4Z7XA

Mdba protein, a thiol-disulfide oxidoreductase from actinomyces oris.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
FPAPSEGLATAKANQGGIPKQVLSDASWTYGEGAALDTVAASAPVLDIYFDYSCSHCAQFEGLHTQEINQLLSDKKITLALHPCKLLQQEWTSVVMNAMGVVLDEAPAQSLSFHNAAFEIFSQAIQTKNQSNMTVEGLVAAAAKVNVPKEVSAKFKAAVDSDKYGKWVKLGDEAFKARELEGTPTVFFKGEKVDLNKLQTPTSLTELVTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MdbA
publication title A Disulfide Bond-forming Machine Is Linked to the Sortase-mediated Pilus Assembly Pathway in the Gram-positive Bacterium Actinomyces oris.
pubmed doi rcsb
source organism Actinomyces oris
molecule tags Oxidoreductase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4z7xA00
3FZ4A 3LFLA 4NMUA 1HQOA 1MTCA 3GIXA 3VWWA 1YEPA 1GL8A 3N5OA 2O89A 3ERGA 2PBJA 2KLXA 5ECLB 3L78A 2CT6A 3IC4A 3GKXA 1A23A 5IMDA 1RK4A 4GXZA 1ST9A 1O7UA 4MZWA 5E4WA 2HFDA 3WGEA 1XOBA 2C8UA 1TRUA 5J41A 3CSJA 5KN1A 1ZL9A 3D22A 5ECIB 1BX9A 4K7NA 5AIXA 2PUKC 1OVNA 1HYUA 2B7JA 1Y6EA 3TB2A 4IQAA 5JWRB 1TTZA 4N0ZA 1SJIA 2JZRA 3RBTA 3P8WA 1M2AA 2DIYA 2CVDA 2IN3A 5C00A 2V1MA 4AGSA 2ON5A 1FAAA 3RDWA 1MD4A 4PQ1A 2VCQA 3GL5A 3APSA 3MDKA 3FY7A 1URMA 5IO2A 2CAIA 2LTKA 3UEMA 5ECRB 5ELAA 5ABRA 4IJ3A 2PERA 2IL3A 4K0NA 1YEXA 5A5KA 3FZ9A 2HZFA 4TRXA 3TKPA 2GT6A 3KIJA 4ACSA 4XCSA 3F9UA 4POBA 5ECHB 1Q4JA 3GH9A 3ZMLA 3HJPA 5EL8A 11GSA 3C71A 2AJQB 5DVBA 1TW9A 3SWLA 2YOIA 1F37A 3W8SA 1QGVA 3HA9A 2B5EA 1X0RA 4V1Ag 3ZZXA 1KEBA 2OE3A 2YPMA 4TKYA 2WB9A 4D73B 2DIZA 2ES7A 3KH9A 1FOVA 1GTAA 2CV4A 3JCML 1GULA 2X8GA 3LORA 2F8FA 2O85A 3M1GA 4OFMA 1Z7PA 5CAXA 2TRXA 1FVJA 1VF2A 4GLTA 2VO4A 1XWCA 4GSTA 1V98A 3F3RA 1O73A 3NIVA 3FK8A 3GSTA 2DSAA 4MJAA 1AQVA 1JHBA 1F3BA 5AIVA 1SK0A 4Q5NA 2L4QA 2YV9A 3L0HA 4EL1A 3A2VA 4KA0A 3M0FA 3EWLA 2HRNA 5D96A 1PX6A 2OE0A 4GF0A 1UN2A 1SD8A 4POMA 1VRSD 2H71A 2VL9A 3CSIA 1PKWA 5KEJA 3KP9A 3CSHA 2DJ2A 1GWCA 2K18A 2AUVA 2GSSA 5ECKB 17GSA 4TXVA 5HR1A 4BVYA 4BL7A 1ERTA 4HZ2A 1AUCA 4JBBA 1B9XC 2X8CA 3L9UA 4AF2A 3RPPA 3TKSA 1MDJA 1FW1A 3EURA 1SD9A 5HQPA 2ON7A 2CX3A 4GSNA 4FYCA 4JZQA 1GRXA 1U6TA 4F2IA 4HOJA 2L6CA 1G7EA 1X5DA 2YJHA 10GSA 4MCUA 3A3TA 1TI1A 3CRUA 2PGTA 3US3A 4KDXA 2GLRA 1ZZYA 1XW5A 4IN0A 4XS6A 3DKSA 3KEBA 5IMZA 4MF5A 4EDZA 3DRNA 2MBSA 3ED3A 1PD21 1T4ZA 5ECMB 2WRTA 1FO5A 5IPHA 2C0EA 2DJJA 3L9VA 1NSWA 1IYIA 3C7MA 1O81A 4XRAA 2PMTA 3WD6A 2CZ3A 3EVIA 2VM1A 2M72A 4MABA 2FY6A 2K8SA 2I4AA 3IK9A 1CQGA 1A8LA 5INYA 2CX4A 2QSIA 3TRXA 4K1FA 4WF4A 2X8HA 3L4NA 3KP8A 2BTOT 1Z6MA 3GX8A 3D5JA 5GSSA 4KB3A 4E8HA 2CQ9A 3D6IA 5JCUA 1A0FA 3GKKA 2HLSA 4PXOA 4IJIA 4JE1A 3EMXA 3QFBC 5IMVA 1EOGA 2FD3A 2C3QA 3V1WA 3EYTA 3UOMA 3C1RA 3KTBA 1GNWA 1TKDB 1E6BA 3TRQA 4ECBA 1A2JA 4GQFA 3E9JB 2EIRA 2L59A 3WGXA 3LGCA 1GLPA 3KZQA 3CMIA 4MA9A 4FYBA 3LXZA 2RM5A 2ZUPA 1EP7A 4NPBA 4G19A 3IPZA 4N10A 5ENUA 4OFNA 1QUWA 2LQQA 2VIMA 1YF0A 3GRXA 4XRDA 3M8NA 1R4WA 1M2BA 4J57E 1WWJA 4PURA 1K0DA 3RAZA 3GMFA 3BD2A 2V32A 1JZWA 1LJRA 4KCAA 1N2AA 2WS2A 3TRPA 2ZCTA 4LMVA 3FKFA 4PGTA 3APOA 2HYXA 2H76A 1GTBA 1K0OA 3TCOA 2OADA 2P5QA 4JEDA 5AGYA 1EZKA 2VAFA 5ECNB 1TK8B 3A5WA 3IE3A 2NBSA 1U3IA 3DWVA 1V40A 2YJ7A 3EINA 5G5EA 2CA8A 2H6XA 4FIWA 1ERVA 1SK2A 5B6MA 1AAZA 4KAEA 4HU7A 2HZEB 3MWHA 3TGZA 3KXOA 19GSA 3VK9A 3LYPA 3DVWA 3ZTLA 3QR6A 2FNOA 4TR1B 1OYJA 4V2NA 3GNJA 2V6KA 5DBQA 4HQZA 4ECIA 4IP6A 3LEFA 3VWXA 2AB6A 1K0NA 4MMMA 2MZCA 2LRNA 1XW9A 2HZEA 1SK1A 2AAWA 3DEXA 5DQYA 2XPEA 1VGLA 5IMFA 1XCCA 2A4VA 6GSVA 5J9CA 3DMLA 1XFLA 2DLXA 1WP0A 4WKWA 4JR6A 2FLSA 4TXOB 2HT9A 1GSEA 5IMAA 4IELA 3IDVA 3F63A 4Z7XA 3BJ5A 1THXA 4MK3A 4ML1A 1V57A 5B6NA 2IMFA 1YJ6A 4I6XA 4IKHA 1S3AA 4EF0A 4GQCA 1M99A 1SL2B 2MMOA 3LYKA 4YAVA 1GLQA 3TKRA 1MEKA 1BEDA 4BPYA 1T00A 5FT3A 3CRTA 3UVTA 1H4OA 3C1SA 4TVEA 2C3NA 4EUYA 2XBQA 3IBHA 1YKAA 4POLA 5AN1A 1USBA 3D4TA 2I3YA 5AISA 2QGVA 4L0WA 4MJBA 2QC7A 4I97A 2WGRA 1Z5YE 4LL1B 4YH2A 5F05A 4N0VA 1HNCA 2H72A 1DSBA 1K0AA 2YNXA 2IFQA 4J56E 3IXRA 1RW1A 2R3XA 2PVOC 4KSMA 2LJRA 5CO3A 1OKDA 2O7KA 1CQHA 1XWGA 2YP6A 2E2GA 4NV5A 1J0FA 5B8BA 4RQXA 4IHUA 2C0GA 1KBNA 3K8NA 1SJZA 4KUNA 3IRAA 4MH2A 3DXBA 4L5OA 1ABAA 2N5FA 1SL1B 2LS5A 1BAYA 2RIIA 1K0CA 1QFNA 1Z9HA 2K6VA 3TOUA 1LBKA 14GSA 5D9XA 4K7OA 1PL1A 4IBPA 2C0DA 5HFIA 2IMIA 4ECCA 1X9MB 1B8XA 2JL4A 1M7TA 1YDKA 2F3MA 2GZPA 3TKSC 2NDOA 3RHBA 2F51A 1U88A 3ZFBA 2LQOA 1QXHA 2RUFA 3UMAA 2GZZA 4EKZA 3PGTA 2M80A 4N30A 2H30A 1SJ6A 1TXXA 4CW9A 3ZIJA 1XBSA 2N5BA 4CHSA 3W6GA 3FZ5A 4IP1A 1W89A 2L57A 5JWQB 5DCHA 5IM9A 2PPTA 2L6DA 2R6KA 3GHAA 4ZBAA 4NAXA 3UJ1A 2YWNA 16GSA 4MDCA 2YCDA 1MD3A 1EOHA 3UIWA 3QAVA 2HSHA 1GSYA 3WT1A 1WIKA 1EEMA 3KJYA 2R4VA 2HXKA 4XTSA 4KGIA 3R2QA 5IQYA 3QD9A 2DJ1A 1O8WA 1GUKA 4XS4A 1B4QA 6GSSA 1A0RP 2L4CA 3BBYA 2LSTA 2OKAA 2OA7A 1SKRB 2WFCA 1ERWA 4PX1A 1YKCA 5FWGA 5IIZA 1J9BA 3Q18A 4RQRA 4WEYA 3ZYWA 5F06A 4I2TA 4HS1A 4Q5FA 5IPGA 5ECPB 2ZNMA 1ACVA 4TW5A 1C72A 2VCZA 2H73A 2JADA 4HDEA 5J5NA 1ON4A 2C1YA 4PNFA 2DMLA 3F0IA 2C0FA 1THOA 1FVKA 2IMKA 1V58A 5J9BA 5KN3A 1PSQA 2O8VB 2ALBA 1W4VA 4OFTA 1KTEA 5LNKe 1JFUA 4YQUA 1NW2A 1PQNA 1Z3EA 5CRWA 4ZIJA 3VI7A 3PH9A 3TJKA 1PMTA 2KUCA 3L9SA 1DE1A 3J7Yb 3C8EA 2TIRA 4GTUA 4HQSA 4O5RA 2P0GA 4DSQA 4QL7A 4OMVA 2HSYA 2GS3A 4Q5QA 4ZL7A 3G9BA 3W8JA 1TRWA 2IMDA 2B5XA 1BQ7A 4ZL8A 1EEJA 2H0GA 4ZL9A 3TJFA 4ZB9A 1F6MC 12GSA 2H01A 4LLRA 1B48A 1PGTA 4YAPA 4QL9A 3F4TA 3UL3A 5H5RA 4HI7A 3ME8A 3FW2A 5B8AA 5G1KA 2E7PA 1O85A 1GSSA 3BOAA 3HVXA 3WYWA 3VI5A 5KN2A 1ZGNA 1T4YA 1U87A 1RQMA 4HZ4A 1JZDA 3FR3A 5DALA 2VCXA 6GSTA 2H74A 3VPQA 4ECJA 2V41A 3GKMA 1JLWA 4NHWA 1EGOA 6GSUA 5G5FA 1WOUA 2FUG2 2HNLA 5DJMA 1TI3A 3EE2A 1MDIA 2EC4A 1TK0B 2J9HA 1XOAA 3HD5A 4AJ6A 1ZOFA 4WBJA 1NHYA 2JACA 3FR6A 4BWQA 2GQLA 1YZXA 4JU5A 4EVMA 4IQ1A 3ZIVA 1AXDA 3VFIA 2XHFA 2B3SA 1O8XA 3A2WA 3RHCA 1GUMA 2H0IA 2G0FA 4YQMA 2P5RA 3KMNA 3ZFLA 2C80A 1HD2A 1GTUA 1V2AA 2LEGA 2CVKA 2OBKA 1UC7A 4HJ2A 1R26A 3O76A 2JU5A 2KOKA 3G7JA 4Q5RA 4EDYA 1TRVA 4TR3A 4K6XA 4PQIA 1OC9A 2VUPA 2H19A 1G7OA 2BJXA 3U5RE 4ISDA 1XWBA 3E3EA 1K3LA 6GSXA 1B4PA 4X1UA 2DJ0A 3LSZA 3DYRA 1SL0B 1EP8A 4F0CA 3DGQA 2GZYA 2JZTA 2GT5A 3CXGA 4ZB6A 1HNBA 3P90A 2WJUA 3C73A 4GSSA 2M46A 4I2UA 1JZOA 3GX0A 3ERFA 5F8BA 2KP2A 1WJKA 4K8MA 1FHEA 1XXUA 4XS1A 3MSZA 4E8EA 3TJBA 1Z6NA 2X64A 1F9MA 5CNWA 3GN3A 4WBRD 1X9SB 4I8BA 4XIHA 2B1KA 4WR5A 2YWIA 2MMZA 1N8JA 2WCIA 3OR5A 4JRRA 1X9WB 4TR4A 3GYKA 5CP1A 3AY8A 5GAPD 3M9KA 1EV9A 4WF5A 5E59A 1OKTA 2HE3A 22GSA 4DVCA 2I1UA 3H79A 2FWHA 2X99A 1QMVA 3QOUA 4MP4A 3GUSA 3Q19A 3U6VA 3EC3A 2PWJA 3QCPA 3QMXA 3CTFA 2AHEA 1SKWB 1NHOA 2JSZA 3GL3A 3FZAA 1YY7A 5DDLA 3UBKA 4BWSA 4KH7A 3IR4A 1QK8A 3S9FA 3I43A 1HNAA 1JZRA 3ZL5A 4CDOA 3M3MA 2P31A 2KHPA 4KDYA 1K0BA 2C4JA 13GSA 1OE7A 2O87A 3HY2A 3F4RA 2VCTA 5A4VA 2HRFA 4ZB8A 4NWYA 4DSSB 5F07A 4N11A 2PVQA 3KGKA 2LUSA 3IK7A 1TU7A 2FWEA 2JSYA 1T8EB 2RUEA 4PQHA 3GSSA 2FHEA 2RLIA 3I9V2 2FWGA 1GTIA 5D73A 3ZITA 2EIOA 1J08A 3TJJA 4TR0A 2GVPA 3P2AA 1M9AA 4DSSA 5DAKA 5ECSA 4MF6A 5JWOB 5G30A 2IWTA 4RI6A 1YQ1A 3NOFA 3GKNA 1TJDA 4HU9A 2DJKA 4OCFA 3QPMA 4OCEA 2IFQB 1H75A 1F3AA 20GSA 3LWAA 2GDRA 2HI7A 1VF4A 2VLVA 5C04A 2DBCA 2H8LA 1QQ2A 1M0UA 3QDNA 4G10A 3EMPA 1OE8A 3KM6A 4K0GA 2B7KA 3ERWA 2H1DA 2YZUA 2NPBA 4V2MA 1R7HA 2R37A 5IOWA 1XPVA 5ID2B 3UAPA 2WZ9A 4ZBDA 5HFKA 4L8EA 1B9YC 3VWUA 1X5CA 4AJ7A 1A8YA 4MJEA 1LU4A 2REMA 3IAS2 1S3CA 1FG4A 4IW9A 2F9SA 4LA1A 3I69A 3HKRA 5ID2A 3F4SA 3FR9A 4PUFC 2VCVA 1M9BA 3A2XA 4WR4A 5D93A 2LNTA 3O3TA 3HJOA 5H5QA 3HYPA 2H6ZA 4L0UA 5HFGA 3LQ7A 2E2MA 2L5OA 4G2EA 4ILFA 2MMNA 4EC0A 2D2ZA 4DSRA 3GTUB 1GSFA 1WE0A 3CTGA 4V1Ap 2JZSA 1GH2A 1V9WA 4MPFA 5CYYA 1BYEA 4OWYA 1A2LA 1I5GA 2FGXA 3QAGA 1JLVA 4ZILA 2B6MA 3CBUA 3KD0A 4MF7A 2K8VA 3Q6OA 4XS4B 5IO0A 3FHKA 4BVXA 3GTUA 4MLYA 3HCZA 4ZBBA 2IIYA 3J7Yk 1SENA 3D0ZA 9GSSA 2OE1A 1DE2A 4LL4B 5CRGA 1K0MA 3IAM2 1GUHA 1K3YA 1IYHA 2YN1A 1K3OA 3UARA 2R5GA 2H1GA 4F9ZA 1ERUA 3M9JA 3GFKA 1T7PB 2PN8A 3IA1A 4MZBA 3DD3A 1OAZA 5IMCA 2YWOA 5J3RA 3ISOA 2LRCA 4KE3A 2FCHA 5COHA 1BG5A 3IOSA 1A24A 4EXJA 2DMMA 3F8UA 1XVQA 7GSSA 5GAND 1DUGA 2VL3A 2VD1A 2GSQA 3LG6A 1XWKA 1PRXA 2LV3A 2H70A 1GSDA 3KTLA 5G2ZA 5JCWA 2VL2A 4FO5A 2VD0A 3GH6A 4H86A 1AQWA 3VURA 3WGDA 1TU8A 4D73A 4GRFA 6GSWA 4DEJA 4I5QA 4ULXA 2YV7A 2MBTA 1GNEA 4F82A 4K9ZA 4PUAA 1XWAA 2Z9SA 3SBCA 2V6OA 1UVZA 3QFAC 1WRYA 4X0XA 4KW6A 1GP1A 4WETA 3VLNA 3I6AA 2GSTA 5FHIA 3VPTA 2XBIA 3D4MA 2CZ2A 1XW6A 2LNSA 3HDCA 4ZXGA 2F8AA 3O6TA 4KSOA 2VCWA 4FH8A 1G0TA 5GSTA 2CAQA 2H66A 4ID0A 2DJ3A 2E0QA 4L5LA 3GV1A 3MNGA 2KP1A 2H75A 2VLUA 1TK5B 5DALB 5G31A 5HR2A 2C3TA 3H1NA 3MAKA 4GWRA 1AIUA 1T3BA 3G7IA 2AV4A 3ZVJD 2OJLA 2YWMA 1EV4A 2J23A 4F03A 1XVWA 2FWFA 3WT2A 1ZMAA 1SU9A 5DCGA 1R5AA 4NXIA 3Q74A 2GSRA 5A4WA 3VWVA 1WMJA 1EWXA 5HR0A 1E2YA 2LRTA 2LJKA 2FA4A 4PNGA 4ML6A 3D21A 5D9VA 5LCZA 3KMOA 5F0GA 6GSYA 1PN9A 4OD7A 2NTOA 4QQ7A 3N9JA 2AYTA 1PA3A 5L71A 3KCMA 5ECOB 5J4UA 5DJLA 4EE0A 4NV2A 5B7CA 5D8IA 18GSA 5HR3A 4MJCA 4OO5A 4JR4A 2VLTA 2DC5A 4MZCA 1NM3A 3HZ4A 2IPAA 4RI7A 2GTUA 3ZMKA 3TDGA 1GSQA 2OBIA 2VOCA 2GQKA 1OC9B 4V2LA 3ME7A 5D9WA 3DIEA 2YANA 2K9FA 3FYGA 3IHQA 2GGTA 1X5EA 3ZLPA 3E0UA 1O6JA 1ML6A 5ELGA 3KH7A 1AC1A 4GCIA 3HHVA 2N5AA 2TRCP 3HVVA 3F6FA 3G7YA 1M2DA 3LJRA 4HEA2 4HUAA 5EY6A 5CREA 5ECQB 4P3YB 2B5YA 4LMWA 1Z7RA 2V2GA 4AJ8A 3P7XA 2A2SA 5DQSA 1AQXA 3EU3A 1OC3A 3LXTA 2IJYA 2OACA 5EPFA 1TDIA 1SYXA 4IGJA 3GURA 2WULA 4K2DA 8GSSA 3F6DA 3ZRDA 4J2FA 5CRDA 3RPNA 4F0BA 1A2MA 2NVLA 4IVFA 4O32A 1EGRA 5IOXA 1KNGA 2A2RA 1Y25A 1U3AA 2FA8A 4KDUA 2PU9C 3QAWA 2MMAA 2H1AA 1UA5A 1ZCPA 1OC8A 4BA7A 1F2EA 4FYUA 3H8QA 1TOFA 2H1BA 2H6YA 2GQMA 3EU4A 4KNDA 4TOPA 5G1LA 5D9TA 5GZZB 1G6YA 1YF1A 2WDUA 3HJMA 2BMXA 4XHMA 2I81A 1XZOA 3TOTA 4K7IA 1FB6A 2QKEA 3TUEA 1FB0A 2XC2A 1ILOA 2EIQA 2LJAA 4MH3A 1PL2A 4KCEA 4NHZA 4EO3A 1G6WA 3FEUA 2G2QA 1PKZA 5DAKB 3ZVJA 1TRSA 3CYNA 2I9HA 1ZYQB 2R2JA 4IS0A 1VF1A 4O7HA 4HJMA 4KX4A 5EVOA 5A4UA 1I9DA 3GA4A 4TR1A 3FRCA 3TKSE 1VF3A 2MYGA 3UBLA 1BJXA 3UVHA 1MDKA 1Q98A 1WPIA 3HZ8A 4WXTA 4G9HA 4O92A 3BCIA 3PINA 2CVBA 1SKSB 1SYRA 1XIYA 2RM6A 3ZREA 2VM2A 4YQVA 4MPGA 1AW9A 2H0HA 5H5SA 1DBYA 2IMEA 3IV4A 3TJGA 2L5LA 4RUVA 4TN8A 4TXOA 1PX7A 3H4KA 3PR8A 1GSUA 3BCKA 2LKUA 3HVSA 3F3QA 3NZNA 3H93A 2XPDA 3HXSA 1T1VA 3DVXA 1TP9A 1R5PA 5KN0A 2B1LA 1ZYEA 4X43A 4OO4A 2YZHA 3TKQA 4POKA 5CRHA 5JCGA 3APQA 1S3DA 2VL2C 5LD0A
