A 4G7YL 2HFFA 1MFAL 4ONHA 1G9NL 1JZ4A 1UG9A 2ZOLB 3V9FA 4OCMC 4NZJA 5I1HL 5FGBC 3SDDB 1IEBB 4KI5F 3LKPB 3QDAA 4HBQA 5FUZL 3U9PH 3TN0C 4TNWK 2OTPA 4LVNB 5B8CA 5INCA 4FHBD 4I5BA 3ZDYE 4NHUB 4CU6A 2JCCF 1RIHH 1W72B 1HIML 2VXUL 1MFNA 1QVOA 5E6IB 5A3ID 4PJEE 2RCSL 4ELMB 4DN3L 4JKKA 2R0WL 1EMTH 1NAMH 3RP1A 1FZOA 5DQJB 4Z7OF 3TFKD 3MA9H 3LMJL 4POZC 5D7LB 4F80A 4CMHC 3EYSH 4HWBL 4FXGA 5HHNA 5D2LE 2EH7H 5DSCB 5I1DA 5IOPA 4MAYD 3VFWB 1HXMB 1T80A 3PXHA 4N90D 3DARA 3GO1L 4IMKA 3NMEA 1GAFL 3QRGH 5ERWA 5HBBA 2RFXB 3C09B 1YEKL 3JV0A 4PYHA 1RIVH 1I9RL 2FD6L 1KPUA 4YBLC 1KENH 4NPYA 4WWKC 2ID5A 3TCLB 4QRRA 3BW9B 1XZ0B 3ZT6A 3GIVA 3EDDA 2DD8H 1MQKL 2W0FA 1QSVA 4M5YL 1CBVL 4PRAA 1UH2A 2FEDD 3RVTC 2W0PA 4WFED 3G08A 1YEGL 2R1XA 2PO6C 3MLXH 2BVUA 3VGDA 1FRGL 2V17H 4XAWL 4OT1L 3FFCB 4WTZG 1PBYA 3OKOB 1BIIB 3QDGE 1U8QB 4KQ4L 1RUKL 1MCCA 3QJFB 2AXHA 5DTFA 3RA7L 3ZHKA 4X80H 3GGWA 1BOGB 3AU1A 4EN3D 1Z5LB 3FJTA 4JG1L 4KAQH 2OL3H 3VFUA 3GSNB 4HS6B 3U6RB 3NBNA 1NBQA 2DM7A 5SWZD 1OTUD 5B3JF 4JDVA 4FQQB 4TULH 1T7WA 1YN7B 1QRKA 2R8SL 4JKMA 3BMWA 3UJJH 1S9VA 3MXVL 1GZPB 3ROLB 1KELL 3ZYJA 4DGYL 2ZKHH 5DEFA 4P23D 2EDHA 2LVEA 4NQSB 3JTTB 3CC5A 2NW3A 1CS6A 4Y5XC 3BWAA 2VXQH 1QR1A 1BAFL 2IADA 4AEFA 3QPQC 4R90L 4UIMB 1Z0MA 1EAPA 1QLEL 1N2RB 3GSUB 1GGYA 3HRZB 5FIEA 4Z7UA 1VGEL 1MRCL 4KDVA 1KT2A 3FOMB 1XGYH 4YHOL 1R3KA 3WFZA 2EDKA 3UTTA 4H1LA 1WFOA 1KC5L 3MZGB 2H32A 3QG7H 5F6HI 5I2IB 1UXWB 1ZVYA 3L3IA 1ZT4B 3QIBD 3ZYZA 3ALXA 4OGYH 1HSBA 1T83A 3WFEL 4OD1L 3MRRB 2BVQA 4XCNA 3CPLB 1QPPA 3ES6B 1XIWC 4XP6H 4PJ8B 3MOBH 1UWGL 5C7XH 2R29H 4U6HB 3P9MB 3WIFB 5LXGL 3M1BB 4KRMB 5BRZA 4Z5RB 5ETUA 3AB0B 1FN4B 2Z93B 2Y5TB 5DXWA 4ZNEA 1MI5A 1N6VA 3ZKXB 2YWYA 4KRPC 4HZLA 3VXMA 2WV3A 4BSJA 2WUBH 1L7TH 4RIRB 4ACPA 5J3HD 2CXKA 4BA8A 1X5FA 3HZMA 3HB3C 4EXPX 5JDSB 1OAZH 5IB5B 2FECI 4HXBH 2WMPA 1HE7A 