4Z9AA

Crystal structure of low molecular weight protein tyrosine phosphatase isoform a complexed with phenylmethanesulfonic acid
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z9aA00
3OLWA 5JNVA 4H3HB 5IULC 1JFTA 3QX8A 4MR7B 2FQWA 2ID7A 4OLAA 1QO0D 1HEYA 1MB3A 3D8UA 4IILA 3RVQA 2WMYA 1W25A 6CHYA 1PEAA 3C3KA 3H5VA 3N53A 3HXMA 1FFGA 3R0JA 1EWKA 5IUNC 5KQGA 3CU5A 4OG2A 4G0YA 2LUOA 2NUBA 3QEKA 3QLVA 3SG0A 5ABPA 1RZRA 1DP4A 4MS4B 2HQOA 3T95A 1A0OA 9ABPA 1K68A 1GUBA 1Z13A 2ZAYA 4G0ZA 1ZESA 2FW0A 3IP5A 1M5UA 1LJUA 3O2QB 1BDJA 3HV2A 4MR9A 3M6MD 4G86A 1EHCA 5JNSA 5EWJB 4O5AA 3IP6A 1GUDA 1TM2A 2PAFA 3ILYA 7ABPA 3A3KA 4D6YA 3QELA 2XDYA 3HO1A 2FN8A 2QVGA 1YMUA 4ML3A 2NT3A 3EGCA 3F6PA 4G0QA 1L5ZA 1C0EA 4YWHA 3GV0A 5IEBA 2FEKA 4ZMSA 1QQAA 4Z4CA 4RXMA 1PNTA 4RY0A 4M88A 3H5WA 4EYQA 3H5IA 3L6UA 3O1IC 1YVUA 3H75A 3KJXA 5JNWA 5E3JA 4MLDA 1Z2DA 1F51E 2MYPA 2IPLA 3CRNA 1LBIA 2HQRA 2FMHA 4GNRA 4MGEA 5IBQA 1EAYA 3JPYA 4KZKA 1SD5A 2RGYA 4TLMB 4EUKA 3H6GA 1GCGA 2HJ9A 1XHFA 1Z12A 3CG4A 4KMRA 5CNKA 4YGXB 2RDMA 3LUAA 3IPAA 4IMIB 4ZMRA 3QLVC 5DLEA 4XASA 2FQXA 4YO7A 3QX9A 5TPWA 1TVMA 2L19A 3DZDA 3UK0A 4YR7A 1TJYA 1Z17A 1ZDMA 2JVIA 4MS1B 5I4CA 1QP4A 4PICA 1OXKB 5FBKA 3LMKA 3O75A 5ED4A 4UHKA 5KC9A 1APBA 3GBVA 2PE5A 3H1EA 1AB5A 2P9HA 3HM9A 2GKGA 3O1JC 4MRMB 1JYEA 4HNSA 4ZJPA 3D02A 5KQLA 4LX8A 4RWEA 2VYCA 3HDVA 2L17A 3EDCA 3BRSA 4KQ9A 3S99A 4MR8A 3LKVA 2IPAB 1D2AA 1D4ZA 3L49A 1D1PA 4QICA 3HCWA 1L5YA 3H5TA 3RVRA 4Z0NA 4MRMA 1Z18A 2GX6A 2IDMA 3UUGA 2V0NA 3RVSA 5FBHA 1RXIA 1QQBA 2IOYA 3RVJA 2FLKA 3MF4A 5HSGA 1QP0A 5HM6A 3OQMA 2PUFA 2JRLA 3CZCA 2PUEA 4D6XA 4S04A 2LPMA 1BA2A 3CLKA 5DCLA 2IYNA 4LZLA 1BAPA 4MQFB 1VRVA 5BRJA 1GLGA 3HUTA 4KK4A 4MYRA 4XLTA 1NXXA 4KV7A 4EVQA 4XAQA 3KTOA 3RVPA 4UHJA 3Q7SA 3T38A 1LK0A 4RXTA 4Z9BA 2FLWA 2WY2D 5JS2A 1TMYA 2R47A 3H5OA 2PL1A 3DBIA 4RK7A 2QW1A 4P98A 2A9QA 2E4XA 4N0QA 1JL3A 3OLVA 2GI4A 2LP4Y 1JDNA 1M2EA 1U2PA 5BQ3A 3MYYA 1AB6A 4NCBA 3W9SA 5TPZD 3HS3A 1VLZA 1W9HA 1Z16A 3LUCA 1DCKA 4MS4A 4EGSA 3QLUA 4N76A 4ZPJA 3CS3A 3FFWA 3N0XA 5KQPA 4Z4IA 2PL9A 4F11A 2FEPA 2NZUG 3HZHA 1VKRA 3I45A 3N0RA 4W5TA 1SRRA 1FSPA 2PUDA 3MM4A 3EAFA 1DRKA 3T6KA 1ZH2A 4FB4A 4W5RA 3QK7A 1D1QA 3H5LA 5IX8A 3CFYA 3OQOA 3FMVA 3A10A 1YS6A 2E4UA 2PUBA 3KCNA 1Z25A 3M9XA 3QEMB 3SY8A 3VNAA 3LOPA 2E4WA 3GA5A 5CNMA 4GPAA 5IUKC 4RZSA 1Z26A 2QVCA 2FMKA 2MYTA 2X7XA 3LUKA 5TQ2B 4YS6A 3OO0A 3OLYA 4H60A 2JBAB 4G0XA 5TQJA 3DGEC 5T7BA 3HJFA 1YMVA 4DN6A 5JNUA 5FWYB 4RK6A 1JF8A 1ZITA 1SXIA 4RY8A 3GYBA 4ETIA 3MA0A 1Z15A 1U2QA 3NBMA 3GL9A 1QP7A 3BBLA 2FTKE 5FWXA 3JTEA 4MAAA 1D5WA 2FMIA 2NT4A 1ZGZA 3GBPA 5PNTA 3TO5A 3K9CA 1KRWA 3SAJA 1JX6A 1NTRA 1M2FA 4O1HA 1DCFA 4YRZA 2L18A 1SXHA 4F3TA 2VUIB 1ABFA 1ISRA 1ZH4A 4G0OA 3OLXA 1E2BA 3JS5A 4QYMA 3HVRA 3SQNA 5DTEA 2Q5CA 2PJUA 3CNBA 3ROTA 1ZN2A 2WWVD 1JHZA 1MB0A 4N41A 3EQZA 3M9WA 4MQEB 3LUFA 1DG9A 3CHYA 4B09A 3B2NA 5C5CA 4YCSA 3LUGA 3HEBA 2QZJA 2FSPA 3F6CA 1QPZA 2CD7A 3MIZA 1NXTA 1U8TA 2HQBA 3QLTA 4PZ0A 1LBHA 1FQWA 2AYZA 4WZZA 3BILA 3FDFA 2IPMA 2MSLA 3HUUA 3LFTA 3O1HB 1E6KA 2YHBA 2WJWA 1USGA 4RS3A 3VNBA 2PUGA 1F4VA 2I6FA 1DBPA 5EWMA 1R8JA 3DLHA 1OXBB 3RH0A 1USIA 1VPWA 3MMNA 4MR9B 4IF4A 4RV5A 4WUTA 4W5NA 1DJMA 3LUJA 1PHRA 2OENG 2QSJA 2WB4A 5KC8A 1NXPA 4EVRA 4PE5B 1MAVA 1FFSA 1PEYA 2OQRA 3QLUC 4EY3A 4W5OA 4MQEA 3O74A 4Q7EA 1WETA 3KG2A 4EVSA 1YK1A 2E4VA 4PYRA 4DADA 4OTZA 4RKRA 4JOQA 4EYGA 4L85A 1YS7A 3OLZA 3Q7TA 3TD9A 4PEVA 3IP9A 2LBPA 4NCAA 4NQRA 3OM1A 4MR7A 4Z4HA 4Z4FA 5JS1A 1QMPA 4JASB 3O21A 1P6UA 5CNIA 4Z99A 5FWYA 1DRJA 3I5AA 1ABEA 2A9PA 2AYXA 2F8TA 2JBAA 1DBQA 3CG0A 4LRQA 2FVYA 2HSGA 5C5EA 5TQ2A 2R48A 1PNRA 3BRQA 4N47A 4QYWA 4E7OA 1JWLA 1RNLA 3KLOA 1I3CA 2FXIA 2GBPA 4TN5A 2M1ZA 3ILHA 3FFTA 1U0SY 3QEMA 4JAVC 5BRAA 3NHZA 3G1WA 6ABPA 2VUHB 4IRXA 2CWDA 4MLCA 2RJNA 3JPWA 1ZAYA 1H9CA 3RQIA 4OLBA 5TQ0A 2FQYA 5IUJC 5DGCA 1DBWA 4EYOA 3G85A 3LUHA 1BVHA 2B1JA 1KMIY 3TX6A 3ROFA 1RXEA 3I42A 4KPYA 1IIBA 4WXEA 1YK0A 2FMFA 4L4UA 8ABPA 1EWTA 1P6QA 3EJWA 4RK0A 4RY9A 3SNKA 2RJOA 2TMYA 4KK3A 4OBBA 3P9YA 5HQJA 4FE4A 4JP1A 2QV0A 2ZWMA 1DCMA 2MSKA 4G0MA 4HNRA 4KVFA 4F12A 1JLKA 1SXGA 3GT7A 4KQCA 1E6MA 2LIVA 4N03A 4XARA 3EULA 3JY6A 1NATA 1P2FA 1QKKA 1JFVA 4WWHA 1EFAA 5CHYA 3GWGA 4YP9A 3GRCA 3QELB 4Z4EA 2MYUA 3LUDA 3EQ2A 1DC7A 3KS9A 4JB0A 5EWJA 2PMCA 4OATA 1CYEA 2QR3A 2F8SA 4RK5A 5GQSA 3FFXA 4XXHA 4ZYLA 5TQ0B 1XHEA 5IEJA 2JCGA 1P8AA 4Q6WA 5KWSA 1BDIA 2CHFA 3Q15C 1KRXA 5TE9A 2FKAA 2JK1A 5HKOA 2MYNA 3C97A 3C3MA 3HDGA 2B4AA 4RK1A 2J48A 3NNNA 1BDHA 4RXUA 1JYFA 1M5TA 1S8NA 3E3MA 1LJLA 5BR1A 3E61A 4RU1A 4E7PA 4NV3A 3H1FA 3C6QA 4Y9TA 4WXMA 4KNYA 2E4ZA 2MSWA 4IMJB 2H0AA 3JVDA 1CEYA 2L2QA 3Q9SA 4H3KB 4MPTA 5EWLA 4DQDA 4LE2A 1T34A 3OO1A 1U04A 1E6LA 1ZGGA 1FFWA 1CHNA 1QNLA 1J56A 5KQMA 3NHMA 1MVOA 2M98A 1RPJA 3RVOA 4W5QA 3NNSA 2H3HA 3EODA 3JVIA 4RDCA 4KREA 2KYRA 2HPHA 4MR8B 4O1IA 1Z2EA 3URMA 4Z9AA 2IKSA 4YLEA 2JB9A 5TPWB 3SM9A 3OMXA 4RK4A 1USKA 4MS3A 3A0RB 4HNQA 4WT7A 3N8IA 3O2SB 1NY5A 1NXVA 