chains in the Genus database with same CATH superfamily
3FZ4A 3LFLA 4NMUA 1HQOA 1MTCA 3GIXA 3VWWA 1YEPA 1GL8A 3N5OA 2O89A 3ERGA 2PBJA 2KLXA 4G0IA 5ECLB 3L78A 2CT6A 3IC4A 3GKXA 1A23A 5IMDA 1RK4A 4GXZA 1ST9A 1O7UA 4MZWA 5E4WA 2HFDA 3WGEA 1XOBA 2C8UA 1TRUA 4K5RA 5J41A 3CSJA 5KN1A 1ZL9A 3D22A 5ECIB 1BX9A 4K7NA 5AIXA 2PUKC 1OVNA 1HYUA 2B7JA 1Y6EA 3TB2A 4IQAA 5JWRB 1TTZA 4N0ZA 1SJIA 2JZRA 3RBTA 3P8WA 1M2AA 2DIYA 2CVDA 2IN3A 5C00A 2V1MA 4AGSA 2ON5A 1FAAA 3RDWA 1MD4A 4PQ1A 2VCQA 3GL5A 3APSA 3MDKA 3FY7A 1URMA 5IO2A 2CAIA 2LTKA 3UEMA 5ECRB 5ELAA 5ABRA 4IJ3A 2PERA 2IL3A 4K0NA 1YEXA 5A5KA 3IC8A 3FZ9A 2HZFA 4TRXA 3TKPA 2GT6A 3KIJA 4ACSA 4XCSA 3F9UA 4POBA 5ECHB 1Q4JA 3GH9A 3ZMLA 3HJPA 5EL8A 11GSA 3C71A 2AJQB 5DVBA 1TW9A 3SWLA 2YOIA 1F37A 3W8SA 1QGVA 3HA9A 2B5EA 1X0RA 4V1Ag 2HRAA 3ZZXA 1KEBA 2OE3A 2YPMA 4TKYA 2WB9A 4EIPA 4D73B 2DIZA 2ES7A 3KH9A 1FOVA 1GTAA 2CV4A 3JCML 1GULA 2X8GA 3LORA 2F8FA 2O85A 4BIKA 3M1GA 4OFMA 1Z7PA 5CAXA 2TRXA 1FVJA 1VF2A 4GLTA 2VO4A 1XWCA 4GSTA 1V98A 3F3RA 1O73A 3NIVA 3FK8A 3GSTA 2DSAA 4MJAA 1AQVA 1JHBA 1F3BA 5AIVA 1SK0A 4Q5NA 2L4QA 2YV9A 3L0HA 4EL1A 3A2VA 4KA0A 3M0FA 3EWLA 2HRNA 5D96A 1PX6A 2OE0A 4GF0A 4BVYB 1UN2A 1SD8A 4POMA 1VRSD 2H71A 2VL9A 3CSIA 1PKWA 5KEJA 3KP9A 3CSHA 2DJ2A 1GWCA 2K18A 2AUVA 2GSSA 5ECKB 17GSA 4TXVA 5HR1A 4BVYA 4BL7A 1ERTA 4HZ2A 1AUCA 4JBBA 1B9XC 5BMUA 2X8CA 3L9UA 4AF2A 3RPPA 3TKSA 1MDJA 1FW1A 3EURA 1SD9A 5HQPA 2ON7A 2CX3A 4GSNA 4FYCA 4JZQA 1GRXA 1U6TA 4F2IA 3EPTA 4HOJA 4X4JA 2L6CA 1G7EA 1X5DA 2YJHA 10GSA 3MIXA 4MCUA 3A3TA 1TI1A 3CRUA 2PGTA 3US3A 4KDXA 2GLRA 1ZZYA 1XW5A 4IN0A 4XS6A 3DKSA 3KEBA 5IMZA 4MF5A 4EDZA 3DRNA 2MBSA 3ED3A 1PD21 1T4ZA 2QA1A 5ECMB 2WRTA 1FO5A 5IPHA 2C0EA 2DJJA 3L9VA 1NSWA 1IYIA 3C7MA 1O81A 4XRAA 2PMTA 3WD6A 2CZ3A 3EVIA 2VM1A 2M72A 4MABA 2FY6A 2K8SA 2I4AA 3IK9A 1CQGA 1A8LA 4Z2RA 5INYA 2CX4A 2QSIA 3TRXA 4K1FA 4WF4A 2X8HA 3L4NA 3KP8A 2BTOT 1Z6MA 3GX8A 3D5JA 5GSSA 4KB3A 4E8HA 2CQ9A 3D6IA 5JCUA 1A0FA 3GKKA 2HLSA 4PXOA 4IJIA 4JE1A 3EMXA 3QFBC 3A5IA 5IMVA 1EOGA 2FD3A 2C3QA 3V1WA 3EYTA 3UOMA 3C1RA 3KTBA 1GNWA 1TKDB 1E6BA 4Z2UA 3TRQA 4ECBA 1A2JA 4GQFA 3E9JB 2EIRA 2L59A 3WGXA 3LGCA 1GLPA 3KZQA 3CMIA 4MA9A 4FYBA 3LXZA 2RM5A 2ZUPA 1EP7A 4NPBA 4G19A 3IPZA 4N10A 5ENUA 4OFNA 1QUWA 2LQQA 2VIMA 1YF0A 3GRXA 4XRDA 3M8NA 1R4WA 1M2BA 4J57E 1WWJA 4PURA 1K0DA 3RAZA 3GMFA 3BD2A 2V32A 1JZWA 1LJRA 4KCAA 1N2AA 2WS2A 3TRPA 2ZCTA 4LMVA 3FKFA 4PGTA 3APOA 2HYXA 2H76A 3FMWA 1GTBA 1K0OA 3TCOA 2OADA 2P5QA 4JEDA 5AGYA 1EZKA 2VAFA 5ECNB 1TK8B 3A5WA 3IE3A 2NBSA 1U3IA 3DWVA 1V40A 2YJ7A 3EINA 5G5EA 2CA8A 2H6XA 4FIWA 1ERVA 1SK2A 5B6MA 1AAZA 4KAEA 4FQUA 4HU7A 2HZEB 3MWHA 3TGZA 4HSCX 3KXOA 19GSA 3VK9A 3LYPA 3DVWA 3ZTLA 1FOHA 3QR6A 2FNOA 4TR1B 1OYJA 4V2NA 3GNJA 2V6KA 5DBQA 4HQZA 4ECIA 4IP6A 3LEFA 5BRTA 3VWXA 2AB6A 1K0NA 1PFOA 4MMMA 2MZCA 2LRNA 1XW9A 2HZEA 1SK1A 2AAWA 3DEXA 5DQYA 2XPEA 1VGLA 5IMFA 1XCCA 2A4VA 6GSVA 5J9CA 3DMLA 1XFLA 2DLXA 1WP0A 4WKWA 4EIQA 4JR6A 2FLSA 4TXOB 2HT9A 1GSEA 5IMAA 4IELA 3IDVA 3F63A 4Z7XA 3BJ5A 1THXA 4MK3A 4ML1A 1V57A 5B6NA 2IMFA 1YJ6A 4I6XA 4IKHA 1S3AA 4EF0A 4GQCA 1M99A 1SL2B 2MMOA 3LYKA 4YAVA 1GLQA 3TKRA 3R3EA 1MEKA 1BEDA 4BPYA 1T00A 5FT3A 3CRTA 3UVTA 1H4OA 3C1SA 4TVEA 2C3NA 4EUYA 2XBQA 2A4HA 3IBHA 1YKAA 1S3RA 4POLA 5AN1A 1USBA 3D4TA 2I3YA 5AISA 2QGVA 4L0WA 4MJBA 2QC7A 4I97A 2WGRA 1Z5YE 4LL1B 4YH2A 5F05A 4N0VA 1HNCA 2H72A 1DSBA 1K0AA 2YNXA 2IFQA 4J56E 2HSMA 3IXRA 1RW1A 2R3XA 2PVOC 4KSMA 2LJRA 5CO3A 1OKDA 2O7KA 1CQHA 1XWGA 2YP6A 2E2GA 4NV5A 1J0FA 5B8BA 4RQXA 4IHUA 2C0GA 1KBNA 3K8NA 1SJZA 4KUNA 3IRAA 4MH2A 3DXBA 4L5OA 1ABAA 2N5FA 1SL1B 2LS5A 1BAYA 2RIIA 1K0CA 1QFNA 1Z9HA 2K6VA 3TOUA 1LBKA 14GSA 5D9XA 4K7OA 1PL1A 4IBPA 2C0DA 5HFIA 2IMIA 4ECCA 1X9MB 1B8XA 2JL4A 1M7TA 1YDKA 2F3MA 2GZPA 3TKSC 2NDOA 3RHBA 2F51A 1U88A 3ZFBA 2LQOA 1QXHA 2RUFA 3UMAA 2GZZA 4EKZA 3PGTA 2M80A 4N30A 2H30A 1SJ6A 1TXXA 4CW9A 3ZIJA 1XBSA 2N5BA 4MNNA 4CHSA 3W6GA 3FZ5A 4IP1A 1W89A 2L57A 5JWQB 5DCHA 5IM9A 2PPTA 2L6DA 2R6KA 3GHAA 4ZBAA 4NAXA 3UJ1A 2YWNA 16GSA 4MDCA 2YCDA 1MD3A 1EOHA 3UIWA 3QAVA 2HSHA 1GSYA 3WT1A 1WIKA 1EEMA 3KJYA 2R4VA 2HXKA 4XTSA 4KGIA 3R2QA 5IQYA 3QD9A 2DJ1A 1O8WA 4K5SA 1GUKA 4XS4A 1B4QA 6GSSA 1A0RP 2L4CA 3BBYA 2LSTA 2OKAA 2OA7A 2R0GA 1SKRB 2WFCA 1ERWA 1XG8A 4PX1A 3IHGA 1YKCA 5FWGA 5IIZA 1J9BA 3Q18A 4RQRA 4WEYA 3ZYWA 5F06A 4I2TA 4HS1A 4Q5FA 5IPGA 5ECPB 2ZNMA 1ACVA 4TW5A 1C72A 2VCZA 2H73A 2JADA 4HDEA 5J5NA 1ON4A 2C1YA 4PNFA 2DMLA 3F0IA 2C0FA 1THOA 1FVKA 2IMKA 1V58A 5J9BA 4BL7B 5KN3A 1PSQA 2QA2A 2O8VB 2ALBA 1W4VA 4OFTA 1KTEA 5LNKe 1JFUA 4G0LA 4YQUA 1NW2A 1PQNA 1Z3EA 5CRWA 4ZIJA 3VI7A 3PH9A 3TJKA 4K2XA 1PMTA 2KUCA 3L9SA 1DE1A 3J7Yb 3C8EA 2TIRA 4GTUA 4HQSA 4O5RA 2P0GA 4DSQA 4QL7A 4OMVA 2HSYA 2GS3A 4Q5QA 4ZL7A 3G9BA 3W8JA 1TRWA 2IMDA 2B5XA 1BQ7A 4ZL8A 1EEJA 2H0GA 4ZL9A 3TJFA 4ZB9A 1F6MC 12GSA 2H01A 4LLRA 1B48A 1PGTA 4YAPA 4QL9A 3F4TA 3UL3A 5H5RA 4HI7A 3ME8A 3FW2A 5B8AA 5G1KA 2UZ8A 2E7PA 1O85A 1GSSA 3BOAA 3HVXA 3WYWA 3VI5A 5KN2A 1ZGNA 1T4YA 1U87A 1RQMA 4HZ4A 1JZDA 3FR3A 5DALA 2VCXA 6GSTA 2H74A 3VPQA 4ECJA 2V41A 3GKMA 1JLWA 4NHWA 1EGOA 6GSUA 5G5FA 1WOUA 2FUG2 2HNLA 5DJMA 4O5QA 1TI3A 2A2PA 3EE2A 1MDIA 2EC4A 1TK0B 2J9HA 1XOAA 1ZYPA 3HD5A 4AJ6A 1ZOFA 4WBJA 1NHYA 2JACA 3FR6A 4BWQA 2GQLA 1YZXA 4JU5A 4EVMA 4IQ1A 3ZIVA 1AXDA 3VFIA 2XHFA 2B3SA 1O8XA 3A2WA 3RHCA 1GUMA 2H0IA 2G0FA 4YQMA 2P5RA 3KMNA 3ZFLA 2C80A 1HD2A 1GTUA 1V2AA 2LEGA 2CVKA 2OBKA 1UC7A 4HJ2A 1R26A 3O76A 2JU5A 2X4AA 2KOKA 3G7JA 4Q5RA 4EDYA 1TRVA 4TR3A 2HRKA 4K6XA 4PQIA 1OC9A 2VUPA 2H19A 1G7OA 2BJXA 3U5RE 4ISDA 1XWBA 3E3EA 1K3LA 6GSXA 1B4PA 4X1UA 2DJ0A 3LSZA 3DYRA 4O5UA 1SL0B 1EP8A 4F0CA 3DGQA 2GZYA 2JZTA 2GT5A 3CXGA 4ZB6A 1HNBA 3P90A 2WJUA 3C73A 4GSSA 2M46A 4I2UA 1JZOA 3GX0A 3ERFA 4A5PA 5F8BA 2KP2A 1WJKA 4K8MA 1FHEA 1XXUA 4XS1A 3MSZA 4E8EA 3TJBA 1Z6NA 2X64A 1F9MA 5CNWA 3GN3A 4WBRD 1X9SB 4I8BA 3CQFA 4XIHA 2B1KA 4WR5A 2YWIA 2MMZA 1N8JA 2WCIA 3OR5A 4JRRA 1X9WB 4KF9A 4TR4A 3GYKA 5CP1A 3AY8A 5GAPD 3M9KA 1EV9A 4WF5A 5E59A 1OKTA 2HE3A 22GSA 4DVCA 2I1UA 3H79A 2FWHA 2X99A 1QMVA 3QOUA 4MP4A 3GUSA 3Q19A 3U6VA 3EC3A 2PWJA 3QCPA 3QMXA 3CTFA 2AHEA 1SKWB 1NHOA 2JSZA 3GL3A 4YKFA 3FZAA 1YY7A 5DDLA 3UBKA 4BWSA 4KH7A 2R0CA 3LW9A 3IR4A 1QK8A 3S9FA 3I43A 1HNAA 1JZRA 3ZL5A 4CDOA 3M3MA 2P31A 2KHPA 4KDYA 1K0BA 2C4JA 4YKGA 13GSA 1OE7A 2O87A 3HY2A 3F4RA 2VCTA 1M3IA 5A4VA 2HRFA 4ZB8A 4NWYA 4DSSB 5F07A 4N11A 2PVQA 3KGKA 2LUSA 3IK7A 1TU7A 2FWEA 2JSYA 1T8EB 2RUEA 4PQHA 3GSSA 2FHEA 2RLIA 3I9V2 2FWGA 1GTIA 5D73A 3ZITA 2EIOA 1J08A 3TJJA 4TR0A 2GVPA 3P2AA 1M9AA 4DSSA 5DAKA 5ECSA 4MF6A 5JWOB 5G30A 2IWTA 4RI6A 3PPUA 1YQ1A 5KOWA 3NOFA 3GKNA 1TJDA 4HU9A 2DJKA 4OCFA 3QPMA 4OCEA 2IFQB 1H75A 1F3AA 20GSA 3LWAA 2GDRA 2HI7A 1VF4A 2VLVA 5C04A 2DBCA 2H8LA 1QQ2A 1M0UA 3QDNA 4G10A 3EMPA 1OE8A 3KM6A 4K0GA 2B7KA 3ERWA 2H1DA 2YZUA 2NPBA 4V2MA 1R7HA 3HVNA 2R37A 5IOWA 1XPVA 5ID2B 3UAPA 2WZ9A 4ZBDA 5HFKA 4L8EA 1B9YC 3VWUA 1X5CA 4AJ7A 1A8YA 5KOXA 4MJEA 1LU4A 2REMA 3IAS2 1S3CA 1FG4A 4IW9A 2F9SA 4LA1A 3I69A 3HKRA 5ID2A 3F4SA 3FR9A 4PUFC 2VCVA 1M9BA 3A2XA 1PN0A 4WR4A 5D93A 2LNTA 3O3TA 3HJOA 5H5QA 3HYPA 2H6ZA 4L0UA 5HFGA 3LQ7A 2E2MA 2L5OA 4G2EA 4ILFA 2X49A 2MMNA 4EC0A 2D2ZA 4DSRA 4BVXB 3GTUB 1GSFA 2DKHA 1WE0A 3CTGA 4V1Ap 2JZSA 1GH2A 1V9WA 4MPFA 5CYYA 1BYEA 4OWYA 1A2LA 1I5GA 2FGXA 3QAGA 1JLVA 4ZILA 2B6MA 3CBUA 3KD0A 4MF7A 2K8VA 3Q6OA 4XS4B 5IO0A 3FHKA 4BVXA 3GTUA 4MLYA 3HCZA 4ZBBA 2IIYA 3J7Yk 1SENA 3D0ZA 9GSSA 2OE1A 1DE2A 4LL4B 5CRGA 1K0MA 3IAM2 1GUHA 1K3YA 1IYHA 2YN1A 1K3OA 3UARA 2R5GA 2H1GA 4F9ZA 1ERUA 3M9JA 3GFKA 1T7PB 2PN8A 3IA1A 4MZBA 3DD3A 1OAZA 5IMCA 2YWOA 5J3RA 3ISOA 2LRCA 4PTSA 4KE3A 2FCHA 5COHA 1BG5A 3IOSA 1A24A 4EXJA 2DMMA 3F8UA 1XVQA 7GSSA 5GAND 1DUGA 2VL3A 2VD1A 2GSQA 3LG6A 1XWKA 1PRXA 2LV3A 2H70A 1GSDA 3KTLA 5G2ZA 5JCWA 2VL2A 4FO5A 2VD0A 3GH6A 4H86A 1AQWA 3VURA 3WGDA 1TU8A 4D73A 4GRFA 6GSWA 1M3JA 4DEJA 4I5QA 4ULXA 2YV7A 2MBTA 1GNEA 4F82A 4K9ZA 4PUAA 1XWAA 2Z9SA 3SBCA 2V6OA 1UVZA 3QFAC 1WRYA 4X0XA 4KW6A 1GP1A 4WETA 3VLNA 3I6AA 2GSTA 5FHIA 3VPTA 2XBIA 3D4MA 2CZ2A 1XW6A 2LNSA 4CY8A 3HDCA 4G0KA 4ZXGA 2F8AA 3O6TA 4KSOA 2VCWA 4FH8A 1G0TA 5GSTA 2CAQA 2H66A 4ID0A 2DJ3A 2E0QA 4L5LA 3GV1A 3MNGA 2KP1A 2H75A 2VLUA 1TK5B 5DALB 5G31A 5HR2A 2C3TA 3H1NA 3MAKA 4GWRA 1AIUA 1T3BA 3G7IA 2AV4A 3ZVJD 2OJLA 2YWMA 1EV4A 2J23A 4F03A 1XVWA 2FWFA 3WT2A 1ZMAA 1SU9A 5DCGA 1R5AA 4NXIA 3Q74A 2GSRA 5A4WA 3VWVA 1WMJA 1EWXA 5HR0A 