1T22B 2HJLB 1IGIL 1CVRA 2AAVA 2BRRH 3QZWG 4ALAL 4POUB 1QHPA 2FJFA 3ULVD 1CLYH 3VWJA 1KPVB 5HD8D 4PGDA 4PRNB 4HIEB 5HGDB 1CDJA 3U46A 5EWIL 3R06B 2X89A 3HI1A 1FFOA 4JR9L 2MHAA 1WWBX 1CFTA 3AS3A 5T1MA 2NY7H 1N3NA 1LO2L 4PJ7E 4C4KT 4DZBA 4DEPC 3QBTB 3RX8A 5C6PB 1Q9LA 3C9NA 4YDVA 3SHSA 3MLYL 3OXSA 3X3FH 1KCUH 3MNWB 5D1ZA 2VZOA 5HI3D 1CG9A 4F58L 1E4XL 4IIQC 5FCUL 4QTIL 2DKMA 3QUZD 4IMLA 3OPZL 1CE1H 1OLLA 3LKSB 1TVBB 3MJGX 2EDQA 2G60H 4DN4L 3DX9B 2NW2A 2H6PA 3G5XB 1DL7L 3VDAA 4YHPA 5ABDE 2Q6WA 4UTBL 3ULUH 4Y5VC 3BIBX 5IT2L 5BMFH 2Q86A 5JA8B 4R7NA 5L2KD 4OCWH 3IDJA 3V0AC 5KAQG 1IZKA 3S3PA 1FJ1B 4LSQL 1P4BL 2WAHA 1IGFL 5DJ6A 1NMCB 4K8RH 3V4VH 4ZG1A 3EO1B 1LQSR 4GAGL 1T7VA 3FQTB 1HDMB 1JYWA 4YQXH 3CZFB 5KSBE 4M6NH 1GIGL 3VDCA 4RMQA 3O2DL 3BN3B 2P5EA 1HKLH 4DQOL 3RWFA 1PG7L 4HSQA 3SJVD 2IQAA 4P59L 5DYOA 1D5XA 5I6XB 5EU5B 2NY3D 3WXVL 4DKDC 2UVEA 1WFTA 2R2BB 4BSVB 1QTYT 1J8HA 4JO4H 4JHAL 3GJFH 4JGJA 4M7ZB 5JHDA 3ZO0A 4YDKH 4WVRA 2XQYK 4HLZH 1AQDA 3QDJA 1T89A 4U1GB 3ULSB 2X1OA 3V2AR 3HA0A 1N59A 4XCYA 4BKLA 4HFUL 5IVXA 2C4XA 1OPGH 4CN4A 5EU4B 3SDAC 4PLKD 5I9QC 3DHMA 1VKXB 1INQB 3UO1H 1VEPA 3SKMA 4YX2H 4XAKE 3EOTL 2EH8H 3E2HC 3AY4A 1KF9B 4URTB 1AQKH 3PWJB 2HT2C 4TSBH 1OWRM 3ILQC 3LPGA 2IJ0C 2XTJD 4K7FA 4YNYB 2Z31B 3H3KA 1DUYA 4MSWA 3J7HA 3TPKA 8CGTA 4EBQH 4OZ4B 2F8OA 1IL1A 1A6PA 2Y36H 3IDNB 5EBMA 4P5TC 1QHOA 4G6JH 2FATL 2BVPA 3QNYB 3BPLB 4UIKH 4Z77B 1H3PL 1S7WB 1NJ9B 3KJ6H 1ZVHA 5ICZA 3EJZD 3VD4A 2XQBL 3KPPB 4HW6A 1NDMA 5KS9A 3OJ2C 5KSAA 3STZA 2ERJB 5ISZD 3VRJA 3D3VD 4C55A 2ZUVA 2DLHA 4JFDE 4YLQT 1OAYL 1ORQB 4PRIA 4WFHD 1E27A 3UTZB 4PV8A 3KLHD 2CUHA 3FB7B 3U0PA 3KPRE 2FB4L 4P3CH 1X4XA 1T21A 2Y07H 4YAQA 5HYJE 1RMFL 3GNML 5BS0E 2WWMC 1UZ8B 1A8JH 5MERA 2XZQH 1GPOH 4M1DL 5CEXB 3VJ6A 1HHJA 5HHOA 1UGNA 4LHUG 1CGYA 2GAZA 3R8BB 4PGJA 5GS2D 3OBAA 4AH2A 4LMQE 5CCKH 