4Z9AA

Crystal structure of low molecular weight protein tyrosine phosphatase isoform a complexed with phenylmethanesulfonic acid
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z9aA00
2QSJA 2PUDA 3CG0A 3N0XA 3KG2A 2H3HA 2IPLA 4YP9A 1JYEA 1E2BA 3EDCA 1FFWA 1PNTA 2GBPA 1PUXA 4Z9AA 4RXTA 5DLEA 2QV0A 2QU7A 4JOQA 1IIBA 1TVMA 2JK1A 3Q7SA 4G0OA 5HM6A 4MRMB 4RY0A 1QQBA 2FEPA 2JVJA 3W9SA 3EAFA 4KK4A 3CS3A 2FQWA 1WETA 1UDRA 4EYQA 2GWRA 4G97A 2VUHB 1YIOA 1ISSA 4CBVA 1Z16A 4QYWA 1SRRA 5FBKA 5TPWB 1APBA 4W5NA 1TMYA 1EWVA 3IP6A 3F6PA 4F12A 2IYNA 4WUTA 4OG2A 6CHYA 1Z12A 1JX6A 4KQCA 2NT3A 5KWSA 2N9UA 5FWYA 2WWVD 4OBBA 3I45A 4UHJA 3OQOA 3KCNA 1USKA 2RDMA 3E3MA 2MYNA 3ILYA 4MS4B 3CLKA 3TMYA 1LJLA 5B3JC 4G0ZA 5TE9A 1Z2EA 2JRLA 2P4UA 5BRAA 1YK1A 1D5WA 4EYKA 3MF4A 3O74A 3CZCA 3OLXA 5EWLA 3O2JA 4MAAA 1Z25A 3H5OA 5IEBA 5CNJA 3RVPA 2DRIA 3GRCA 3JPWA 3RVOA 3OMWA 9ABPA 2L19A 2Q5CA 3QX9A 3UUGA 1YVUA 3QEKA 1NXOA 1DBQA 4HNQA 4Q7EA 1JDPA 1D1QA 3RVRA 6ABPA 1RXIA 5E3JA 2M98A 4Q6BA 3TD9A 1M5TA 5KI6A 4MQFB 2HSGA 3HEBA 2P9HA 3P9YA 1VRVA 3G1WA 4ZJPA 2CD7A 2NT4A 3CRNA 3LMKA 1OXBB 4MQEB 4PICA 3H5TA 1H9CA 5JS1A 4RK7A 3BRQA 2CHEA 1QPZA 3OM0A 3CG4A 4MGEA 2IPMA 2PE5A 1D4ZA 4NCBA 2IKSA 1EWTA 3QEMA 5TQJA 4KPYA 2MSKA 3RVKA 3ROFA 4YCSA 2FVYA 2R48A 1D2AA 2QVGA 1E6KA 1SD5A 1CYEA 1QQAA 1KRXA 3MMNA 5TQ0A 4D74A 1JFSA 4ETMA 4MLDA 1GUBA 3GWGA 5F64A 2FEWB 1U04A 3HUUA 2JCGA 2WJAA 2OENG 4PE5B 3A0UA 1W9HA 1PHRA 2E4UA 3EGCA 3HUTA 5KQLA 2E4ZA 2PLNA 1SXHA 3QELA 3OO0A 4XAQA 3JVDA 4WT7A 1Z26A 3KJXA 3RVQA 2L2QA 1JDNA 2WJWA 3UK0A 1MB3A 3EJWA 1GCAA 1S8NA 2XDYA 4KV7A 3HM9A 4MS3B 1JFVA 2ID9A 5T7BA 1ZH4A 1GUDA 3O21A 3KLOA 4YO7A 2MSLA 3T95A 1JFTA 4G0PA 1DG9A 3C97A 4LZLA 5B3JA 4E7PA 5IUNC 4JB0A 3UKJA 4MPTA 3LUFA 4LE1A 3GBVA 4OATA 1LBHA 1JH9A 4LDZA 3HZHA 2HPHA 3CFYA 1JF8A 4S04A 1EHCA 3T8YA 4RU1A 4WXMA 2MSWA 2JBAA 4NICA 4ETNA 1P6UA 3L49A 4KK3A 4YR7A 1GLGA 1CEYA 2H0AA 5T3YA 1MIHA 1URPA 3GA5A 1ZESA 2PL1A 4EVSA 3HO1A 2KYRA 4RY8A 5D2CA 3TO5A 1PNRA 2HQOA 5FBHA 3SNKA 3H1EA 4RK5A 3E61A 5BQ3A 1BVHA 1KGSA 4Z4IA 3HSYA 3IPAA 4KZKA 1JL3A 3MIZA 5KQMA 1F4VA 2GI4A 3M9WA 3S99A 3JY6A 3H75A 5KC8A 1YK0A 2PUFA 5IC5A 4JA2A 2MYPA 3IP5A 2FKAA 1DJMA 5TPWA 3QLUC 1DZ3A 1BAPA 1MAVA 1XHEA 2FMFA 4MR8B 4TLMB 5CHYA 1RXEA 3Q9SA 2PUCA 5JNVA 5HQJA 1M5UA 3LKVA 4HNRA 3DZDA 3H1FA 4D6XA 2AYZA 1E6LA 2YHAA 3C3WA 4Z9BA 4RV5A 3RVNA 5IBQA 1Z17A 4FE7A 2PUBA 1D1PA 1NY5A 4YV7A 3RVSA 1HEYA 4F3TA 1TJYA 1F51E 1I3CA 5FWXA 1XHFA 4Z4EA 4LDAA 3CU5A 1ZH2A 2MYTA 2WMYA 3GT7A 1AB6A 1MB0A 2F8TA 3ROTA 2QW1A 1YS6A 4N76A 1LK0A 3QX8A 4P1ZA 1Z15A 1ZAYA 1U2PA 2PKXA 4FB4A 2PAFA 3T38A 3JVIA 5DKFA 2A9QA 1DC7A 4G86A 4RK6A 2QZJA 3CZ5A 5KC9A 1XWWA 2FLWA 2FXIA 3O1HB 3SM9A 3A3KA 3HDGA 1LJUA 1QP7A 3QLTA 4XLTA 1L5YA 2FMHA 1FFSA 3LUGA 3HCWA 1DRJA 4O1HA 3LUHA 4TN5A 2FQYA 4DN6A 3LOPA 4W5QA 3H5VA 2E4WA 5DGCA 4KMRA 5FWYB 4G0YA 1DCMA 1FSPA 1VLZA 2RGYA 1YS7A 3HDVA 1BDJA 3MQ4A 4Z4CA 3H5WA 3OLZA 2RJOA 4LRQA 1ZGZA 4QICA 4ZMRA 1DC8A 4FE4A 3B2NA 3NHMA 4G0MA 2R25B 4W5TA 2WB4A 1EFAA 1W25A 5TQ2A 1VKRA 5JNSA 2CHFA 4NQRA 4KREA 4IRXA 4EY3A 1NXTA 3CNBA 4RZSA 4XARA 1BDIA 3KKEA 4RDCA 2ZWMA 4OTZA 1C0EA 1U8TA 3Q7TA 5EWLB 5EWMA 3CKMA 1DCKA 2IPNA 4YLEA 4EGSA 3OQNA 3HVRA 1PEYA 3EQ2A 3IP9A 1R8JA 1U0SY 3LKBA 1RNLA 1QP4A 4KFCA 4N03A 3C3KA 3F7NA 3EQZA 3F6CA 2ID7A 2GX6A 3CTPA 1USGA 4F06A 3HK2A 4MYRA 3RVJA 4L4UA 4N41A 4Z4GA 4RK4A 1SXGA 3QLUA 1DP4A 3RH0A 5JS2A 3OMXA 4MR7A 4OLAA 3R0JA 1RZRA 4PZ0A 2FN9A 4PYRA 4S05A 5CNKA 3KSMA 5GOTA 5HKOA 2CWDA 1VPWA 3KTOA 3O1IC 4YRZA 3NNSA 3TB6A 3D02A 3FFWA 4G0XA 4YS6A 4G0QA 3GV0A 3QEMB 1DRKA 3RQIA 3JS5A 5EWJA 4EYOA 3SAJA 4NCAA 3H6GA 3LUDA 4JP1A 3QLVC 4MR9A 4MS1A 1Z18A 5TQ0B 3GYBA 4DQDA 2IDMA 3OQMA 2LUOA 2IOYA 1ZGGA 3L6UA 1NXPA 5IUKC 5ABPA 1NXXA 4MLCA 4ZYLA 1MVOA 3IDOA 3NBMA 3DLHA 1ZHHA 4WXEA 4EYGA 2PUEA 2PL9A 1E6MA 3QELB 3N0WA 4EVRA 2FSPA 1QNLA 4W5RA 1QP0A 2RJNA 3LFTA 3M9XA 1P8AA 3K4HA 4RS3A 8ABPA 1ABEA 5PNTA 4DADA 1P2FA 4ZMSA 3FMVA 4WZZA 3MYYA 2M1ZA 1RZRD 1NATA 4MRMA 3A0RB 2AYXA 2FLKA 3FFTA 3OO1A 3GBPA 1NXWA 1AB5A 3CHYA 4H3HB 2OQRA 4B09A 2JVKA 3F73A 4N0QA 2FN8A 5JNTA 3TX6A 1SXIA 4JASB 1KRWA 2E4XA 1DBPA 2F8SA 5JNWA 4D6YA 2JBAB 2R4QA 5CNIA 2PUAA 1K68A 3MM4A 4IILA 4Z0NA 3O2QB 2PJUA 1NXVA 7ABPA 4MS4A 1OXKB 1T34A 1QO0A 3BBLA 4LE2A 5DCLA 1JLKA 4Z4HA 2A9PA 4LE0A 4QYMA 2V0NA 5IX8A 1BA2A 5ED4A 1JBEA 3DGFC 3C3MA 4OLBA 2O20A 4GPAA 1J56A 3IPCA 3Q15C 1YMVA 3N75A 3I5AA 1JHZA 2QR3A 3LUJA 4TMYA 3NNDA 4N0PA 4RY9A 4Y9TA 3D8UA 1LBIA 4E7OA 3HV2A 1A0OA 2X7XA 5I4CA 1JWLA 1GCGA 1RPJA 3BREA 3Q41A 4L85A 4RXMA 3MA0A 1YTUA 5GQSA 4XFKA 3N0RA 5C5CA 1FQWA 4JAVC 2YHBA 3FDFA 2LBPA 3I42A 1FFGA 1C4WA 4HYEA 1NTRA 1ZDMA 4Z99A 4UHKA 1QMPA 4WWHA 3QLVA 3T6KA 1L5ZA 4MQFA 3DLBA 3SG0A 3FGZA 3HS3A 2HQRA 4O5AA 2A9OA 4MQEA 1K66A 2PMCA 4F11A 5FWXB 1DBWA 4XASA 1TM2A 2JB9A 4YWHA 1B00A 1ZY2A 1EAYA 1KMIY 3JTEA 2NZVG 3JPYA 3LUAA 4KQ9A 1QKKA 1ABFA 1DCFA 3HXMA 3DGEC 1QO0D 4RK0A 3N53A 3HJFA 3C6QA 3QK7A 3VNBA 2LPMA 4N47A 4IF4A 4H3KB 3OLWA 2MYUA 3H1GA 4F8JA 3RVMA 4PEVA 3LTEA 