1E2YA 2LRTA 2LJKA 2FA4A 4PNGA 4ML6A 3D21A 5D9VA 5LCZA 3KMOA 5F0GA 6GSYA 1PN9A 4OD7A 2NTOA 4QQ7A 3N9JA 2AYTA 1PA3A 5L71A 3KCMA 5ECOB 5J4UA 5DJLA 4EE0A 4Z2TA 4NV2A 5B7CA 5D8IA 18GSA 5HR3A 4MJCA 4OO5A 4JR4A 2VLTA 2DC5A 4MZCA 1NM3A 3HZ4A 2IPAA 4RI7A 2GTUA 3ZMKA 3TDGA 1GSQA 2OBIA 2VOCA 2GQKA 1OC9B 4V2LA 3ME7A 5D9WA 3DIEA 2YANA 2K9FA 3FYGA 3IHQA 2GGTA 1X5EA 3ZLPA 3E0UA 4ICYA 1O6JA 1ML6A 5ELGA 3KH7A 1AC1A 4GCIA 3HHVA 2N5AA 2TRCP 3HVVA 3F6FA 3G7YA 1M2DA 3LJRA 4HEA2 4HUAA 5EY6A 5CREA 5ECQB 4P3YB 2B5YA 4LMWA 1Z7RA 2V2GA 4AJ8A 3P7XA 2A2SA 5DQSA 1AQXA 3EU3A 1OC3A 3LXTA 2IJYA 2OACA 5EPFA 1TDIA 1SYXA 4IGJA 3GURA 2WULA 4K2DA 8GSSA 3F6DA 3ZRDA 4J2FA 5CRDA 3RPNA 4F0BA 1A2MA 2NVLA 4IVFA 4O32A 1EGRA 5IOXA 1KNGA 2R0PA 2A2RA 1Y25A 1U3AA 2FA8A 4KDUA 2PU9C 3QAWA 2MMAA 2H1AA 1UA5A 1ZCPA 1OC8A 4BA7A 1F2EA 4FYUA 3H8QA 1TOFA 2H1BA 2H6YA 2GQMA 3EU4A 4KNDA 4TOPA 5G1LA 5D9TA 5GZZB 4CY6A 1G6YA 1YF1A 2WDUA 3HJMA 2BMXA 4XHMA 2I81A 1XZOA 3TOTA 4K7IA 1FB6A 2QKEA 3TUEA 1FB0A 2XC2A 1ILOA 2EIQA 2LJAA 4MH3A 1PL2A 4KCEA 4NHZA 4EO3A 1G6WA 3FEUA 2G2QA 1PKZA 4USSA 5DAKB 3ZVJA 1TRSA 3CYNA 2I9HA 1ZYQB 2R2JA 4IS0A 1VF1A 2DKIA 4O7HA 4HJMA 4KX4A 5EVOA 5A4UA 1I9DA 3GA4A 4TR1A 3FRCA 3MYDA 3TKSE 1VF3A 2MYGA 3UBLA 1BJXA 3UVHA 1MDKA 1Q98A 1WPIA 3HZ8A 4WXTA 4G9HA 4O92A 3BCIA 3PINA 2CVBA 1SKSB 1SYRA 1XIYA 2RM6A 3ZREA 2VM2A 4YQVA 4MPGA 1AW9A 2H0HA 5H5SA 1DBYA 2IMEA 3IV4A 3TJGA 2L5LA 4RUVA 4TN8A 4TXOA 1PX7A 3H4KA 3PR8A 1GSUA 3BCKA 2LKUA 3HVSA 3F3QA 3NZNA 3H93A 2XPDA 3HXSA 1T1VA 3DVXA 1TP9A 1R5PA 5KN0A 2B1LA 1ZYEA 4X43A 4OO4A 2YZHA 3TKQA 4POKA 5CRHA 5JCGA 3APQA 1S3DA 1ZYNA 2VL2C 5LD0A
chains in the Genus database with same CATH topology
3FZ4A 3LFLA 4NMUA 1HQOA 1MTCA 3GIXA 3VWWA 1YEPA 1GL8A 3N5OA 2O89A 3ERGA 2PBJA 2KLXA 4G0IA 5ECLB 3L78A 2CT6A 3IC4A 3GKXA 1A23A 5IMDA 1RK4A 4GXZA 1ST9A 1O7UA 4MZWA 5E4WA 2HFDA 3WGEA 1XOBA 2C8UA 1TRUA 4K5RA 5J41A 3CSJA 5KN1A 1ZL9A 3D22A 5ECIB 1BX9A 4K7NA 5AIXA 2PUKC 1OVNA 1HYUA 2B7JA 1Y6EA 3TB2A 4IQAA 5JWRB 1TTZA 4N0ZA 1SJIA 2JZRA 3RBTA 3P8WA 1M2AA 2DIYA 2CVDA 2IN3A 5C00A 2V1MA 4AGSA 2ON5A 1FAAA 3RDWA 1MD4A 4PQ1A 2VCQA 3GL5A 3APSA 3MDKA 3FY7A 1URMA 5IO2A 2CAIA 2LTKA 3UEMA 5ECRB 5ELAA 5ABRA 4IJ3A 2PERA 2IL3A 4K0NA 1YEXA 5A5KA 3IC8A 3FZ9A 2HZFA 4TRXA 3TKPA 2GT6A 3KIJA 4ACSA 4XCSA 3F9UA 4POBA 5ECHB 1Q4JA 3GH9A 3ZMLA 3HJPA 5EL8A 11GSA 3C71A 2AJQB 5DVBA 1TW9A 3SWLA 2YOIA 1F37A 3W8SA 1QGVA 3HA9A 2B5EA 1X0RA 4V1Ag 2HRAA 3ZZXA 1KEBA 2OE3A 2YPMA 4TKYA 2WB9A 4EIPA 4D73B 2DIZA 2ES7A 3KH9A 1FOVA 1GTAA 2CV4A 3JCML 1GULA 2X8GA 3LORA 2F8FA 2O85A 3M1GA 4OFMA 1Z7PA 5CAXA 2TRXA 1FVJA 1VF2A 4GLTA 2VO4A 1XWCA 4GSTA 1V98A 3F3RA 1O73A 3NIVA 3FK8A 3GSTA 2DSAA 4MJAA 1AQVA 1JHBA 1F3BA 5AIVA 1SK0A 4Q5NA 2L4QA 2YV9A 3L0HA 4EL1A 3A2VA 4KA0A 3M0FA 3EWLA 2HRNA 5D96A 1PX6A 2OE0A 4GF0A 4BVYB 1UN2A 1SD8A 4POMA 1VRSD 2H71A 2VL9A 3CSIA 1PKWA 5KEJA 3KP9A 3CSHA 2DJ2A 1GWCA 2K18A 2AUVA 2GSSA 5ECKB 17GSA 4TXVA 5HR1A 4BVYA 4BL7A 1ERTA 4HZ2A 1AUCA 4JBBA 1B9XC 5BMUA 2X8CA 3L9UA 4AF2A 3RPPA 3TKSA 1MDJA 1FW1A 3EURA 1SD9A 5HQPA 2ON7A 2CX3A 4GSNA 4FYCA 4JZQA 1GRXA 1U6TA 4F2IA 3EPTA 4HOJA 4X4JA 2L6CA 1G7EA 1X5DA 2YJHA 10GSA 3MIXA 4MCUA 3A3TA 1TI1A 3CRUA 2PGTA 3US3A 4KDXA 2GLRA 1ZZYA 1XW5A 4IN0A 4XS6A 3DKSA 3KEBA 5IMZA 4MF5A 4EDZA 3DRNA 2MBSA 3ED3A 1PD21 1T4ZA 2QA1A 5ECMB 2WRTA 1FO5A 5IPHA 2C0EA 2DJJA 3L9VA 1NSWA 1IYIA 3C7MA 1O81A 4XRAA 2PMTA 3WD6A 2CZ3A 3EVIA 2VM1A 2M72A 4MABA 2FY6A 2K8SA 2I4AA 3IK9A 1CQGA 1A8LA 4Z2RA 5INYA 2CX4A 2QSIA 3TRXA 4K1FA 4WF4A 2X8HA 3L4NA 3KP8A 2BTOT 1Z6MA 3GX8A 3D5JA 5GSSA 4KB3A 4E8HA 2CQ9A 3D6IA 5JCUA 1A0FA 3GKKA 2HLSA 4PXOA 4IJIA 4JE1A 3EMXA 3QFBC 3A5IA 5IMVA 1EOGA 2FD3A 2C3QA 3V1WA 3EYTA 3UOMA 3C1RA 3KTBA 1GNWA 1TKDB 1E6BA 4Z2UA 3TRQA 4ECBA 1A2JA 4GQFA 3E9JB 2EIRA 2L59A 3WGXA 3LGCA 1GLPA 3KZQA 3CMIA 4MA9A 4FYBA 3LXZA 2RM5A 2ZUPA 1EP7A 4NPBA 4G19A 3IPZA 4N10A 5ENUA 4OFNA 1QUWA 2LQQA 2VIMA 1YF0A 3GRXA 4XRDA 3M8NA 1R4WA 1M2BA 4J57E 1WWJA 4PURA 1K0DA 3RAZA 3GMFA 3BD2A 2V32A 1JZWA 1LJRA 4KCAA 1N2AA 2WS2A 3TRPA 2ZCTA 4LMVA 3FKFA 4PGTA 3APOA 2HYXA 2H76A 3FMWA 1GTBA 1K0OA 3TCOA 2OADA 2P5QA 4JEDA 5AGYA 1EZKA 2VAFA 5ECNB 1TK8B 3A5WA 3IE3A 2NBSA 1U3IA 3DWVA 1V40A 2YJ7A 3EINA 5G5EA 2CA8A 2H6XA 4FIWA 1ERVA 1SK2A 5B6MA 1AAZA 4KAEA 4FQUA 4HU7A 2HZEB 3MWHA 3TGZA 3KXOA 19GSA 3VK9A 3LYPA 3DVWA 3ZTLA 1FOHA 3QR6A 2FNOA 4TR1B 1OYJA 4V2NA 3GNJA 2V6KA 5DBQA 4HQZA 4ECIA 4IP6A 3LEFA 5BRTA 3VWXA 2AB6A 1K0NA 4MMMA 2MZCA 2LRNA 1XW9A 2HZEA 1SK1A 2AAWA 3DEXA 5DQYA 2XPEA 1VGLA 5IMFA 1XCCA 2A4VA 6GSVA 5J9CA 3DMLA 1XFLA 2DLXA 1WP0A 4WKWA 4EIQA 4JR6A 2FLSA 4TXOB 2HT9A 1GSEA 5IMAA 4IELA 3IDVA 3F63A 4Z7XA 3BJ5A 1THXA 4MK3A 4ML1A 1V57A 5B6NA 2IMFA 1YJ6A 4I6XA 4IKHA 1S3AA 4EF0A 4GQCA 1M99A 1SL2B 2MMOA 3LYKA 4YAVA 1GLQA 3TKRA 3R3EA 1MEKA 1BEDA 4BPYA 1T00A 5FT3A 3CRTA 3UVTA 1H4OA 3C1SA 4TVEA 2C3NA 4EUYA 2XBQA 2A4HA 3IBHA 1YKAA 4POLA 5AN1A 1USBA 3D4TA 2I3YA 5AISA 2QGVA 4L0WA 4MJBA 2QC7A 4I97A 2WGRA 1Z5YE 4LL1B 4YH2A 5F05A 4N0VA 1HNCA 2H72A 1DSBA 1K0AA 2YNXA 2IFQA 4J56E 2HSMA 3IXRA 1RW1A 2R3XA 2PVOC 4KSMA 2LJRA 5CO3A 1OKDA 2O7KA 1CQHA 1XWGA 2YP6A 2E2GA 4NV5A 1J0FA 5B8BA 4RQXA 4IHUA 2C0GA 1KBNA 3K8NA 1SJZA 4KUNA 3IRAA 4MH2A 3DXBA 4L5OA 1ABAA 2N5FA 1SL1B 2LS5A 1BAYA 2RIIA 1K0CA 1QFNA 1Z9HA 2K6VA 3TOUA 1LBKA 14GSA 5D9XA 4K7OA 1PL1A 4IBPA 2C0DA 5HFIA 2IMIA 4ECCA 1X9MB 1B8XA 2JL4A 1M7TA 1YDKA 2F3MA 2GZPA 3TKSC 2NDOA 3RHBA 2F51A 1U88A 3ZFBA 2LQOA 1QXHA 2RUFA 3UMAA 2GZZA 4EKZA 3PGTA 2M80A 4N30A 2H30A 1SJ6A 1TXXA 4CW9A 3ZIJA 1XBSA 2N5BA 4MNNA 4CHSA 3W6GA 3FZ5A 4IP1A 1W89A 2L57A 5JWQB 5DCHA 5IM9A 2PPTA 2L6DA 2R6KA 3GHAA 4ZBAA 4NAXA 3UJ1A 2YWNA 16GSA 4MDCA 2YCDA 1MD3A 1EOHA 3UIWA 3QAVA 2HSHA 1GSYA 3WT1A 1WIKA 1EEMA 3KJYA 2R4VA 2HXKA 4XTSA 4KGIA 3R2QA 5IQYA 3QD9A 2DJ1A 1O8WA 4K5SA 1GUKA 4XS4A 1B4QA 6GSSA 1A0RP 2L4CA 3BBYA 2LSTA 2OKAA 2OA7A 2R0GA 1SKRB 2WFCA 1ERWA 4PX1A 3IHGA 1YKCA 5FWGA 5IIZA 1J9BA 3Q18A 4RQRA 4WEYA 3ZYWA 5F06A 4I2TA 4HS1A 4Q5FA 5IPGA 5ECPB 2ZNMA 1ACVA 4TW5A 1C72A 2VCZA 2H73A 2JADA 4HDEA 5J5NA 1ON4A 2C1YA 4PNFA 2DMLA 3F0IA 2C0FA 1THOA 1FVKA 2IMKA 1V58A 5J9BA 4BL7B 5KN3A 1PSQA 2QA2A 2O8VB 2ALBA 1W4VA 4OFTA 1KTEA 5LNKe 1JFUA 4G0LA 4YQUA 1NW2A 1PQNA 1Z3EA 5CRWA 4ZIJA 3VI7A 3PH9A 3TJKA 4K2XA 1PMTA 2KUCA 3L9SA 1DE1A 3J7Yb 3C8EA 2TIRA 4GTUA 4HQSA 4O5RA 2P0GA 4DSQA 4QL7A 4OMVA 2HSYA 2GS3A 4Q5QA 4ZL7A 3G9BA 3W8JA 1TRWA 2IMDA 2B5XA 1BQ7A 4ZL8A 1EEJA 2H0GA 4ZL9A 3TJFA 4ZB9A 1F6MC 12GSA 2H01A 4LLRA 1B48A 1PGTA 4YAPA 4QL9A 3F4TA 3UL3A 5H5RA 4HI7A 3ME8A 3FW2A 5B8AA 5G1KA 2UZ8A 2E7PA 1O85A 1GSSA 3BOAA 3HVXA 3WYWA 3VI5A 5KN2A 1ZGNA 1T4YA 1U87A 1RQMA 4HZ4A 1JZDA 3FR3A 5DALA 2VCXA 6GSTA 2H74A 3VPQA 4ECJA 2V41A 3GKMA 1JLWA 4NHWA 1EGOA 6GSUA 5G5FA 1WOUA 2FUG2 2HNLA 5DJMA 4O5QA 1TI3A 2A2PA 3EE2A 1MDIA 2EC4A 1TK0B 2J9HA 1XOAA 1ZYPA 3HD5A 4AJ6A 1ZOFA 4WBJA 1NHYA 2JACA 3FR6A 4BWQA 2GQLA 1YZXA 4JU5A 4EVMA 4IQ1A 3ZIVA 1AXDA 3VFIA 2XHFA 2B3SA 1O8XA 3A2WA 3RHCA 1GUMA 2H0IA 2G0FA 4YQMA 2P5RA 3KMNA 3ZFLA 2C80A 1HD2A 1GTUA 1V2AA 2LEGA 2CVKA 2OBKA 1UC7A 4HJ2A 1R26A 3O76A 2JU5A 2X4AA 2KOKA 3G7JA 4Q5RA 4EDYA 1TRVA 4TR3A 2HRKA 4K6XA 4PQIA 1OC9A 2VUPA 2H19A 1G7OA 2BJXA 3U5RE 4ISDA 1XWBA 3E3EA 1K3LA 6GSXA 1B4PA 4X1UA 2DJ0A 3LSZA 3DYRA 4O5UA 1SL0B 1EP8A 4F0CA 3DGQA 2GZYA 2JZTA 2GT5A 3CXGA 4ZB6A 1HNBA 3P90A 2WJUA 3C73A 4GSSA 2M46A 4I2UA 1JZOA 3GX0A 3ERFA 4A5PA 5F8BA 2KP2A 1WJKA 4K8MA 1FHEA 1XXUA 4XS1A 3MSZA 4E8EA 3TJBA 1Z6NA 2X64A 1F9MA 5CNWA 3GN3A 4WBRD 1X9SB 4I8BA 4XIHA 2B1KA 4WR5A 2YWIA 2MMZA 1N8JA 2WCIA 3OR5A 4JRRA 1X9WB 4KF9A 4TR4A 3GYKA 5CP1A 3AY8A 5GAPD 3M9KA 1EV9A 4WF5A 5E59A 1OKTA 2HE3A 22GSA 4DVCA 2I1UA 3H79A 2FWHA 2X99A 1QMVA 3QOUA 4MP4A 3GUSA 3Q19A 3U6VA 3EC3A 2PWJA 3QCPA 3QMXA 3CTFA 2AHEA 1SKWB 1NHOA 2JSZA 3GL3A 4YKFA 3FZAA 1YY7A 5DDLA 3UBKA 4BWSA 4KH7A 2R0CA 3LW9A 3IR4A 1QK8A 3S9FA 3I43A 1HNAA 1JZRA 3ZL5A 4CDOA 3M3MA 2P31A 2KHPA 4KDYA 1K0BA 2C4JA 4YKGA 13GSA 1OE7A 2O87A 3HY2A 3F4RA 2VCTA 5A4VA 2HRFA 4ZB8A 4NWYA 4DSSB 5F07A 4N11A 2PVQA 3KGKA 2LUSA 3IK7A 1TU7A 2FWEA 2JSYA 1T8EB 2RUEA 4PQHA 3GSSA 2FHEA 2RLIA 3I9V2 2FWGA 1GTIA 5D73A 3ZITA 2EIOA 1J08A 3TJJA 4TR0A 2GVPA 3P2AA 1M9AA 4DSSA 5DAKA 5ECSA 4MF6A 5JWOB 5G30A 2IWTA 4RI6A 3PPUA 1YQ1A 5KOWA 3NOFA 3GKNA 1TJDA 4HU9A 2DJKA 4OCFA 3QPMA 4OCEA 2IFQB 1H75A 1F3AA 20GSA 3LWAA 2GDRA 2HI7A 1VF4A 2VLVA 5C04A 2DBCA 2H8LA 1QQ2A 1M0UA 3QDNA 4G10A 3EMPA 1OE8A 3KM6A 4K0GA 2B7KA 3ERWA 2H1DA 2YZUA 2NPBA 4V2MA 1R7HA 2R37A 5IOWA 1XPVA 5ID2B 3UAPA 2WZ9A 4ZBDA 5HFKA 4L8EA 1B9YC 3VWUA 1X5CA 4AJ7A 1A8YA 5KOXA 4MJEA 1LU4A 2REMA 3IAS2 1S3CA 1FG4A 4IW9A 2F9SA 4LA1A 3I69A 3HKRA 5ID2A 3F4SA 3FR9A 4PUFC 2VCVA 1M9BA 3A2XA 1PN0A 4WR4A 5D93A 2LNTA 3O3TA 3HJOA 5H5QA 3HYPA 2H6ZA 4L0UA 5HFGA 3LQ7A 2E2MA 2L5OA 4G2EA 4ILFA 2X49A 2MMNA 4EC0A 2D2ZA 4DSRA 4BVXB 3GTUB 1GSFA 2DKHA 1WE0A 3CTGA 4V1Ap 2JZSA 1GH2A 1V9WA 4MPFA 5CYYA 1BYEA 4OWYA 1A2LA 1I5GA 2FGXA 3QAGA 1JLVA 4ZILA 2B6MA 3CBUA 3KD0A 4MF7A 2K8VA 3Q6OA 4XS4B 5IO0A 3FHKA 4BVXA 3GTUA 4MLYA 3HCZA 4ZBBA 2IIYA 3J7Yk 1SENA 3D0ZA 9GSSA 2OE1A 1DE2A 4LL4B 5CRGA 1K0MA 3IAM2 1GUHA 1K3YA 1IYHA 2YN1A 1K3OA 3UARA 2R5GA 2H1GA 4F9ZA 1ERUA 3M9JA 3GFKA 1T7PB 2PN8A 3IA1A 4MZBA 3DD3A 1OAZA 5IMCA 2YWOA 5J3RA 3ISOA 2LRCA 4PTSA 4KE3A 2FCHA 5COHA 1BG5A 3IOSA 1A24A 4EXJA 2DMMA 3F8UA 1XVQA 7GSSA 5GAND 1DUGA 2VL3A 2VD1A 2GSQA 3LG6A 1XWKA 1PRXA 2LV3A 