4JEGB 2VSDA 3EYFB 5EUOF 1TNMA 1IKFL 3QPQD 4XWOC 1R3LA 5MENE 1Z9SA 3W11C 2YA0A 1MUJA 3H2WA 2HKHL 1LNUB 2I25N 1XF1A 3HPJA 3L6FA 1TITA 3WIHL 1RU9L 3NGBC 4LCWA 2NXZD 4XT1C 5CJBA 4NNYA 4PJXE 2W92A 4MQ7A 4WWID 1S5HB 4Y8AA 1U95A 3QULA 5F6IC 4OF8A 2OZ4A 4KC3B 1S7SB 5AUMB 1SY6L 4Q9RH 4XP1H 4W6XB 3MBEB 4LPUA 2I07B 2X4TA 5GGUA 3QJHA 2HFFB 4ONHB 1SJVA 1QSEA 3QRFM 1FAIH 2QSCH 3V4UH 5L7XH 3A6BL 3MRQA 1QNZH 3HHRB 4PRPE 2VLKA 5JUEH 1AGBA 1DJSA 5B8CB 1MCWM 3HPLA 4JFXA 3P11H 4F7EA 1EK3A 5INCB 5C08D 2DQGH 1BFOA 3FT3A 3B5HA 3VXUD 2AEIT 4I5BB 4U1NA 4KZEL 4PY8I 1F3RB 5HVGB 4GAJL 2GHWB 1MF2L 1CLZH 1HXYA 3O3AA 1QVOB 3F6LA 1EFXD 1NFDE 4V2CB 1FZOB 2OR9L 5EPMA 3CLEL 1MAKA 1W2KT 2PO6A 5FUOL 4M5ZL 3DBXA 3KYNA 1K4DA 5HVWA 1CCZA 3AAZA 4FXGB 4HH9A 1G0DA 2DL2A 5HHNB 4Q0XL 3R1GH 1I9IL 5I1DB 4M7LL 5I1JL 5IOPB 2CLVA 4BM7A 1YUHA 4OAWA 4K3GA 3KJ4C 5ERWB 4WTXA 1KPUB 1G7HA 4NPYB 5LG1A 4QRRB 4PP1C 1B0GA 3GIVB 2W0FB 4XPTL 4PRHA 1DANU 1UA6H 5IQ7L 2GUOA 3QG6A 3ARBA 4PRAB 3G08B 4F57L 2R1XB 2YRLA 4S1SL 4IRSA 2BRQA 4TN9A 5I8CA 4FFZL 1Z3GH 2DB8A 4GSDH 2XA8L 4M4PA 4LMQI 5DTFB 3LEVL 5HDQH 4Q6IC 3GGWB 3AU1B 3BP5A 4X5WA 4KXZI 4GXVL 4J4PA 3VFUB 1P7KA 2OJEA 4LPYA 4Y4HB 5L6YH 4LQ1A 5EOQH 3B83A 3U30C 1PY9A 4JDVB 1XCTB 2PR4L 3CZJA 4PJDF 5CZXD 4CN6A 4F15C 3EFDL 4LAQH 4L8BA 2VDML 4NBXB 4TSAL 1N6QH 3FB5B 1MAML 1S9VB 3RY4A 3EOBA 1ZHLA 3NCBB 4MGXA 5DEFB 4NC2B 2IPTH 3KPOA 3CFDA 3B2UC 3NN8A 4CUCA 4PG2C 2IPUG 4N0YL 2NW3B 4BUHA 4JFPA 1KCVH 4RA3A 5TPWH 1QR1B 4FQIL 2IADB 3RUGE 5I74B 4OZIA 4LCIL 5AWNH 2YD9A 1EAPB 3IRPX 2EZ0D 4Z7UB 4Z7WE 3G9VA 1KT2B 4U05A 4WI9A 2YA1A 5K9JL 1NBZA 1TQBC 1NCNA 4X8JA 2R4RH 1R3KB 3UTTB 2H32B 3CVHH 3G6JE 3L3IB 1BD2A 1QBBA 4JFFE 2IAMD 5DUML 1HSBB 4OLYH 2BVQB 4XCNB 4KJQC 4QRPA 1QG3A 2NTSP 4C56E 4BJLA 4BYHA 1R3IH 5TFSH 5BRZB 2HRPL 3WNKA 5IBLC 1NFIA 5ETUB 3WCYA 1I1FA 4K94H 4LSTL 