1BDHA 1ZVVA 2IPAB 3IP7A 4TLLB 1M2FA 1TLFA 4EUKA 2QXYA 2VYCA 2R47A 4KVFA 5TPZA 4O1IA 2L17A 4HNSA 2FTKE 2FQXA 3EULA 1CHNA 2VK2A 3A10A 2I6FA 3G85A 4ML3A 2FMKA 1PEAA 3H6HA 3NNNA 3KYJB 2A9RA 3FFXA 2FW0A 2FEKA 4RWEA 3OLVA 4RKRA 3URMA 5BR1A 2PUGA 2E4VA 4MS3A 5TQ2B 4RSMA 3H5LA 4ETIA 2JVIA 5IEJA 3KYIB 2J48A 5IUJC 5EWMB 2W42A 4YGXB 3SQNA 2BGGA 1P6QA 4IGAA 4RKQA 4H60A 4KRFA 5DTEA 3KLNA 5IULC 4EVQA 3DBIA 2WY2D 5CNMA 2HJ9A 1EWKA 3M6MD 2VUIB 2NUBA 3KHTA 3KS9A 4QPJC 4P98A 1Y1LA 1Z13A 5BRJA 4RK1A 1A04A 3H5IA 3OLYA 3O1JC 4GNRA 4XXHA 3N8IA 1NXSA 1A2OA 2HQBA 4MR7B 4JB2A 1U2QA 1ZN2A 3SY8A 3VNAA 3I09A 3OM1A 4Q6WA 2E4YA 2LIVA 4ZPJA 4IMJB 5TPZD 2FMIA 4LX8A 5JNUA 2GKGA 1M2EA 3LUCA 4NV3A 1USIA 5HSGA 5KQPA 1ZITA 5JNRA 2ZAYA 3BRSA 5KQGA 3O2SB 5EWJB 3ILHA 2B1JA 2LP4Y 1Z2DA 2NZUG 4MR9B 4MS1B 5C5EA 2TMYA 2WRZA 1JYFA 3BILA 4Z4FA 3GL9A 4IMIB 1ISRA 2B4AA 4MR8A 1YMUA 3NHZA 3Q7RA 4W5OA 4RXUA 2QVCA 3LUKA 4M88A 3EODA 4KNYA 3O75A 3K9CA 3N6VA 2L18A 3RVLA
chains in the Genus database with same CATH superfamily
1GWNA 2CFIA 3LQ2A 1CTQA 2P9TA 4CUZA 3I5YA 2WU4A 1DAHA 3O7WA 4EO7A 5JAHA 2VJBA 3EEOA 2SKEA 3NWPA 1Q1QA 2H52A 1HFEL 3M4JA 2WIDA 4ZXFA 2VJKA 2ZJOA 4IO0A 5JYCA 1ZK2A 4L4RA 4MGIR 4D96A 4NU5A 4WY8A 1JJVA 4Q05A 5CUQA 421PA 1BXGA 2WPDA 4JOBA 4KO4S 3ZH9B 4TKUA 3EIQA 1T13A 1T5SA 3OKCA 1ZCFA 2WWFA 3PGLA 4S1OA 3T1OA 4ZCTA 1X1DA 5K6TA 1U2SA 4US1R 1T5BA 2FQWA 2GFQA 4Y8VA 1IWOA 1QRUA 1BE1A 2VT3A 1CY2A 2QSUA 4GX5A 1YC5A 4B71A 3CVXA 4TTRA 1H9BA 2XZDA 2AFHE 4GP6A 3C14C 3UMJA 2VPXA 1DINA 4W8GA 5G0VA 4PVCA 3REOA 2ECFA 3QFCA 2AEMA 1BXRB 1R88A 5KNDH 2PNJA 1JSZA 2FR8C 2PXXA 4P7KA 2JGAA 3EDQA 3HU3A 3CUVA 4PX9A 5E9QA 5E7QA 1ODCA 3DTVB 5DXJA 5FWDA 5TY0A 3ZDBA 3C6XA 1I2AA 3E4CA 1NC1A 4FMDF 2PUVA 5E9JA 3KCNA 1MXHA 4K9NA 1WPQA 4RHUA 4G1MB 1IRIA 1EFPB 4GOXA 2Y1FA 3G6KA 5KYXB 1EDOA 4M0MA 2HSDA 2FDXA 1PNOA 5BRAA 4WACA 1G9XA 1PDWA 5JCJA 1II0A 1CJMA 1G3IA 4CPDA 1K7CA 2LR0A 4RETA 3H04A 3PGKA 2YXDA 1OLSA 3QG5A 1E66A 2GM9A 3GRCA 4C2AA 3ODPA 5E7IA 1IJBA 2FUEA 3OMWA 2ZJ2A 4RQBA 5COAA 1RYYA 4MVJM 5AM1A 3NFRA 3SI7A 9ABPA 1DBSA 3A70A 4GUDA 4TVKA 3LD9A 3SD7A 3VVLA 3C3CA 5JC1A 1N5IA 3QE0A 1DBQA 5J2UA 5BWCA 4J6EA 2OP0A 2ONKA 5E3JA 3I8SA 1KI4A 2IBSA 1PJ4A 4BN5A 1V3VA 1JIVA 221PA 3O8OB 1TQHA 2WVJA 4GICA 3DMFA 4B4OA 7MHTA 2QRUA 4G1BA 4CYMA 4ZJPA 4BO2A 1NUAA 1JKXA 1OWLA 2AOXA 2OB1A 4EW3A 3MBKA 1ZL0A 4OHPA 3R3YA 1QO7A 1GL7A 3EXHA 1IN7A 1YDWA 1B93A 3EFBA 4II2A 2JD1A 4ZVQA 5HFNA 1N2EA 3A9WA 1T5DX 2G5CA 4KTVE 4KFRA 3VGJA 2E3JA 2E82A 2IKSA 4J3FA 2FRDA 2VSQA 4PGFA 1OH8A 3QV1A 1BS1A 3ROFA 3V00A 5IZ4A 4B3RB 3C7AA 4BNKA 1VKJA 1EFHA 1SD5A 2OILA 1PNVA 2VTEA 2VWQA 4I6EA 4QPPA 2B3TA 2HF7A 4ZYYA 3KOXA 5C7IO 3JQCA 2XYRA 4HDAA 3OIVA 3OTHA 3MNFA 4ETMA 3HDTA 1N1DA 2O48X 5AUQA 2D13A 1FDTA 1H2EA 2DWOA 3E7DA 2XVXA 3NHBA 3T5TA 1IHXA 2WV9A 4LYFA 4ZALA 1J21A 2C4NA 3BIJA 2HHHB 1QV7A 2PBFA 3NC1C 3ELDA 4D8UA 3ZHXA 1VPDA 1ZAKA 1PJAA 4DDVA 3T1YB 4XYEA 3JVDA 2ZT7A 3GR6A 2JCVA 2PH3A 3M6WA 1SXJC 3OCYA 5AHXA 4X60A 3G02A 1SKYE 2R0QC 2D1SA 1PP4A 4HB4A 5ALLA 1EK1A 5FYDA 3TSYA 2POQX 3WYGA 3ZK9A 4RTRA 5CDHA 2B4QA 1BD4A 4EKYA 4H6VA 3WK5A 1ZH4A 3PX3A 4ZHQA 3TXYA 2J3QA 3KLOA 3PL5A 4CKWB 1YH3A 1FFXB 3EZ7A 2NO6A 3A37A 4QDTA 5I7RA 3BIXA 5DK6A 3ZDRA 5EIBD 4DCUA 1AMUA 2VH2A 3JQ9C 4O25A 2YJNA 1MG0A 1ETUA 5AYVA 5HBGA 4GBJA 4URUR 3UKJA 5CITA 3ANNA 2DTEA 3AESA 4ZAYA 1X74A 2IRWA 3BWBA 3NDBB 3EPPA 4DLVA 1T2CA 3C15C 1NAIA 1Z82A 2F7SA 4A6PA 3RD5A 3CFYA 2UZ0A 1DSSG 1JF8A 5IW8A 3Q0EA 1V1RA 3G59A 4KFUA 3GJQA 1MDBA 3P71T 4D4GA 1R0SA 4UATA 3VI3B 2P77A 4UREA 4UUBA 2D5CA 5KUTA 1T0PA 5JBQA 1NVBA 1YV9A 1DXYA 1Z36A 3ANSA 3FCYA 2Q2OA 1IH8A 3A1WA 3OQHA 4OOEA 4JU8A 3ZE7A 3O4FA 1NRXA 1P73A 2XHZA 4X94A 4C5AA 5KJFA 1N8TA 2F55A 3E3AA 2DUMA 2NP6A 1XP8A 4PCUA 1A97A 1J99A 2XYPA 2ETXA 3SNKA 2VNAA 4MW0A 3P2MA 3O31A 3OI7A 3BWYA 4Y1GA 2ZK7A 4DILA 2GYYA 4XGKA 2XZTA 3JY6A 3RIHA 4DG9A 3B9PA 5CT8A 4BEWA 3FZEA 1CUZA 2K2WA 1OKKA 4UUNA 5F1PA 1QOZA 1N2ZA 3MGAA 1VCMA 4HEHA 3OZTA 3FYHA 3PJFA 3CPEA 1VIMA 3HR7A 1OH7A 3NBQA 1K8QA 3PGMA 3R5JA 3TCKA 1V7PC 2QOEA 1PGJA 3Q3GE 1G8JA 3K32A 4IJ5A 1MZPA 3AG5A 4RANA 4D6XA 5IVDA 1GUYA 2PKCA 1XXHA 3QITA 3QRWA 1BWRA 1MR3F 1IM2A 1Z75A 1NY5A 2Q1SA 1JPJA 2CHUA 3C6MA 4JODA 5IP5A 4BBJA 4DCSA 4XFDA 3FE2A 4LHSA 3BF8A 1TTHA 3KP1A 3H05A 4LDAA 1SHJA 1AH2A 1F5NA 3HFRA 3I1JA 3T7SA 3C5WP 3O3CA 5GINE 5DDIP 3L04A 3IB3A 1TZKA 4Q3BA 2ZYDA 4U7JA 3R24A 5LL6P 1OC4A 5AK0A 1U8EA 1SKAA 2H2GA 1Y80A 3P7MA 2XB9A 4AKEA 1VKZA 2DFPA 3ZU5A 3VKGA 1KK0A 1I5RA 2HHLA 2KQUA 1IM8A 1FRQA 1I6MA 3NVMB 4UMEA 1SCNE 4FHZA 3U16A 4GWLA 1RQGA 3SZMA 1KEZA 5ERYA 2WM9B 5KYYB 1BHQ1 1WMSA 3BULA 3QLTA 3B1XA 3H11A 5A1TA 3LH5A 1YNSA 5IDQA 5KYUB 1R3DA 1QGDA 1AHIA 5CVJA 2NP7A 2GO1A 2R5FA 3W5VA 4DUPA 5I5GA 4W5QA 1F9EA 4IZIA 3AT1A 5D1NA 4P3KA 1FSPA 1FVFA 1JHOA 1QIGA 3CVWA 1RC1A 1GG9A 1FQJA 1X86B 2NOAA 1MDFA 1WSBA 4EG1A 4QSMA 4Z4CA 2X5KO 3FHTA 1N0WA 1F60A 2WNIA 3EVFA 4JNCA 1HEIA 3INRA 3BH0A 3IMKA 3KUXA 5FOQA 4FSDA 3EF0A 3I9MA 4PHHA 1SUDA 1TK9A 4HNAA 3DKKA 4XCQA 2XTJA 4MQLA 