2H70A 1GSDA 3KTLA 5G2ZA 5JCWA 2VL2A 4FO5A 2VD0A 3GH6A 4H86A 1AQWA 3VURA 3WGDA 1TU8A 4D73A 4GRFA 6GSWA 4DEJA 4I5QA 4ULXA 2YV7A 2MBTA 1GNEA 4F82A 4K9ZA 4PUAA 1XWAA 2Z9SA 3SBCA 2V6OA 1UVZA 3QFAC 1WRYA 4X0XA 4KW6A 1GP1A 4WETA 3VLNA 3I6AA 2GSTA 5FHIA 3VPTA 2XBIA 3D4MA 2CZ2A 1XW6A 2LNSA 4CY8A 3HDCA 4G0KA 4ZXGA 2F8AA 3O6TA 4KSOA 2VCWA 4FH8A 1G0TA 5GSTA 2CAQA 2H66A 4ID0A 2DJ3A 2E0QA 4L5LA 3GV1A 3MNGA 2KP1A 2H75A 2VLUA 1TK5B 5DALB 5G31A 5HR2A 2C3TA 3H1NA 3MAKA 4GWRA 1AIUA 1T3BA 3G7IA 2AV4A 3ZVJD 2OJLA 2YWMA 1EV4A 2J23A 4F03A 1XVWA 2FWFA 3WT2A 1ZMAA 1SU9A 5DCGA 1R5AA 4NXIA 3Q74A 2GSRA 5A4WA 3VWVA 1WMJA 1EWXA 5HR0A 1E2YA 2LRTA 2LJKA 2FA4A 4PNGA 4ML6A 3D21A 5D9VA 5LCZA 3KMOA 5F0GA 6GSYA 1PN9A 4OD7A 2NTOA 4QQ7A 3N9JA 2AYTA 1PA3A 5L71A 3KCMA 5ECOB 5J4UA 5DJLA 4EE0A 4Z2TA 4NV2A 5B7CA 5D8IA 18GSA 5HR3A 4MJCA 4OO5A 4JR4A 2VLTA 2DC5A 4MZCA 1NM3A 3HZ4A 2IPAA 4RI7A 2GTUA 3ZMKA 3TDGA 1GSQA 2OBIA 2VOCA 2GQKA 1OC9B 4V2LA 3ME7A 5D9WA 3DIEA 2YANA 2K9FA 3FYGA 3IHQA 2GGTA 1X5EA 3ZLPA 3E0UA 4ICYA 1O6JA 1ML6A 5ELGA 3KH7A 1AC1A 4GCIA 3HHVA 2N5AA 2TRCP 3HVVA 3F6FA 3G7YA 1M2DA 3LJRA 4HEA2 4HUAA 5EY6A 5CREA 5ECQB 4P3YB 2B5YA 4LMWA 1Z7RA 2V2GA 4AJ8A 3P7XA 2A2SA 5DQSA 1AQXA 3EU3A 1OC3A 3LXTA 2IJYA 2OACA 5EPFA 1TDIA 1SYXA 4IGJA 3GURA 2WULA 4K2DA 8GSSA 3F6DA 3ZRDA 4J2FA 5CRDA 3RPNA 4F0BA 1A2MA 2NVLA 4IVFA 4O32A 1EGRA 5IOXA 1KNGA 2R0PA 2A2RA 1Y25A 1U3AA 2FA8A 4KDUA 2PU9C 3QAWA 2MMAA 2H1AA 1UA5A 1ZCPA 1OC8A 4BA7A 1F2EA 4FYUA 3H8QA 1TOFA 2H1BA 2H6YA 2GQMA 3EU4A 4KNDA 4TOPA 5G1LA 5D9TA 5GZZB 4CY6A 1G6YA 1YF1A 2WDUA 3HJMA 2BMXA 4XHMA 2I81A 1XZOA 3TOTA 4K7IA 1FB6A 2QKEA 3TUEA 1FB0A 2XC2A 1ILOA 2EIQA 2LJAA 4MH3A 1PL2A 4KCEA 4NHZA 4EO3A 1G6WA 3FEUA 2G2QA 1PKZA 4USSA 5DAKB 3ZVJA 1TRSA 3CYNA 2I9HA 1ZYQB 2R2JA 4IS0A 1VF1A 2DKIA 4O7HA 4HJMA 4KX4A 5EVOA 5A4UA 1I9DA 3GA4A 4TR1A 3FRCA 3MYDA 3TKSE 1VF3A 2MYGA 3UBLA 1BJXA 3UVHA 1MDKA 1Q98A 1WPIA 3HZ8A 4WXTA 4G9HA 4O92A 3BCIA 3PINA 2CVBA 1SKSB 1SYRA 1XIYA 2RM6A 3ZREA 2VM2A 4YQVA 4MPGA 1AW9A 2H0HA 5H5SA 1DBYA 2IMEA 3IV4A 3TJGA 2L5LA 4RUVA 4TN8A 4TXOA 1PX7A 3H4KA 3PR8A 1GSUA 3BCKA 2LKUA 3HVSA 3F3QA 3NZNA 3H93A 2XPDA 3HXSA 1T1VA 3DVXA 1TP9A 1R5PA 5KN0A 2B1LA 1ZYEA 4X43A 4OO4A 2YZHA 3TKQA 4POKA 5CRHA 5JCGA 3APQA 1S3DA 1ZYNA 2VL2C 5LD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZ4 A;  3LFL A;  4NMU A;  1HQO A;  1MTC A;  3GIX A;  3VWW A;  1YEP A;  1GL8 A;  3N5O A;  2O89 A;  3ERG A;  2PBJ A;  2KLX A;  5ECL B;  3L78 A;  2CT6 A;  3IC4 A;  3GKX A;  1A23 A;  5IMD A;  1RK4 A;  4GXZ A;  1ST9 A;  1O7U A;  4MZW A;  5E4W A;  2HFD A;  3WGE A;  1XOB A;  2C8U A;  1TRU A;  5J41 A;  3CSJ A;  5KN1 A;  1ZL9 A;  3D22 A;  5ECI B;  1BX9 A;  4K7N A;  5AIX A;  2PUK C;  1OVN A;  1HYU A;  2B7J A;  1Y6E A;  3TB2 A;  4IQA A;  5JWR B;  1TTZ A;  4N0Z A;  1SJI A;  2JZR A;  3RBT A;  3P8W A;  1M2A A;  2DIY A;  2CVD A;  2IN3 A;  5C00 A;  2V1M A;  4AGS A;  2ON5 A;  1FAA A;  3RDW A;  1MD4 A;  4PQ1 A;  2VCQ A;  3GL5 A;  3APS A;  3MDK A;  3FY7 A;  1URM A;  5IO2 A;  2CAI A;  2LTK A;  3UEM A;  5ECR B;  5ELA A;  5ABR A;  4IJ3 A;  2PER A;  2IL3 A;  4K0N A;  1YEX A;  5A5K A;  3FZ9 A;  2HZF A;  4TRX A;  3TKP A;  2GT6 A;  3KIJ A;  4ACS A;  4XCS A;  3F9U A;  4POB A;  5ECH B;  1Q4J A;  3GH9 A;  3ZML A;  3HJP A;  5EL8 A;  11GS A;  3C71 A;  2AJQ B;  5DVB A;  1TW9 A;  3SWL A;  2YOI A;  1F37 A;  3W8S A;  1QGV A;  3HA9 A;  2B5E A;  1X0R A;  4V1A g;  3ZZX A;  1KEB A;  2OE3 A;  2YPM A;  4TKY A;  2WB9 A;  4D73 B;  2DIZ A;  2ES7 A;  3KH9 A;  1FOV A;  1GTA A;  2CV4 A;  3JCM L;  1GUL A;  2X8G A;  3LOR A;  2F8F A;  2O85 A;  3M1G A;  4OFM A;  1Z7P A;  5CAX A;  2TRX A;  1FVJ A;  1VF2 A;  4GLT A;  2VO4 A;  1XWC A;  4GST A;  1V98 A;  3F3R A;  1O73 A;  3NIV A;  3FK8 A;  3GST A;  2DSA A;  4MJA A;  1AQV A;  1JHB A;  1F3B A;  5AIV A;  1SK0 A;  4Q5N A;  2L4Q A;  2YV9 A;  3L0H A;  4EL1 A;  3A2V A;  4KA0 A;  3M0F A;  3EWL A;  2HRN A;  5D96 A;  1PX6 A;  2OE0 A;  4GF0 A;  1UN2 A;  1SD8 A;  4POM A;  1VRS D;  2H71 A;  2VL9 A;  3CSI A;  1PKW A;  5KEJ A;  3KP9 A;  3CSH A;  2DJ2 A;  1GWC A;  2K18 A;  2AUV A;  2GSS A;  5ECK B;  17GS A;  4TXV A;  5HR1 A;  4BVY A;  4BL7 A;  1ERT A;  4HZ2 A;  1AUC A;  4JBB A;  1B9X C;  2X8C A;  3L9U A;  4AF2 A;  3RPP A;  3TKS A;  1MDJ A;  1FW1 A;  3EUR A;  1SD9 A;  5HQP A;  2ON7 A;  2CX3 A;  4GSN A;  4FYC A;  4JZQ A;  1GRX A;  1U6T A;  4F2I A;  4HOJ A;  2L6C A;  1G7E A;  1X5D A;  2YJH A;  10GS A;  4MCU A;  3A3T A;  1TI1 A;  3CRU A;  2PGT A;  3US3 A;  4KDX A;  2GLR A;  1ZZY A;  1XW5 A;  4IN0 A;  4XS6 A;  3DKS A;  3KEB A;  5IMZ A;  4MF5 A;  4EDZ A;  3DRN A;  2MBS A;  3ED3 A;  1PD2 1;  1T4Z A;  5ECM B;  2WRT A;  1FO5 A;  5IPH A;  2C0E A;  2DJJ A;  3L9V A;  1NSW A;  1IYI A;  3C7M A;  1O81 A;  4XRA A;  2PMT A;  3WD6 A;  2CZ3 A;  3EVI A;  2VM1 A;  2M72 A;  4MAB A;  2FY6 A;  2K8S A;  2I4A A;  3IK9 A;  1CQG A;  1A8L A;  5INY A;  2CX4 A;  2QSI A;  3TRX A;  4K1F A;  4WF4 A;  2X8H A;  3L4N A;  3KP8 A;  2BTO T;  1Z6M A;  3GX8 A;  3D5J A;  5GSS A;  4KB3 A;  4E8H A;  2CQ9 A;  3D6I A;  5JCU A;  1A0F A;  3GKK A;  2HLS A;  4PXO A;  4IJI A;  4JE1 A;  3EMX A;  3QFB C;  5IMV A;  1EOG A;  2FD3 A;  2C3Q A;  3V1W A;  3EYT A;  3UOM A;  3C1R A;  3KTB A;  1GNW A;  1TKD B;  1E6B A;  3TRQ A;  4ECB A;  1A2J A;  4GQF A;  3E9J B;  2EIR A;  2L59 A;  3WGX A;  3LGC A;  1GLP A;  3KZQ A;  3CMI A;  4MA9 A;  4FYB A;  3LXZ A;  2RM5 A;  2ZUP A;  1EP7 A;  4NPB A;  4G19 A;  3IPZ A;  4N10 A;  5ENU A;  4OFN A;  1QUW A;  2LQQ A;  2VIM A;  1YF0 A;  3GRX A;  4XRD A;  3M8N A;  1R4W A;  1M2B A;  4J57 E;  1WWJ A;  4PUR A;  1K0D A;  3RAZ A;  3GMF A;  3BD2 A;  2V32 A;  1JZW A;  1LJR A;  4KCA A;  1N2A A;  2WS2 A;  3TRP A;  2ZCT A;  4LMV A;  3FKF A;  4PGT A;  3APO A;  2HYX A;  2H76 A;  1GTB A;  1K0O A;  3TCO A;  2OAD A;  2P5Q A;  4JED A;  5AGY A;  1EZK A;  2VAF A;  5ECN B;  1TK8 B;  3A5W A;  3IE3 A;  2NBS A;  1U3I A;  3DWV A;  1V40 A;  2YJ7 A;  3EIN A;  5G5E A;  2CA8 A;  2H6X A;  4FIW A;  1ERV A;  1SK2 A;  5B6M A;  1AAZ A;  4KAE A;  4HU7 A;  2HZE B;  3MWH A;  3TGZ A;  3KXO A;  19GS A;  3VK9 A;  3LYP A;  3DVW A;  3ZTL A;  3QR6 A;  2FNO A;  4TR1 B;  1OYJ A;  4V2N A;  3GNJ A;  2V6K A;  5DBQ A;  4HQZ A;  4ECI A;  4IP6 A;  3LEF A;  3VWX A;  2AB6 A;  1K0N A;  4MMM A;  2MZC A;  2LRN A;  1XW9 A;  2HZE A;  1SK1 A;  2AAW A;  3DEX A;  5DQY A;  2XPE A;  1VGL A;  5IMF A;  1XCC A;  2A4V A;  6GSV A;  5J9C A;  3DML A;  1XFL A;  2DLX A;  1WP0 A;  4WKW A;  4JR6 A;  2FLS A;  4TXO B;  2HT9 A;  1GSE A;  5IMA A;  4IEL A;  3IDV A;  3F63 A;  4Z7X A;  3BJ5 A;  1THX A;  4MK3 A;  4ML1 A;  1V57 A;  5B6N A;  2IMF A;  1YJ6 A;  4I6X A;  4IKH A;  1S3A A;  4EF0 A;  4GQC A;  1M99 A;  1SL2 B;  2MMO A;  3LYK A;  4YAV A;  1GLQ A;  3TKR A;  1MEK A;  1BED A;  4BPY A;  1T00 A;  5FT3 A;  3CRT A;  3UVT A;  1H4O A;  3C1S A;  4TVE A;  2C3N A;  4EUY A;  2XBQ A;  3IBH A;  1YKA A;  4POL A;  5AN1 A;  1USB A;  3D4T A;  2I3Y A;  5AIS A;  2QGV A;  4L0W A;  4MJB A;  2QC7 A;  4I97 A;  2WGR A;  1Z5Y E;  4LL1 B;  4YH2 A;  5F05 A;  4N0V A;  1HNC A;  2H72 A;  1DSB A;  1K0A A;  2YNX A;  2IFQ A;  4J56 E;  3IXR A;  1RW1 A;  2R3X A;  2PVO C;  4KSM A;  2LJR A;  5CO3 A;  1OKD A;  2O7K A;  1CQH A;  1XWG A;  2YP6 A;  2E2G A;  4NV5 A;  1J0F A;  5B8B A;  4RQX A;  4IHU A;  2C0G A;  1KBN A;  3K8N A;  1SJZ A;  4KUN A;  3IRA A;  4MH2 A;  3DXB A;  4L5O A;  1ABA A;  2N5F A;  1SL1 B;  2LS5 A;  1BAY A;  2RII A;  1K0C A;  1QFN A;  1Z9H A;  2K6V A;  3TOU A;  1LBK A;  14GS A;  5D9X A;  4K7O A;  1PL1 A;  4IBP A;  2C0D A;  5HFI A;  2IMI A;  4ECC A;  1X9M B;  1B8X A;  2JL4 A;  1M7T A;  1YDK A;  2F3M A;  2GZP A;  3TKS C;  2NDO A;  3RHB A;  2F51 A;  1U88 A;  3ZFB A;  2LQO A;  1QXH A;  2RUF A;  3UMA A;  2GZZ A;  4EKZ A;  3PGT A;  2M80 A;  4N30 A;  2H30 A;  1SJ6 A;  1TXX A;  4CW9 A;  3ZIJ A;  1XBS A;  2N5B A;  4CHS A;  3W6G A;  3FZ5 A;  4IP1 A;  1W89 A;  2L57 A;  5JWQ B;  5DCH A;  5IM9 A;  2PPT A;  2L6D A;  2R6K A;  3GHA A;  4ZBA A;  4NAX A;  3UJ1 A;  2YWN A;  16GS A;  4MDC A;  2YCD A;  1MD3 A;  1EOH A;  3UIW A;  3QAV A;  2HSH A;  1GSY A;  3WT1 A;  1WIK A;  1EEM A;  3KJY A;  2R4V A;  2HXK A;  4XTS A;  4KGI A;  3R2Q A;  5IQY A;  3QD9 A;  2DJ1 A;  1O8W A;  1GUK A;  4XS4 A;  1B4Q A;  6GSS A;  1A0R P;  2L4C A;  3BBY A;  2LST A;  2OKA A;  2OA7 A;  1SKR B;  2WFC A;  1ERW A;  4PX1 A;  1YKC A;  5FWG A;  5IIZ A;  1J9B A;  3Q18 A;  4RQR A;  4WEY A;  3ZYW A;  5F06 A;  4I2T A;  4HS1 A;  4Q5F A;  5IPG A;  5ECP B;  2ZNM A;  1ACV A;  4TW5 A;  1C72 A;  2VCZ A;  2H73 A;  2JAD A;  4HDE A;  5J5N A;  1ON4 A;  2C1Y A;  4PNF A;  2DML A;  3F0I A;  2C0F A;  1THO A;  1FVK A;  2IMK A;  1V58 A;  5J9B A;  5KN3 A;  1PSQ A;  2O8V B;  2ALB A;  1W4V A;  4OFT A;  1KTE A;  5LNK e;  1JFU A;  4YQU A;  1NW2 A;  1PQN A;  1Z3E A;  5CRW A;  4ZIJ A;  3VI7 A;  3PH9 A;  3TJK A;  1PMT A;  2KUC A;  3L9S A;  1DE1 A;  3J7Y b;  3C8E A;  2TIR A;  4GTU A;  4HQS A;  4O5R A;  2P0G A;  4DSQ A;  4QL7 A;  4OMV A;  2HSY A;  2GS3 A;  4Q5Q A;  4ZL7 A;  3G9B A;  3W8J A;  1TRW A;  2IMD A;  2B5X A;  1BQ7 A;  4ZL8 A;  1EEJ A;  2H0G A;  4ZL9 A;  3TJF A;  4ZB9 A;  1F6M C;  12GS A;  2H01 A;  4LLR A;  1B48 A;  1PGT A;  4YAP A;  4QL9 A;  3F4T A;  3UL3 A;  5H5R A;  4HI7 A;  3ME8 A;  3FW2 A;  5B8A A;  5G1K A;  2E7P A;  1O85 A;  1GSS