1TLFA 2JVKA 5JNRA 3KYJB 4G97A 2E4YA 5KI6A 3Q41A 1URPA 3KYIB 1PUXA 4FE7A 3OMWA 4KFCA 4RSMA 1C4WA 5JNTA 3F73A 4MS1A 4D74A 1JBEA 4G0PA 5DKFA 1ZY2A 5IC5A 3DLBA 4KRFA 4ETNA 1XWWA 5EWMB 4HYEA 2CHEA 5TPZA 3HSYA 2NZVG 2JVJA 1A04A 3N6VA 3O2JA 2PUAA 4RKQA 2WJAA 3CKMA 1K66A 4TLLB 2QU7A 4TMYA 2FN9A 3LKBA 1ZHHA 3TB6A 1YIOA 4YV7A 3N0WA 2QXYA 4LE1A 3FGZA 3KLNA 1JH9A 1GCAA 1NXOA 1JDPA 2A9OA 3UKJA 4P1ZA 3HK2A 4NICA 3F7NA 2PKXA 4F8JA 4LDAA 3OM0A 4CBVA 2FEWB 4N0PA 2VK2A 1EWVA 3C3WA 3CZ5A 1UDRA 3K4HA 3MQ4A 4LE0A 4MQFA 4Z4GA 1DZ3A 3RVLA 2PUCA 4F06A 4S05A 3H1GA 3NNDA 3KSMA 1YTUA 4LDZA 4ETMA 2A9RA 3KKEA 3N75A 3RVMA 1ZVVA 3A0UA 4Q6BA 1ISSA 1DC8A 3RVKA 3I09A 2W42A 5CNJA 3CTPA 1NXWA 1KGSA 1QO0A 2DRIA 2YHAA 4MS3B 4EYKA 2R4QA 4JB2A 2PLNA 2R25B 4QPJC 3TMYA 2N9UA 2GWRA 1B00A 1MIHA 5D2CA 1A2OA 1NXSA 2IPNA 2P4UA 1JFSA 2WRZA 2O20A 3OQNA 3H6HA 3IPCA 5GOTA 5F64A 5B3JA 1RZRD 2BGGA 3KHTA 3LTEA 1Y1LA 5B3JC 2ID9A 3BREA 3IP7A 5EWLB 5FWXB 3DGFC 4XFKA 5T3YA 3T8YA 4JA2A 4IGAA 3Q7RA 3RVNA 3IDOA
chains in the Genus database with same CATH superfamily
1VDMA 1HQYE 3ZW7A 1MJGM 3KBBA 2CD9A 5IULC 3SHWA 2XXAA 1JFTA 3AM5A 1IG3A 2FJPA 1O5OA 2V1XA 2Y1XA 4N6NA 2NTJA 4S1WA 2IU3A 5EMLA 1KAQA 1XTZA 1EE2A 4D4KA 3FBGA 1W1WA 1VB5A 2XMPA 1S2MA 1JXAA 3O7MA 1MB3A 2WMDA 3ESQA 3OC6A 4WW0A 1KJQA 1Z07A 2D1FA 3VDMA 2PKYX 2CXOA 5FXMA 4QBGB 3HXMA 3L06A 4MEJA 5ULLA 1X1SA 3KXPA 4GKVA 1GZUA 3IQZA 3HYTA 5EI5A 2OESA 2RHDA 2Z95A 5T6MA 2J1LA 1UBGA 1W88B 1FNCA 4DA7A 4FDVA 1H6CA 1WXXA 4QQFA 4ZOLB 4CCSA 6GPBA 4JR1A 5K99A 4KVZA 3HJHA 3ZK7A 5BQXA 3DE6X 5AW5A 3WJ1A 2BCJQ 3UOWA 4Y0VA 1M5UA 1N7JA 4PHFA 1NVTA 4G23A 4PTLA 1G5RA 4PO3X 1QCDA 1GTL1 2ZYHA 2EGUA 5F9MA 3TS1A 7ABPA 2CNKA 4EJSC 3UUFA 3HCDA 2OHJA 4ML3A 1J42A 3CUYA 2PUTA 3PEYA 1E4YA 3FD8A 4F97A 2HMVA 4R3NA 3G13A 2HF2A 4RD0A 5AVRA 3EDMA 4JT4A 4NAUA 3TBHA 4R0NA 1B1CA 5BQ5A 2CVFA 3ZNNA 1ADBA 1PL8A 2UXCB 3Q8LA 2RH4A 1Q7TA 3O9ZA 3N6RA 4QIHA 1WZ2A 2ZQZA 3NXSA 4R71A 1KSJA 1VIMA 4DE5A 2G1AA 1QIFA 3JZFA 1SA0B 5LBUA 4YCLA 2WLSA 1O97D 1PYGA 5IBQA 3UKDA 4EQ6B 1OPRA 5DF1A 1FDTA 4S2UA 2RGYA 5IDWA 5FKJA 1ZJWA 1SUWA 4U7JA 5JJBA 2IIVA 4UUAA 1EDOA 2IYYA 4U4AA 5D84A 2O7SA 2IP1A 4R69A 1UXGA 3B9BA 2WFLB 4F71A 1SBCA 4BN5A 5CA1B 1B3BA 4MV9A 3LUAA 5DXAA 4B4UA 4ZMRA 5B58C 4RCZA 1GIAA 3WHPA 4FUTA 1NDHA 4A0QA 3ORHA 1V9LA 5L6MB 5TMPA 4GQIA 1QR6A 1SVLA 2VXCA 1RFLA 4H2DA 2BMFA 4E1AA 5CFLA 2BE9A 3EIQA 1QFXA 4B0OA 3O75A 3NMUF 3RFUA 4CKCB 3UA3A 1TGYA 3RSSA 4XYBA 3ZWKA 1N0WA 4BXOA 5CDSA 3G3EA 3K05A 4URWR 3RUDA 1JE0A 3BCUA 1XRJA 3JQGB 3SEAA 3PIIA 1T91A 2QW8A 1SXJB 1C3OB 1KXZA 2ZWOA 3BMOB 2C3MA 2V3WA 2P91A 1FMCA 3ZY4A 3TIXB 2AKEA 1MIOA 1D1PA 2WU1A 4ZALA 4Q66C 4B3TB 2DHRA 3QNWA 3RVRA 2Q3BA 2IDMA 5DHFA 3WY9A 3PE6A 5KJ1A 3W2IA 5CA1F 1U4NA 3H7IA 4G5HA 4PTYA 3SR0A 2ZR8A 4LMPA 3H83A 4FB5A 4DDHA 4RSRA 2PUEA 1SPBS 2X0KA 2X1MA 4CQLB 4YMGA 1ILWA 4MQFB 3C85A 4W1RA 4X6LA 2Q1TA 1VPVA 1YQQA 1W9MA 5HZGA 4D9HA 4XAQA 1Y6QA 3WGIA 1R6TA 4YT4A 5CA1A 4GI2A 3JSAA 3TTUA 3BL5A 4P9NA 5F76A 2AW3A 4TV9B 3SJZA 4CVNA 2RHTA 1ZK3A 3NC4A 3TN7A 1TMYA 3H1TA 4J1TC 3QVXA 2YHUA 4DJFC 1E9RA 1NRWA 3VBEA 2YC2C 5L3QA 3GI1A 3M5DA 1Q0SA 2QXTA 3A9CA 1TT5B 5FWNA 4JEIA 3B36A 4XWGA 4A16A 4LCJA 4CV0A 2DLNA 2QF7A 1SFRA 3ZE8A 3NIDB 4LAFA 5KQPA 4Y18A 4BLQA 2VCEA 1G38A 1U9CA 3N0RA 3AMVA 4DNXA 2WFZA 3TQCA 5ESDA 1B26A 1LDGA 1J21A 1VQ1A 3T4XA 3HCFA 2CHQA 3HDTA 2Y99A 4M8SA 4G56A 5BNWA 1A5AB 1KEUA 2GK3A 1W96A 1WCYA 3ORRA 4D43A 2QM8A 4NCJA 4PANA 3RT7A 4BC0A 1QRDA 3IVAA 3ZVLA 3OQOA 5L51A 2SHKA 2RI1A 4PYIA 3ACDA 2D5CA 1KAMA 4OHVA 1BH6A 1GGMA 1CQIA 1OR8A 1X9GA 3Q72A 3GA5A 5F35A 3DW1X 1SQ5A 2YWEA 3CWZA 2FMKA 2RHWA 2Q3DA 3MMZA 4H3SA 3NDIA 4OQDA 1PR0A 2CCKA 4YS6A 4EIWA 3T1HB 3ZUPA 4FYHA 5M5BA 5J3JA 1Z62A 1YB1A 1DUVG 3UNXA 1MW8X 1HEIA 5BXYA 5LNK1 4UZEA 3U4QA 2BOVA 5D86A 3JYLA 5AJVB 4KR2A 4PPNA 3U7QA 1X42A 1U2QA 5LD2B 3BBLA 3EQ8A 5E0OA 4YRIA 3NBFA 1LY1A 2XUPA 4DCUA 3HDJA 1P3DA 5EC8A 2W8BB 5EP4A 1C3XA 2X0NA 4GM0A 4CODB 2HCBA 1QXSA 1V45E 1T1SA 3Q6IA 1VL0A 4C6RA 2ZUFA 4M22A 1YKSA 3WV5A 3ES9A 4BVGA 4GGPA 1D1TA 4X1KA 4GW3A 3HVRA 2B78A 2PJZA 3AFMA 5HFJA 3SE7A 3SQNA 2WM9B 3GW8A 5JCOA 3ROTA 1ZN2A 2C5FA 1XU9A 1CEQA 3GRFA 4EZBA 2RI6A 2HNBA 1KI8A 1FDUA 3WNZA 4H0CA 3NKVA 1XZNA 2A84A 2ZW9A 1C8VB 3GEPA 4IDPA 1OT5A 3ER6A 4MHSA 4OMFG 4KFTA 2IBSA 5C1IA 2IC5A 3QLJA 4RTQA 1FFDA 1XT6A 1ZK2A 2BKXA 3I72A 1LBHA 2IFTA 1G60A 3V8NA 3BILA 5M3BA 3PSAA 4BWGA 2W37A 2V98A 1G7TA 4EB3A 3E7XA 3WGKA 1IK4A 1SBQA 2YJZA 4CEJA 3PFIA 4B3SB 3U4HA 1A2KC 1QVRA 1E77A 1TI7A 3PKJA 4NHOA 5I8PA 4QYSA 1WUIS 1XRMA 3FUVA 2OLJA 4HDOB 3ZGLA 5KTOA 2VAMA 4JGGA 2ISCA 3NHBA 1JDTA 3IRVA 3MGBA 4XQEA 4JENA 5J5CA 4ARAA 1YJBA 4BGUA 4WZAA 1V26A 3FDZA 5IJWA 3QSYA 1FS4A 1YQGA 2ZUVA 2JJYA 1DE0A 1G66A 2XUAA 1FUYB 4KIJA 1N34B 2PKRA 2XRFA 4UHCA 2V58A 3R7WA 1XD2A 3H5NA 1P19A 1DOAA 1QFYA 1V8BA 1Z6GA 3DMRA 1MC1A 3FVVA 4LDNA 3O74A 1ZEMA 4NFYA 2QT1A 5IJZA 4EYEA 2QE6A 4IR7A 1SVSA 1SKUA 1KSGA 4FW9A 4H9GA 4RF5A 3UMJA 4ZKDA 1W2HA 4FSDA 1EDDA 4B3MB 1ZYUA 