3ELYA 2OGTA 3HY6A 2ZT5A 2IHYA 5FFNA 3DE0X 3AVVA 1JQJC 2X8JA 5AXCA 1ONBA 2BCGY 1O89A 3OT4A 2DPXA 1EFRA 2ERCA 1KJZA 1N6HA 1R8JA 1XMIA 3PQCA 4LKOA 3TQFA 4ALIA 4F7WA 2RKBA 2NO4A 3RJZA 3FA2A 4E5SA 1NW7A 1OIWA 1ZRNA 4XWTA 3U7FB 1KAMA 2Q5LA 3PK0A 4JL6A 1WB4A 4PYMA 3V9PA 1Y81A 4Y9SA 1KVTA 1T3HA 1UIMA 4OY3A 2Z2XA 3OZRA 4CM1A 1ZK0A 3HVHA 2GCOB 3K96A 3ZGVA 1Y42X 4AIRA 4EHKA 2CFCA 4OH1A 1U2RA 2XMRA 1T2AA 1GU1A 4ZU6X 5SYMA 4C87A 4F3CA 2IBTA 1SURA 1GTZA 1ADCA 1CUDA 5BNWA 2JI4A 2CXOA 4LZJA 1WPXA 2VDWA 1YQDA 2DPLA 3DDHA 3NNSA 2O3RA 4ZVMA 4JT8A 4JIMA 5H82A 4ZYVA 4NBNA 1A7AA 3GV0A 5AICA 1I01A 1MENA 2XNDA 1CY8A 3PDHA 1OZHA 4LYJA 2OV4A 2XEXA 3E3LA 2WTEA 4QJ3A 4IWYA 4DT1A 5BOSA 3GEDA 1CR1A 3KZNA 4J90A 3H6GA 4JP1A 1W44A 3I9FA 2EC5A 4RZ2A 3PC8A 3I5MA 2IDMA 4YPOA 2LUOA 1WD7A 1Y98A 3DXYA 1GNVA 2QKYA 4G36A 4OHBA 1WQ1R 3ONDA 4R81A 4NY1A 4JI3B 3T61A 3ZJVA 3AVUA 2GAOA 1XTTA 4YJ2B 1NMXA 4P5DA 1B8OA 5AW4A 2VHQA 2O4CA 2IYRA 1K9VF 1RWXA 2WF9A 3NEYA 4GWKA 2B34A 4OFZA 4XEUA 3NOOA 4MKIA 3SSAA 3M9XA 2DHCA 3ZZ0A 1I2DA 2W8BA 4B80A 4AY5A 1VKHA 1S4MA 3WGTA 2R00A 4MTLA 4NKRA 2YNMD 4KXFB 3HXKA 3EXAA 3QI2A 4KGXA 4ZMSA 4M0EA 5HBRA 3RYHB 3SVTA 4R83A 2NU6B 1RZRD 4BEVA 1E1MA 1JJAA 3FJOA 3MGBA 6LDHA 4EA9A 3MWEA 1F2TA 1NBEA 5IAEA 2I6SA 3T1TA 1C7IA 3V1MA 2HCBA 2HRBA 5ES3A 1K7XB 1KRWA 3BCHA 5J4HA 5DGHA 3WL6A 5ALDA 4EF6A 4DUGD 3TVYA 1AF7A 2BFDA 3INNA 2Z9CA 2JI6A 1Y4SA 3WO1A 4M1QA 4TTQA 1CERA 1EP3B 3WGLA 1NT4A 1N9KA 3T12A 2NUPA 1JLKA 1VG0B 2A9PA 3BXPA 3DLIA 4M9CA 4ZTZB 1Z6AA 2XE7A 4CN9A 3G0OA 4FUTA 4GL2A 3JWGA 4P34A 3C3MA 3BGDA 5TNXA 5I7FA 3LPLA 4PS1A 1QFZA 1IAVA 1P7WA 4JC0A 3QVJA 4YBZA 2IYUA 2YWEA 4R8VA 4UJ5A 4P54A 3O7MA 1X13A 3N2IA 4HUJA 4HXGA 1D2NA 3HV2A 2C83A 2X7XA 4Y9TA 5I4CA 4B3SB 4L9AA 2OC9A 1LFDB 5GAJA 3B36A 5JALA 1QM5A 4JSYA 1OYOA 2O2IA 1DAFA 4DGSA 2AN3A 1MIOB 2LBPA 4DMFA 2B1QA 3I42A 1FFGA 1Z4JA 4LY0A 3K1AA 4OO3A 4NS1A 3VMMA 1PR5A 4DPKA 2ZKLA 4HTFA 4UDNA 3WK6A 1DKRA 4AROA 2F00A 2ZWIA 2ZI5A 3PE4A 5EJ7A 1V4VA 5KTOA 1VFPA 3TQHA 1P2GA 2YY6A 3A1FA 1YI0A 4RZXA 4MQMA 3CRMA 4JD5A 4IDQA 4ZYXA 5G2OA 3IMEA 1Z3CA 1P3Y1 4JSTA 1L1EA 1H4VB 4G4GA 4KQ9A 2W5UA 4X97A 1KQNA 5JZBA 2FW9A 2NZYA 1U28A 1S8AA 5C4GB 4H7IA 4I4TA 2XNCA 2IU3A 2JA1A 4Z1OA 2PKQO 4FJ0A 1JAZA 2Y1KA 3ZE1B 4ARSA 1KWKA 4H3KB 5FNVB 4KQIA 4OOFA 4H7PA 1QAQA 2WF6A 4X1IA 3UMBA 3AMVA 3FPKA 5EXPA 1AURA 1TCCA 5I9LA 3L7BA 3T9CA 1J2TA 1NG9A 1BHO1 2JIDA 3RS2A 4EUKA 1OFVA 3BDAA 3EISA 3KQOA 1AF4A 1O3YA 2BZSA 3BXFA 3F5SA 5DNEA 4GKAA 3OPYA 3GGCA 3BMCB 1SCJA 1V0JA 2GZDA 1W0KA 5DHPA 5FT9A 4YIHA 3BMXA 4DNXA 1LGYA 1RLIA 5IFKA 5JV5A 3CNEA 2ZM5A 2PUGA 1M1YB 2WLTA 4FFDA 5TQ2B 4HVAA 1PJQA 1DOZA 2YOHA 3D4BA 4U0JA 3SF8B 5G41A 1AKYA 4W9MC 3L4JA 4DYVA 3F78A 3PEFA 3A25A 1J70A 4S0XA 4LGYA 2GZHA 4WECA 1BW9A 1J5XA 1ZGBA 2H07A 4UNRA 4ZCMA 5C1PA 5AI9A 1UAYA 4NMMA 3ZLJA 1W96A 1FDOA 1RQNA 2EX1A 2EW8A 2QX7A 1IRXA 3LV8A 2GERA 3W06A 1A7KA 3K6JA 4KLNA 4AKTA 5I45A 2EBHX 4R2IA 2WJ4A 1N9ZA 3RT7A 3EVEA 3M5DA 1NMYA 4Z3KA 3NOVA 1KY3A 4S1TA 1S7GA 3DV9A 4EZIA 5D84A 1E7MA 1V43A 4AP9A 4MVJG 4KQGA 4YCLA 1GVNB 1J2RA 4R2WA 1QSGA 1R5JA 1HPLA 3JQAA 4RF2A 1OI7A 3DAPA 3N3AC 3W5AA 3ZWQA 1G60A 1KYWA 1XQ6A 2N3ZA 5C32A 4RPIA 3GRUA 2B25A 2JAXA 3LVQE 4OMDA 4W99A 5B1YA 2PU5A 2X0NA 1YJQA 2GZAA 1KKUA 2EBUA 2FNAA 1WMAA 1T3LA 4ZCIA 1Y4AE 3L8DA 4DA8A 5CDFE 3FTDA 3PJDA 2QTVB 2AMLA 4MQ5A 1Z6PA 4OHUA 4WV3A 5FTKA 1Y5MA 3R0VA 4RYLA 3VOAA 2ZSEA 3VQTA 5FAKA 1Z2DA 1OLUB 3H9GA 3VSAA 4FSHA 4C76A 1I3OA 1XX6A 1EJ6A 1A9ZA 2AL7A 3R40A 4B34A 4LSZA 4ZQEA 5CB4B 2BZ0A 4AK9A 5FDFA 2PVSA 1A72A 3EW7A 4E0BA 3CRZA 5C8VA 4A0QA 3K1ZA 3U81A 1R4MB 1P18A 1SUCA 2V8BA 1L5GB 5DNYB 3S27A 3DMPA 4TMVA 3WOVA 5F35A 5JD6A 3L7MA 3LUKA 4H6XA 1IULA 2DKOA 2G04A 2Q8PA 3D4NA 4MLPA 3AB7A 1VSVA 2D06A 4JQZA 5IK2A 3MC1A 3RVLA 4B44A 1LQUA 2CXQA 4H1VA 4M60A 2GDZA 4KUEA 4H18A 3OQIA 1AXEA 1O5OA 1P9RA 1GUFA 2R8YA 1ARZA 3BH6A 1EG2A 3W3AA 4MDYA 4QYXA 3UJ3X 1H6BA 2F43A 4QODA 3ZGZA 3ERCA 2H06A 3R3WA 3OLCX 5D5QA 2AG5A 4WZ6A 3M6IA 3QPWA 3ONNA 2QLNA 1IIBA 1LS6A 1VBNA 2JK1A 4WK6A 2INGX 3NZEA 4IX1A 4M8KA 4RY0A 3TSAA 3EX7C 2C54A 2HF8A 3I52A 2FVXA 2ZIZA 2HSZA 1PYGA 1PQYA 4KE6A 1BG6A 3GNQA 3TVTA 5IKPA 3GJ6A 1NV9A 4N5IX 3UAWA 3EA4A 3HDQA 3I0MA 4FZRA 4HVTA 4Q19A 4RPHA 4DJDC 1S1MA 3HCOA 3MLAA 4L8VA 1TRKA 4ALMA 1G17A 5L3SB 3V46A 1GP2A 2H4WA 1CV2A 1A9TA 1LCIA 3TI7A 4DQKA 2Q4RA 3L7DA 4LJLA 2HF2A 3GH3A 4C7VA 1FB5A 1A82A 4MMYB 3KJNA 4FFRA 4DV7B 5EQTA 1E8MA 1USKA 3UXYA 2VHTA 1L4EA 1RE1A 3A1VA 1DX4A 1NFQA 3DL7A 5T4HA 1FU7A 4BNFA 2BTOA 3G5AA 4YRRA 4J1TC 4Q7MB 2DY0A 2WWIA 1Y8RB 2B7LA 4EYKA 4UU7A 2Q3HA 1D6SA 1Y1SA 2K5UA 3OAAD 3OLXA 4JC5A 4MVXA 4RFVA 1FYDA 5DULA 1KEEA 3CLRC 3H4VA 1EUQA 5IEBA 4JMLA 2ZYTX 3RVPA 4A2QA 3DLPX 5I4KA 5KTSA 3UPTA 2VDQB 4ZXPA 3WL3A 3OCJA 2DR0A 5JLAA 1U80A 3MCAA 1YQUA 2JAUA 3NBXX 3WL8A 4JMPA 5CFZA 4TV9B 3KYCA 2DF8A 3VPGA 3WTBA 4E3WA 2C9OA 2GF9A 4MQ6A 1QLWA 3WNDA 4BPRA 2EP7A 1FFCA 1THGA 3PYLA 1T43A 3Q0IA 4GBMA 3ZEAA 4E32A 4QTXA 1MPTA 4OHVA 3IVXA 3GUYA 3MOGA 2XH8A 5EMJA 3KR2A 2CCGA 3JASA 1G66A 4EB0A 1M0TA 