A;  3BOA A;  3HVX A;  3WYW A;  3VI5 A;  5KN2 A;  1ZGN A;  1T4Y A;  1U87 A;  1RQM A;  4HZ4 A;  1JZD A;  3FR3 A;  5DAL A;  2VCX A;  6GST A;  2H74 A;  3VPQ A;  4ECJ A;  2V41 A;  3GKM A;  1JLW A;  4NHW A;  1EGO A;  6GSU A;  5G5F A;  1WOU A;  2FUG 2;  2HNL A;  5DJM A;  1TI3 A;  3EE2 A;  1MDI A;  2EC4 A;  1TK0 B;  2J9H A;  1XOA A;  3HD5 A;  4AJ6 A;  1ZOF A;  4WBJ A;  1NHY A;  2JAC A;  3FR6 A;  4BWQ A;  2GQL A;  1YZX A;  4JU5 A;  4EVM A;  4IQ1 A;  3ZIV A;  1AXD A;  3VFI A;  2XHF A;  2B3S A;  1O8X A;  3A2W A;  3RHC A;  1GUM A;  2H0I A;  2G0F A;  4YQM A;  2P5R A;  3KMN A;  3ZFL A;  2C80 A;  1HD2 A;  1GTU A;  1V2A A;  2LEG A;  2CVK A;  2OBK A;  1UC7 A;  4HJ2 A;  1R26 A;  3O76 A;  2JU5 A;  2KOK A;  3G7J A;  4Q5R A;  4EDY A;  1TRV A;  4TR3 A;  4K6X A;  4PQI A;  1OC9 A;  2VUP A;  2H19 A;  1G7O A;  2BJX A;  3U5R E;  4ISD A;  1XWB A;  3E3E A;  1K3L A;  6GSX A;  1B4P A;  4X1U A;  2DJ0 A;  3LSZ A;  3DYR A;  1SL0 B;  1EP8 A;  4F0C A;  3DGQ A;  2GZY A;  2JZT A;  2GT5 A;  3CXG A;  4ZB6 A;  1HNB A;  3P90 A;  2WJU A;  3C73 A;  4GSS A;  2M46 A;  4I2U A;  1JZO A;  3GX0 A;  3ERF A;  5F8B A;  2KP2 A;  1WJK A;  4K8M A;  1FHE A;  1XXU A;  4XS1 A;  3MSZ A;  4E8E A;  3TJB A;  1Z6N A;  2X64 A;  1F9M A;  5CNW A;  3GN3 A;  4WBR D;  1X9S B;  4I8B A;  4XIH A;  2B1K A;  4WR5 A;  2YWI A;  2MMZ A;  1N8J A;  2WCI A;  3OR5 A;  4JRR A;  1X9W B;  4TR4 A;  3GYK A;  5CP1 A;  3AY8 A;  5GAP D;  3M9K A;  1EV9 A;  4WF5 A;  5E59 A;  1OKT A;  2HE3 A;  22GS A;  4DVC A;  2I1U A;  3H79 A;  2FWH A;  2X99 A;  1QMV A;  3QOU A;  4MP4 A;  3GUS A;  3Q19 A;  3U6V A;  3EC3 A;  2PWJ A;  3QCP A;  3QMX A;  3CTF A;  2AHE A;  1SKW B;  1NHO A;  2JSZ A;  3GL3 A;  3FZA A;  1YY7 A;  5DDL A;  3UBK A;  4BWS A;  4KH7 A;  3IR4 A;  1QK8 A;  3S9F A;  3I43 A;  1HNA A;  1JZR A;  3ZL5 A;  4CDO A;  3M3M A;  2P31 A;  2KHP A;  4KDY A;  1K0B A;  2C4J A;  13GS A;  1OE7 A;  2O87 A;  3HY2 A;  3F4R A;  2VCT A;  5A4V A;  2HRF A;  4ZB8 A;  4NWY A;  4DSS B;  5F07 A;  4N11 A;  2PVQ A;  3KGK A;  2LUS A;  3IK7 A;  1TU7 A;  2FWE A;  2JSY A;  1T8E B;  2RUE A;  4PQH A;  3GSS A;  2FHE A;  2RLI A;  3I9V 2;  2FWG A;  1GTI A;  5D73 A;  3ZIT A;  2EIO A;  1J08 A;  3TJJ A;  4TR0 A;  2GVP A;  3P2A A;  1M9A A;  4DSS A;  5DAK A;  5ECS A;  4MF6 A;  5JWO B;  5G30 A;  2IWT A;  4RI6 A;  1YQ1 A;  3NOF A;  3GKN A;  1TJD A;  4HU9 A;  2DJK A;  4OCF A;  3QPM A;  4OCE A;  2IFQ B;  1H75 A;  1F3A A;  20GS A;  3LWA A;  2GDR A;  2HI7 A;  1VF4 A;  2VLV A;  5C04 A;  2DBC A;  2H8L A;  1QQ2 A;  1M0U A;  3QDN A;  4G10 A;  3EMP A;  1OE8 A;  3KM6 A;  4K0G A;  2B7K A;  3ERW A;  2H1D A;  2YZU A;  2NPB A;  4V2M A;  1R7H A;  2R37 A;  5IOW A;  1XPV A;  5ID2 B;  3UAP A;  2WZ9 A;  4ZBD A;  5HFK A;  4L8E A;  1B9Y C;  3VWU A;  1X5C A;  4AJ7 A;  1A8Y A;  4MJE A;  1LU4 A;  2REM A;  3IAS 2;  1S3C A;  1FG4 A;  4IW9 A;  2F9S A;  4LA1 A;  3I69 A;  3HKR A;  5ID2 A;  3F4S A;  3FR9 A;  4PUF C;  2VCV A;  1M9B A;  3A2X A;  4WR4 A;  5D93 A;  2LNT A;  3O3T A;  3HJO A;  5H5Q A;  3HYP A;  2H6Z A;  4L0U A;  5HFG A;  3LQ7 A;  2E2M A;  2L5O A;  4G2E A;  4ILF A;  2MMN A;  4EC0 A;  2D2Z A;  4DSR A;  3GTU B;  1GSF A;  1WE0 A;  3CTG A;  4V1A p;  2JZS A;  1GH2 A;  1V9W A;  4MPF A;  5CYY A;  1BYE A;  4OWY A;  1A2L A;  1I5G A;  2FGX A;  3QAG A;  1JLV A;  4ZIL A;  2B6M A;  3CBU A;  3KD0 A;  4MF7 A;  2K8V A;  3Q6O A;  4XS4 B;  5IO0 A;  3FHK A;  4BVX A;  3GTU A;  4MLY A;  3HCZ A;  4ZBB A;  2IIY A;  3J7Y k;  1SEN A;  3D0Z A;  9GSS A;  2OE1 A;  1DE2 A;  4LL4 B;  5CRG A;  1K0M A;  3IAM 2;  1GUH A;  1K3Y A;  1IYH A;  2YN1 A;  1K3O A;  3UAR A;  2R5G A;  2H1G A;  4F9Z A;  1ERU A;  3M9J A;  3GFK A;  1T7P B;  2PN8 A;  3IA1 A;  4MZB A;  3DD3 A;  1OAZ A;  5IMC A;  2YWO A;  5J3R A;  3ISO A;  2LRC A;  4KE3 A;  2FCH A;  5COH A;  1BG5 A;  3IOS A;  1A24 A;  4EXJ A;  2DMM A;  3F8U A;  1XVQ A;  7GSS A;  5GAN D;  1DUG A;  2VL3 A;  2VD1 A;  2GSQ A;  3LG6 A;  1XWK A;  1PRX A;  2LV3 A;  2H70 A;  1GSD A;  3KTL A;  5G2Z A;  5JCW A;  2VL2 A;  4FO5 A;  2VD0 A;  3GH6 A;  4H86 A;  1AQW A;  3VUR A;  3WGD A;  1TU8 A;  4D73 A;  4GRF A;  6GSW A;  4DEJ A;  4I5Q A;  4ULX A;  2YV7 A;  2MBT A;  1GNE A;  4F82 A;  4K9Z A;  4PUA A;  1XWA A;  2Z9S A;  3SBC A;  2V6O A;  1UVZ A;  3QFA C;  1WRY A;  4X0X A;  4KW6 A;  1GP1 A;  4WET A;  3VLN A;  3I6A A;  2GST A;  5FHI A;  3VPT A;  2XBI A;  3D4M A;  2CZ2 A;  1XW6 A;  2LNS A;  3HDC A;  4ZXG A;  2F8A A;  3O6T A;  4KSO A;  2VCW A;  4FH8 A;  1G0T A;  5GST A;  2CAQ A;  2H66 A;  4ID0 A;  2DJ3 A;  2E0Q A;  4L5L A;  3GV1 A;  3MNG A;  2KP1 A;  2H75 A;  2VLU A;  1TK5 B;  5DAL B;  5G31 A;  5HR2 A;  2C3T A;  3H1N A;  3MAK A;  4GWR A;  1AIU A;  1T3B A;  3G7I A;  2AV4 A;  3ZVJ D;  2OJL A;  2YWM A;  1EV4 A;  2J23 A;  4F03 A;  1XVW A;  2FWF A;  3WT2 A;  1ZMA A;  1SU9 A;  5DCG A;  1R5A A;  4NXI A;  3Q74 A;  2GSR A;  5A4W A;  3VWV A;  1WMJ A;  1EWX A;  5HR0 A;  1E2Y A;  2LRT A;  2LJK A;  2FA4 A;  4PNG A;  4ML6 A;  3D21 A;  5D9V A;  5LCZ A;  3KMO A;  5F0G A;  6GSY A;  1PN9 A;  4OD7 A;  2NTO A;  4QQ7 A;  3N9J A;  2AYT A;  1PA3 A;  5L71 A;  3KCM A;  5ECO B;  5J4U A;  5DJL A;  4EE0 A;  4NV2 A;  5B7C A;  5D8I A;  18GS A;  5HR3 A;  4MJC A;  4OO5 A;  4JR4 A;  2VLT A;  2DC5 A;  4MZC A;  1NM3 A;  3HZ4 A;  2IPA A;  4RI7 A;  2GTU A;  3ZMK A;  3TDG A;  1GSQ A;  2OBI A;  2VOC A;  2GQK A;  1OC9 B;  4V2L A;  3ME7 A;  5D9W A;  3DIE A;  2YAN A;  2K9F A;  3FYG A;  3IHQ A;  2GGT A;  1X5E A;  3ZLP A;  3E0U A;  1O6J A;  1ML6 A;  5ELG A;  3KH7 A;  1AC1 A;  4GCI A;  3HHV A;  2N5A A;  2TRC P;  3HVV A;  3F6F A;  3G7Y A;  1M2D A;  3LJR A;  4HEA 2;  4HUA A;  5EY6 A;  5CRE A;  5ECQ B;  4P3Y B;  2B5Y A;  4LMW A;  1Z7R A;  2V2G A;  4AJ8 A;  3P7X A;  2A2S A;  5DQS A;  1AQX A;  3EU3 A;  1OC3 A;  3LXT A;  2IJY A;  2OAC A;  5EPF A;  1TDI A;  1SYX A;  4IGJ A;  3GUR A;  2WUL A;  4K2D A;  8GSS A;  3F6D A;  3ZRD A;  4J2F A;  5CRD A;  3RPN A;  4F0B A;  1A2M A;  2NVL A;  4IVF A;  4O32 A;  1EGR A;  5IOX A;  1KNG A;  2A2R A;  1Y25 A;  1U3A A;  2FA8 A;  4KDU A;  2PU9 C;  3QAW A;  2MMA A;  2H1A A;  1UA5 A;  1ZCP A;  1OC8 A;  4BA7 A;  1F2E A;  4FYU A;  3H8Q A;  1TOF A;  2H1B A;  2H6Y A;  2GQM A;  3EU4 A;  4KND A;  4TOP A;  5G1L A;  5D9T A;  5GZZ B;  1G6Y A;  1YF1 A;  2WDU A;  3HJM A;  2BMX A;  4XHM A;  2I81 A;  1XZO A;  3TOT A;  4K7I A;  1FB6 A;  2QKE A;  3TUE A;  1FB0 A;  2XC2 A;  1ILO A;  2EIQ A;  2LJA A;  4MH3 A;  1PL2 A;  4KCE A;  4NHZ A;  4EO3 A;  1G6W A;  3FEU A;  2G2Q A;  1PKZ A;  5DAK B;  3ZVJ A;  1TRS A;  3CYN A;  2I9H A;  1ZYQ B;  2R2J A;  4IS0 A;  1VF1 A;  4O7H A;  4HJM A;  4KX4 A;  5EVO A;  5A4U A;  1I9D A;  3GA4 A;  4TR1 A;  3FRC A;  3TKS E;  1VF3 A;  2MYG A;  3UBL A;  1BJX A;  3UVH A;  1MDK A;  1Q98 A;  1WPI A;  3HZ8 A;  4WXT A;  4G9H A;  4O92 A;  3BCI A;  3PIN A;  2CVB A;  1SKS B;  1SYR A;  1XIY A;  2RM6 A;  3ZRE A;  2VM2 A;  4YQV A;  4MPG A;  1AW9 A;  2H0H A;  5H5S A;  1DBY A;  2IME A;  3IV4 A;  3TJG A;  2L5L A;  4RUV A;  4TN8 A;  4TXO A;  1PX7 A;  3H4K A;  3PR8 A;  1GSU A;  3BCK A;  2LKU A;  3HVS A;  3F3Q A;  3NZN A;  3H93 A;  2XPD A;  3HXS A;  1T1V A;  3DVX A;  1TP9 A;  1R5P A;  5KN0 A;  2B1L A;  1ZYE A;  4X43 A;  4OO4 A;  2YZH A;  3TKQ A;  4POK A;  5CRH A;  5JCG A;  3APQ A;  1S3D A;  2VL2 C;  5LD0 A; 
#chains in the Genus database with same CATH topology
 3FZ4 A;  3LFL A;  4NMU A;  1HQO A;  1MTC A;  3GIX A;  3VWW A;  1YEP A;  1GL8 A;  3N5O A;  2O89 A;  3ERG A;  2PBJ A;  2KLX A;  4G0I A;  5ECL B;  3L78 A;  2CT6 A;  3IC4 A;  3GKX A;  1A23 A;  5IMD A;  1RK4 A;  4GXZ A;  1ST9 A;  1O7U A;  4MZW A;  5E4W A;  2HFD A;  3WGE A;  1XOB A;  2C8U A;  1TRU A;  4K5R A;  5J41 A;  3CSJ A;  5KN1 A;  1ZL9 A;  3D22 A;  5ECI B;  1BX9 A;  4K7N A;  5AIX A;  2PUK C;  1OVN A;  1HYU A;  2B7J A;  1Y6E A;  3TB2 A;  4IQA A;  5JWR B;  1TTZ A;  4N0Z A;  1SJI A;  2JZR A;  3RBT A;  3P8W A;  1M2A A;  2DIY A;  2CVD A;  2IN3 A;  5C00 A;  2V1M A;  4AGS A;  2ON5 A;  1FAA A;  3RDW A;  1MD4 A;  4PQ1 A;  2VCQ A;  3GL5 A;  3APS A;  3MDK A;  3FY7 A;  1URM A;  5IO2 A;  2CAI A;  2LTK A;  3UEM A;  5ECR B;  5ELA A;  5ABR A;  4IJ3 A;  2PER A;  2IL3 A;  4K0N A;  1YEX A;  5A5K A;  3IC8 A;  3FZ9 A;  2HZF A;  4TRX A;  3TKP A;  2GT6 A;  3KIJ A;  4ACS A;  4XCS A;  3F9U A;  4POB A;  5ECH B;  1Q4J A;  3GH9 A;  3ZML A;  3HJP A;  5EL8 A;  11GS A;  3C71 A;  2AJQ B;  5DVB A;  1TW9 A;  3SWL A;  2YOI A;  1F37 A;  3W8S A;  1QGV A;  3HA9 A;  2B5E A;  1X0R A;  4V1A g;  2HRA A;  3ZZX A;  1KEB A;  2OE3 A;  2YPM A;  4TKY A;  2WB9 A;  4EIP A;  4D73 B;  2DIZ A;  2ES7 A;  3KH9 A;  1FOV A;  1GTA A;  2CV4 A;  3JCM L;  1GUL A;  2X8G A;  3LOR A;  2F8F A;  2O85 A;  4BIK A;  3M1G A;  4OFM A;  1Z7P A;  5CAX A;  2TRX A;  1FVJ A;  1VF2 A;  4GLT A;  2VO4 A;  1XWC A;  4GST A;  1V98 A;  3F3R A;  1O73 A;  3NIV A;  3FK8 A;  3GST A;  2DSA A;  4MJA A;  1AQV A;  1JHB A;  1F3B A;  5AIV A;  1SK0 A;  4Q5N A;  2L4Q A;  2YV9 A;  3L0H A;  4EL1 A;  3A2V A;  4KA0 A;  3M0F A;  3EWL A;  2HRN A;  5D96 A;  1PX6 A;  2OE0 A;  4GF0 A;  4BVY B;  1UN2 A;  1SD8 A;  4POM A;  1VRS D;  2H71 A;  2VL9 A;  3CSI A;  1PKW A;  5KEJ A;  3KP9 A;  3CSH A;  2DJ2 A;  1GWC A;  2K18 A;  2AUV A;  2GSS A;  5ECK B;  17GS A;  4TXV A;  5HR1 A;  4BVY A;  4BL7 A;  1ERT A;  4HZ2 A;  1AUC A;  4JBB A;  1B9X C;  