5CLLA 3LF1A 1O9HA 1D03A 5DEIA 3ZZNA 4NP6A 1KMHA 2FFJA 5FFMA 4Q1EA 5EQTA 1TTQB 1UBNA 3L0IB 4H6VA 3VZCA 4EGFA 4FWTA 4CCYB 2ZBUA 4HLUC 4OM8A 3SEFA 5DBIA 5JO9A 3LQYA 2FW9A 2NPOA 3TK1A 5GZ1A 3S81A 4M0LA 3R5HA 4R1OA 1J00A 4YJGB 4HDAA 2PLFA 2FVYA 5BV8A 4GDFA 3KVNA 4AU1A 2QORA 4WASA 4N47A 4HEA1 1HT2E 4BOYA 2E5LB 1Q21A 1Y1KE 2PN1A 5KQSA 1V6SA 2M1ZA 3ETGA 1PJ2A 5EA2A 3WMGA 1JEYB 1C8LA 2D1SA 2WWTA 3GF4A 2QBYB 1E1RD 1WXFA 1DX9A 1T9BA 1EK0A 3KFXA 4WLVA 4R6WA 2GXQA 3V80A 4M8KA 2Q1WA 2YYAA 3KWJA 3NGMA 1E9DA 3QW4B 2V7QA 1DQNA 2GBIA 3B51X 3OURA 4BAUA 5JQGB 2AFHE 5LR6A 1E2EA 1GD1O 4ZVQA 2YV2A 5THKA 5TMEA 1H4SA 5KPJA 2ZREA 3ZCRA 4RTOA 1K6XA 4R8RA 5K0NA 4IM7A 4LJLA 2GAIA 4LF9B 3W3AA 3GLKA 1BKDR 2C3PA 5AH0A 2GDZA 3ELWA 4B4OA 3FOAA 2ZSUA 5LP6C 4DRXA 4RK0A 5A7FA 3CN7A 1YA8A 4RVUA 3OOHA 1L7RA 4KSBA 3D5TA 3E3OA 2EW1A 2A3RA 2J3LA 3I9LA 3MZ0A 4EO9A 2I1VB 4IF6A 5IYZA 1P6XA 2O52A 4IHJF 4BY9E 3H04A 4I99A 4TYWA 3GIWA 5EPUA 4UDOA 3L1KA 2CDNA 2QM3A 3ZG6A 1JFVA 3AP3A 4FGWA 1EFAA 3Q5EA 3OIFA 2H06A 2X8BA 2G72A 4M1TA 3HJAA 4TLBA 3ROEA 2AOUB 2BKAA 2NVWA 2Z8XA 3SR3A 4HQRA 4RD2A 4UCWA 4PQGA 1RBQA 3WB1A 4CFYA 4TV8F 5KMGB 4J0KA 2O5VA 2FSSA 5EN4A 2VYQA 1T5BA 3MJSA 1NQOA 2FHPA 2HT1A 3MWGA 3OCYA 1RAGA 1CJMA 1FP1D 2BMJA 5AI8A 3ZDQA 3D54D 1IHXA 1PZNA 3BKWA 2E49A 3AXTA 4KO4S 2VR1A 4ND8A 1HG1A 5DM4A 4EUHA 3SF0A 5A4MS 5IEJA 3NUGA 3WK9A 2SKEA 1OCEA 1XAIA 2RK4A 5A05A 3ZY6A 4BL5A 4CL0A 2KB0A 1XTTA 3ENWA 3QU2A 1RI1A 4MMXB 3KFLA 2JAHA 3R09A 3GLIA 2ZJ0A 1Q77A 4PQFA 4CLOA 1US8A 2PUJA 3FB4A 4GXRA 3SHVA 1M5TA 1S8NA 3IE2A 3NOOA 4PHHA 1DNPA 2CFSA 2O4CA 1UDCA 2PX8A 2G67A 1YR7A 2I4IA 1E2DA 2TECE 2W2NA 3EXHA 3OZXA 4DR2B 3OFJA 3IT2A 4EZEA 2EKDA 3AOEA 3AEUA 3R9KA 5BWNA 1BN6A 2CJXA 2R8EA 1QGUA 4JJGA 1ZD9A 3VU9B 3TINA 2WR8A 3OZRA 1LI7A 3A9VA 3DT8A 3N07A 4KO2S 1N2JA 3A4VA 3KB6A 3QIVA 4MPTA 4NYJQ 4Y0NA 5TC4A 5K3OA 5KNDA 5GIOE 4D41A 1OH6A 1T34A 4R68A 4E5VA 2WUVA 2I80A 2OZLA 2VJLA 5LA6B 1OA0A 3FRJA 2DWPA 1HH4A 3DKVA 1W85A 1EEXB 4O4HF 2VXYA 3KJGA 1BD3A 4RDCA 5KOIA 3FWYA 3I34X 2I87A 4E03A 4BFTA 2WZQA 3WTCA 2OHOA 3UXHA 4QOEA 1TCBA 3EXHB 1YT5A 1UMCA 3OMXA 2BWJA 1G55A 3A0RB 4FPXA 5CFPA 2V65A 1MH9A 5CITA 1OIWA 3KC2A 2VT2A 1NY5A 4MH0R 2HWKA 5T5QA 3VDNB 1IMOA 1I1NA 4FYWA 4X3CA 1PUXA 4KFCA 3U44B 4ZI7F 3HKBA 3JWEA 4ZO8A 2GJ8A 1C4WA 1KY2A 1U7UA 3WDSA 4DNFA 8ATCA 2CUTA 3ZV4A 2YHIA 5K8UA 1IPHA 2IZZA 4PWYA 4C0KA 3AV3A 5DKFA 4YASA 2XAAA 1WMAA 2BI4A 3PUKA 3KKQA 4M4SA 4BVJA 5BW8A 3EGEA 1CDZA 3M83A 2CHEA 4HYEA 3EWNA 5D6OA 5DHQA 1Z3CA 3ZDYB 3PTLA 1VE1A 1GGEA 1V7PC 3M6XA 3PA8A 5CLIA 1N78A 4AKGA 2R00C 1JAXA 4N4AA 4Y1FA 5DNDA 5C81A 4U8GA 4EA7A 5KIAA 1SB8A 2OR3A 5KTRA 3QBTA 1OKKA 4QUKA 4ICIA 5FORA 3CVJA 3LKBA 3EBPA 4PLCA 1TEVA 2JD0A 3QE4A 3TSWA 5C3MA 5LQRA 2DULA 4HWTA 3S28A 1X7WB 3LPDA 3EXFA 2X3UA 3N0VA 4LE1A 2DYKA 1X7XA 1YACA 1PV4A 3A36A 2LIPA 4KQKA 6AT1A 2BCEA 2FRXA 2PZMA 4MUEA 2IDKA 4JU8A 1EU1A 2P3LA 5A5DA 4DRXB 3MQ4A 4DJAA 4JX9A 1KVUA 1F5SA 1KEWA 1YDHA 3O2NA 4QX6A 3G8YA 5JBIA 3GX1A 4HG2A 4DVGA 4MHOA 2PXXA 2PUCA 4RMGA 3TPZA 4O2AA 3ZCVA 4NMWA 2AN9A 2CZCA 5JG7A 2LKDA 4W4TA 4ZDIA 5K3FA 1FS5A 2Q1SA 3QFHA 1D04A 5IDQA 1EK1A 4JLUA 3QTBA 3W3ZB 3K32A 4E4TA 1K8QA 3D8TA 4MWSA 3O03A 1N6PA 2JLUA 1PJ3A 1XA3A 1KGSA 2ORED 4NZ9A 1DOHA 1EHYA 2B0JA 3FY4A 4O29A 3OEWA 2QX4A 2VNJA 4OEHA 4RW0A 2PLNA 1NLYA 4WLFA 1Z75A 5KVAA 1PJ4A 1J33A 2QUZA 3N8DA 3D6MA 3PFBA 3TMYA 4YRRA 2J46A 5MDHA 4JITA 1MZVA 3DE4X 1K7EB 4RZQA 4Z7NB 1FP4A 1W4RA 2BMDA 3C48A 2CJYA 4NZPA 5BN1A 2IF2A 2QGFA 3H9CA 1C9DB 1MF7A 1V1MB 3BSFA 3OIDA 4TYQA 1U7OA 5GOTA 1F38A 5E2BA 3TSZA 1ODLA 4WLNA 5EJEA 4DSUA 3OTWA 2PGJA 2HA0A 3HDQA 1PSDA 1GXSB 5EHIA 2QRNA 3RVNA 3NAQA 721PA 2VJMB 1V48A 1RI3A 1ICIA 3SS9X 4MA0A 1C9MA 4FYMA 5C32A 1JJFA 2H9AA 3R3ZA 3VMMA 5CIQA 4D3ZA 1DWPA 1R18A 2PDAA 2QTAA 3KXKA 2GLTA 4BN4A 5A9RA 1MJHA 2E89A 1N77A 1SC6A 4CM5A 2PX0A 1KVQA 2P2YA 2XTAA 1JHQA 2PK3A 4KHPB 2B61A 3R0JA 4C6TA 3OWXA 4I9GA 4QC2A 2GJAA 4BV9A 4LHEA 1V11A 5CLHA 4ZFNA 2VQSA 3W8EA 3RIHA 1X2EA 4R31A 4I5FA 4PC7A 3TRKA 3AFHA 3QXJA 5LYJF 2BEVB 2JGJA 3T12A 4TUYF 2ZAYA 3OX4A 1V3TA 4PLGA 4DREA 2XUKA 4B3BA 2XADA 1YI8A 2IYXA 3Q7QA 4J0EA 4RGQA 5EIBD 1ZJ4A 3QELA 1SBIA 3VYVA 4AUEA 5KINB 2VDNB 2NT3A 2VAPA 1K8XB 3ORYA 4B79A 3U5TA 2O57A 1EP3B 3CY6A 3ONDA 4MIYA 4OMDA 3ANNA 4RY0A 1XIVA 4L57A 2JBWA 5FUBA 1Q74A 3T1QA 3SCZA 3RU2A 2F55A 1RLTA 3RFVA 1BQ4A 3OD1A 1EDZA 2YRFA 3Q3JB 2W4MA 4MB6A 3KJXA 4IZ6A 3QI2A 5LOVB 4IKOA 4N5IX 4QEKA 5AM5A 3F3SA 5FTLA 4GM4A 4TTSA 3BEDA 1Y8RA 2JI7A 4Z1MD 2GS9A 2ZVDA 1TJ3A 3GAAA 2JGRA 4C29A 4BFWA 1R8SA 1GCGA 1RT9A 1OGYA 2XD9A 5KCMA 5KO2A 1V5FA 4RQUA 4ACAA 2PBZA 3GJ4A 1M33A 4PC2A 1G6OA 4OHRA 3F98A 3JQ6A 1QIIA 5KHOC 5DLEA 3L8EA 1CRLA 3J7AC 1GRNA 3R7AA 3TRIA 4WY2A 2I8AA 4QO7A 2VJMA 1Q0UA 1HM5A 1YZ3A 1ZM3A 3I04A 1GXSA 1DDGA 2ECQA 2QM7A 3E2PA 1XC7A 4LS3A 2HMYB 4DIMA 4UTXA 5SZIA 4GIBA 3KPVA 1WXIA 5EP2A 3ZS8A 5KU7A 1R6AA 1WB5A 1RHUA 2QAGB 1V71A 4KITB 3HDVA 5AW4A 3EDCA 5MN5A 1R88A 1EUZA 2H2HA 2UYGA 2FPLA 4K5QA 3LKVA 4L4SA 4F2WA 