5IASA 2HJSA 5GJCA 3U3OA 3NJ4A 4X00A 3BRQA 1XVAA 1M34E 4FR5A 4HWKA 2OMKA 4MK4A 4RHTA 2HGSA 3CF2A 3DV0B 1PD0A 1WJGA 2P2SA 3X1WA 1S2NA 2HH9A 5L6MB 5LQCA 1O6GA 2D8AA 1IB6A 2Y1CA 4LK2A 4YRMA 1FBTA 4J03A 1ZIDA 2OFWA 1CQJB 1IY8A 2AOVA 3V6LA 5EJ9A 3HRHA 4QXRA 2ERYA 4LW8A 2XQVA 4LJ5A 4TL7A 4X8LA 5K1ZA 5LZ7A 4Z2AA 3K3PA 1OXUA 1VC2A 1VMDA 3A1TA 3KVOA 3L6DA 4NNPA 1YVDA 1Z4KA 2FEWB 1QE0A 4KXVA 4ZO9A 1JIKA 2WJAA 4GM1A 4I99A 3KRTA 3T3PB 1W9HA 4FYYA 4IKEA 5U4XA 2JFFA 4TQUS 4S1PA 5KQLA 4K9PA 2B9VA 3QELA 4I1VA 4JFAA 4MLZA 4DBVO 3B8EA 5AKEA 4ZYTA 3KSBC 4WT7A 9ATCA 4PS0A 2H31A 3M6VA 2L2QA 1YRAA 2W2PA 3IQWA 4IDNA 4LAFA 4DMKA 2BSAA 2QLBA 3EOZA 5DEOA 3W79A 4KR9A 3QTBA 3K2EA 4XIJA 3WNVA 1P72A 3VTFA 3H83A 1O94A 2C0CA 3FHJA 1CW2B 1V5IA 2FSVA 2RGNC 3DHEA 3G2KA 1P7PA 1Y6QA 3L7YA 3LFHA 4PXSA 1ECFA 1HKHA 3WIOA 5BQ5A 4BO1A 5EIFA 1VP3A 3NCTA 1NL3A 3K9QO 4ISBA 4MV4A 1DG9A 3O4IA 3S7ZA 1VPVA 2JHAA 4ZT4A 5AK4A 3SLGA 2B1RA 3EK2A 4N6OA 2QNRA 1Z4PX 2NNLD 3OE4A 1XCPA 3SSNA 3IQGX 1YS2X 2B61A 5K8VA 4GO1A 4C20A 4HATA 1G0OA 1U9CA 1XEWX 4CE6A 3ZLBA 4HK4A 1KBQA 3K2IA 5IBCA 1MC1A 3CEAA 3SLRA 2B5OA 3IAEA 3IULA 4FLFA 4DREA 5BSUA 3ZHYA 1AQYA 4RA6A 1RAIA 4Q9DA 2IHUA 4D5GA 2WHXA 4X6YA 5DHFA 1YB2A 3H16A 4BFLA 3I9V6 3V2IA 4R3NA 2EL7A 1PR3A 4IQGA 5KKCA 1QQ5A 2H1HA 4M87A 3DO5A 4Q3CA 2YCLA 1T4GA 4EJSC 2M32A 2QAGB 2QA5A 3HB5X 5BQ3A 4EKDA 5CVTA 2GN4A 4K26A 4OHOA 1CE8A 3HCCA 4HLUA 1CY4A 2JLAA 3JARB 2WWHA 1JNXX 3N05A 3SICE 4BU0A 4IS3A 3D6VA 4II3A 1TTQB 4NC9A 1PUJA 4O4HB 3U39A 3HKDB 3VO8A 4ENVA 3IP3A 3TS1A 1C81A 2O5RA 1SQFA 3CJRA 2TYSB 3HBMA 3I04M 3LBHA 3V55A 3B38A 4H7HA 3WQSB 1UFQA 4RE6A 1QZUA 5EEHA 2FMFA 1VA4A 1LBTA 3JV7A 4QAJA 3SJ7A 3W4IA 2VAPA 5C18A 4W4TA 1WXHA 2AFIE 4P81A 3V1YA 4BV2A 3P0JA 2EJCA 4D8WA 4YY3B 4HJRA 4A0SA 4BJ3A 1YT5A 1GNRA 2FXVA 3JYPA 5A02A 3GVPA 3OKFA 2PT5A 2ZKIA 3DEZA 3PDWA 1MA3A 3DM5A 2PFGA 3OJWA 4MRRA 2ZUUA 4ZI5A 4OB7A 4GD3Q 4MWOA 1TJYA 1F51E 4A4DA 4NE9A 1T8TA 5EMKA 3ABRB 1T0JB 2PGAA 4WY2A 1ZUIA 3LUBA 2C7VA 2EEZA 2WYWA 1IPFA 4CQJA 4QNNA 4DL9A 4M55A 2M6LA 1ZMXA 1WZNA 1T8SA 2BD0A 2KX7A 2XB6A 4RPCA 2PKXA 4DRXB 1R0CA 1NBIA 4JJKA 4PO8A 4QGHA 3N2YA 3EZLA 3QOWA 5FNZA 1U9IA 4G86A 4PSDA 4YR9A 4AZWA 3CZ5A 4ND6A 1M7BA 2FR1A 1ZOIA 3RTCA 3ZQJA 1DAIA 1TXGA 1XXLA 1CDEA 4FP9A 2ORYA 4YP5A 5EJEA 3UATA 1FVHA 3SJUA 2L69A 2QPLA 4BP8A 2P0YA 3LUGA 5CVUA 4E4TA 4IDAA 4NJMA 1AZLA 4IDFA 4U39A 1E5LA 1B8NA 4YQEA 3U7JA 2FZ5A 4AZ0B 2FX5A 3LOPA 3KLMX 4HGYA 1XQWA 3FAZA 2NV0A 2BC9A 3DB2A 4RGVA 4YAGA 3BXHA 2BFFB 2X0RA 3QE2A 2HYDA 1OYVA 3PC7A 3CQ9A 5LYJF 2GBFA 1W4CA 2PTGA 2XR1A 1UBLS 2FFHA 2R25B 4QJIA 1XZFA 4R1SA 3MOSA 5CA0F 5FD8A 4KXLA 2Q99A 3AHJA 1D09A 4OQNA 4WK0B 4V1CI 1E1QD 2HHAA 3V4LA 5LFAA 4I9FA 4LNUA 5EKUA 3WJ7A 3L4BC 3VKFA 3DAOA 2P2GA 4DW8A 1F38A 2HJVA 3EQ7A 2IYQA 2QAJA 3O73A 3VU9A 1X1RA 3D3EA 4Z9XA 1YFJA 3SQOA 2NYUA 3IP9A 3RIGA 3VJMA 1RC8A 2ZP1A 4FGZA 3QEAZ 1GHTA 1RKBA 3ABOB 3EQZA 2O2GA 5K8TA 1VMIA 2GN1A 3SHFA 1MAUA 3CTPA 4JBXA 1JHQA 5ES4B 3QUCA 4IHJF 5C3UA 3U4HA 4C7BA 3PHLA 1TF2A 4QQ8A 1A4RA 4LV6A 1VBKA 1YVRA 1J0DA 5JUWA 1GO2A 5IAAA 3KEMA 3OMXA 4ZEVA 3WKCA 3I6IA 2NO0A 1PX2A 2NO1A 5COQA 2V7WA 2J6BA 1G8AA 1F17A 5B3LA 2CFOA 2QD5A 3KVNA 1OILA 1OA1A 5ALYA 1O96A 2GHIA 4YRJA 1X8KA 3PLAE 3H2BA 3B82A 1L6IA 4R0VA 3RBXA 2BBOA 1CS0B 2B9EA 3WFJA 5EWJA 1UOOA 2IP4A 3EG9A 3K5PA 4M1EA 5A4MS 3ZKWB 2FZWA 4BLQA 1SCAA 1FBNA 3HV0A 2YWBA 3L01A 3AB8A 3UB3A 4N0DA 3EQ9A 2ZTMA 1L5VA 2WLSA 1MH9A 5JCPA 4G1CA 4WZBB 4ZYLA 1U0HC 2OGWA 1X1CA 8MHTA 1ENOA 4YBRA 4O2BF 1ZHHA 3UGTA 5A7HA 2O7RA 1KK1A 2V7GA 3EYWA 3F96A 1KYXA 3M9LA 3EBPA 5KNCA 5DHUA 4NULA 1NQUA 2FSPA 2HX1A 5FOXA 1WABA 1EE9A 3FUUA 4XPIB 1EU1A 5THQA 2C77A 1HUQA 2EZ8A 1WKCA 1KTVA 2ZUDA 3AR2A 3E35A 4K40A 4OQ4A 5D3ZA 1OSNA 4I5EA 2AG0A 2ZTSA 4I8DA 3NGLA 3M4YA 3VPDA 1P1CA 3FB4A 2G40A 1ABEA 3AI3A 3QLJA 4RAOA 4ZVSA 1P9NA 3GLGA 1XJQA 1BCRA 1XTQA 1EJBA 2HLHA 3QKIA 2QRVA 4YAWA 5GONF 1SVWA 1T5HX 2IX9A 3E27A 2CXUA 3CGWA 1J4AA 5EJAA 3HGQA 1B1AA 3NWBA 2AZTA 1DWQA 1ESZA 1NXWA 3DKPA 3K9HA 2WWYA 4CEJB 2OQRA 4UNIA 3TQOA 1CCWA 2J9GA 3TVDA 4HWSA 1I3MA 1U6KA 5BNZA 4YPVA 1L5SA 2QUBA 3CO0S 1QH1A 1NJ8A 4DVJA 1QXSA 1SULA 2J5RA 4CDNA 1DBPA 4CEIA 1DAKA 1DUSA 5DLQC 4N3GA 5FR2A 2A3RA 3N58A 3MN1A 1K4YA 2XUAA 1R00A 2JBAB 4GP7A 2GPAA 4I8IA 4X91A 2P9GA 2FPGB 2GJ9A 5G02A 4DLKA 3TLMA 3U48A 4W9NC 5A4JA 5ICCA 5BMVB 1U1EA 1NXVA 1XZDA 2C2ZA 4GPIB 4KIUA 5FBVB 1QO0A 1QHEA 2QRLA 3A8TA 1YBVA 2CVPA 2P0AA 2QX4A 4WKPA 2O1XA 3WZ2A 2JGFA 3KHSA 3DEKA 5K9ZA 2O6LA 2B8EA 2ZPTX 4EEZA 3S40A 3BGSA 1OWMA 4HDMB 8ADHA 2HTFA 2XOKA 3EHDA 2QR3A 1J5EB 1GAJA 2ZBDA 1FTSA 4BRWA 4M1SA 2QW8A 1LBIA 1G1MA 3RE1A 4DDHA 5CFPA 1EX6A 1WNFA 2P4HX 3WWCA 3ADPA 2NPOA 3IURA 3Q41A 4PGMA 5KU1A 1TDJA 2AC4A 4S1NA 5REQA 1KFKB 5AVZA 4A0GA 2VJQA 3IR5A 4KMMA 4KHZA 2CZCA 4I5GA 4X20A 4C22A 4DXHA 2B4TO 4OP3A 1THMA 3BGVA 3GZTB 2OKGA 1ZD4A 3HU2A 3U17A 3HCPA 3HBAA 4WMLA 5CAEB 1M5RA 3AEUA 3TLAA 5KNDA 3ZU6A 3OOEA 2A9OA 4DCCA 4TWIA 3GJRA 3DW3X 4QJ4A 2OCDA 5IBPA 1YQXA 4ZAWA 2MINB 1XLUA 2I5PO 3GGGA 3OTOB 5CPBA 3JR7A 