5BMU A;  2X8C A;  3L9U A;  4AF2 A;  3RPP A;  3TKS A;  1MDJ A;  1FW1 A;  3EUR A;  1SD9 A;  5HQP A;  2ON7 A;  2CX3 A;  4GSN A;  4FYC A;  4JZQ A;  1GRX A;  1U6T A;  4F2I A;  3EPT A;  4HOJ A;  4X4J A;  2L6C A;  1G7E A;  1X5D A;  2YJH A;  10GS A;  3MIX A;  4MCU A;  3A3T A;  1TI1 A;  3CRU A;  2PGT A;  3US3 A;  4KDX A;  2GLR A;  1ZZY A;  1XW5 A;  4IN0 A;  4XS6 A;  3DKS A;  3KEB A;  5IMZ A;  4MF5 A;  4EDZ A;  3DRN A;  2MBS A;  3ED3 A;  1PD2 1;  1T4Z A;  2QA1 A;  5ECM B;  2WRT A;  1FO5 A;  5IPH A;  2C0E A;  2DJJ A;  3L9V A;  1NSW A;  1IYI A;  3C7M A;  1O81 A;  4XRA A;  2PMT A;  3WD6 A;  2CZ3 A;  3EVI A;  2VM1 A;  2M72 A;  4MAB A;  2FY6 A;  2K8S A;  2I4A A;  3IK9 A;  1CQG A;  1A8L A;  4Z2R A;  5INY A;  2CX4 A;  2QSI A;  3TRX A;  4K1F A;  4WF4 A;  2X8H A;  3L4N A;  3KP8 A;  2BTO T;  1Z6M A;  3GX8 A;  3D5J A;  5GSS A;  4KB3 A;  4E8H A;  2CQ9 A;  3D6I A;  5JCU A;  1A0F A;  3GKK A;  2HLS A;  4PXO A;  4IJI A;  4JE1 A;  3EMX A;  3QFB C;  3A5I A;  5IMV A;  1EOG A;  2FD3 A;  2C3Q A;  3V1W A;  3EYT A;  3UOM A;  3C1R A;  3KTB A;  1GNW A;  1TKD B;  1E6B A;  4Z2U A;  3TRQ A;  4ECB A;  1A2J A;  4GQF A;  3E9J B;  2EIR A;  2L59 A;  3WGX A;  3LGC A;  1GLP A;  3KZQ A;  3CMI A;  4MA9 A;  4FYB A;  3LXZ A;  2RM5 A;  2ZUP A;  1EP7 A;  4NPB A;  4G19 A;  3IPZ A;  4N10 A;  5ENU A;  4OFN A;  1QUW A;  2LQQ A;  2VIM A;  1YF0 A;  3GRX A;  4XRD A;  3M8N A;  1R4W A;  1M2B A;  4J57 E;  1WWJ A;  4PUR A;  1K0D A;  3RAZ A;  3GMF A;  3BD2 A;  2V32 A;  1JZW A;  1LJR A;  4KCA A;  1N2A A;  2WS2 A;  3TRP A;  2ZCT A;  4LMV A;  3FKF A;  4PGT A;  3APO A;  2HYX A;  2H76 A;  3FMW A;  1GTB A;  1K0O A;  3TCO A;  2OAD A;  2P5Q A;  4JED A;  5AGY A;  1EZK A;  2VAF A;  5ECN B;  1TK8 B;  3A5W A;  3IE3 A;  2NBS A;  1U3I A;  3DWV A;  1V40 A;  2YJ7 A;  3EIN A;  5G5E A;  2CA8 A;  2H6X A;  4FIW A;  1ERV A;  1SK2 A;  5B6M A;  1AAZ A;  4KAE A;  4FQU A;  4HU7 A;  2HZE B;  3MWH A;  3TGZ A;  4HSC X;  3KXO A;  19GS A;  3VK9 A;  3LYP A;  3DVW A;  3ZTL A;  1FOH A;  3QR6 A;  2FNO A;  4TR1 B;  1OYJ A;  4V2N A;  3GNJ A;  2V6K A;  5DBQ A;  4HQZ A;  4ECI A;  4IP6 A;  3LEF A;  5BRT A;  3VWX A;  2AB6 A;  1K0N A;  1PFO A;  4MMM A;  2MZC A;  2LRN A;  1XW9 A;  2HZE A;  1SK1 A;  2AAW A;  3DEX A;  5DQY A;  2XPE A;  1VGL A;  5IMF A;  1XCC A;  2A4V A;  6GSV A;  5J9C A;  3DML A;  1XFL A;  2DLX A;  1WP0 A;  4WKW A;  4EIQ A;  4JR6 A;  2FLS A;  4TXO B;  2HT9 A;  1GSE A;  5IMA A;  4IEL A;  3IDV A;  3F63 A;  4Z7X A;  3BJ5 A;  1THX A;  4MK3 A;  4ML1 A;  1V57 A;  5B6N A;  2IMF A;  1YJ6 A;  4I6X A;  4IKH A;  1S3A A;  4EF0 A;  4GQC A;  1M99 A;  1SL2 B;  2MMO A;  3LYK A;  4YAV A;  1GLQ A;  3TKR A;  3R3E A;  1MEK A;  1BED A;  4BPY A;  1T00 A;  5FT3 A;  3CRT A;  3UVT A;  1H4O A;  3C1S A;  4TVE A;  2C3N A;  4EUY A;  2XBQ A;  2A4H A;  3IBH A;  1YKA A;  1S3R A;  4POL A;  5AN1 A;  1USB A;  3D4T A;  2I3Y A;  5AIS A;  2QGV A;  4L0W A;  4MJB A;  2QC7 A;  4I97 A;  2WGR A;  1Z5Y E;  4LL1 B;  4YH2 A;  5F05 A;  4N0V A;  1HNC A;  2H72 A;  1DSB A;  1K0A A;  2YNX A;  2IFQ A;  4J56 E;  2HSM A;  3IXR A;  1RW1 A;  2R3X A;  2PVO C;  4KSM A;  2LJR A;  5CO3 A;  1OKD A;  2O7K A;  1CQH A;  1XWG A;  2YP6 A;  2E2G A;  4NV5 A;  1J0F A;  5B8B A;  4RQX A;  4IHU A;  2C0G A;  1KBN A;  3K8N A;  1SJZ A;  4KUN A;  3IRA A;  4MH2 A;  3DXB A;  4L5O A;  1ABA A;  2N5F A;  1SL1 B;  2LS5 A;  1BAY A;  2RII A;  1K0C A;  1QFN A;  1Z9H A;  2K6V A;  3TOU A;  1LBK A;  14GS A;  5D9X A;  4K7O A;  1PL1 A;  4IBP A;  2C0D A;  5HFI A;  2IMI A;  4ECC A;  1X9M B;  1B8X A;  2JL4 A;  1M7T A;  1YDK A;  2F3M A;  2GZP A;  3TKS C;  2NDO A;  3RHB A;  2F51 A;  1U88 A;  3ZFB A;  2LQO A;  1QXH A;  2RUF A;  3UMA A;  2GZZ A;  4EKZ A;  3PGT A;  2M80 A;  4N30 A;  2H30 A;  1SJ6 A;  1TXX A;  4CW9 A;  3ZIJ A;  1XBS A;  2N5B A;  4MNN A;  4CHS A;  3W6G A;  3FZ5 A;  4IP1 A;  1W89 A;  2L57 A;  5JWQ B;  5DCH A;  5IM9 A;  2PPT A;  2L6D A;  2R6K A;  3GHA A;  4ZBA A;  4NAX A;  3UJ1 A;  2YWN A;  16GS A;  4MDC A;  2YCD A;  1MD3 A;  1EOH A;  3UIW A;  3QAV A;  2HSH A;  1GSY A;  3WT1 A;  1WIK A;  1EEM A;  3KJY A;  2R4V A;  2HXK A;  4XTS A;  4KGI A;  3R2Q A;  5IQY A;  3QD9 A;  2DJ1 A;  1O8W A;  4K5S A;  1GUK A;  4XS4 A;  1B4Q A;  6GSS A;  1A0R P;  2L4C A;  3BBY A;  2LST A;  2OKA A;  2OA7 A;  2R0G A;  1SKR B;  2WFC A;  1ERW A;  1XG8 A;  4PX1 A;  3IHG A;  1YKC A;  5FWG A;  5IIZ A;  1J9B A;  3Q18 A;  4RQR A;  4WEY A;  3ZYW A;  5F06 A;  4I2T A;  4HS1 A;  4Q5F A;  5IPG A;  5ECP B;  2ZNM A;  1ACV A;  4TW5 A;  1C72 A;  2VCZ A;  2H73 A;  2JAD A;  4HDE A;  5J5N A;  1ON4 A;  2C1Y A;  4PNF A;  2DML A;  3F0I A;  2C0F A;  1THO A;  1FVK A;  2IMK A;  1V58 A;  5J9B A;  4BL7 B;  5KN3 A;  1PSQ A;  2QA2 A;  2O8V B;  2ALB A;  1W4V A;  4OFT A;  1KTE A;  5LNK e;  1JFU A;  4G0L A;  4YQU A;  1NW2 A;  1PQN A;  1Z3E A;  5CRW A;  4ZIJ A;  3VI7 A;  3PH9 A;  3TJK A;  4K2X A;  1PMT A;  2KUC A;  3L9S A;  1DE1 A;  3J7Y b;  3C8E A;  2TIR A;  4GTU A;  4HQS A;  4O5R A;  2P0G A;  4DSQ A;  4QL7 A;  4OMV A;  2HSY A;  2GS3 A;  4Q5Q A;  4ZL7 A;  3G9B A;  3W8J A;  1TRW A;  2IMD A;  2B5X A;  1BQ7 A;  4ZL8 A;  1EEJ A;  2H0G A;  4ZL9 A;  3TJF A;  4ZB9 A;  1F6M C;  12GS A;  2H01 A;  4LLR A;  1B48 A;  1PGT A;  4YAP A;  4QL9 A;  3F4T A;  3UL3 A;  5H5R A;  4HI7 A;  3ME8 A;  3FW2 A;  5B8A A;  5G1K A;  2UZ8 A;  2E7P A;  1O85 A;  1GSS A;  3BOA A;  3HVX A;  3WYW A;  3VI5 A;  5KN2 A;  1ZGN A;  1T4Y A;  1U87 A;  1RQM A;  4HZ4 A;  1JZD A;  3FR3 A;  5DAL A;  2VCX A;  6GST A;  2H74 A;  3VPQ A;  4ECJ A;  2V41 A;  3GKM A;  1JLW A;  4NHW A;  1EGO A;  6GSU A;  5G5F A;  1WOU A;  2FUG 2;  2HNL A;  5DJM A;  4O5Q A;  1TI3 A;  2A2P A;  3EE2 A;  1MDI A;  2EC4 A;  1TK0 B;  2J9H A;  1XOA A;  1ZYP A;  3HD5 A;  4AJ6 A;  1ZOF A;  4WBJ A;  1NHY A;  2JAC A;  3FR6 A;  4BWQ A;  2GQL A;  1YZX A;  4JU5 A;  4EVM A;  4IQ1 A;  3ZIV A;  1AXD A;  3VFI A;  2XHF A;  2B3S A;  1O8X A;  3A2W A;  3RHC A;  1GUM A;  2H0I A;  2G0F A;  4YQM A;  2P5R A;  3KMN A;  3ZFL A;  2C80 A;  1HD2 A;  1GTU A;  1V2A A;  2LEG A;  2CVK A;  2OBK A;  1UC7 A;  4HJ2 A;  1R26 A;  3O76 A;  2JU5 A;  2X4A A;  2KOK A;  3G7J A;  4Q5R A;  4EDY A;  1TRV A;  4TR3 A;  2HRK A;  4K6X A;  4PQI A;  1OC9 A;  2VUP A;  2H19 A;  1G7O A;  2BJX A;  3U5R E;  4ISD A;  1XWB A;  3E3E A;  1K3L A;  6GSX A;  1B4P A;  4X1U A;  2DJ0 A;  3LSZ A;  3DYR A;  4O5U A;  1SL0 B;  1EP8 A;  4F0C A;  3DGQ A;  2GZY A;  2JZT A;  2GT5 A;  3CXG A;  4ZB6 A;  1HNB A;  3P90 A;  2WJU A;  3C73 A;  4GSS A;  2M46 A;  4I2U A;  1JZO A;  3GX0 A;  3ERF A;  4A5P A;  5F8B A;  2KP2 A;  1WJK A;  4K8M A;  1FHE A;  1XXU A;  4XS1 A;  3MSZ A;  4E8E A;  3TJB A;  1Z6N A;  2X64 A;  1F9M A;  5CNW A;  3GN3 A;  4WBR D;  1X9S B;  4I8B A;  3CQF A;  4XIH A;  2B1K A;  4WR5 A;  2YWI A;  2MMZ A;  1N8J A;  2WCI A;  3OR5 A;  4JRR A;  1X9W B;  4KF9 A;  4TR4 A;  3GYK A;  5CP1 A;  3AY8 A;  5GAP D;  3M9K A;  1EV9 A;  4WF5 A;  5E59 A;  1OKT A;  2HE3 A;  22GS A;  4DVC A;  2I1U A;  3H79 A;  2FWH A;  2X99 A;  1QMV A;  3QOU A;  4MP4 A;  3GUS A;  3Q19 A;  3U6V A;  3EC3 A;  2PWJ A;  3QCP A;  3QMX A;  3CTF A;  2AHE A;  1SKW B;  1NHO A;  2JSZ A;  3GL3 A;  4YKF A;  3FZA A;  1YY7 A;  5DDL A;  3UBK A;  4BWS A;  4KH7 A;  2R0C A;  3LW9 A;  3IR4 A;  1QK8 A;  3S9F A;  3I43 A;  1HNA A;  1JZR A;  3ZL5 A;  4CDO A;  3M3M A;  2P31 A;  2KHP A;  4KDY A;  1K0B A;  2C4J A;  4YKG A;  13GS A;  1OE7 A;  2O87 A;  3HY2 A;  3F4R A;  2VCT A;  1M3I A;  5A4V A;  2HRF A;  4ZB8 A;  4NWY A;  4DSS B;  5F07 A;  4N11 A;  2PVQ A;  3KGK A;  2LUS A;  3IK7 A;  1TU7 A;  2FWE A;  2JSY A;  1T8E B;  2RUE A;  4PQH A;  3GSS A;  2FHE A;  2RLI A;  3I9V 2;  2FWG A;  1GTI A;  5D73 A;  3ZIT A;  2EIO A;  1J08 A;  3TJJ A;  4TR0 A;  2GVP A;  3P2A A;  1M9A A;  4DSS A;  5DAK A;  5ECS A;  4MF6 A;  5JWO B;  5G30 A;  2IWT A;  4RI6 A;  3PPU A;  1YQ1 A;  5KOW A;  3NOF A;  3GKN A;  1TJD A;  4HU9 A;  2DJK A;  4OCF A;  3QPM A;  4OCE A;  2IFQ B;  1H75 A;  1F3A A;  20GS A;  3LWA A;  2GDR A;  2HI7 A;  1VF4 A;  2VLV A;  5C04 A;  2DBC A;  2H8L A;  1QQ2 A;  1M0U A;  3QDN A;  4G10 A;  3EMP A;  1OE8 A;  3KM6 A;  4K0G A;  2B7K A;  3ERW A;  2H1D A;  2YZU A;  2NPB A;  4V2M A;  1R7H A;  3HVN A;  2R37 A;  5IOW A;  1XPV A;  5ID2 B;  3UAP A;  2WZ9 A;  4ZBD A;  5HFK A;  4L8E A;  1B9Y C;  3VWU A;  1X5C A;  4AJ7 A;  1A8Y A;  5KOX A;  4MJE A;  1LU4 A;  2REM A;  3IAS 2;  1S3C A;  1FG4 A;  4IW9 A;  2F9S A;  4LA1 A;  3I69 A;  3HKR A;  5ID2 A;  3F4S A;  3FR9 A;  4PUF C;  2VCV A;  1M9B A;  3A2X A;  1PN0 A;  4WR4 A;  5D93 A;  2LNT A;  3O3T A;  3HJO A;  5H5Q A;  3HYP A;  2H6Z A;  4L0U A;  5HFG A;  3LQ7 A;  2E2M A;  2L5O A;  4G2E A;  4ILF A;  2X49 A;  2MMN A;  4EC0 A;  2D2Z A;  4DSR A;  4BVX B;  3GTU B;  1GSF A;  2DKH A;  1WE0 A;  3CTG A;  4V1A p;  2JZS A;  1GH2 A;  1V9W A;  4MPF A;  5CYY A;  1BYE A;  4OWY A;  1A2L A;  1I5G A;  2FGX A;  3QAG A;  1JLV A;  4ZIL A;  2B6M A;  3CBU A;  3KD0 A;  4MF7 A;  2K8V A;  3Q6O A;  4XS4 B;  5IO0 A;  3FHK A;  4BVX A;  3GTU A;  4MLY A;  3HCZ A;  4ZBB A;  2IIY A;  3J7Y k;  1SEN A;  3D0Z A;  9GSS A;  2OE1 A;  1DE2 A;  4LL4 B;  5CRG A;  1K0M A;  3IAM 2;  1GUH A;  1K3Y A;  1IYH A;  2YN1 A;  1K3O A;  3UAR A;  2R5G A;  2H1G A;  4F9Z A;  1ERU A;  3M9J A;  3GFK A;  1T7P B;  2PN8 A;  3IA1 A;  4MZB A;  3DD3 A;  1OAZ A;  5IMC A;  