4Y0AA 3GJXC 3T54A 4AZ0B 3KEFA 4P7BA 5CX1B 4KN6A 3L49A 4KRXA 4D57A 2GO1A 2FPKA 4JJFA 2FUNB 1T5SA 3IKMB 3K6SA 3FNIA 2P11A 2NNLD 1K2VN 2YJNA 3QJYA 1TU3A 2XQGA 4JLKA 4Y9UA 3BCSA 2CJWB 1H1DA 3P71T 5HSGA 1FUUA 2QRJA 1Z6ZA 1JMYA 4W9MC 3LXXA 3ZOZA 4K0KB 1Q16A 1IHOA 1ZRNA 1T5LA 1KDOA 4LHZA 4HDMA 1OX4A 3R3JA 4RHTA 4KQMA 4QFDA 4TXNA 4EW6A 1V8FA 4ZCRA 4KPGA 1U1DA 4UHJA 2G07A 2ZRFA 4MQ4A 4UMDA 1YOVB 4B2YA 4CKBA 4CQMD 2XB9A 2WU4A 4RXTA 2A0UA 4LNUB 3VZPA 5AVUA 5KOJB 2FLWA 3CR8A 3EFOA 4BNNA 4H7PA 5G0VA 2R65A 2ZRHA 4ALLA 2R47A 5I9SA 2VWGA 2NU6A 2YJTD 2PL1A 1N2SA 3FPAA 2G6BA 2P65A 2QG6A 3HB9A 1S1CA 1NFRA 1ZKDA 3ANTA 2AFIE 2V54A 3AHJA 4GPIB 4F04A 1CRPA 4ND7A 3RRZA 3FSGD 1JDNA 2H1LA 4G0VA 1AB6A 1IM2A 1XQVA 3AB8A 4EHAA 4HDRA 4YRTA 1QV6A 1O03A 3QLUA 1ND5A 3M6WA 2JBHA 2EP7A 3LUBA 4XRRA 3R3UA 1JA0A 2B1GA 1EGMB 3K8YA 3BIFA 2YINC 4TX1A 1BKSB 4ERXA 3I45A 1NUUA 2J4FA 1YRYE 2GYVA 3TIGA 1GLNA 2BP7B 4KXXA 5IXSA 2NTVA 2UDPA 3E3LA 3EUAA 2BZ0A 3AP1A 1G3UA 2Q41A 3PENA 4BLWA 1P9NA 4F9EA 2CK3A 3FJYA 4AN0A 1SHJA 3B20A 4FCCA 4EVIA 1JTEA 2GRJA 3CFYA 2XRMA 10MHA 4LYFA 2O8CB 3KIPA 1UMCB 1LF5A 4XLLA 1Y34E 1YDGA 1JSCA 2PRJA 3CA8A 4CRWB 4MARA 1TEZA 2WSMA 4M99A 4E11A 3PR1A 1H2XA 4TL7A 2OCPA 1GQFA 1JPNA 4GPAA 1N6OA 5HILA 1LPOA 1WCWA 1XP8A 5IKMA 1FFYA 1KQNA 2D59A 2OL4A 3CUWA 5FFNA 2CVQA 1E8DA 2H2AA 3D7LA 3OLYA 1M6HA 5I7EA 4D42A 3ZGZA 4YJGA 5T7BA 4NH0A 2J9YB 2EKLA 1UJ4A 1N2ZA 2JEOA 3NBZC 4IDQA 4Q03A 4WH0A 4P4NA 4DL9A 2F3QA 4Q34A 3NFRA 4ZVRA 1N33B 3PYLA 1P4AA 3OZDA 1EBFA 2MOKA 3NORA 3OJXA 2BL4A 5IARA 3WQRA 1X0VA 4TKUB 2ENUA 1HDRA 2RGXA 1ZCZA 1HORA 1MEOA 2NT4A 2P9ZA 2Z0MA 3LLMA 4FC7A 4K6MA 1UKYA 5G40A 3UCFA 2XVYA 3WGMA 2GA8A 1OFUA 2QRPA 1HI9A 1SXHA 2L18A 4F3TA 3TL6A 2Z3ZA 4GSKA 4L5JA 4ZVSA 3VDRA 4W63A 4V0QA 2G71A 3GUUA 3UV7A 5CB0A 1IN8A 3C6MA 3EVCA 4TTTS 1L4FA 1N5KA 3BGSA 1Z6XA 2H8KA 4G1EB 3SXPA 1AUVA 3EQZA 1L5LA 1SIWA 3LV8A 2L82A 2Q2OA 3KHKA 5GV7A 2BHSA 3WGTA 1A9QA 3OSUA 5ALLA 3SIXA 3ZZ1A 3KXLA 3O0DA 1BXKA 3ESRA 3T7CA 1DEHA 2BGRA 3RJ9A 4G89A 5JXWA 1U8TA 2B36A 2J5XA 2I7XA 1K5GA 4WXRA 2CYCA 3TLYA 5LXTB 2CXSA 1B43A 1IHUA 2AJ8A 4W7SA 3WFZA 4RY2A 1L4KA 3GEGA 4IJQA 5A4FS 2C7GA 1QG6A 5L4SA 4MRPA 3F3MA 5JYCA 1M74A 5IT9A 1JKFA 4M6WB 4TWIA 3TNYA 3IGFA 1YB6A 2YHSA 4LZJA 3V32A 1QE3A 4UQOA 4YFVA 4LEIA 5T6BA 4DAOA 3VKHA 5KREA 3UHJA 3PDIA 2QL7A 3H11A 3QVOA 4GUDA 5K0LA 1UWLA 3EVAA 1M0EA 2QSZA 3THXA 3SJ7A 2P2NA 5ARCA 5CEFA 1ICEA 1PHRA 2QSJA 2OCAA 2QN2A 4RLFA 2RKBA 4XQGA 2X58A 5JSQA 2ZBDA 1MAVA 3K0KA 1P7ZA 4Y6OA 2ZUWA 2GGSA 1P0CA 1T9GS 2J9RA 1RWPA 2Z98A 3NEPX 3Q5DA 4ND3A 3L7YA 4NZOA 4CT4B 4Q7EA 5JALA 1AKVA 2VZLA 3EG5A 1GTVA 4DQLA 1WU7A 2PMKA 1CTQA 1JYSA 3D4NA 3INRA 2I1WA 1PT6A 2DWCA 2HRDA 5DI9A 4F46A 1XEAA 4ALIA 1O5TA 2GUWA 4IRUB 4EYGA 1U1GA 5FUXA 1K4MA 3BS4A 4AWBA 4TRRA 2GA9A 3QEAZ 1GQRA 2SKCA 2BSQA 2AMFA 1EFHA 3QZUA 5K4AA 5JWOA 4OXNA 3I28A 1W19A 4KE7A 1NNSA 2WLTA 4UJ5A 5LBTA 2Q3MA 1J9GA 1K6IA 1M6YA 5BXQC 1D8AA 1KKMA 3HO8A 1BMFA 4UAJA 1M2NA 2W2LD 1V16A 1ZN9A 2WMOB 1V41E 1W59A 4E2WA 2GXSA 1U3WA 2ZJOA 2OK7A 4OGWA 4CTKA 5B12A 2IZ6A 4HTAA 5IHXA 1P39A 1Q14A 5DT9A 4CCYA 2GD0A 3B60A 3IMFA 1ZN8A 4AKHA 4TN5A 4B6FA 2O7NA 2NADA 2ZJ1A 4PCVA 5DOVA 4WLUA 1L3BA 1S96A 4Q82A 3QE3A 4UM5A 1GU1A 4C6SA 4KWHA 1A72A 1O87A 3A3NA 5EXTA 2ZAGA 1A7JA 4F6LA 2XRYA 3KUUA 4X63A 1MAUA 3O84A 3SDSA 1H9CA 1SQFA 4JEHA 1QHHB 2XGOA 2XIQA 3HPQA 3KRTA 5COAA 5TQ0A 3SDZA 2CXHA 3M3PA 3ANYB 4PZYA 4URFA 2R1TA 4X61A 2WQ6A 2GPJA 2CV1A 2C2ZA 1DIRA 1NVAA 4GP7A 3TX6A 3D7MA 3TXYA 1XEWX 5CB4A 5LOVF 1K88A 2G8LA 4L0DA 5CPFA 1I1OA 4RPLA 4RYDA 4FMPA 1DARA 3SNKA 3CRW1 4OBBA 2JLVA 3TVYA 5I7RA 1IJFA 2CYAA 3S5UA 2ZWMA 4AUMA 3D6NB 4KVFA 3DL4A 2YZNA 4QQRA 2ZJ8A 1LI5A 5B6IA 1EBBA 5HDBB 1JQ3A 3ERCA 5KYYB 5MGBA 3FWKA 1QKKA 4H1WA 5L3QB 4YREA 3FYTA 4LQLA 3NEJA 2JFXA 5ALXA 5I4IA 3HWX1 1FFAA 1UBKS 3BMCB 2VJCA 4P4SB 5HFNA 1ZMBA 4IZHA 2G80A 3SICE 4P38A 4YQZA 1U28A 3CJTA 2FFAA 3GH3A 1KEZA 4ESOA 1S2IA 5LYJB 3IOYA 3DOOA 4BLSA 2P4HX 2NAFA 1NVVR 1F60A 3F90A 2GM5A 2YH2A 3ZUGA 1BKYA 4FGUA 2A1IA 1DPGA 4WECA 4BX0A 5AYVA 4JX8A 2C54A 1QHYA 3TUZC 4YV1A 4RF2A 1BDIA 4EARA 2P9GA 4GYYA 1KZ7B 3O9VA 2VQEB 1ETUA 2WJIA 4MROA 4E08A 4A0SA 3CISA 3MT9A 2NU7B 3A6ZA 3C3MA 3PCRB 5DGHA 5GOZA 4NARA 5FDFA 4LYAA 4YDRA 1CJBA 3CUKA 4Q7KA 3SNHA 1OFTA 3ZY2A 2ZUBA 4AC9A 1K1EA 4C22A 1Z45A 1DXYA 4IG4A 1XPOA 1Q57A 1QHHA 2IYLD 2QTGA 1CFZA 3BH0A 4QDJA 1CE8A 1N5IA 3AOEC 3HH8A 1IOLA 4OQEA 4PYQA 4RA9B 2G1PA 1AUPA 1GSIA 3EXEA 1HNWB 3I53A 3OBIA 3WIEA 2EJUA 1DO0A 1HF3A 3LRXA 1IY0A 1L1QA 2H9IA 4DQDA 4GKKB 4KACA 3ZOKA 3INNA 4OI2A 1ZGGA 1TA0A 4A6DA 4BRWA 4EKYA 5HIJA 5KVVA 4AQ7A 1KJJA 1WS6A 4R1LA 3R76A 3CSDA 1I2ZA 1EZ1A 1ADFA 3V7FA 4BFUA 4UEOA 3JVIA 2X5NA 3ZCUA 5IH7A 5M7EA 4LFCB 3PWKA 3NZEA 1NJ8A 3UAYA 1NMXA 4PFJA 2C77A 4ZT5A 4G1CA 4C03A 4R3UC 2DU8A 1HLGA 3VPAA 4DF3A 3ONFA 3A70A 3P45A 1FBNA 1O9BA 2QJRA 2XQKA 3ASZA 3A6LA 3C8HA 3HM2A 2VZ8A 5BP7A 3ET4A 4XVCA 4M1ZA 2C8KA 1I51A 3HB0A 2FR1A 4PGMA 3QBDA 1VKJA 3DMGA 1XVUA 3IO3A 3VR3D 4ZZ2A 5H81A 