4LXTA 3RYFB 3SEFA 2YZKA 2BEKA 4B1FA 4B81A 3QYJA 1XPUA 2RC5A 1NLFA 4G5SA 3E1SA 1O08A 2IW1A 3AILA 3K94A 4WN9B 3MQFA 4WJLA 2ZROA 4V0QA 1J9GA 1TD9A 1PL0A 3RKUA 3RYIB 3FKQA 5JQGB 3VVMA 3UV3A 3HJGA 4BP3A 3QG1A 2HF9A 1NVDA 3RARA 1D1TA 5KX5A 5AIBA 4YRQA 2LTAA 2NTJA 1NJFA 5GJBA 1PQWA 4NZYA 3B3QA 3BFPA 1KS9A 4KQHA 3RIXA 3MTEA 4L0QA 4DZRA 3E5NA 1N2IA 3IV6A 3PR1A 3KHUA 5LC1A 4OAQA 3BXGA 2J3KA 2FOXA 2Z09A 1E4EA 1IEVA 3CH7A 3I04A 3ORHA 1YZFA 3W8RA 1XF9A 4UD6A 1NVVR 4GH5A 2FMKA 2JH3A 1YHNA 5DU2A 2YFKA 4ES6A 5DLYA 3AH8A 3OFND 2J0EA 4FSXA 1XSEA 2E4VA 1ZZGA 4K6KA 3RRMA 4B5KA 2CNWD 4AC9A 4M0DA 2V7BA 1E9VA 3QJGA 4GOKA 3TDKA 2FMXA 4KLCA 3EVDA 1MKYA 3NATA 4FTWA 1H85A 3FWZA 1VCIA 4TS9A 2BGGA 1VZ3A 3LCUA 3UO8B 1XZKA 2FFJA 4QUKA 1SKYB 2Z5LA 4O0LA 1VCOA 2QJOA 1J07A 2Y67A 4HGPA 4MNTA 2PXAA 1KAHA 2WE8A 2XCSB 2WWXA 3JQPA 3SIXA 5EUBA 4BMCA 3S2UA 3SIRA 1DAGA 3RG2A 4DLYA 4CM8A 2PR7A 2PX3A 5C52B 2OZVA 1Z13A 1AKQA 2OFOA 3K0KA 4N54A 4LPSA 1I4LD 3L7LA 3U0VA 1C9EA 4J49A 1L5LA 4ENRA 3HL0A 2J5KA 3DFFA 2C5AA 2HMYB 2YFQA 2FU5C 3LWDA 3QEOA 5AKZA 3AIMA 1I7QB 5EMMA 3RGWS 3GLIE 1RM0A 2R1TB 3ETCA 1NXSA 1L8LA 2HQBA 2GRUA 4DEYA 1QRSA 2E4YA 4JR2A 4QRIA 1FU8A 5FBZA 3PI6A 2C98A 2FP3A 2ZS9A 4W1SA 5KB3A 2O9JA 2EL9A 2UZ1A 1OI3A 3PXXA 4NV3A 1Z5GA 2KW5A 3UJCA 3WL5A 1V1JA 2PD4A 3BRSA 4B8ZA 1X42A 5K3CA 4D98A 2HXYA 3BJZA 1VL0A 1EP1B 2G8LA 2O6HA 3OTQA 3SXPA 4EY6A 2VBCA 3FZQA 1ZZEA 4UMFA 2A94A 4KWTA 3RBAA 4NFYA 3JSXA 1E0DA 3OECA 2C00A 4YJHA 4LI3X 4C03A 1KY2A 4RHFA 3X1DA 5CH5A 1J7JA 2CV1A 1HURA 5DM60 3W7BA 1E5TA 3ZI4A 2BUAA 3JZAA 4FS8A 3DOHA 4G1VA 3TUZC 3UXMA 4EECA 3FZNA 4KRFA 2C88A 3N6VA 3KXDA 4KQEA 1R15A 3PFHA 1Q15A 4R41A 3KG2A 4GKVA 4HNTA 4LFAB 2UU9B 2XRZA 3ZCTA 4F2HA 1ZQ1A 1TAUA 2JHGA 2NU9A 2H2DA 3O4HA 4O5OA 4EFDA 2O7NA 2II6A 4F6RB 4TRJA 5JDCA 4Z9AA 4OP1A 4OXRA 2O23A 1VB3A 3ZY6A 1VPEA 4GVPA 3PXEA 2PSSA 1GA1A 2NN3C 1QOPB 1NQOA 1LX7A 1TQDA 2BISA 2A30A 1ZVQA 3MWJA 2PWBA 3SKXA 3DHNA 2SNIE 3MHTA 2D7CA 3GI1A 2GM5A 3MD9A 3V4ZA 2NUTB 2ZJ1A 3AB3A 5JHHB 1Z16A 1GPJA 2OV1A 2OV8A 4K88A 3A6GA 4BRUA 1I2ZA 1PV2A 4OA8A 3V5NA 1APBA 3RFCA 1DBRA 3EB9A 2G71A 4HKTA 1ID8A 1MW9X 3NTRA 4UCWA 1ODFA 5A4FS 1Z5UA 5J47A 1LK7A 2BJHA 2V65A 4GLFA 2W6MA 1AGNA 3C6KA 2ZSBA 2C5LA 3CLKA 3GEMA 2QWXA 2A86A 2O2YA 2R4TA 5T67A 5TE9A 5FOWA 3IDFA 3GMTA 4I5DA 2JL1A 1NDUA 3C1OA 1D5WA 3RYCA 5IXJA 2JFQA 4F91B 1UFRA 2OD7A 3CZCA 3MZ0A 3SHVA 4AZVA 2QAIA 4ZYWA 3AJ8A 2VS1A 2I71A 1O8BA 2MMCA 3HXQA 4IDPA 3FRIA 4V0SA 2H2IA 2Q3BA 4OFXA 2BKEA 2Q9AA 2XLCA 2ADOA 2L19A 3ZWCA 2QJRA 3TN7A 4PO1A 1I0LA 4C06A 4OPMA 4D45A 3H2IA 3UJAA 3IEPA 4YCDA 3G2LA 1UJ6A 1WXWA 4I1UA 5AI8A 1MW8X 4TV8A 1Y3IA 2W4MA 1D1QA 3FWHA 1U7WA 3AHFA 3SNHA 1VE6A 1H93A 2DLCX 2XB2A 4QDZA 3VGPA 5K6RA 1ODTC 3KB8A 4CMAA 4ZOLA 3WYFA 4OYLA 1EZ1A 1OXBB 2VEOA 2Y92A 3GLQA 1VHTA 3H5TA 2R87A 4FBLA 5E1MA 1W75A 4EUEA 1AN0A 1TKRA 5MDHA 2DQ4A 2HW8A 3ZTTA 4X84A 3ZK7A 2C99A 3B5IA 1RHMA 3CG4A 1IXZA 3JZIA 3KAPA 2CFTA 2YINC 3P4YA 1K4KA 1JE0A 3DT8A 3FAKA 1TPYA 3KJGA 4Q4DA 4XWAA 1KI6A 1F8YA 1WZUA 2X3YA 2UXBB 9LDTA 3WLRA 4JI4B 1U8UA 5FBLB 4CDMA 1T2FA 1CYEA 3L79A 1SC1A 1JSRA 1UZMA 1QHSA 1R9NA 5F4ZA 1AS0A 5CLQA 2AUTA 4L78A 4ZMBA 1GQ2A 1WVIA 2X8AA 4P36A 2FPIA 4NYIQ 3ZY5A 3THXB 3PNLA 4HPJB 4B7AA 4D82A 3WSWA 4EBBA 3J80A 1KOGA 1PHRA 2KSQA 4H1UA 4U7FA 1JVSA 4N5NA 3PNBA 1DV1A 4G0NA 5AM2A 2R8EA 1P91A 3UMFA 1HNNA 3U61B 4Y6LA 3UK0A 2WJWA 1A5ZA 3PNSA 3SS8A 1RZVA 2QZPA 4I2NA 3MOIA 2FG6C 4WERA 3I4FA 3IC5A 2VWGA 1IM5A 4KV7A 4X1YA 4NXNB 1QPBA 2FDCA 3EIFA 1T6ZA 4WBXC 3DBLB 1U7UA 2K4MA 3IMGA 3SYNA 3NW9A 3SQWA 5DM2A 5JC8A 1G18A 2PQ0A 1W88B 3JVVA 1E0SA 1X94A 2JGNA 3HKBB 5B55A 2IS2A 3PTZA 1YGPA 3X1YA 1QLHA 1Q0SA 4H4CA 5E9AA 3NO4A 2HGZA 1PI3A 4INOA 4TRMA 4OATA 1Z5WA 2BFMA 2V9PA 3M70A 3I58A 1RC0A 2XMSA 4GRAA 3U3ZA 3GJ8A 1CWUA 1VJ0A 4LJRA 1EDBA 3WB2A 4YCNA 1P5JA 5HP4A 4XUCA 2QK4A 4X8HA 4ICIA 3LBYA 1I5EA 3AEKB 3RABA 4D8YA 2PX0A 1Z62A 2O0HA 4AY4A 1R27A 4C01A 2B0JA 1EVZA 1N6RA 1OAAA 1FRZA 1UWVA 2ANBA 2JJQA 3GLHE 1PU2A 4GOOD 1WY5A 4O2AA 4QPDA 2NPFA 1OFTA 3RG8A 1I2CA 1MIHA 3PNYA 5D87A 3WWOA 4UVDA 3VBEA 2A7XA 4CM5A 3FDZA 1JIIA 3I9V1 3UA4A 3WIEA 4KWHA 3HO1A 4RY8A 3TO5A 1UBFA 1WSDA 1GGKA 3DTNA 1K8YB 2AC7A 5JZSA 2F3RA 2Y1DA 2GUGA 3EZ2A 3H84A 4FCWA 5EUMA 3V33A 4BLPA 2DHDA 5ERGB 3IPAA 2NVUB 1KIAA 5E6RA 3WHLA 3DZJA 4I5FA 3CVOA 2YRXA 1WCXA 3ESXA 1N5JA 2I2XB 3QM1A 5CVDA 3I83A 4MIYA 4L5YA 3KQMA 2IZ6A 4KR7A 1GAEO 4JXZA 5KYNA 3OIDA 3OPMA 1FU4A 2ZTLA 1L8OA 4LOIA 1E3TA 2EKLA 1M5UA 5ILGA 2FWRA 4Q82A 1OX4B 3U4GA 1GNQA 2VJNA 2YHAA 3C3WA 2WFAA 3EXEA 5ALPA 5C34B 1OXTA 3R0XA 1RLTA 1HYBA 4J0DA 4UOQA 2JEOA 2ZRQA 2Y05A 1EXMA 4I1SA 1TM3E 1M6EX 1WUTA 3ZW9A 3L6BA 1JHVA 1N2SA 3HKEA 1RYNA 4BNDB 1MGOA 3JD3A 3Q88A 4Z8XA 4PFJA 4LJ9A 1ZU4A 3T5PA 2Y66A 4JLBA 1FMTA 1ZNXA 1KZ6A 4BZWA 3RJ9A 5JISA 2GPSA 3EXIA 4F71A 3IT3A 1OJLA 4U2GA 1GZVA 2VSOA 3WBFA 1I7PA 2FXIA 2VJLA 5B6JA 3PIIA 3DULA 3EZ6A 3HDGA 3PNKA 3V7FA 3M4XA 2OO7A 5DF1A 1FFSA 1E1RA 3IAAA 1NM5C 2FQYA 1BEUB 3JYNA 3VOSA 5T6MA 2PGJA 4XA8A 2EFGA 4DN6A 4DTCA 2HA3A 4HT3B 4RESA 