2YWO A;  5J3R A;  3ISO A;  2LRC A;  4PTS A;  4KE3 A;  2FCH A;  5COH A;  1BG5 A;  3IOS A;  1A24 A;  4EXJ A;  2DMM A;  3F8U A;  1XVQ A;  7GSS A;  5GAN D;  1DUG A;  2VL3 A;  2VD1 A;  2GSQ A;  3LG6 A;  1XWK A;  1PRX A;  2LV3 A;  2H70 A;  1GSD A;  3KTL A;  5G2Z A;  5JCW A;  2VL2 A;  4FO5 A;  2VD0 A;  3GH6 A;  4H86 A;  1AQW A;  3VUR A;  3WGD A;  1TU8 A;  4D73 A;  4GRF A;  6GSW A;  1M3J A;  4DEJ A;  4I5Q A;  4ULX A;  2YV7 A;  2MBT A;  1GNE A;  4F82 A;  4K9Z A;  4PUA A;  1XWA A;  2Z9S A;  3SBC A;  2V6O A;  1UVZ A;  3QFA C;  1WRY A;  4X0X A;  4KW6 A;  1GP1 A;  4WET A;  3VLN A;  3I6A A;  2GST A;  5FHI A;  3VPT A;  2XBI A;  3D4M A;  2CZ2 A;  1XW6 A;  2LNS A;  4CY8 A;  3HDC A;  4G0K A;  4ZXG A;  2F8A A;  3O6T A;  4KSO A;  2VCW A;  4FH8 A;  1G0T A;  5GST A;  2CAQ A;  2H66 A;  4ID0 A;  2DJ3 A;  2E0Q A;  4L5L A;  3GV1 A;  3MNG A;  2KP1 A;  2H75 A;  2VLU A;  1TK5 B;  5DAL B;  5G31 A;  5HR2 A;  2C3T A;  3H1N A;  3MAK A;  4GWR A;  1AIU A;  1T3B A;  3G7I A;  2AV4 A;  3ZVJ D;  2OJL A;  2YWM A;  1EV4 A;  2J23 A;  4F03 A;  1XVW A;  2FWF A;  3WT2 A;  1ZMA A;  1SU9 A;  5DCG A;  1R5A A;  4NXI A;  3Q74 A;  2GSR A;  5A4W A;  3VWV A;  1WMJ A;  1EWX A;  5HR0 A;  1E2Y A;  2LRT A;  2LJK A;  2FA4 A;  4PNG A;  4ML6 A;  3D21 A;  5D9V A;  5LCZ A;  3KMO A;  5F0G A;  6GSY A;  1PN9 A;  4OD7 A;  2NTO A;  4QQ7 A;  3N9J A;  2AYT A;  1PA3 A;  5L71 A;  3KCM A;  5ECO B;  5J4U A;  5DJL A;  4EE0 A;  4Z2T A;  4NV2 A;  5B7C A;  5D8I A;  18GS A;  5HR3 A;  4MJC A;  4OO5 A;  4JR4 A;  2VLT A;  2DC5 A;  4MZC A;  1NM3 A;  3HZ4 A;  2IPA A;  4RI7 A;  2GTU A;  3ZMK A;  3TDG A;  1GSQ A;  2OBI A;  2VOC A;  2GQK A;  1OC9 B;  4V2L A;  3ME7 A;  5D9W A;  3DIE A;  2YAN A;  2K9F A;  3FYG A;  3IHQ A;  2GGT A;  1X5E A;  3ZLP A;  3E0U A;  4ICY A;  1O6J A;  1ML6 A;  5ELG A;  3KH7 A;  1AC1 A;  4GCI A;  3HHV A;  2N5A A;  2TRC P;  3HVV A;  3F6F A;  3G7Y A;  1M2D A;  3LJR A;  4HEA 2;  4HUA A;  5EY6 A;  5CRE A;  5ECQ B;  4P3Y B;  2B5Y A;  4LMW A;  1Z7R A;  2V2G A;  4AJ8 A;  3P7X A;  2A2S A;  5DQS A;  1AQX A;  3EU3 A;  1OC3 A;  3LXT A;  2IJY A;  2OAC A;  5EPF A;  1TDI A;  1SYX A;  4IGJ A;  3GUR A;  2WUL A;  4K2D A;  8GSS A;  3F6D A;  3ZRD A;  4J2F A;  5CRD A;  3RPN A;  4F0B A;  1A2M A;  2NVL A;  4IVF A;  4O32 A;  1EGR A;  5IOX A;  1KNG A;  2R0P A;  2A2R A;  1Y25 A;  1U3A A;  2FA8 A;  4KDU A;  2PU9 C;  3QAW A;  2MMA A;  2H1A A;  1UA5 A;  1ZCP A;  1OC8 A;  4BA7 A;  1F2E A;  4FYU A;  3H8Q A;  1TOF A;  2H1B A;  2H6Y A;  2GQM A;  3EU4 A;  4KND A;  4TOP A;  5G1L A;  5D9T A;  5GZZ B;  4CY6 A;  1G6Y A;  1YF1 A;  2WDU A;  3HJM A;  2BMX A;  4XHM A;  2I81 A;  1XZO A;  3TOT A;  4K7I A;  1FB6 A;  2QKE A;  3TUE A;  1FB0 A;  2XC2 A;  1ILO A;  2EIQ A;  2LJA A;  4MH3 A;  1PL2 A;  4KCE A;  4NHZ A;  4EO3 A;  1G6W A;  3FEU A;  2G2Q A;  1PKZ A;  4USS A;  5DAK B;  3ZVJ A;  1TRS A;  3CYN A;  2I9H A;  1ZYQ B;  2R2J A;  4IS0 A;  1VF1 A;  2DKI A;  4O7H A;  4HJM A;  4KX4 A;  5EVO A;  5A4U A;  1I9D A;  3GA4 A;  4TR1 A;  3FRC A;  3MYD A;  3TKS E;  1VF3 A;  2MYG A;  3UBL A;  1BJX A;  3UVH A;  1MDK A;  1Q98 A;  1WPI A;  3HZ8 A;  4WXT A;  4G9H A;  4O92 A;  3BCI A;  3PIN A;  2CVB A;  1SKS B;  1SYR A;  1XIY A;  2RM6 A;  3ZRE A;  2VM2 A;  4YQV A;  4MPG A;  1AW9 A;  2H0H A;  5H5S A;  1DBY A;  2IME A;  3IV4 A;  3TJG A;  2L5L A;  4RUV A;  4TN8 A;  4TXO A;  1PX7 A;  3H4K A;  3PR8 A;  1GSU A;  3BCK A;  2LKU A;  3HVS A;  3F3Q A;  3NZN A;  3H93 A;  2XPD A;  3HXS A;  1T1V A;  3DVX A;  1TP9 A;  1R5P A;  5KN0 A;  2B1L A;  1ZYE A;  4X43 A;  4OO4 A;  2YZH A;  3TKQ A;  4POK A;  5CRH A;  5JCG A;  3APQ A;  1S3D A;  1ZYN A;  2VL2 C;  5LD0 A; 
#chains in the Genus database with same CATH homology
 3FZ4 A;  3LFL A;  4NMU A;  1HQO A;  1MTC A;  3GIX A;  3VWW A;  1YEP A;  1GL8 A;  3N5O A;  2O89 A;  3ERG A;  2PBJ A;  2KLX A;  4G0I A;  5ECL B;  3L78 A;  2CT6 A;  3IC4 A;  3GKX A;  1A23 A;  5IMD A;  1RK4 A;  4GXZ A;  1ST9 A;  1O7U A;  4MZW A;  5E4W A;  2HFD A;  3WGE A;  1XOB A;  2C8U A;  1TRU A;  4K5R A;  5J41 A;  3CSJ A;  5KN1 A;  1ZL9 A;  3D22 A;  5ECI B;  1BX9 A;  4K7N A;  5AIX A;  2PUK C;  1OVN A;  1HYU A;  2B7J A;  1Y6E A;  3TB2 A;  4IQA A;  5JWR B;  1TTZ A;  4N0Z A;  1SJI A;  2JZR A;  3RBT A;  3P8W A;  1M2A A;  2DIY A;  2CVD A;  2IN3 A;  5C00 A;  2V1M A;  4AGS A;  2ON5 A;  1FAA A;  3RDW A;  1MD4 A;  4PQ1 A;  2VCQ A;  3GL5 A;  3APS A;  3MDK A;  3FY7 A;  1URM A;  5IO2 A;  2CAI A;  2LTK A;  3UEM A;  5ECR B;  5ELA A;  5ABR A;  4IJ3 A;  2PER A;  2IL3 A;  4K0N A;  1YEX A;  5A5K A;  3IC8 A;  3FZ9 A;  2HZF A;  4TRX A;  3TKP A;  2GT6 A;  3KIJ A;  4ACS A;  4XCS A;  3F9U A;  4POB A;  5ECH B;  1Q4J A;  3GH9 A;  3ZML A;  3HJP A;  5EL8 A;  11GS A;  3C71 A;  2AJQ B;  5DVB A;  1TW9 A;  3SWL A;  2YOI A;  1F37 A;  3W8S A;  1QGV A;  3HA9 A;  2B5E A;  1X0R A;  4V1A g;  2HRA A;  3ZZX A;  1KEB A;  2OE3 A;  2YPM A;  4TKY A;  2WB9 A;  4EIP A;  4D73 B;  2DIZ A;  2ES7 A;  3KH9 A;  1FOV A;  1GTA A;  2CV4 A;  3JCM L;  1GUL A;  2X8G A;  3LOR A;  2F8F A;  2O85 A;  3M1G A;  4OFM A;  1Z7P A;  5CAX A;  2TRX A;  1FVJ A;  1VF2 A;  4GLT A;  2VO4 A;  1XWC A;  4GST A;  1V98 A;  3F3R A;  1O73 A;  3NIV A;  3FK8 A;  3GST A;  2DSA A;  4MJA A;  1AQV A;  1JHB A;  1F3B A;  5AIV A;  1SK0 A;  4Q5N A;  2L4Q A;  2YV9 A;  3L0H A;  4EL1 A;  3A2V A;  4KA0 A;  3M0F A;  3EWL A;  2HRN A;  5D96 A;  1PX6 A;  2OE0 A;  4GF0 A;  4BVY B;  1UN2 A;  1SD8 A;  4POM A;  1VRS D;  2H71 A;  2VL9 A;  3CSI A;  1PKW A;  5KEJ A;  3KP9 A;  3CSH A;  2DJ2 A;  1GWC A;  2K18 A;  2AUV A;  2GSS A;  5ECK B;  17GS A;  4TXV A;  5HR1 A;  4BVY A;  4BL7 A;  1ERT A;  4HZ2 A;  1AUC A;  4JBB A;  1B9X C;  5BMU A;  2X8C A;  3L9U A;  4AF2 A;  3RPP A;  3TKS A;  1MDJ A;  1FW1 A;  3EUR A;  1SD9 A;  5HQP A;  2ON7 A;  2CX3 A;  4GSN A;  4FYC A;  4JZQ A;  1GRX A;  1U6T A;  4F2I A;  3EPT A;  4HOJ A;  4X4J A;  2L6C A;  1G7E A;  1X5D A;  2YJH A;  10GS A;  3MIX A;  4MCU A;  3A3T A;  1TI1 A;  3CRU A;  2PGT A;  3US3 A;  4KDX A;  2GLR A;  1ZZY A;  1XW5 A;  4IN0 A;  4XS6 A;  3DKS A;  3KEB A;  5IMZ A;  4MF5 A;  4EDZ A;  3DRN A;  2MBS A;  3ED3 A;  1PD2 1;  1T4Z A;  2QA1 A;  5ECM B;  2WRT A;  1FO5 A;  5IPH A;  2C0E A;  2DJJ A;  3L9V A;  1NSW A;  1IYI A;  3C7M A;  1O81 A;  4XRA A;  2PMT A;  3WD6 A;  2CZ3 A;  3EVI A;  2VM1 A;  2M72 A;  4MAB A;  2FY6 A;  2K8S A;  2I4A A;  3IK9 A;  1CQG A;  1A8L A;  4Z2R A;  5INY A;  2CX4 A;  2QSI A;  3TRX A;  4K1F A;  4WF4 A;  2X8H A;  3L4N A;  3KP8 A;  2BTO T;  1Z6M A;  3GX8 A;  3D5J A;  5GSS A;  4KB3 A;  4E8H A;  2CQ9 A;  3D6I A;  5JCU A;  1A0F A;  3GKK A;  2HLS A;  4PXO A;  4IJI A;  4JE1 A;  3EMX A;  3QFB C;  3A5I A;  5IMV A;  1EOG A;  2FD3 A;  2C3Q A;  3V1W A;  3EYT A;  3UOM A;  3C1R A;  3KTB A;  1GNW A;  1TKD B;  1E6B A;  4Z2U A;  3TRQ A;  4ECB A;  1A2J A;  4GQF A;  3E9J B;  2EIR A;  2L59 A;  3WGX A;  3LGC A;  1GLP A;  3KZQ A;  3CMI A;  4MA9 A;  4FYB A;  3LXZ A;  2RM5 A;  2ZUP A;  1EP7 A;  4NPB A;  4G19 A;  3IPZ A;  4N10 A;  5ENU A;  4OFN A;  1QUW A;  2LQQ A;  2VIM A;  1YF0 A;  3GRX A;  4XRD A;  3M8N A;  1R4W A;  1M2B A;  4J57 E;  1WWJ A;  4PUR A;  1K0D A;  3RAZ A;  3GMF A;  3BD2 A;  2V32 A;  1JZW A;  1LJR A;  4KCA A;  1N2A A;  2WS2 A;  3TRP A;  2ZCT A;  4LMV A;  3FKF A;  4PGT A;  3APO A;  2HYX A;  2H76 A;  3FMW A;  1GTB A;  1K0O A;  3TCO A;  2OAD A;  2P5Q A;  4JED A;  5AGY A;  1EZK A;  2VAF A;  5ECN B;  1TK8 B;  3A5W A;  3IE3 A;  2NBS A;  1U3I A;  3DWV A;  1V40 A;  2YJ7 A;  3EIN A;  5G5E A;  2CA8 A;  2H6X A;  4FIW A;  1ERV A;  1SK2 A;  5B6M A;  1AAZ A;  4KAE A;  4FQU A;  4HU7 A;  2HZE B;  3MWH A;  3TGZ A;  3KXO A;  19GS A;  3VK9 A;  3LYP A;  3DVW A;  3ZTL A;  1FOH A;  3QR6 A;  2FNO A;  4TR1 B;  1OYJ A;  4V2N A;  3GNJ A;  2V6K A;  5DBQ A;  4HQZ A;  4ECI A;  4IP6 A;  3LEF A;  5BRT A;  3VWX A;  2AB6 A;  1K0N A;  4MMM A;  2MZC A;  2LRN A;  1XW9 A;  2HZE A;  1SK1 A;  2AAW A;  3DEX A;  5DQY A;  2XPE A;  1VGL A;  5IMF A;  1XCC A;  2A4V A;  6GSV A;  5J9C A;  3DML A;  1XFL A;  2DLX A;  1WP0 A;  4WKW A;  4EIQ A;  4JR6 A;  2FLS A;  4TXO B;  2HT9 A;  1GSE A;  5IMA A;  4IEL A;  3IDV A;  3F63 A;  4Z7X A;  3BJ5 A;  1THX A;  4MK3 A;  4ML1 A;  1V57 A;  5B6N A;  2IMF A;  1YJ6 A;  4I6X A;  4IKH A;  1S3A A;  4EF0 A;  4GQC A;  1M99 A;  1SL2 B;  2MMO A;  3LYK A;  4YAV A;  1GLQ A;  3TKR A;  3R3E A;  1MEK A;  1BED A;  4BPY A;  1T00 A;  5FT3 A;  3CRT A;  3UVT A;  1H4O A;  3C1S A;  4TVE A;  2C3N A;  4EUY A;  2XBQ A;  2A4H A;  3IBH A;  1YKA A;  4POL A;  5AN1 A;  1USB A;  3D4T A;  2I3Y A;  5AIS A;  2QGV A;  4L0W A;  4MJB A;  2QC7 A;  4I97 A;  2WGR A;  1Z5Y E;  4LL1 B;  4YH2 A;  5F05 A;  4N0V A;  1HNC A;  2H72 A;  1DSB A;  1K0A A;  2YNX A;  2IFQ A;  4J56 E;  2HSM A;  3IXR A;  1RW1 A;  2R3X A;  2PVO C;  4KSM A;  2LJR A;  5CO3 A;  1OKD A;  2O7K A;  1CQH A;  1XWG A;  2YP6 A;  2E2G A;  4NV5 A;  1J0F A;  5B8B A;  4RQX A;  4IHU A;  2C0G A;  1KBN A;  3K8N A;  1SJZ A;  4KUN A;  3IRA A;  4MH2 A;  3DXB A;  4L5O A;  1ABA A;  2N5F A;  1SL1 B;  2LS5 A;  1BAY A;  2RII A;  1K0C A;  1QFN A;  1Z9H A;  2K6V A;  3TOU A;  1LBK A;  14GS A;  5D9X A;  4K7O A;  1PL1 A;  4IBP A;  2C0D A;  5HFI A;  2IMI A;  4ECC A;  1X9M B;  1B8X A;  2JL4 A;  1M7T A;  1YDK A;  2F3M A;  2GZP A;  3TKS C;  2NDO A;  3RHB A;  2F51 A;  1U88 A;  3ZFB A;  2LQO