4UMGA 4MQSB 3ILQD 1MI5B 2ARJQ 3ZTNL 4UDUA 4XXDA 4MA7L 4H0IA 1RUAL 4HZLB 4JN1H 3HZMB 1NL0L 2BX5A 3ZHLA 1A1MA 1G9EA 1SEBA 3PWNA 4IIQA 3MRPA 5JTWA 4GOSA 4O2EA 1LDPH 5D7KD 4JPIA 3E1F1 2FJFB 3VWJB 5F7KC 4PGDB 5HXMA 3U46B 1FV1A 2X4UA 3HI1B 1WCBA 4PJFE 1FFOB 1Y18A 2MHAB 3VRLF 1PFCA 5FHBH 1CFTB 1WIPA 5T1MB 4C4KO 1N3NB 5H37H 3GSWA 4DZBB 1AGCA 2GT9A 1G7PA 1Q9LB 3C9NB 4YDVB 1RZ7L 2ZNWA 2A83A 2ESVA 2X4QA 5JXAL 3OXSB 1JZ8A 3D1MC 3QXUA 4L4TA 1RUMH 5D1ZB 1CG9B 1F3JA 1V3LA 2KBGA 2O5XL 4IMLB 4G43A 1MWAH 3IFLL 3WNNA 1R0AL 2CKBL 2NW2B 5GSVA 2CGRH 2H6PB 3QQNA 4G42A 5EOCJ 2DMCA 4YHPB 2Q6WB 1SM3L 4YJZL 3SKNB 1G9MH 2Q86B 4R7NB 2ICCA 3IDJB 3S4SA 4B7IA 4DZ8A 1NDGA 4XWOD 3P3YA 3ARQA 1HYSC 5DJ6B 5F3HA 3DVFA 5I1EL 4H8WL 3CXHJ 4BZ2L 4ISVA 3NACL 2QADB 4E41D 3PP3H 5GRVK 3ARFA 2D7QA 1SEQH 2ED8A 3F8UB 2QL1A 5C0CA 1NC4A 5EH1A 5LWYL 2J4WL 1N4XL 2EKJA 4EI5A 4LRNH 1CTNA 3ZKQD 1MHPH 3BSZL 1BVKA 2P5EB 2P8MA 3SDAA 1KTRL 2A6JA 3DIFA 3HFMH 3RWFB 5E2WH 4L4VA 1FFNA 2UWEA 3A0OA 3HCVA 5DYOB 1D5XB 4KV5F 4J1UA 2FH6A 3C5ZD 4NQXA 4R0LC 1DBMH 1J8HB 5J56B 3WN5C 4AG4H 3ZE0F 1OTSD 3WHXA 5JHDB 3MV8A 3VXSD 1NCAH 4XVJL 4XMLH 1AQDB 3QDJB 3BEVA 3PP4H 5DR5L 1NGYA 5IVXB 4BKLB 5IKCA 1N59B 4XCYB 1ZLSH 1JHTA 4HDIA 5T33L 5JPNA 5D70L 5E00A 3PWVA 4PRBA 4JO1H 1YQVH 2RBLA 1NAKH 2GJJA 3SKMB 2D0HA 3T0ED 4LSUH 4DVRH 4OF7A 3HC3H 1G7JA 1RZIA 1ZAGA 2IQ9H 2Q20A 3GK8L 5EA0H 3L5WA 3M8OH 4K7FB 1RZKH 5KVEH 1RURL 2ILLA 1DUYB 4MSWB 3DRTA 1I4FA 5E24E 1FGVL 1IL1B 5EBMB 4ZO8A 2CUMA 2B1HH 2BVPB 3T3PE 4A6YA 5DHYA 5C2BH 5EOCH 5ICZB 1UM5L 2C5DC 2DQIL 1NDMB 1E6OL 5KS9B 5KSAB 1JTPA 4NN6C 2ZCKH 3STZB 3GIZL 3O11A 3WKMH 3VRJB 1OF2A 3JWDH 1UCBH 1CVSC 4JRXD 1WISA 5F21B 3QI9A 5TQ0L 3HR6A 4PRIB 1IGMH 1E27B 3I3DA 3AROA 4MWFA 4PV8B 1YECH 4XNQA 3BISA 1BJ8A 3U0PB 2VKWA 1YEFL 1U8JA 4HJ0C 4G7VL 2RB8A 1T21B 5IJVA 3W5MA 4YAQB 3V6OA 5C07E 3MLWH 