3KQNA 4HLNA 5J23A 3W8DA 1YSCA 2GRUA 2QTWB 3WA7A 3JQCA 4R1PA 1MVNA 3UV6A 4YAKA 3D3NA 2HMUA 2P1RA 3EZFA 4K1LA 2IYTA 1J0CA 1HE1C 2YWGA 4DEVA 4DG5A 2FZEA 1EFPA 4P36A 1K66A 2A30A 3KYCA 2FPUA 4UNQA 3WYNA 1U6JA 4TT8A 4OKIA 4E07A 1WV1A 4WJLA 2WHEA 4YA6A 2COEA 1GKKA 3DMFA 4JU9A 2DY1A 3CH6A 4P5EA 3GJTA 2QXYA 4UE6A 1I7QB 3MQFA 1EQAA 2ONYA 2BELA 3LBHA 3V4PB 1T3HA 4HX9A 2IHZA 4OIMA 1G1MA 3VR6A 1J0AA 1VL2A 4F8JA 4QPZA 2YWHA 1R5JA 1QGDA 2NU6B 3UN1A 4ZJUA 2VK2A 1CY8A 4TQ9A 2Q9CA 2QRMA 3S70A 3VVLA 4D5GA 4X3PA 1CYDA 2Q1YA 3R0VA 3NALA 1V47A 1EE1A 1MLDA 2Q2NA 2QD4A 5CIYA 2I33A 4GR5A 2HCTA 1QMGA 1ORWA 1AGYA 1THMA 3HU5A 3N75A 1XTQA 2V6MA 4IOLA 4G5SA 1F8UA 1ZKMA 3EPRA 3U3KA 4LJAA 2DP4E 1FA9A 4A0FA 3B9PA 3CTPA 4F84A 1OLSA 1JLLA 2YW2A 5DNUA 2AZMA 2AEFA 3FTQA 4QT0A 4AYTA 1PX0A 1AOXA 4O4HB 3B52X 5KDDA 4ASUD 1KJZA 1VJCA 1BFUA 1MIHA 1OYYA 3AEYA 2X5XA 1UBRS 1NPTO 1JFSA 1OXSC 1RCUA 5IM5A 2WYVA 2H1OA 3K20A 2PS0A 3O93A 2Y8EA 4DJJA 3JQ8A 1XALA 4NULA 1XZEA 3BHIA 2GB4A 5CX1A 2QSUA 4NMXB 3EWAA 3T8YA 5AWFC 3JYHA 1BYIA 2B2CA 5FA6A 1Y80A 2OBYA 1L6RA 3UFXA 3FVTA 1RIFA 4L6CA 1L7XA 3B82A 2P3QA 1XCBA 2Q6KA 3HA7A 3R77A 1C41A 3DYVA 3OIWA 3GR6A 3VR5D 5TGTA 3C2QA 2BLLA 3R4VA 4FGJA 4KDRA 1PQ4A 4R9VA 2EJWA 4RPJA 5TLSA 2IHYA 4FR0A 3E8SA 1XTSA 4NR0A 3S8MA 4DJ5X 2JA1A 3FKJA 2ZM6B 5IG2A 2DFVA 3M3DA 3Q0TA 2R79A 3U26A 1E2FA 1W25A 4C20A 1X15A 4FZJA 1ZNXA 1ZBQA 5KYGA 1XJQA 1EWKA 4IXNA 3QVJA 1I01A 1TRHA 3WGJA 2B8TA 1SCBA 2NUBA 5F33A 4QWMA 3NAGA 1N0IA 3K4PA 4KVAA 1Q1NA 4FFBA 2AR9A 4WX2B 4IRMA 5DI3B 4EY5A 1RZRA 4NZNA 3SHFA 3PEWA 3C3EA 1T5TA 2FPPB 3DWEX 2BFCB 3KLMX 5EOVA 4DA8A 1JG1A 1RDFA 3DBRA 4OH7A 3TEMA 1KPHA 2PKEA 4XIIA 4O5AA 2GZHA 3IP6A 1VSUA 2FUG1 3TLKA 2EKQA 4Q9HA 3AF5A 4OSEA 4LFAB 1U94A 1UP4A 1T5OA 4O4JB 2PUVA 4G0QA 5CH8A 1ENZA 1SBYA 4PO1A 2ETVA 2DHCA 4J1NA 1U0GA 1Z22A 1FB5A 4QDZA 4ZCMA 2ZUSA 3M9LA 1NW4A 1AQ6A 1LRKA 3HY6A 4X93A 3H0EA 4H17A 4IH9A 2C94A 4N0MA 1Q0PA 4LRYA 1D2GA 2VIIA 3WISA 2O9JA 3ND9A 1T9DA 3AFIA 4TWBA 2OP0A 4XWTA 3I6MA 1SKQA 4L22A 2E1RA 4Q3CA 2C78A 1TB4A 1TVCA 2AKYA 2F00A 2C3YA 3OHSX 4CFSA 1FX0B 4D2IA 4WSOA 2P6PA 3FJOA 4KV9A 1Z4LA 4XUCA 5CXXA 5DHSA 2P79A 2XYPA 3MVEA 3IDSA 2OXCA 4IIJF 5EIOA 4A2QA 4JXJA 2FPMA 4CQMB 4DYDA 3FKSA 1NLZA 4K9RA 1NHGA 2GHQA 1CUIA 3BRCA 3GGDA 1U0FA 3MG9A 2G6TA 3LO8A 4KQEA 3L6EA 2VTEA 4H7KA 3LPLA 5HE8A 2VNIA 4YR7A 4XDHA 2J0SA 4Q9JA 3LOQA 3P5BA 3HDHA 2OBMA 3CT6A 4C7XA 3NETA 3P5SA 5ED4A 2OORA 3SJBA 5FOXA 3GT0A 4ZYYA 1R15A 2CVPA 1M1UA 3A6FA 2RIRA 3P9QA 4R8LA 2PE5A 1JQLB 4RELA 1NG9A 5F9HA 4JWKA 4S1OA 2ZE6A 4Z6KA 4ZJPA 1ZJ5A 3HBAA 4LX8A 4E70A 4KQ9A 2AKAB 4OO3A 4UBKA 3LK6A 1ZUNB 2PFGA 3WTBA 1SOVA 4QARA 4MCIA 1UMDB 5KJCA 3WK5A 3KWMA 2YXNA 3RIXA 1QIMA 4V0OA 3GU3A 1KWGA 4LMRA 4HNGA 5E4JA 2QQFA 3OUTA 4IKPA 4PCLA 1NLMA 3WRVA 5ICSA 1ADCA 1SM4A 3D8SA 4HO1X 2QAGA 3IOEA 3L05A 1EXVA 4HRYA 2PZFA 4Y6QA 1CP3A 2ZJ3A 1L3IA 4QHTA 1G64A 2HLDD 2X22A 3PDHA 2IOYA 3RVSA 4ZEMA 1XK6A 3JAKA 2CB0A 1U1FA 4P2GA 2YKGA 1G5QA 5HM6A 4JQZA 3C6XA 2BJHA 4AZSA 3Q1KA 4WKOA 2NVBA 4UHFA 4RETA 1GZ6A 1Y9JA 1RXUA 1BAPA 2PQ2A 1GLGA 1SEVA 1CQZA 4HN9A 3QXSA 5FA8A 1WXEA 1T2NA 5DOZA 1UZMA 1XGKA 4KV7A 1SELA 2I6TA 4WQMA 4EG0A 3WRYA 2C2YA 4IDNA 1R0LA 2WW8A 4HMOA 4RIEA 621PA 2J87A 1MA0A 2H8GA 4HAWA 4FYIA 3KLBA 3B1ZA 4O1MA 3TZ6A 2ZATA 3JWJA 1Y5NA 3GEIA 1N6LA 2W6CX 2CSUA 4AJJA 2AWNA 3MELA 5GM2A 4RO0A 4Z7OB 4IEFB 3UMGA 1CZHA 1JL3A 3LBYA 4DLBA 1EX7A 2PL3A 4WBNF 1ZI6A 1SVUA 1M2EA 3EZXA 2Q0XA 1UF9A 2EAUA 3MWKA 1QF6A 3QF4B 2PX6A 4AWXA 1CWUA 2J3KA 5LZ4A 4EUSA 4Y2JA 1KEEB 3TJMA 4H15A 3DLAA 4Z9XA 3RS0A 1SHZA 4BP8A 1Z0IA 1V5WA 4FQ7A 1N1EA 3ZZTA 2Q3FA 4LBWA 1OKKD 1KFEB 4CYMA 3CVVA 1KZ4A 1SRRA 1BN7A 2W6ZA 3FMPB 3KKZA 3U3DA 2DKFA 2VDVE 5KNBH 4MCAA 3CUVA 2OFWA 1BX3A 1E1CB 4WJKB 3RJMA 3U56A 2J9FA 1UWKA 3QK7A 2UXDB 2FVXA 5IN4A 3H2JA 3K2QA 1W75A 2Z8YM 4P2BA 2BEKA 2V4UA 2JEZA 4ENPA 4ZYWA 1P2DA 1RM0A 2J59A 4AAYA 3EAQA 5GONF 3U7EB 3T3DA 3P0EA 3PC2A 4NYMQ 3VUEA 3DD5A 4I4CA 3I5UA 2PKQO 4LX0A 5T4BA 1B1AA 1CF9A 1DTEA 1MO6A 4OQPA 4X8MA 5LKAA 2RKOA 3WWPA 4RMNA 1QFMA 1YBAA 4RA6B 4UJ3A 1WDLA 4NJOA 4BUJA 4CMIA 2WIBA 3MMXA 2OG2A 4W1SA 3VYSB 3DJYA 1HURA 2R1ZA 1X8XA 2RKWA 2Y1WA 1T15A 3ABOB 1L5KA 5K3BA 4L4RA 1CVLA 3UMVA 3AUKA 5AHXA 5DIFA 4R84A 3QVGB 1VXRA 1FF9A 3ZGNA 2FMIA 3OCZA 4NONA 1HKUA 1VZ3A 5DM1A 2Q8QA 5AVOA 3NJ8A 1JQKA 4LWOA 4H7DA 2AV6A 2PWZA 1MENA 4PQEA 3VOTA 1QHFA 4L5AA 5C7IO 2GM4A 3WL8A 1JZSA 1R6BX 2WU3A 2O14A 2DHDA 4IDFA 2PGDA 1JMKC 2DH5A 1K5HA 2WF6A 3OLXA 4PZZA 5A06A 5JZMA 3ZVKA 4H1TA 1XXHA 2PX4A 3FIUA 4HWSA 5BN4B 5BRNA 4B83A 3QPDA 4FYPA 4LTNA 1EK2A 4L0CA 1J70A 1QOQB 4NDZA 1VHDA 2XSZA 1N2CE 1S0UA 3DUFA 3FPCA 3SGLA 1LZLA 4FTWA 5SZHB 4GMGA 4URVR 1LNQA 4D7AA 3EASA 1SCQA 1Z2PX 4WCFA 1KY3A 4FFVA 5B36A 2CNBA 1NC3A 1SHUX 4IP0A 1EUCA 3HZOA 1AC5A 1SD1A 3P9IA 4I9FA 2XXBA 3GMDA 2XGMA 2DZDA 4ZEWA 4EPRA 1QVAA 2WHXA 3C7AA 1GSAA 1LV8A 2BFEB 1DXHA 4B71A 1MMFB 3KUCA 4RFVA 1XL1A 1QP8A 2C5EA 2N1BA 4MGHA 3MGKA 3AETA 2ADOA 1JQDA 3DUWA 4NBRA 5I9LA 1UIRA 1F0NA 