4UM7A 3GLVA 5I3ZA 2D4HA 3N1UA 2VO1A 3QBVA 4MV0A 1XRPA 4R1TA 3TW0A 3OLZA 1HT3A 4PGAA 1WY7A 4JLNA 1YZKA 5DHRA 5F7JA 1ZGAA 5IN5A 4H9GA 3STYA 4BNMA 4FM9A 1W36C 1HFWA 3IILA 4J4TA 5FL3A 5C5IA 2O14A 3C3PA 3OFVA 4XARA 1U1CA 1VE9A 3SYLA 1NBOA 4EYEA 5LQUA 4KAAA 4OTZA 3U7GA 4HZUB 1U8TA 4XYBA 5KHAA 4DF3A 2O3JA 2O3UA 3FUCA 4YLEA 2JJ2A 4JYPA 3LIIA 1U0RA 1YULA 2BHTA 3SC2A 3KIPA 5JAPA 3QTLA 3R5XA 3DAFA 4NENB 4Q0MA 4WLNA 1D2CA 4NZZA 1ACLA 3ZHUA 4QGAA 3H87A 2Q6KA 2ZQYA 3T4XA 3NBKA 3F6CA 2VZ8A 5T8KC 4AG6A 3QKSB 1CQIA 1X7WA 3QVWA 2HIMA 4ZDWA 1FQOA 3ROXA 1FQKA 3WMGA 1FF9A 3FOZA 4L4UA 1MJHA 2GEFA 1ODKA 1JFFB 3GFSA 2FUKA 1E20A 1L8QA 3NC4A 3GNLA 1TM4E 1SXGA 2QMUA 1N7JA 1VJCA 1UINA 4JQOA 4DNPA 2XOEA 3OE7A 1C3EA 1D9XA 3C70A 3T99A 2HA4A 2X13A 2AW3A 1GQOA 3O1IC 4II7A 4L72A 2WNSA 5KZMB 4ISCA 4Z3OA 4K3UA 3CNOA 1IXRC 2B30A 1PT7A 2G07A 3RFUA 1NTOA 3LECA 3RK0A 4ZT3A 1C7FA 1C0IA 2PH5A 2WDPA 1X80A 5ED0A 3N2GA 1QIHA 4V0KA 1T4CA 4NONA 3PUXA 2P9ZA 2Z2YA 4DR2B 1VSTA 2FW6A 3MJRA 1QB8A 4DQDA 1G3QA 4DIMA 3D7MA 4MZDA 2C4WA 3OESA 2GEVA 2UV8A 4DSAA 1EVYA 4TT3D 4MLCA 3OLQA 3NANA 4BQFA 1UBJS 2WKWA 4WXEA 3K31A 2Q3FA 3UJBA 3BMOB 1SZDA 2WB2A 2AOTA 2Y71A 5JXWA 1Q6ZA 5ESXA 3T7EA 3K70C 2FZKA 2Z1DA 2XA2A 3IV9A 1QCYA 3D6HA 1PWZA 4M83A 4X3CA 5C8YB 4BLOA 2H18A 1IEQA 1MQSA 3KWFA 1AK1A 4HAUA 1I1HA 4XIGS 2C7PA 2GVNA 3PFGA 2V3VA 4N01A 5D01A 3PQ5A 5SICE 9MHTA 1JRLA 1BOOA 1HYEA 3BA1A 2GKOA 3LZ6A 3QA9A 4M6WA 3VU3A 4A9AA 1LRJA 3T7KA 1IWPB 5EZYA 4DWJA 1SH7A 1EA7A 1PYOA 5HDBB 2AYXA 2FLKA 2HWKA 3RF6A 1PK7A 2PKQP 3B1WA 1J39A 3K0CC 3O1LA 3G2PA 1C7QA 1GG8A 1E6WA 1PL8A 1WNTA 2OAQ1 2WMOB 2X1VA 2HU5A 1R8YA 1T8UA 4O2LA 1NU8A 4PM4A 4QIHA 2LKDA 1BE6A 3IBYA 3A28A 2ZIAA 1C3VA 2AWNA 5AT1A 3PNOA 3TDMA 3TLGA 5J2TB 2BI4A 3CNLA 2RHJA 1JSLA 1SCUB 1UMDB 2QRQA 3F90A 3H4TA 5LVAA 3EE6A 3JQFC 1VIDA 2UAGA 4LHEA 4LV8B 3OZIA 4E5KA 4ECEA 3JD0A 2VA8A 2WYUA 1H8HA 1OWNA 3AKYA 3MBOA 3PYXA 1G9TA 4MW6A 5DMXA 3Q3HA 5C46F 2QTNA 3X2FA 3TZEA 1RDFA 1XO1A 4J16A 3ZH2A 3VSDA 4IIJB 1IMJA 4UAVA 2BGWA 1NBMA 4NYJR 5A2QA 1AXGA 3R7SA 4OXNA 5C1DA 3MELA 1BCSB 5I9MA 2I87A 3R5HA 4BTLA 5ILQA 4GMDA 4NOKA 2WAXA 2Z56A 4EP1A 1XVUA 2JC3A 4HL6A 3MA0A 1UQTA 3KQQA 3FUVA 4QARA 4EI9A 4Q1CA 2J0SA 3K2QA 1NX9A 1PFQA 3WP1B 2RK3A 2I1QA 3DO6A 1N0HA 4TX1A 1Y3CE 3G23A 5BQXA 5C35A 1OH6A 1FJHA 3Q6MA 1AO3A 5DHSA 5BN5A 3EH2A 4O5AA 3TQCA 4FQ8A 3TSZA 4AN4A 3K71B 2F1JA 3LW8A 2H3EA 3O9VA 4H3VA 4QVKA 2EQBA 2CB0A 4LWQA 1H1LB 1QONA 3K05A 4MB0A 3FYDA 5AKYA 2XZOA 2DPYA 1GADO 3MWGA 3QPVA 3VR3A 1B4DA 1SUPA 1C8LA 4KPUB 4CLXA 4YAKA 1N77A 4ZC8A 3JPYA 1RJ9A 4G5RA 1ABFA 1Z5OA 4PLGA 1DCFA 4MP6A 4KO2S 4X95A 1I1QB 4RK0A 5AXBA 4CGZA 3IQXA 2W6JD 4CHTA 2BJVA 4GPEA 1WQ4A 1T29A 1IU9A 3D3QA 1M34B 2RONA 3RBVA 4PLTA 1FC0A 1K06A 3KTAB 4DY4A 1Q1AA 2ACWA 3BN3A 3CINA 3V8BA 5HZHA 1EK0A 3R9XA 4FMCF 4RA9B 3W5DA 2ZBEA 2I6GA 4R1LA 4RV4A 1BDHA 3VDRA 4B2LA 3CPJB 1UAGA 5LBTA 5FHRA 1X92A 1NLMA 2J85A 5E6SB 3VXKA 1DUVG 2FTKE 3EULA 4XWKA 3G85A 4BGVA 4IPTA 3IUJA 3LRTA 4ZRMA 4AI6A 4RWEA 1MOPA 2DPGA 2D1QA 5EMLA 4H15A 3U7IA 4GRIA 4XGIA 5G1PA 3R3SA 2Q3LA 1D6NA 3UZUA 1DEKA 1RCFA 1ZH6A 1LQ2A 3PC6A 1QQBA 4UCXA 3HDYA 1W6RA 1L7VC 3S2GA 5JAMA 4HWPA 1M1ZA 1CUHA 1TZCA 2VHUA 3H0EA 2O8DA 1GTVA 3F1LA 3PF8A 3ZPXA 4A10A 4U63A 5IH7A 3KZVA 3EZXA 1V3QE 3LHFA 1FMCA 4N8EA 2YDXA 1US8A 2B2CA 3OEEA 1W7AA 1B74A 2OL4A 1U8XX 3VYRB 1QVZA 2A0XA 2GAIA 2NSDA 1HFJA 3NIFB 1IG3A 1IN1A 2VHYA 1CRLA 2IHJA 1RMTA 5AVYA 1T1GA 1DWUA 2HV9A 1Z56C 1AQIA 5LUAA 2G77B 1BNCA 1DHRA 3L8CA 1E3SA 4B0OA 4E5PA 2O0JA 5K3FB 3VHRA 1N2BA 1W1WA 3QJ5A 3U7QB 1OLOA 5LA6A 5B1EA 1TK2A 2IW3A 2NTYC 3HZRA 3GHYA 2HA6A 4NECA 2IZ5A 1G3UA 2YCBA 1UOQA 3CNNA 2CNNA 4OFBA 5HUJA 4IFTA 4YCCA 1NSFA 3OTGA 4TMXA 2I78A 5F2OA 2BGJA 1LW6E 3RS8A 1LD3A 1PEDA 4R8LA 2O1EA 3LNTA 4XSVA 2B2XA 4WOKA 5SY4A 3IUYA 1JPVA 2JLWA 5DH9A 1RKUA 3A4NA 3F6SA 3BILA 4RSHA 2ATXA 2R62A 5DTRA 5HR5A 4LXYA 3NAGA 4MR8A 4H7DA 4RXUA 4EFKA 2QVCA 3HDHA 3QU2A 4ZYZA 1T2NA 5JSYA 3UHJA 3UOAB 1N6IA 1VRCA 1XD8A 5AVTA 4LRYA 2C2YA 1REQA 2DFLA 2OORC 3ETHA 4LBZA 1B2LA 1CULC 4LK3A 1N8NA 4FFWA 2ZYAA 2UUBB 2BY4A 2PNFA 2ZPUA 4DLRA 1ULZA 3NU1A 2ZM6B 2VP4A 4EAQA 5M34A 4GKJB 2WHRA 1PUXA 1DAOA 1COWA 2AFIB 4C5CA 3RWOA 3PI7A 1EVEA 2PQ6A 4KQ6A 4X66B 4BS9A 4MRMB 1DRWA 5AVXA 1ZM7A 3V8MA 1Z2CA 4ACBA 3MAAC 4Q9IA 5AI6A 5HOQA 1DB3A 2VJOA 3MTBA 4B7CA 4D46A 2CJWB 1TC1A 3I9KA 4DA7A 1GYQA 1XZAA 4GGPA 1TKCA 3PFNA 4QYWA 1SRRA 1QC5B 2QLJA 3L8YA 2FPWA 1MPXA 1O6ZA 3NX4A 3OU6A 4U2DA 5FBWB 4AB1A 4B3TB 4URYR 5AJTA 2WQZA 3UANA 2VVTA 2HZ7A 3EOBI 3LHSA 3QVGA 4FEYA 3IVMA 4CVNA 3ID6C 2CBGA 2NTNA 4CEHA 4OAOA 1C9KA 5FUMA 2RDMA 3TZLA 1E7RA 3PFIA 3HBNA 2YC2C 4ND4A 3TMYA 4QTYA 2QQFA 3MJCA 4AT1A 1P5FA 1XF1A 3EEYA 3W6UA 2GLXA 4I14A 4PQFA 4DHWA 1Q84A 1P62B 3ZJUA 3VVCA 4BLUA 4HEJA 2YUIA 5IVKA 1IK4A 1FP2A 2OK7A 3VBCA 1YZUA 3WDLA 3COVA 4RE5A 1ZCZA 4UPDA 4M49A 2DRIA 3LHDA 1E9CA 3D8SA 4FT2A 2XTZA 4HAIA 3ROQA 2OOSA 1YZVA 1P0QA 4YREA 1Z45A 4B87A 2Y0PA 4P9NA 5GIPE 3HFJA 4IW3B 4N18A 5KMGB 4L5BA 2VF4X 1D0IA 5C37A 1A1VA 2QIOA 4ACAA 1UPFA 5I7HA 