1MFDH 1M4KA 2RJMA 3U36B 3GJFK 4OQTH 1JIBA 3WO3B 1J8KA 4JFEA 5M94B 2HTKD 5MERB 1KN2H 4S0SD 2IBGA 3S97C 3VJ6B 1HHJB 4Z8FL 4BZ1L 5HHOB 1ETZA 1MPAL 5CUSL 1Y6NR 2GAZB 4AH2B 4YHMH 2JJTC 2P8LA 3C60C 3RWIA 1RUPL 2F54D 1KCSH 1DBBH 3MOAL 1L4IA 2IWGA 4NO2A 4ODWA 4O5LL 3FFDA 3QFJE 1R3LB 5F1IA 4DKAA 1MUJB 1W8OA 1AHWA 3MLSL 3HAEG 5HYSG 3L6FB 3C2SA 3HPJB 4YZFF 1I9EA 2ICEA 4LCWB 5I8OH 4PJ5D 4ONGL 1CZ8L 4NNYB 3RZCA 4MQ7B 4NRYA 2YD8A 4DKEL 3FCTA 3LHPH 4DOHB 1RPQA 5E4IA 1U95B 1B6DA 1WGOA 3QULB 1I7ZA 5SWQA 4LASH 4M8QB 4JRWA 4LHJB 3Q2CA 5L8LB 4RGMC 2X4TB 5SWZE 5GGUB 5HHPA 3ARVA 3QJHB 5JORA 1TCMA 2O5YL 4MXQC 1Q38A 1DN0A 4G5ZL 4QCIB 1QSEB 5CJ5A 4XHJD 2XYCA 4JY5H 4CMHB 3J8F7 4UT6H 3MRQB 4YIQA 2VLKB 1AGBB 5ITBH 3HPLB 1QLRA 4JFXB 4Z9KB 4F7EB 2C1OA 2QEJA 4TOYH 1BFOB 3FT3B 3VGBA 3NZHL 2R2CA 5MP6L 4U1NB 3MSPA 5C0BE 1GGBH 2OTWA 4ZD3L 4WWKB 2A6DA 3IKKA 2JELL 5DUBA 1KLUA 5GS0L 4N1EA 1HXYB 2K7QA 4NWUH 1CE6A 4PP2A 2DI8A 3MXWL 5DRWA 5IK3A 1M05A 5EPMB 4Z7UF 3U0WL 2PO6B 4HEPG 3DBXB 4FQ2L 2UYLA 3KYNB 1K4DB 3AAZB 4HH9B 5HI4D 5F9WC 2AK4E 4RISL 3VFPB 4Q6IA 2CLVB 1YUHB 4OAWB 2A9ML 3NCJL 1DFBL 1UEYA 1G7HB 1I7RA 4ODHL 1B0GB 5CHNA 1II4E 2Q3ZA 3EFFB 3UDWA 1F4XL 4BQCA 1ZHBA 1TVHA 2GUOB 3ARBB 4ZPTA 5ADPH 5E1AA 3CK0L 2DLTA 3MBED 4ZUSA 4N8VA 4X4ME 1AR2A 1T1XA 5HGBB 3N85L 2E7LC 4PG2A 3RDTA 4IRSB 5I8CB 2CR6A 1AH1A 1ZT7A 5AZEL 3LEYL 5DRNA 2B4CH 3EJJX 5FUCC 3ULVE 2DLGA 1OGAA 5GS0C 3SE9H 2KKQA 3BP5B 4X5WB 1FZMA 2PNDA 1QRNE 1P7KB 2OJEB 4V1DA 5ENWA 1FNFA 1FO0A 4MA8H 2X42A 3BYTA 3RBSA 3PNWA 3LH2H 1JF1A 4MMXC 3GHBH 4L8BB 2G5RA 1O0VA 1CU4H 1CXEA 3EOBB 1ZHLB 3ZKMD 4NQDA 4U6XA 1C5BH 2HTLC 3KPOB 2X44D 5C0AD 3NN8B 4Q7DA 4Q6YA 4HUVA 4JFPB 2NY2C 4LLMA 2J88L 3OAZH 4KVNH 4KQ3L 1P7QA 4PJCA 4OZIB 2HFGL 2W9DH 4M43L 1M6OA 4UOW1 4XPFH 4AQOA 4OLUL 5FM5M 3S37X 1MFEH 4XMPL 3D0VA 3QAZB 1NBZB 1X6LA 4KRPB 1T2QH 