A;  1QXH A;  2RUF A;  3UMA A;  2GZZ A;  4EKZ A;  3PGT A;  2M80 A;  4N30 A;  2H30 A;  1SJ6 A;  1TXX A;  4CW9 A;  3ZIJ A;  1XBS A;  2N5B A;  4MNN A;  4CHS A;  3W6G A;  3FZ5 A;  4IP1 A;  1W89 A;  2L57 A;  5JWQ B;  5DCH A;  5IM9 A;  2PPT A;  2L6D A;  2R6K A;  3GHA A;  4ZBA A;  4NAX A;  3UJ1 A;  2YWN A;  16GS A;  4MDC A;  2YCD A;  1MD3 A;  1EOH A;  3UIW A;  3QAV A;  2HSH A;  1GSY A;  3WT1 A;  1WIK A;  1EEM A;  3KJY A;  2R4V A;  2HXK A;  4XTS A;  4KGI A;  3R2Q A;  5IQY A;  3QD9 A;  2DJ1 A;  1O8W A;  4K5S A;  1GUK A;  4XS4 A;  1B4Q A;  6GSS A;  1A0R P;  2L4C A;  3BBY A;  2LST A;  2OKA A;  2OA7 A;  2R0G A;  1SKR B;  2WFC A;  1ERW A;  4PX1 A;  3IHG A;  1YKC A;  5FWG A;  5IIZ A;  1J9B A;  3Q18 A;  4RQR A;  4WEY A;  3ZYW A;  5F06 A;  4I2T A;  4HS1 A;  4Q5F A;  5IPG A;  5ECP B;  2ZNM A;  1ACV A;  4TW5 A;  1C72 A;  2VCZ A;  2H73 A;  2JAD A;  4HDE A;  5J5N A;  1ON4 A;  2C1Y A;  4PNF A;  2DML A;  3F0I A;  2C0F A;  1THO A;  1FVK A;  2IMK A;  1V58 A;  5J9B A;  4BL7 B;  5KN3 A;  1PSQ A;  2QA2 A;  2O8V B;  2ALB A;  1W4V A;  4OFT A;  1KTE A;  5LNK e;  1JFU A;  4G0L A;  4YQU A;  1NW2 A;  1PQN A;  1Z3E A;  5CRW A;  4ZIJ A;  3VI7 A;  3PH9 A;  3TJK A;  4K2X A;  1PMT A;  2KUC A;  3L9S A;  1DE1 A;  3J7Y b;  3C8E A;  2TIR A;  4GTU A;  4HQS A;  4O5R A;  2P0G A;  4DSQ A;  4QL7 A;  4OMV A;  2HSY A;  2GS3 A;  4Q5Q A;  4ZL7 A;  3G9B A;  3W8J A;  1TRW A;  2IMD A;  2B5X A;  1BQ7 A;  4ZL8 A;  1EEJ A;  2H0G A;  4ZL9 A;  3TJF A;  4ZB9 A;  1F6M C;  12GS A;  2H01 A;  4LLR A;  1B48 A;  1PGT A;  4YAP A;  4QL9 A;  3F4T A;  3UL3 A;  5H5R A;  4HI7 A;  3ME8 A;  3FW2 A;  5B8A A;  5G1K A;  2UZ8 A;  2E7P A;  1O85 A;  1GSS A;  3BOA A;  3HVX A;  3WYW A;  3VI5 A;  5KN2 A;  1ZGN A;  1T4Y A;  1U87 A;  1RQM A;  4HZ4 A;  1JZD A;  3FR3 A;  5DAL A;  2VCX A;  6GST A;  2H74 A;  3VPQ A;  4ECJ A;  2V41 A;  3GKM A;  1JLW A;  4NHW A;  1EGO A;  6GSU A;  5G5F A;  1WOU A;  2FUG 2;  2HNL A;  5DJM A;  4O5Q A;  1TI3 A;  2A2P A;  3EE2 A;  1MDI A;  2EC4 A;  1TK0 B;  2J9H A;  1XOA A;  1ZYP A;  3HD5 A;  4AJ6 A;  1ZOF A;  4WBJ A;  1NHY A;  2JAC A;  3FR6 A;  4BWQ A;  2GQL A;  1YZX A;  4JU5 A;  4EVM A;  4IQ1 A;  3ZIV A;  1AXD A;  3VFI A;  2XHF A;  2B3S A;  1O8X A;  3A2W A;  3RHC A;  1GUM A;  2H0I A;  2G0F A;  4YQM A;  2P5R A;  3KMN A;  3ZFL A;  2C80 A;  1HD2 A;  1GTU A;  1V2A A;  2LEG A;  2CVK A;  2OBK A;  1UC7 A;  4HJ2 A;  1R26 A;  3O76 A;  2JU5 A;  2X4A A;  2KOK A;  3G7J A;  4Q5R A;  4EDY A;  1TRV A;  4TR3 A;  2HRK A;  4K6X A;  4PQI A;  1OC9 A;  2VUP A;  2H19 A;  1G7O A;  2BJX A;  3U5R E;  4ISD A;  1XWB A;  3E3E A;  1K3L A;  6GSX A;  1B4P A;  4X1U A;  2DJ0 A;  3LSZ A;  3DYR A;  4O5U A;  1SL0 B;  1EP8 A;  4F0C A;  3DGQ A;  2GZY A;  2JZT A;  2GT5 A;  3CXG A;  4ZB6 A;  1HNB A;  3P90 A;  2WJU A;  3C73 A;  4GSS A;  2M46 A;  4I2U A;  1JZO A;  3GX0 A;  3ERF A;  4A5P A;  5F8B A;  2KP2 A;  1WJK A;  4K8M A;  1FHE A;  1XXU A;  4XS1 A;  3MSZ A;  4E8E A;  3TJB A;  1Z6N A;  2X64 A;  1F9M A;  5CNW A;  3GN3 A;  4WBR D;  1X9S B;  4I8B A;  4XIH A;  2B1K A;  4WR5 A;  2YWI A;  2MMZ A;  1N8J A;  2WCI A;  3OR5 A;  4JRR A;  1X9W B;  4KF9 A;  4TR4 A;  3GYK A;  5CP1 A;  3AY8 A;  5GAP D;  3M9K A;  1EV9 A;  4WF5 A;  5E59 A;  1OKT A;  2HE3 A;  22GS A;  4DVC A;  2I1U A;  3H79 A;  2FWH A;  2X99 A;  1QMV A;  3QOU A;  4MP4 A;  3GUS A;  3Q19 A;  3U6V A;  3EC3 A;  2PWJ A;  3QCP A;  3QMX A;  3CTF A;  2AHE A;  1SKW B;  1NHO A;  2JSZ A;  3GL3 A;  4YKF A;  3FZA A;  1YY7 A;  5DDL A;  3UBK A;  4BWS A;  4KH7 A;  2R0C A;  3LW9 A;  3IR4 A;  1QK8 A;  3S9F A;  3I43 A;  1HNA A;  1JZR A;  3ZL5 A;  4CDO A;  3M3M A;  2P31 A;  2KHP A;  4KDY A;  1K0B A;  2C4J A;  4YKG A;  13GS A;  1OE7 A;  2O87 A;  3HY2 A;  3F4R A;  2VCT A;  5A4V A;  2HRF A;  4ZB8 A;  4NWY A;  4DSS B;  5F07 A;  4N11 A;  2PVQ A;  3KGK A;  2LUS A;  3IK7 A;  1TU7 A;  2FWE A;  2JSY A;  1T8E B;  2RUE A;  4PQH A;  3GSS A;  2FHE A;  2RLI A;  3I9V 2;  2FWG A;  1GTI A;  5D73 A;  3ZIT A;  2EIO A;  1J08 A;  3TJJ A;  4TR0 A;  2GVP A;  3P2A A;  1M9A A;  4DSS A;  5DAK A;  5ECS A;  4MF6 A;  5JWO B;  5G30 A;  2IWT A;  4RI6 A;  3PPU A;  1YQ1 A;  5KOW A;  3NOF A;  3GKN A;  1TJD A;  4HU9 A;  2DJK A;  4OCF A;  3QPM A;  4OCE A;  2IFQ B;  1H75 A;  1F3A A;  20GS A;  3LWA A;  2GDR A;  2HI7 A;  1VF4 A;  2VLV A;  5C04 A;  2DBC A;  2H8L A;  1QQ2 A;  1M0U A;  3QDN A;  4G10 A;  3EMP A;  1OE8 A;  3KM6 A;  4K0G A;  2B7K A;  3ERW A;  2H1D A;  2YZU A;  2NPB A;  4V2M A;  1R7H A;  2R37 A;  5IOW A;  1XPV A;  5ID2 B;  3UAP A;  2WZ9 A;  4ZBD A;  5HFK A;  4L8E A;  1B9Y C;  3VWU A;  1X5C A;  4AJ7 A;  1A8Y A;  5KOX A;  4MJE A;  1LU4 A;  2REM A;  3IAS 2;  1S3C A;  1FG4 A;  4IW9 A;  2F9S A;  4LA1 A;  3I69 A;  3HKR A;  5ID2 A;  3F4S A;  3FR9 A;  4PUF C;  2VCV A;  1M9B A;  3A2X A;  1PN0 A;  4WR4 A;  5D93 A;  2LNT A;  3O3T A;  3HJO A;  5H5Q A;  3HYP A;  2H6Z A;  4L0U A;  5HFG A;  3LQ7 A;  2E2M A;  2L5O A;  4G2E A;  4ILF A;  2X49 A;  2MMN A;  4EC0 A;  2D2Z A;  4DSR A;  4BVX B;  3GTU B;  1GSF A;  2DKH A;  1WE0 A;  3CTG A;  4V1A p;  2JZS A;  1GH2 A;  1V9W A;  4MPF A;  5CYY A;  1BYE A;  4OWY A;  1A2L A;  1I5G A;  2FGX A;  3QAG A;  1JLV A;  4ZIL A;  2B6M A;  3CBU A;  3KD0 A;  4MF7 A;  2K8V A;  3Q6O A;  4XS4 B;  5IO0 A;  3FHK A;  4BVX A;  3GTU A;  4MLY A;  3HCZ A;  4ZBB A;  2IIY A;  3J7Y k;  1SEN A;  3D0Z A;  9GSS A;  2OE1 A;  1DE2 A;  4LL4 B;  5CRG A;  1K0M A;  3IAM 2;  1GUH A;  1K3Y A;  1IYH A;  2YN1 A;  1K3O A;  3UAR A;  2R5G A;  2H1G A;  4F9Z A;  1ERU A;  3M9J A;  3GFK A;  1T7P B;  2PN8 A;  3IA1 A;  4MZB A;  3DD3 A;  1OAZ A;  5IMC A;  2YWO A;  5J3R A;  3ISO A;  2LRC A;  4PTS A;  4KE3 A;  2FCH A;  5COH A;  1BG5 A;  3IOS A;  1A24 A;  4EXJ A;  2DMM A;  3F8U A;  1XVQ A;  7GSS A;  5GAN D;  1DUG A;  2VL3 A;  2VD1 A;  2GSQ A;  3LG6 A;  1XWK A;  1PRX A;  2LV3 A;  2H70 A;  1GSD A;  3KTL A;  5G2Z A;  5JCW A;  2VL2 A;  4FO5 A;  2VD0 A;  3GH6 A;  4H86 A;  1AQW A;  3VUR A;  3WGD A;  1TU8 A;  4D73 A;  4GRF A;  6GSW A;  4DEJ A;  4I5Q A;  4ULX A;  2YV7 A;  2MBT A;  1GNE A;  4F82 A;  4K9Z A;  4PUA A;  1XWA A;  2Z9S A;  3SBC A;  2V6O A;  1UVZ A;  3QFA C;  1WRY A;  4X0X A;  4KW6 A;  1GP1 A;  4WET A;  3VLN A;  3I6A A;  2GST A;  5FHI A;  3VPT A;  2XBI A;  3D4M A;  2CZ2 A;  1XW6 A;  2LNS A;  4CY8 A;  3HDC A;  4G0K A;  4ZXG A;  2F8A A;  3O6T A;  4KSO A;  2VCW A;  4FH8 A;  1G0T A;  5GST A;  2CAQ A;  2H66 A;  4ID0 A;  2DJ3 A;  2E0Q A;  4L5L A;  3GV1 A;  3MNG A;  2KP1 A;  2H75 A;  2VLU A;  1TK5 B;  5DAL B;  5G31 A;  5HR2 A;  2C3T A;  3H1N A;  3MAK A;  4GWR A;  1AIU A;  1T3B A;  3G7I A;  2AV4 A;  3ZVJ D;  2OJL A;  2YWM A;  1EV4 A;  2J23 A;  4F03 A;  1XVW A;  2FWF A;  3WT2 A;  1ZMA A;  1SU9 A;  5DCG A;  1R5A A;  4NXI A;  3Q74 A;  2GSR A;  5A4W A;  3VWV A;  1WMJ A;  1EWX A;  5HR0 A;  1E2Y A;  2LRT A;  2LJK A;  2FA4 A;  4PNG A;  4ML6 A;  3D21 A;  5D9V A;  5LCZ A;  3KMO A;  5F0G A;  6GSY A;  1PN9 A;  4OD7 A;  2NTO A;  4QQ7 A;  3N9J A;  2AYT A;  1PA3 A;  5L71 A;  3KCM A;  5ECO B;  5J4U A;  5DJL A;  4EE0 A;  4Z2T A;  4NV2 A;  5B7C A;  5D8I A;  18GS A;  5HR3 A;  4MJC A;  4OO5 A;  4JR4 A;  2VLT A;  2DC5 A;  4MZC A;  1NM3 A;  3HZ4 A;  2IPA A;  4RI7 A;  2GTU A;  3ZMK A;  3TDG A;  1GSQ A;  2OBI A;  2VOC A;  2GQK A;  1OC9 B;  4V2L A;  3ME7 A;  5D9W A;  3DIE A;  2YAN A;  2K9F A;  3FYG A;  3IHQ A;  2GGT A;  1X5E A;  3ZLP A;  3E0U A;  4ICY A;  1O6J A;  1ML6 A;  5ELG A;  3KH7 A;  1AC1 A;  4GCI A;  3HHV A;  2N5A A;  2TRC P;  3HVV A;  3F6F A;  3G7Y A;  1M2D A;  3LJR A;  4HEA 2;  4HUA A;  5EY6 A;  5CRE A;  5ECQ B;  4P3Y B;  2B5Y A;  4LMW A;  1Z7R A;  2V2G A;  4AJ8 A;  3P7X A;  2A2S A;  5DQS A;  1AQX A;  3EU3 A;  1OC3 A;  3LXT A;  2IJY A;  2OAC A;  5EPF A;  1TDI A;  1SYX A;  4IGJ A;  3GUR A;  2WUL A;  4K2D A;  8GSS A;  3F6D A;  3ZRD A;  4J2F A;  5CRD A;  3RPN A;  4F0B A;  1A2M A;  2NVL A;  4IVF A;  4O32 A;  1EGR A;  5IOX A;  1KNG A;  2R0P A;  2A2R A;  1Y25 A;  1U3A A;  2FA8 A;  4KDU A;  2PU9 C;  3QAW A;  2MMA A;  2H1A A;  1UA5 A;  1ZCP A;  1OC8 A;  4BA7 A;  1F2E A;  4FYU A;  3H8Q A;  1TOF A;  2H1B A;  2H6Y A;  2GQM A;  3EU4 A;  4KND A;  4TOP A;  5G1L A;  5D9T A;  5GZZ B;  4CY6 A;  1G6Y A;  1YF1 A;  2WDU A;  3HJM A;  2BMX A;  4XHM A;  2I81 A;  1XZO A;  3TOT A;  4K7I A;  1FB6 A;  2QKE A;  3TUE A;  1FB0 A;  2XC2 A;  1ILO A;  2EIQ A;  2LJA A;  4MH3 A;  1PL2 A;  4KCE A;  4NHZ A;  4EO3 A;  1G6W A;  3FEU A;  2G2Q A;  1PKZ A;  4USS A;  5DAK B;  3ZVJ A;  1TRS A;  3CYN A;  2I9H A;  1ZYQ B;  2R2J A;  4IS0 A;  1VF1 A;  2DKI A;  4O7H A;  4HJM A;  4KX4 A;  5EVO A;  5A4U A;  1I9D A;  3GA4 A;  4TR1 A;  3FRC A;  3MYD A;  3TKS E;  1VF3 A;  2MYG A;  3UBL A;  1BJX A;  3UVH A;  1MDK A;  1Q98 A;  1WPI A;  3HZ8 A;  4WXT A;  4G9H A;  4O92 A;  3BCI A;  3PIN A;  2CVB A;  1SKS B;  1SYR A;  1XIY A;  2RM6 A;  3ZRE A;  2VM2 A;  4YQV A;  4MPG A;  1AW9 A;  2H0H A;  5H5S A;  1DBY A;  2IME A;  3IV4 A;  3TJG A;  2L5L A;  4RUV A;  4TN8 A;  4TXO A;  1PX7 A;  3H4K A;  3PR8 A;  1GSU A;  3BCK A;  2LKU A;  3HVS A;  3F3Q A;  3NZN A;  3H93 A;  2XPD A;  3HXS A;  1T1V A;  3DVX A;  1TP9 A;  1R5P A;  5KN0 A;  2B1L A;  1ZYE A;  4X43 A;  4OO4 A;  2YZH A;  3TKQ A;  4POK A;  5CRH A;  5JCG A;  3APQ A;  1S3D A;  1ZYN A;  2VL2 C;  5LD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...