2E21A 3PTAA 2XDQA 5A62A 1PK9A 4UXHA 1XZMA 4H27A 3E15A 3KXPA 3S8YA 3NVKI 3G1WA 1QX4A 2J3HA 1XDWA 1RHUA 1QK4A 2PV0A 4REMA 4RORA 4QG7A 5A4DA 2H1RA 4HGRA 5AKGA 3O92A 3TL3A 1UWKA 4LF5B 5GTDA 3K6SB 4YMWA 2IPMA 4KN5A 3KT8A 4UULA 3EC2A 5TGZA 4MPRA 2IFTA 2YXNA 2MSKA 3IIKA 5BO5A 4KPYA 2ID8A 3S44A 4W6ZA 2FSFA 3P45A 5CLLA 4ZAXA 5B12A 2QVGA 1C29B 1SZPA 4PSCA 2BFBA 3JAWA 1KFJB 1N2XA 2VBGA 3GCXA 4PLWA 2ODWA 2QTWB 5A3RA 5KVCA 2WC1A 1R5OA 3DZCA 1Y3BE 2BP7A 2JJ1A 2QQGA 3C3JA 3E84A 5HHTA 2JLXA 2AIRA 1NF3A 5JAOA 4B3MB 4HDCA 1UKAA 3A0UA 3WV4A 3SVLA 1YUNA 2GD1O 3H4MA 3SC4A 2ZE6A 3QW4B 3BK2A 3UWOA 4ZZ1A 2JIOA 1M9NA 4CM6A 4CCAA 1ORIA 2DLNA 4CTKA 4DMGA 3DWFA 1KERA 1QB7A 3VKHA 1MB3A 3L7OA 4PSKA 1T6BY 1V6CA 2V0GA 2PX6A 1JSCA 1U11A 3BEOA 4LPKA 2GK7A 3UEOA 3ICVA 3UYLA 1A1SA 3WKEA 1GPAA 4JJ4A 1NQXA 4ZI7F 1XCGB 2AMYA 3AGQA 2ST1A 5LXTF 1M10A 4TYNA 1RBQA 3UMCA 5BQFA 4YONB 1S2OA 2M6SA 1ZR2A 5BWOA 2FPPB 4GF5A 1LUAA 3RAFC 2WW8A 4CLEA 3EHEA 3G0GA 1JKMA 2A5GA 1IQ0A 2WSSD 4MUAA 4LF6B 4RYDA 2ZZNA 3KJQA 1JU9A 2B8WA 3SMQA 4EF5A 1IBMB 4WCDA 1T36A 1XCMA 4PU0A 2D5BA 2JHFA 4FK8A 3MILA 1A9RA 1O1YA 1X8XA 2JD0A 1CRPA 3KQTA 5L3ZA 2ZJ4A 4BNYA 4DTIA 2AR7A 2IEIA 1YFLA 1UM9B 4LOAA 1UBKS 3AETA 3P26A 4YASA 4D2IA 2EEPA 4ERNA 1Q44A 4KQXA 2G82A 3GY0A 3JRNA 5K0LA 4FWBA 3FMOB 2OO5A 4QTZA 1U0BB 2IS6A 5GVRA 1TECE 1Q6YA 3NS7A 1YA6A 3ZXXA 4EVSA 2W7TA 1KA9H 1S3IA 2IVFA 4QXOA 2JARA 4XJSA 2OHOA 3VO9A 2IIVA 2W4QA 5FYQA 3PWZA 3QVOA 2Q29A 2V7UA 3DZIA 3EXFA 3ICCA 2XF2A 5HIJA 3FSRA 2PD6A 3F8TA 4AS1A 1ETHA 4PIPA 4MQUA 3MCTA 1RXUA 1IHDA 3Q11A 5HCNA 4MVJE 5IC5A 5B7GA 2ZWVA 1Z6GA 4JA0A 3U40A 3IRVA 2O2DA 3U6BA 3C5HA 3AUYA 3FI9A 5AM0A 3WG9A 3LT0A 2R66A 2OSBA 3MTJA 5DI3B 5L3SA 1MAVA 4GC9A 2VN8A 2XRYA 4Z51A 1LDNA 1N9GB 3ITDA 4PPGA 4G6ZA 1ML4A 1PKXA 4GE0A 4HNRA 3ESBA 2BFNA 5EKTA 3DMTA 3RC3A 1K3TA 2HLNA 2HPVA 1E6LA 2YY5A 3ELBA 1G5QA 1NYQA 3U4QB 3PPVA 2CVOA 2J5XA 3NWOA 1YI1A 2ZRJA 1C41A 1LTQA 3U19A 2FSIA 3K8OE 4TYMA 4FKZA 1XQVA 3WLFA 2WMYA 3D6UA 1C1XB 4EG3A 1GQFA 4G4SP 3WYNA 2R2GA 4WD3A 2F8TA 3R7LA 1KL7A 1SHLA 3IT1A 2GCEA 1U2PA 2WD8A 2XUHA 4Q1FA 1TGVA 4HGNA 1XFAA 3F8WA 2G67A 2J3LA 3EIWA 1V26A 4RD1A 4ENPA 3ZIAA 1H6CA 1MEOA 5LU9A 3ER6A 1UH5A 3SM9A 4AWXA 4BQEA 4DC1A 2XCTB 2ZUFA 1QP7A 4I55F 1HRKA 4PZCA 1JLRA 3EGXB 1QK3A 5C7OO 2XMCA 3WNQA 2BH2A 2OKCA 4M89A 1PIWA 2BT4A 2IZOA 4A36A 1N1GA 2H16A 3ETGA 3H5VA 4E1AA 5DGCA 4D02A 5BR4A 1BN7A 1T26A 3UWSA 2YYAA 1N25A 3RT1A 1KKLA 3HDVA 5MGBA 1FXWA 2OBNA 2HQSA 4D92A 4LRQA 1E1KA 3HE3A 2WABA 2X9LA 1E99A 3B2NA 3NHMA 4F84A 4DXDA 3L4SO 4CIYA 2RIRA 3IIMA 4ZP1A 4OUKX 2J87A 4W5TA 3DVLA 3WA6A 5J5CA 4IRXA 1ACMA 2OBLA 1BDIA 4PNZA 3TAXA 2Y99A 5EWLB 3MPUA 1T1RA 3HCDA 2C2OA 2MT9A 2ZB2A 4PPFA 4OP2A 4J0KA 4RBNA 3CY6A 2V0CA 4EUNA 5KWVA 2OT3B 4DAEA 2J6HA 3DBRB 4BXOA 1U0SY 2VL7A 3AONB 4FLMA 4Q01A 2C3UA 2I66A 3SEZA 3KOMA 3CCFA 1Q17A 3QH4A 1DRVA 4WXHA 3SR0A 4MRNA 2GX6A 3X0DA 2WOJA 4NOLA 1L5KA 1ATZA 2GN0A 5H9VA 3NEJA 4AN0A 2A5YB 1ZPDA 1XEXA 1MEEA 2Q8QA 2XRFA 2ZJFA 3G89A 3LX6A 3M1LA 1SC3A 4HEA6 4HFJA 4PLZA 3N6RA 3GFVA 1L7DA 1Z6ZA 5C3MA 2BWJA 1FP4B 4WK4B 1SKBA 4HLCA 3IQDB 2WG1A 2XKBA 4L6CA 1POXA 3N86A 2VQ6A 4HN4B 3BF7A 5D00A 2Y6UA 3C8ZA 3MEQA 1YRQA 5L3QB 4V39A 3ZHRA 1GTJ1 3WWDA 1A96A 1JXOA 3QEMB 1GDHA 1IIRA 2FW8A 3HNOA 4KP7A 4D9NA 1PDVA 4YLYA 3JVUA 3AJEA 1EFCA 3IVRA 3DDUA 3QU9A 5BVHA 4CKCA 4POOA 4C7MA 3KXLA 3FCAA 3G8YA 2AF3C 4CIXA 2CDRA 1R18A 3L8GA 3TPZA 1DXHA 1P1RA 1XTKA 3WRXA 5EN4A 5ABPA 4J7UA 1GRRA 2QRZA 4N5MA 3WJ1A 5KYKA 5LDDC 3ER8A 3FW1A 3WI7A 4RD0A 5TMPA 1UKVY 4EVRA 2PRKA 2ZRHA 3LCMA 4Z54A 5M7EA 3CJQA 2Q3MA 2EIXA 2BSQA 3BD6A 3H9EO 1T15A 5FPTA 2FFQA 2QTMA 3KU4A 4FPXA 4OQEA 2X42A 3TL6A 4EA8A 2C9DA 5B1HA 2X3UA 3GFOA 2JGDB 4AY3A 4YRBA 3FMVA 4PYNA 4DR4B 4R2XA 5K3BA 2AZDA 1R5NA 4ZQBA 3RB8A 1XZCA 2Y93A 1GZ5A 1TTPB 3N8DA 1GITA 4MH0R 1QFYA 1U63A 3KZCA 3NBFA 4A8JC 4M86A 4ZTBA 4FGUA 2CL6X 2QE6A 3BSFA 3NYRA 1E5DA 1LH0A 4KXUA 4Y3UA 2JFXA 2DETA 3H1BA 3B6IA 2HDHA 2IHKA 3ZVMA 4DB2A 2EZ4A 4Z7QB 1E89A 4NCNA 5FUVA 4K9QA 2D3TA 4X0EA 2F8SA 2BE7A 5FOTA 1A9YA 5CU7A 1CFJA 2UZAA 2JGKA 5DASA 3EUWA 5E95A 4MINA 3FSJX 2BUCA 2ZRCA 2ZJ0A 3O0DA 4IQ4A 3BMNA 4W8HA 5EE3A 1XVIA 1CJKC 3OZCA 4MP3A 1XTIA 1ZN8A 2X0JA 3USES 2VDMB 5DO9A 1HDEA 1BA2A 1W9MA 3K09A 1EFLA 2QN3A 4NK5A 1TTTA 3HL4A 5A03A 3ENZA 3KR1A 4LDPA 5EC8A 2GILA 1I0IA 3A9TA 3STUA 1G4UR 2WZCA 4K2AA 1L7QA 4CN8A 4ZZ3A 5EJ8A 1L2TA 1KJWA 2I03A 1QUFA 4GGMX 1LW7A 4XYGA 4F92B 5CDUA 1LQTA 4UAJA 2EZUA 3G9XA 3IFSA 2YVKA 3RDPA 1XC7A 2B6NA 2OXFA 3H19A 1TT5B 4FYHA 4FYVA 5GQSA 5JSFA 2ZBPA 3QI7A 2HMSA 2PRJA 1V35A 4GR5A 3W2HA 4DDUA 5IM4A 1BWPA 2OC4A 4N5DA 4AJNA 5M04A 4HDNB 1KAEA 2WFZA 1Q1NA 5HE9A 3LXUX 4YLGA 4AO8A 3L92A 4OSPA 2NZJA 2B1IA 3C3BA 4Y2XA 1PHPA 4MQEA 4B9AA 5K8UA 5EI5A 3ACBA 1MOQA 2JGJA 1GRVA 3LQ4A 4E4YA 1SHTX 1BFKA 3H2ZA 2ERXA 4X7MA 4MB2A 1QTNA 1TVCA 4ED9A 1AZTA 2RH9B 3GUVA 3TTUA 5IXSA 2OHIA 3PEUA 1ZJWA 5LNK6 1P31A 1FFEA 1A9OA 1CQZA 2G9UA 4ONEA 1IZ7A 3VR5D 4UUOA 4PZLA 4CMIA 2JGEA 3HI4A 3NTVA 4N8DA 1QP8A 4MKZA 4QA9A 3V9AA 2ODPA 5CW2A 