1MJUH 1CYGA 4X8JB 3VDBA 5KVFL 4I77H 5JZ7D 2MMXA 3H6JA 3O4OB 1PJ9A 3GMQA 1BD2B 5IIEA 5SX4H 4KU1A 3O6FA 3VCLA 2VLRE 4EIGB 4XB8A 4JQIL 4ZTPH 4QRPB 1B6UA 2FLBT 4ONFH 3S36H 3EYUL 4XRCA 4GLRH 4G9FE 2N4IA 1VDGA 3UAJC 5EU7C 4OGXL 3RTQC 1G6VK 2IG2L 1NFIB 4IDJH 1FE8L 5DLML 3FHAA 4UDUB 4XXDB 1P6AB 1UWEL 2PTTA 2CJUL 4XPBH 4M00A 1MSPA 5D5MA 1NCDL 1A6AA 4R96A 4JO3L 3P9LA 5I71C 4XC3L 1A1MB 3DV4A 1YEEL 4KTEL 1EUUA 1SEBB 3PWNB 4IIQB 3D39D 3MRPB 4P57A 4O2EB 1DQJA 3KHOA 4JPIB 4PB0H 4QHMA 5I18H 1DSFH 3CSBA 5T3XL 3TNNA 5LQBL 1FV1B 2DJUA 2X4UB 1YJDC 2J6EH 1Y18B 3WMSA 3JWOH 2FHFA 2VDRH 3F62A 4WI3A 4WJ5A 4OFDA 4GO6B 3GSWB 3PDGA 1AGCB 2GT9B 1G7PB 3BN9D 2IF7A 1ZOXA 4WRLA 2A83B 2ESVB 2X4QB 3EGSA 5FKPA 4FFWD 2GEEA 3UTTD 4EDWH 5IVXF 1S5IL 5DQ9A 1AFVH 5CIPA 2F53A 1S7XA 1F3JB 4RNRA 4YHLH 4G43B 3BZFA 3UBXI 3X12B 4LVOC 1T7YA 2C3XA 4G42B 4RFEA 1N5YH 1A6ZA 4R2GC 4XXCC 1UJ3C 4OLZH 4JQXC 3P4OA 1DEEA 4IS6A 1R6VA 3S4SB 4BQ6A 4NSKA 4DZ8B 1NDGB 4PR5A 1BFVL 1DQLH 3I9GH 5F3HB 3QUMH 4ORZC 3SY0B 2FGWL 3HE6C 4I3RH 4ISVB 3VXMD 4MS8D 4WFHE 3TWCL 3PJSA 3B9KC 4NQVA 4OBSA 5DC4B 1BIHA 3QXDA 5KS9F 4KK6D 3ARFB 4D0DA 5BQ7A 2C26A 4H20L 4POYA 3DOSA 3ULVH 3D0LA 4YHNA 1LO0L 2FJGB 1NC4B 5C0CB 4I9WD 5GJSL 3CXDL 1CD8A 3A6CL 5E2UH 4EI5B 1IAII 5L8JB 3MZTA 2F19H 1BVKB 1SMAA 2P8MB 1GJIA 4NNPL 3SDAB 4YFLF 1F90H 2A6JB 3DIFB 3OAUH 4L8SC 3PGFL 1X5GA 3CFKA 4L4VB 3KPSD 4HG4J 5JIIA 1A6UL 1FFNB 3BEWA 1BJMA 4GRWF 2X89D 1F8TL 5DT1H 2UWEB 4PJGE 3HCVB 1LO3H 3NCMA 5EBLA 3BPNB 4P2RE 4J1UB 2DM2A 3S88H 1TQCC 1YMME 4NQXB 1KTLA 3GI9L 5LBSH 2HH0H 5DFTA 3CAFA 3B2VH 3WHXB 2DQDH 4HF5L 2JLLA 4KVCH 1F5WA 3MV8B 3OKKA 3CLFH 5F7MC 5DK3A 4P9HH 2QQKH 3BEVB 1A7NL 1NGYB 5BV7B 2QHRH 3MUHL 5IKCB 4PPTA 3P0GB 1JHTB 15C8L 4HDIB 2I60L 5JPNB 5E08L 4GBXC 5E00B 3PWVB 1K2DA 3SKUD 4EUPA 4PRBB 3RNKA 1ZGLA 4OLVL 3UYOD 4OGAD 1G6RL 3MV11 1NCWL 4GRWH