2PMEA 3CPSA 4PLPA 1BE1A 2Q7OE 4M7PA 3PYXA 2Q5EA 4DR4B 2P8JA 4HGNA 1R8XA 1RZ3A 4O2RA 2IV7A 4BJHB 5JR3A 4R8VA 1YCHA 1AK2A 3PEVA 1NDQA 3G5MA 3UATA 4EVRA 1QAOA 4U9IS 3L4JA 3C98A 4PBRA 4C1BA 3JQ9A 4XR9A 4YLGA 5CYPA 2B2NA 3KV3O 1CZOA 1Q83A 2WJ4A 2XZDA 3KG2A 421PA 1YK1A 1OX4B 4PYRA 2OCBA 5FB3A 1CZLA 4P0QB 2EFEB 2GO7A 2VBGA 3K0BA 4BHTA 2VEOA 4CKWA 4M86A 4EITA 3GO4A 1D4FA 4MW9A 4TKVB 3ZXYA 3F9IA 3QVLA 2B8EA 4M0MA 2ZT7A 1P44A 4PXYA 3PC3A 5ESXA 1VSQA 3ZU5A 1R37A 4B85A 3AP2A 3UH0A 3NCTA 1XU4A 5HJ2A 5JSZA 5T8KA 4UC0A 4Z4HA 5ILOA 1D7AA 4PINA 1RRMA 3G9TA 3O21A 2FE4A 5H83A 4V0KA 1EMDA 3RASA 1U0TA 1UBLS 4PLVA 1RYEA 5SY6A 3B70A 3MCVA 4PC3A 1QAQA 2PH5A 4XI9A 4FLFA 5CLGA 821PA 2HSGA 4KQFA 1PDOA 4IVRA 4TUYA 2W2KA 2ECOA 3IPRA 1ZRSA 4U5QA 3VO8A 4GLJA 4E7OA 2IXTA 1YB2A 2I7TA 1R3UA 3X1ZA 1P31A 1CEEA 1J24A 4IRXA 4N8DA 2YOFA 3R6GA 2QTFA 1GPMA 2JCBA 3A11A 3HMQA 3LG2A 4A7PA 1ZXBA 3NV7A 3ZCSA 4FFOA 2XCOA 3GDFA 2HSJA 3G85A 1I7PA 5K0CA 2HGSA 5EUQB 1E1CA 1Q0TA 2CDBA 4J29A 3I2JA 3KNZA 3MRVA 1P0PA 1XJWA 4HF7A 1XNHA 3JD2A 4ON9A 5FBRB 2FMFA 1U8YA 1ZPDA 3F5SA 3UK6A 3CMCO 1SU4A 2EQ5A 3RUAA 1Y48E 1YJQA 1UBSB 1VMKA 1Z8HA 2ZSAA 4MI6A 4ATNA 3GLFA 4QXQA 1VC2A 4ND8B 5FFFA 4A03A 2ZP1A 3PVZA 4HQ6A 2DETA 1SUEA 2BHTA 3GT7A 1NBEA 3PQ8A 2HNKA 1IC6A 3EULA 1WB4A 4PLWA 3OA2A 4DFDA 5K0TA 1Q1EA 3W9BA 3CLTD 2D0PB 3CXRA 3NP7A 5EEHA 2CUNA 3CZRA 3WWDA 1QOPB 1SQSA 4Q48A 5AVVA 1A88A 2HPVA 5C5IA 3RC3A 2P90A 4NXMB 4DB4A 1HYQA 3LW7A 3S1AA 3CRQA 4LQDA 3E05A 3H2KA 1LQ2A 4CUKA 5JDIA 3H84A 2QR3A 5A4KA 1Y5MA 4Q7MB 2P1DA 2Q62A 4HFMA 5I9BA 2FW8A 9LDBA 3VH3A 3IQEA 2BEVA 2JJQA 3A8TA 1WUTA 3KTDA 4G3XA 1HE4A 2C4MA 4FDLA 4I4TB 4PSUA 4XW2A 5CLJA 1UC8A 1PS0A 3FOZA 1HMYA 2IVZA 1GZSA 4R81A 2LKCA 1OT3A 4ONEA 3U62A 1HOXA 2O8VA 5JAUA 1G6Q1 4WLOA 5FYDA 1H2EA 1HSOA 2G82A 3MCZA 1FFHA 2PCJA 2F1HA 4URZR 1LWOA 2B4AA 2QAJA 2LD4A 1GPBA 3ESZA 3IPYA 1XMVA 1E0AA 3IAFA 2QTNA 2RGEA 4MYHA 4ZWNA 1KYTA 5GJVC 2HWUA 3GFQA 1RKVA 3IT3A 3L7CA 4NMLA 4OP2A 1DT5A 4UPDA 4QG3A 1QLWA 3L77A 2OWDA 3OX2A 2WILA 4EW2A 1C5KA 2OHFA 2C9OA 1JHUA 1ZXLA 3SR4A 1PW7A 4NZMA 1FSZA 3Q9SA 2H2FA 4QGBA 1GGJA 1T1EA 2C03A 4F9GA 1LH0A 4E4RA 1E3WA 5DRYA 3ZVMA 1J23A 3QIAA 2QZ4A 5IKPA 1MVOA 2P5UA 3KB1A 3BXGA 2BKVA 4JOBA 4YXFA 4RTRA 1FTYA 2V4MA 3RUIA 4EHIA 1IAVA 5E1DA 3RJ5A 4EI8A 4JL8A 3TUJC 1Z4QA 2V6BA 4Z9AA 5E9QA 2VBFA 2RD2A 2V0GA 4M89A 4E5DA 4Q37A 3N0TA 1AS3A 4HNQA 5CX4A 5INTA 2EWWA 1KK3A 1IXRC 4G97A 1T0BA 3MLEA 5AW9A 2BC9A 2X4DA 1CULC 3KYIB 4OXYA 1VIAA 2BFWA 1EVZA 2EHJA 5C7LO 3W6ZA 4G8BA 4ILKA 2QT0A 3FYSA 4P81A 4YCCA 1JFLA 4D8XA 1N2XA 3RKSA 4YXWD 1GN9A 2OY0A 4HCJA 1WPRA 3EGVA 1X39A 3AETB 1U5BB 4WOCA 1MB9A 3OTIA 4BIIA 2GEBA 2VT6A 3DLBA 5TPZA 5FL7A 5SV2A 1IQRA 2Z08A 4RL4A 2EJTA 4WLEA 1W6UA 3FUTA 5DYGA 2FP3A 1DHRA 1NUHA 2BDTA 3I30X 1KDVA 2R5NA 1CB7A 3OT1A 3W2HA 2WJ6A 3B12A 4UVHA 3AM1A 1SUAA 1YIOA 3M8KA 3KHUA 4R2JA 1GTJ1 1SCJA 5ER6A 4E5PA 6CHYA 1PCXA 1MC5A 1R2QA 1KTVA 2ZTLA 3MSCA 2AN5A 3M1LA 4ZV9A 3RSQA 4B6EA 2XUOA 2V1UA 4KJZA 1XCOA 4N5DA 4GOOD 3VPFA 4G67A 4D5EA 3FE2A 1V43A 5CFMA 5U9CA 2DFPA 5DI3A 5FR1A 1YC2A 5DP1A 3OEED 3U40A 1KFCB 3A6KA 4BO1A 2FPGA 4YMHA 1EM8B 4I4NA 4QVKA 3ZXXA 3NWPA 4GNKA 4A3SA 4BKUA 4OGFA 3GPLA 1KJWA 2RGNC 3NNDA 1M0WA 3FWPA 5FUQA 2JGAA 4LSWA 2DEUA 1PJTA 4ZQGA 1LDBA 2AW5A 1JFRA 2A9VA 2GBLA 1TJ5A 5EZSA 3EYAA 1JZQA 1XROA 3D64A 1HGXA 4MUNA 3ZE0B 5E7IA 4QQKA 1LVHA 1J49A 1T26A 1FBTA 3FVQA 1R0ZA 3UMYA 3AG5A 1XNJA 3EIOA 3OKAA 4HKTA 2AFIA 2UZ1A 2IPNA 3LVRE 1E59A 3JWIA 2OGZA 3IAEA 1NU6A 2AT1A 2JGDA 2WJYA 5B3JC 4AJNA 2I78A 4G5FA 4GEKA 1O3YA 4J0IA 3L40A 5LZ5A 1TC2A 1VPLA 2X0IA 4FZVA 1X7DA 1SKAA 4IHQA 3U7QB 4DBVO 5FHRA 4IIBA 3D0OA 4DV5B 1QRSA 1CQJA 1N8NA 3DB2A 3ODGA 3WWCA 4HGPA 1GUYA 4ND1A 1OIVA 2JAXA 3OCXA 1AQUA 4D8YA 3TDNA 2YIDA 3U0VA 1WOYA 2I1LA 2ID7A 3JQ8B 2QJOA 1M9NA 2DFNA 5HUJA 5BSFA 4Q4HB 3A1NA 1IRIA 1WXWA 3AHIA 1BCRB 1E2KA 3FOBA 2OG1A 3GLIB 1JB9A 3WSWA 3WQQA 3KKLA 3GVXA 1VIDA 3D7KA 5JVDF 3UOAB 1V35A 4HS9A 3L7NA 3R7FA 4BUCA 4BVLA 4D3YA 5JAOA 4S2EA 2B4QA 3DBHB 3ZN2A 2CXRA 2WG2A 3NHAA 4BNHA 3JYPA 4JNCA 3TNFA 3MCAA 1XQ1A 3V46A 5I4BA 2XNKA 1GDHA 4IDCA 4BNYA 4QLOA 2QN7A 3EEIA 2YWCA 1C81A 5DNEA 2WPDA 3GWZA 3H8SA 5L3SA 1EM6A 4O4LA 1M7BA 1OH8A 1NG1A 1WQ1R 4KWIA 1SBHA 3DF7A 2FN8A 2X19A 4YQEA 5KYUA 4UQLA 2XDQA 3HO1A 3U17A 1QV9A 4J94A 3M89A 5DNCA 4H08A 2OV3A 3WLTA 4Z4CA 5C8DA 1RRGA 2D8MA 4AP9A 2O8BA 3QU4A 3PK0A 2IF0A 1G98A 4EYQA 5GV8A 2XEDA 4MVYA 3OWHA 4H7JA 4XIFA 4YMSA 1M2VB 2P9BA 1WRBA 5TNXA 2G9VA 3L7KA 2O3RA 3PHLA 4FZ3A 2D0IA 1IEWA 4MV5A 1SZCA 3K2IA 4TLMB 4D3FA 4MVJA 2LDBA 1TO6A 1MJ5A 4GKAA 4YGXB 5B7GA 2RDMA 3DBHA 2BD0A 4RE6A 1I32A 4QJIA 2JJ2D 3AO0B 4QULA 4UMVA 2OXIA 1XDUA 3SOPA 1EVKA 1PTJC 3RWOA 1D7OA 4N5HX 2QRHA 3ZNPA 1GEGA 4BRZA 4DDWA 4GYKA 1QYRA 5FPKA 4Z8YA 2XDWA 3G5AA 3GLTA 1I80A 4GLLA 2OXEA 4PU0A 4Q4HA 2VHJA 2Y66A 1BS2A 1QQ6A 3GBVA 3LLSA 2CLEB 2VWHA 2Z9BA 2P9HA 4P4GA 4AKTA 4EOGA 1JHRA 1RAIA 4ZGWA 3VH2A 2KPOA 1T0JB 1YCGA 4RHFA 3ZWMA 3AHGA 4OLHA 1NIPA 1NQAO 2W6NA 4B48A 2CXPA 