1A27A 4GKBA 2OUKA 4QXAA 2XT0A 3K6KA 1A8HA 2C92A 2FWBA 2HUPA 4F4JA 3MJVA 1ATIA 2YQ5A 2I3GA 5KEIA 2CJPA 5HVNA 1DIAA 4DBZA 3UJ9A 2LZ0A 2VJMB 3C8DA 3CW9A 2XTNA 3ICPA 5E2IA 4L7VA 3W2TA 1EJ2A 1FFAA 1EFTA 3IEXA 4TLLB 4E5NA 2JFBA 1P7CA 4IAOA 1QIDA 4KVFA 4RD3A 4OK3A 3II6X 1EX7A 1X7GA 3LP5A 3ZC3A 5LZ2A 1XMJA 2GVZC 4QRHA 3VR4H 4ZRDA 3SS7X 3TTSA 4HB2A 4FC6A 2AJDA 1PR0A 2A9RA 1DMSA 4WCFC 1AGPA 3GRFA 1C5KA 4MUHA 4L9SA 1RPNA 2ONZA 1OIVA 3H5LA 3FPSA 4BQIA 4JKOA 1A9QA 2OZEA 3TLYA 3WP0A 3TOXA 3WOHA 3WRWA 1ZW1A 2CBZA 5IUJC 1DQYA 4PPQA 4QGFA 5AHWA 3W2GA 2D3WA 3ZZ1A 3B1KA 2V7EA 5JCOC 4G2NA 4IGAA 2I8LA 2R8PA 4Q47A 1UAAA 1XEAA 1YA4A 4C0XA 3SSMA 4HX9A 2AK2A 1SK8A 4JROA 5CNMA 1EHIA 2HJ9A 4G65A 1MABB 5AQEA 4L8GA 3Q7PA 3FCEA 2WTMA 4QPJC 4ND3A 4EBFA 3F46A 1SRQA 4PG5A 1XTZA 2YICA 2IYWA 3ICEA 4BIMA 1GAWA 1EVQA 2YV2A 1E6EA 3BBPA 4IQ0A 4QDUA 4U5XA 4AUMA 4I7EA 4R2KA 4YYEA 1A4XA 2PO7A 5BYBA 3VTZA 2ENWA 3BHIA 1VGRA 3DBVO 2CLEB 2Q45A 3GMSA 1NASA 4XE5A 4FCCA 5TPZD 3K8ZA 4B6FA 4RIGA 3KELA 1DQRA 3SP1A 3ZDZB 1MOSA 4PYLA 1GSIA 1GZDA 4DIOA 1A8IA 3KKPA 1N78A 3KOYA 2JZNA 1E7YA 4UQOA 1XMPA 1OT3A 2PX5A 2RHCA 2P6UA 2X9NA 3O2SB 1FTYA 1N7IA 2IOFK 3GLHB 3JALA 4QBFA 1ZRMA 3GZNA 3EAGA 2JFGA 3V8QA 3I9JA 5FUXA 5KNLA 3DCJA 1L4UA 1MFZA 1R7RA 3UVEA 5D5PA 2HIGA 1XRLA 5EGSA 3TW8B 2REQA 4HWOA 1G4HA 4QYSA 3GL9A 5CXSA 5DISB 5FA6A 4QJBA 4LVCA 1XQXA 2NGRA 5B1IA 4GLLA 2FA9A 1U94A 1NW4A 1UPTA 1DZIA 2AOUB 2Z8YA 4ZWNA 5K01A 4JY7A 1R0LA 2AFHA 2GJKA 2KI5A 5JD3A 1MJ5A 5F2KA 4X65B 3C7DB 5LD2B 2QMQA 3DE4X 1N2CA 4WOBA 2V5AA 3OBIA 3P9RA 3VDMA 1PNTA 2KMLA 5L8VA 2P6PA 4FXOA 3JR3A 3KPYA 2P9JA 4J0GA 3S68A 5DX1A 5F52A 4QUAA 3Q12A 1JALA 2ZJAA 2N1BA 3LDAA 4BB0A 2WJ3A 5FFMA 5TRTA 1JWBB 3ZNNA 1IONA 1XTPA 2PH7A 4X8MA 5DT9A 3ZWKA 1VI5A 1JEJA 2PSFA 3A6PC 2DLDA 2R6FA 5CGQB 2IZ7A 2HV8A 4MGZR 5F7OA 5ITZB 1W59A 5BXQC 3UH1A 5CK4A 2HMTA 1VYUA 3L07A 2R7AA 1KYQA 2FLVA 1TMYA 3IUNA 4MIKA 1IPHA 2C4KA 1TC2A 2R5NA 3LDGA 4FGJA 1Z12A 2WG2A 4HADA 3ZJ4A 1NE7A 1MGPA 4Y0VA 1YKFA 5KYWB 2H4YA 4EKIA 3BQ9A 3E22B 3LO5A 4RABA 3PXDA 5FWYA 3AR4A 3QUBA 2XNSA 1LRKA 1NY6A 4B3BA 4BYMA 3WBKA 1SIOA 5B3JC 4JI6B 1K6JA 5IVHA 4WN9A 2BFWA 2OHVA 2GZMA 4M1TA 3IAM6 4MVYA 5KNBH 5EIXA 2IU4A 1QS0A 1L7BA 3ENNA 3IIJA 3M49A 1HF3A 3KSZO 5JARA 2ZR7A 4C6HA 2WIAA 4XQCA 5CNJA 5FQNA 3UJ8A 3Q5DA 1KY5A 5CX1B 1T3SA 1E8NA 2PWZA 2WPDD 3LYAA 1Q57A 1WMBA 1XRRA 3OCXA 3FDIA 3T9BA 3VX3A 3ZX5A 2A2ZA 2IKQA 2ISQA 2J32A 2Q5CA 3PF9A 3QX9A 4IXNA 3Q8LA 1EFVB 2OCBA 3HHEA 1E0KA 4TUYF 4EPVA 3DA8A 1TYEB 2QY6A 4Q1DA 4Q6BA 2FDRA 4BL5A 1KNQA 3NJRA 4FYMA 1Z6TA 3PPYA 3QOXA 1BS2A 2HSGA 3TWOA 3VHXB 2QUJA 2GCIA 3RFVA 1PR4A 2IVZA 2BKUA 1RS0A 4JJ6A 1JHAA 2HCFA 4KVZA 2BEJA 4NCIA 1JQKA 4BGEA 2K6GA 2DECA 3HY3A 2BCEA 2C5FA 1QHIA 3NH6A 2BMEA 2W2QA 1I7NA 4OSOA 1O9GA 1XZJA 3E53A 1RT9A 1HDXA 1S8OA 3DJFA 4UNPA 3N8GA 2CHGA 4OL0A 4RD6A 4ND8B 5E6UA 3WAJA 2R48A 2ON6A 4KRXA 4FR2A 4OXQA 1CB7A 1DT3A 3PV0A 3IRUA 5HOEA 5I51A 3P9XA 1U1FA 2WU8A 3L7IA 4CM7A 2VDRB 3TG2A 5DNVA 1QFXA 1YDEA 3GC6A 5JCJD 1BE8A 4JK3A 3K09C 3HB0A 3K1YA 2HIHA 1I1OA 1VL2A 3O0TA 4JLMA 4M7OA 4ZQCB 3WXMA 1XRJA 1BMDA 2ODQA 3QFSA 1V3TA 2QDKA 1HE3A 1KP3A 3IALA 4G85A 3WL4A 1UT8A 1E2KA 1QQ7A 1SHUX 2N42A 1SBHA 2QU8A 4IXMA 3ROMA 4D0RA 2SECE 3DNFA 3I2YX 1KDPA 1I7LA 5ELLA 4A82A 1MOZA 3PKJA 4XVHA 4EEKA 4RTPA 4KPEC 3ODGA 3TRKA 4MS3B 2VRCA 3D8RA 2XUIA 3UG7A 2EKQA 1V8ZA 3GROA 4M0UA 3R3UA 4QYIA 3ON5A 2QYOA 3WFZA 3DYIA 1GPBA 3DCNA 1QGED 3NVDA 2EZ9A 4PRKA 3WLOA 2C0PA 4ARVA 4HWGA 4YXWA 3UQZA 5IJ9B 4ABTA 2I29A 2GRJA 2W2KB 4Q4CA 5ICSA 1TA9A 3C97A 3L6CA 1GGMA 5IAKA 1EIZA 2W58A 4FD3A 3T5BA 2X41A 1XT6A 3CONA 1XA3A 2H51A 2Q8NA 4IBOA 1JH9A 4F1KA 3QU7A 3P9ZA 2BFCA 1LJ8A 4B4VA 5CLFA 1XAGA 3RSOA 5CYOA 1X15A 3L49A 3BT7A 5BUQA 4IQFA 2IV2X 1YZ3A 2V3CC 4D3ZA 5TR9A 2I1LA 2FPKA 2FRXA 3CA8A 3CWZA 1RWBA 3LWBA 5AOCA 1O97C 1PLLA 1W87A 3ZDQA 4M8LA 2NSHA 3DQQA 4A8JA 4BWVA 5EIEA 3DWIA 2CLKB 3HJCA 2HQOA 5A9SA 2BGNA 4EI7A 3SEQA 4LV5B 3K35A 1X7YB 4NE7A 4AKIA 1EUDB 3HSYA 1SY7A 5EUQB 4DSOA 1NUUA 3PHBE 1K97A 1DV2A 3AY0A 2W9XA 4LG1A 4YCBA 3G5TA 1V4NA 1OGYA 4C7OB 2Z95A 3AHIA 2GPJA 1L8AA 2J31A 3JAKA 3QLUC 1JUDA 3F74A 4UW9A 5F98A 1DJMA 3Q6NA 1LTKA 2XNHA 4IJWA 1D0SA 1UDWA 2A14A 2ZUTA 1SQ0A 1UQUA 4E94A 4JXKA 2GETA 3LPMA 1WX1A 2FRVA 4YALA 2PH1A 1H22A 1IUPA 4TYPA 4X93A 3KALA 4C6SA 5AD1A 4A0RA 1L7AA 3UNXA 2WV7A 3EIHA 5EXSA 4YHHB 4RVCA 4G8CA 2F48A 4H2DA 4EY5A 3QXJA 1FMFA 2GZ3A 3CNHA 3UY4A 5A7FA 4FIZA 4A6XA 2XRMA 4TS1A 1GEGA 4BNXA 3NIWA 5KJ1A 4B4DA 4DV5B 1YF3A 3DMYA 3VUEA 1BXGB 3ETLA 1A5BB 1AB6A 2G72A 3GF4A 2OSVA 2IU0A 4BNHA 4W63A 1F8UA 1WB6A 4GU5A 1LK0A 4TKUB 1U9JA 4QOGA 1MB4A 3PE3A 2UKDA 2QT0A 2PBZA 5JEDA 2RG1A 3FPJA 3PXCX 3J81k 4KHPB 1A4IA 1W34A 1FMJA 4MVJH 5ICMA 1ZN7A 2BR5A 5K0SA 2PZKA 2ZUCA 4L5JA 1GNSA 1Y82A 3I34X 4ZQHA 1PTJC 4A0FA 3N07A 5K03A 4GEGA 1OTHA 4KTTE 2FLWA 3N5CA 3DD1A 1G9SA 3UWKA 5ELXA 2X1MA 1ECBA 2ZULA 1C3XA 2AQIA 3U9SA 5M29A 4HSGA 4OXIA 4CG2A 2FMHA 5JD5A 4P0PB 2VDLB 4BCDA 1NZFA 1OKKD 3EVAA 3ZNOA 2ZUEA 2VC2B 2E4WA 3FBGA 3VV2A 5JSZA 1L4MA 4KU4A