5ICEA 4ZOEA 5E6RA 2FPIA 1YZYA 1H66A 2FY8A 1RXYA 3A9TA 3SFTA 1M3SA 3KJIA 3V97A 1ZWKA 2JFQA 2AMLA 2Z1NA 3AEZA 2BVNA 4J0CA 2H6EA 1GG5A 4HDQB 3DWGA 4R7TA 1GTZA 4R51A 1PBTA 5D3MA 3OTQA 2A57A 2NWQA 5LQCA 2NACA 2QQGA 2VHYA 3AJAA 3DOUA 3QKIA 1V1RB 2OPBA 1F8GA 5JSYA 3TZBA 4A6PA 4B47A 1DVRA 1I6MA 1HTWA 4X45A 2PUFA 3O9MA 3V4SA 2GH1A 1IWBB 2ODNA 4AG6A 1PT7A 2V5AA 3LYHA 2GEUA 4LK3A 3K2EA 2QZZA 4NBWA 1ZRHA 1PK8A 1NXXA 2P2GA 3JV7A 5EKSA 3RS5A 4JLDA 4E4YA 4MQ5A 1TRKA 3DBVO 4TS9A 4MW2A 3SZMA 4PN3A 4I4TF 3FPFA 1T3GA 3JRXA 2WY2D 3LP6A 3TQQA 3UC9A 2WUDA 3FDZB 4QATA 4K46A 3F5DA 4WERA 5LZ7A 1B8VA 4L6AA 4RK7A 2VPWA 1M8JA 1Y1TA 4HQ0A 5F5LA 4R40A 4RDHA 1L4HA 5DBEX 4DWOA 5AFSA 2C4KA 3MGAA 1RYFA 2Z43A 4MA4A 4R9RA 2NZXA 1L4GA 4WTOA 1KBOA 4HNTA 5KYTA 1H5NA 1OUMA 1AUQA 4Q3KA 1ST2A 3FZNA 3KL2A 3LUCA 4JSRA 1XJ0A 4YVFA 4MS4A 2ZYSA 2YVUA 3PQEA 3I6QA 4EI7A 4UZFA 3VYUB 2F3SA 1PZHA 3N0XA 2HBRA 1KVSA 2GKSA 2JGEA 3REQB 1U2GA 3HZHA 2CZQA 1FSPA 1Y6ZA 1O96A 3MM4A 5CJ2A 1OJ7A 3A4NA 2MMGA 3B1XA 4I7EA 4U6QA 3U13A 3K2BA 2ZYGA 3H5LA 1CD5A 2DWUA 2XQJA 4K8RB 4BKMA 4FFWA 4PLTA 4DYHA 2HBYA 3TIFA 4GWKA 2ZDHA 3CGWA 4F6RB 5KHLB 5L7WA 3OKCA 4PBSA 3QY9A 1YS6A 2VCYA 1IFXA 2ZSDA 4EGAA 2PZGA 3M9XA 1UJ2A 4IIJA 3SY8A 4JI0B 3LOPA 2HXSA 4P0TA 1BWSA 2BFBA 2G1UA 5C8YA 2C4NA 2V97A 3F5MA 3H2IA 3TAUA 2QVZX 4HJXA 2IYFA 1P2SA 4GDMA 4B45A 4QBFA 4ZK6A 1CY2A 5BMOA 2Q8PA 1UIMA 3HKEB 3OO0A 2X1LA 3R7NA 3VO2A 2JGIA 2D7DA 4KRYA 1FS6A 1IDOA 1QG0A 2VZ0A 3BDVA 5DRTA 2WJZB 1D9XA 4D45A 4NY1A 2CKMA 4I36A 4RGBA 1I5RA 2GZMA 4HSEA 1L4BA 1RI4A 4EHNA 2ATCA 3NBMA 3D6VA 3KAPA 4INPA 4MZDA 1UBOS 2C2GA 1YI0A 5HF5A 3PU6A 4A8TA 1H23A 3WKAA 2BUBA 1WW3A 3PHBE 4HB3A 4YBZA 2PWYA 1KRWA 4H18A 4EUEA 1NTRA 4H6XA 3ZWBA 4WA7A 3VZDA 4YRZA 2I1QA 2G36A 4ZYUA 1MRZA 4QBKA 1ZH4A 4G0OA 3DV0A 4EHBA 1NGSA 2I3BA 3Q40A 4PAWA 4E5YA 2VYVA 4YP7A 4M83A 2HRCA 3CX3A 3WIBA 3EDOA 1P1FA 2ZYWX 1FVFA 2HXYA 3FNBA 4B7ZA 4BC1A 5GTDA 2XCSB 4J3JA 1QIJA 1TLLA 3L4BA 5NULA 1E7RA 5KX5A 2V5UA 1JSZA 3OZBA 4H0FA 5J58A 2OYRA 5KSOA 2PSSA 1SHTX 1OX6A 1XQYA 3GHYA 1U02A 4U3JB 1QPZA 1NMSA 4JSTA 3TTWA 5CRIA 1JKJA 2OGTA 3B53X 3REQA 1GL7A 1E2PA 4Y98A 2IZ1A 1YBVA 3QLTA 1LZKA 3CEJA 2PS3A 3HCBA 1I0IA 1XJ5A 4LN1A 5GAJA 3V55A 4BZWA 3NOXA 1PSWA 4HS4A 3FNHA 5IJ9A 1DFGA 1YR9A 2X2EA 1WXHA 4L15A 4S1PA 2Z30A 3N8NA 4QODA 4BB6A 2ZSEA 3WWYA 1ZCJA 4QQ8A 2VHWA 3ABZA 1P5ZB 3LYLA 1IQ0A 4RABA 4BX9A 4WKCA 1PR1A 3LX8A 5E1BA 2WVHA 3EMBA 4EDHA 3UBTA 3K7EA 4KXYA 2O8FB 4NX2A 4WESA 5FUVA 2ZIFA 1SXPA 4WUTA 3LJKA 1U3FA 4X9XA 2WB4A 4Z2YA 3E84A 1UDBA 4HH0A 4IINA 3UJNA 4OGGA 5AKIA 1DRUA 1A8QA 4LISA 1FFSA 3QLUC 2X0EA 2ATIA 2DR3A 1X1BA 1FJHA 2SNIE 3GHHA 4DC9A 4EFDA 3NATA 4EVSA 1TM5E 2IKQA 1WCV1 5C46F 1SKYB 1VP9A 4LPKA 4G37A 5L53A 1TMKA 1QJ4A 1Z68A 1H6BA 1H8EA 1B2LA 1L6IA 1GOTA 4ZARA 1JPUA 1F14A 1C1DA 2B4KA 4O2BB 2NXEA 2WU0A 4XGRA 3HCRA 4PEVA 2CF5A 5JC8A 3WG9A 1CSEE 2DTXA 4TKUA 2QLMA 5LCXA 4GI7A 3VI4B 1E7SA 2JAUA 4GQBA 5ES3A 3T0GA 6YASA 1I7LA 4FGZA 2WI8A 3DBLA 4RA9A 2ZSFA 3I5AA 4PQYA 1ZD3A 5B3KA 2IUSA 1FDRA 5AVTA 1RS0A 4OXQA 4KDEA 4QD3A 5BSEA 3P7MA 3IH5A 5B58T 2WV9A 2BJWA 2ZBPA 3LFHA 4L74A 4Q9DA 4WHMA 4YP0A 4EG6A 4Z5XA 3EVFA 3MWYW 5AD1A 4QE3A 5TXGA 2VT3A 1L3CA 1Q1AA 1VJDA 3DHVA 3ILHA 2VF4X 5G4LA 2WZCA 1X7YA 2HZ7A 1RRVA 2BTOA 3AI7A 2RJNA 2F64A 3JPWA 3UT5A 2COKA 3PC7A 4X66B 4PG5A 2XUGA 3IKJA 5AVJA 3QHPA 7MHTA 5PGMA 5J2TA 3QUCA 3FSRA 1J5EB 2BP7A 4IWYA 3HCEA 4H27A 2W6JD 4FSHA 4YDHB 4YPFA 3WHIA 4BNLA 2HMTA 3FGNA 3FTCA 3GRKA 3OPMA 4WDQA 4WK2B 1Z4OA 2B98A 3HJCA 4FHGA 4MICA 4P82A 3R7DA 4P7FA 1Y0BA 3N2LA 2JCVA 4Q1AA 3RHFA 1VE6A 2JLBA 4CMHA 1MOSA 1CZRA 2FG6C 1ZGJA 1V9CA 3KE8A 2OO3A 1ULBA 4BX2A 5HBGA 6REQA 2QV0A 3PKIA 1DCMA 3KQTA 2HHJA 5LSAA 3KUDA 2AJDA 1RPNA 2D7CA 2OGUA 4OP1A 1V2HE 3SWWA 1DO8A 1NATA 4D4HA 4WWHA 3TXXA 3C74A 2QD2A 1RAFA 2FZLA 3DR5A 2EVWX 3ND6A 4M55A 2VXOA 5CU7A 1FTWA 4N5NA 1TU4A 4V0RA 3ZIAD 1OE0A 4IFTA 4NG5A 2E18A 5KSPA 1NM5A 1GUZA 1E1QD 4X8HA 4OATA 1G8FA 1GPAA 1XWIA 4XB2A 5IJ0B 5HJEA 4DV2B 2IS4A 3ESCA 2GOYA 3OZ7A 4O59O 3OJFA 3EOBI 5J5VA 3PB3A 3L02A 2I6GA 1PGOA 5AVKA 5K6RA 1W88A 4ISCA 1PL7A 2QMYA 1U7HA 2YZ7A 5CP8A 5K5EA 3ZLJA 2EJBA 2I9PA 4BEVA 4OVKA 1JSXA 3KFVA 1EFRD 3EIXA 4IX9A 1ZRMA 5JCXA 1LSUA 1TUBB 2FZCA 2C7RA 2V7QD 1ODSA 4AQYB 3K6SB 1LPMA 4RXUA 4X1OA 3WLAA 2H4WA 3EC7A 1Z0JA 4QYTA 1FDSA 2I4TA 4BWFB 4Q9NA 4E7PA 4B73A 4ZGGA 5HZKA 3PEFA 4MDFA 2D1QA 5KNLA 2CHVA 3FDIA 1JR4A 3D59A 3R5FA 3A2NA 4IMJB 1ZAKA 3SC3A 3C1UA 1VI2A 5DISB 4S35A 1SD2A 1JVNA 1U7DA 3Q0IA 2G7MC 5TS2A 1FNNA 3R5KA 4YH1A 3IQDB 3VR6D 1E79D 4IXTA 4C0SA 2ZZMA 3FOEC 2VT7A 4LRXA 5CH3A 1S3SA 4F3KA 1N9ZA 1UMKA 4MWGA 4LRSB 1RPJA 3GQVA 4ENQA 1FTGA 1RKUA 1BSVA 2AIRA 1NI5A 2HY7A 3FYUA 2IYRA 3QBVA 1Y9AA 4LI3X 5DLYA 5NLLA 4ZJZA 1M1YA 3AB3A 3AUXA 2VHCA 1RYBA 1XRRA 3LVFO 5AW8A 4K40A 1H2WA 1MA3A 3LZ6A 1GGHA 1NI3A 2B20A 3N58A 5EY5B 1AKWA 5CD9A 1HZZC 3EF0A 1JU9A 3CN9A 3OE1A 2TRSB 3GZNB 1ULHA 3KYJB 5JRZA 1UXIA 3ZH2A 2QDXA 3AR5A 3FI9A 4G26A 3OMWA 3L6CA 3GCWA 2E82A 1UM9B 2FFRA 1AZWA 4YJFA 2VJKA 3PRKE 4YRQA 4I1RA 3VV2A 1RZUA 1LGYA 4ZXFA 2BGKA 4KRFA 3ZWDA 3K1AA 2J0EA 4CR8A 1RADA 3C1TA 4KOEC 4JMLA 3ZBTA 4JXXA 3HU3A 2J5QA 2ZE8A 2F4VB 1OZ0A 4Y2VA 3DONA 1NJ2A 3FCYA 2PUAA 4D99A 3RC1A 3EH1A 2BFNA 3RRYA 3FZEA 3PFCA 2IHBA 4GEGA 4L5IA 3TB6A 3TSCA 2I91A 1QH9A 2FZKA 3GC6A 4FQ8A 4XM0A 1YDEA 5AVSA 3TVTA 3HCPA 3W8FA 4UU1A 3ZHZA 1IPFA 1PNOA 2VUUA 2XZPA 1R6XA 1PN3A 2F7SA 3UKJA 2HCFA 1IZ7A 1AV7A 2PXAA 2HA2A 4B1FA 1E8NA 1S2LA 3WLQA 1OWMA 4G85A 3HL0A 1MPTA 3NXKA 4KXVA 2YWDA 3U39A 4CM3A 1P5JA 2J3MA 1Z5VA 4Z3DA 5IMSA 5DN9A 4BN0A 2NX2A 3KKEA 2C42A 4LJ6A 4JJ6A 2O0KA 2QYHA 2PR2A 3U31A 1ECLA 2Z1MA 2ES4A 4PNPA 5A1TA 4KE8A 4OGLA 1XKXA 4WOJA 4MQ6A 1DTWB 4RM2A 3R7LA 1EYZA 2DPYA 5M2QA 3DMTC 3PS9A 5D5HA 2NXWA 4XSVA 4OQXA 3TBKA 2JFYA 2Y71A 4C0AC 1E2UA 3F96A 2IUFA 1GYRA 1ONNA 1Y9ZA 4MW1A 3SYTA 3V7YA 1YOBA 3TQSA 1ZNZA 2JI9A 3CCCA 1N25A 4NJEB 3VPDA 1R9JA 3OQNA 3WOHA 2ZYTX 2P9TA 5F64A 4PYJA 3WB0A 1TDJA 2AI2A 2BMVA 1RI2A 1U2SA 2W8ZA 4ZQBA 4E5MA 1Q22A 1W6RA 4KP7A 1F2TB 2QL5A 4JD5A 4WINA 1W30A 2AG1A 5DNWA 5B4VA 1JECA 3LS2A 5LZ2A 2F8LA 1DU4A 4ESEA 4OM7A 2I3ZA 1P7CA 4UU0A 3UWDA 3N6XA 2C99A 4FXOA 2VYNA 1IPEA 1U2RA 1M2WA 2ZFUA 4N9WA 3S2UA 3RTAA 1UQTA 2H7YA 1JILA 4ZI5A 1KQGA 3DL0A 2G40A 3G8AA 3PHHA 4OLAA 1XZQA 4NOMA 2PFKA 3BL8A 2E2WA 1LD3A 1RMTA 1ADGA 4O2AB 2Y9MB 4Q12A 5IVDA 2UYOA 4RJKA 4FX2A 3W5HA 5I7FA 1KU0A 1Z5NA 3P9ZA 5A9TA 1CUYA 4XB6B 4CCAA 2FN7A 3FAZA 5B4TA 3IIJA 1KIAA 3ZE1B 4C6HA 3PFHA 2ST1A 3IAAA 3QI7A 4BUZA 4DLTA 1O5IA 2FSFA 5C31A 2IOQA 3IURA 1A0OA 3JQBA 4KI7A 1NAIA 2AA3A 3DNPA 3P0FA 4KO1S 3ZWQA 4L02A 1BC5A 1KPGA 1MGPA 1NUPA 3IR5A 4F5EA 3O1LA 2OCKA 3GNQA 3QJ5A 5B57C 4JGIA 3VHXA 4L6IA 1JFFA 2IYZA 4XSGA 4BNIA 2GCEA 5HK9A 1QS0A 2D1TA 3JYNA 1TQ2A 1WQ3A 4D6YA 3ROKA 4CETA 2I3DA 3BGWA 1YMUA 2JZNA 2WAMA 3LO5A 4YB8A 3EGCA 5D1HA 1JLSA 1C0EA 3DLTA 3UOGA 3F97A 4TL9A 1IHPA 1ES9A 1KZGB 3HSKA 1TF7A 2Q6IA 2IHKA 3PDUA 2X40A 3H75A 4MQLA 2C4UA 4N48A 1B42A 1T4CB 1ZR2A 2FHSA 1F51E 2MYPA 4K6OA 4PRLA 3T06B 2HQRA 4RH3A 1RIIA 3U1TA 4HVTA 4L3OA 4LBVA 5HKAA 2Q1XA 3QNUA 4BFCA 4QPDA 5A0VA 4LVNA 3ZI4A 2FW7A 4EUKA 3U7HB 2P7IA 3EF1A 2J5RA 3R3XA 3AQ4A 4KHZA 4LWQA 3R3SA 4CHTA 1XPJA 2N1MA 3C14C 3QLVC 2AE1A 2FWMX 4DLUA 1L5WA 2VK4A 2WSYB 4WCDA 5JATA 3PFKA 4JUAA 1ZGBA 3PTAA 1W44A 2ESRA 1IEVA 4KMSA 4RD4A 4XDZA 1FLAA 3DOIA 3JQEA 2VN8A 3N59A 3U3JA 1XX6A 2GXAA 4LDPA 1KZYC 4EI9A 1Q0HA 1U8FO 1NOKA 3LKDA 2C5AA 1JDJA 2FX2A 2Q4TA 4QU5A 5HKBA 1B76A 3H9QA 3VC2A 3DAHA 1CUGA 3FUCA 3X1MA 1YO6A 3DAPA 3EPPA 3MLAA 3RO7A 4CM8A 3P27A 5B3AA 2PKCA 2VYCA 3TEFA 3DXXA 4HD8A 3URKA 2IZ7A 2GPNA 1B8PA 2MU1A 4UNSA 4MR8A 1IJEA 2JL1A 4RZ3A 5F5NA 1KIFA 3KPWA 4WACA 5IT0A 3KOZA 4N3AA 1D4ZA 1YE8A 4M98A 1TKCA 4U2BA 1BWPA 4HAYA 4BGVA 4JJ8A 4FUQA 3SU8A 4CV3A 4C06A 5LN1A 1RKXA 5WRFA 1S3IA 2YIJA 1OFUX 4YIKA 2K6GA 1Z73A 2Q0SA 2XYHA 2JH9A 3Q2OA 2HAEA 3GUHA 3N3AC 4G9EA 2W11A 2WTXA 2FR8C 1JNYA 3EFBA 5CPBA 5HFAA 2VPZA 5F77A 3T7JA 1CJSA 2J09A 4KXUA 3HUTA 2WVGA 3NG1A 1E3MA 5JHHB 1MO5A 4BMDA 1YQUA 1EXDA 5B1SA 4KQJA 5HR5A 5FT9A 3AIOA 3NI2A 2J67A 1F0PA 2YMPA 4QU8A 3Q7SA 4G2TA 2QLLA 1YFLA 3T61A 2EL9A 121PA 4XPIA 1DKUA 5EE1A 4LUCA 4O5OA 1QV7A 3T7TA 1EVLA 4CPDA 2ERCA 1T6ZA 3M1YA 4LBYA 1H8HD 4BNZA 2A8YA 1NVUQ 2ZIGA 3BWBA 4B6QA 2F1OA 3TLBA 4BKRA 3VHXB 3QU7A 5HYVA 4ZO6A 2AMJA 1UK6A 1W4AA 2VPXA 4M1EA 4ZAVA 3RRFA 1TO2E 4KX5A 3DG9A 4NCBA 4V1CB 3VU3A 1W9HA 2G5GX 3UWKA 4BLOA 1OBFO 4M1SA 3V1TC 2OT3B 3LX5A 1S8OA 2IXBA 3GEEA 3NCHA 3TWOA 3N3BC 3ND8A 2ERXA 1Z33A 2AHRA 4EPXA 4JV5B 4RF3A 2D06A 3W05A 2EV9A 1OF1A 2O4UX 1F6BA 3PQ3A 2GYWA 4NIMA 4CMCA 1NW8A 4TLDA 4LWZA 3K73O 1AK9A 2QN9A 1Z0AA 2Q8NA 4FB4A 4CMEA 2Z6VA 3C0KA 1DHTA 1W581 4HADA 5EUCA 5FCDA 2WUFA 2IK8A 5C51B 3LYUA 5JVDB 4UTZA 3ZHSA 4I6GA 2QUBA 4LNAA 3T9DA 3ENKA 3AWIA 4BO4A 3L5KA 2QI9C 2PUBA 3A32A 2IT1A 2FAXA 4ZZ1A 2DJIA 1N7HA 4JR2A 3HR8A 5IAJA 5JD4A 2C7VA 5A1JA 2HQSA 1OB5A 1ODIA 3IHTA 4BLRA 5BMVB 3WYEA 4B6GA 1REQB 3KQSA 3HXOA 3VPCA 2RAFA 3S40A 1SO8A 2MJLA 4RAOA 4RKFA 2A59A 1DAHA 3E35A 3EZYA 2NQ8A 2GUGA 5EE5B 3B38A 5J1SB 3ZVRA 1HA3A 2ZANA 2NU8B 4M38A 4RK6A 3BWVA 5TDHA 4AKEA 1SXIA 1NVKA 2FMUA 2PT9A 3ANSA 4Z1OA 1B23P 4MMZB 3C3CA 1JEYA 3IT1A 3OA0A 1P1HA 3JTEA 3T9EA 8OHMA 3C16C 3HJGA 2JCXA 2VYFA 2Z2YA 1V7QA 2KMLA 4JYCA 4I3HA 4YAFA 4NF2A 2Q4EA 5DYNA 4BQQA 5K3FB 1E1NA 1U8XX 2YV4A 4CM1A 4XB1A 3LDAA 1XELA 3PGMA 4JLMA 3SVTA 2GF9A 4FCTA 4O8ZA 1WX1A 1ABFA 4R2MA 3PQ7A 1R6VA 1GQ2A 1H8ED 3OZTA 1E2BA 1QM5A 1XKQA 1U98A 2XT6A 4WI1A 4LJSA 2WWVD 1MB0A 3E1GA 4NBUA 1RM4A 2E6KA 2Z5VA 4EA9A 2DERA 1XO1A 1W5EA 4EUFA 2XLBA 2C9ZA 3HKDB 2LR0A 2DLDA 1ZW1A 2F3UA 3T7RA 4C5BA 5HK8A 1TD9A 2QUJA 4YCSA 3KDPA 4G6ZA 4YRBA 4IX1A 3RT9A 1R3DA 1XE3A 1XMXA 1A97A 3V1YA 1ACLA 2YOHA 4PX2A 4P54A 1XZMA 1FVHA 1OXVA 1ZN7A 2WMNB 4GMDA 3ZE6A 3N76A 4C0BA 4P5PA 4C7MA 5BNZA 1KEEA 4C4YA 4ECAA 4AJ1A 2WKSA 3FIJA 1USGA 4YROA 2PUGA 4TSRA 4GX1A 4JP3A 4ZVUA 1VHWA 1Q1QA 1DBPA 3ENQA 1FK8A 4LVOA 1G59A 4ESVA 3KQWA 2HX1A 5G53C 2PPVA 4DA6A 5BSHA 1N4DA 3LA8A 3OT5A 1LCIA 5I3ZA 5IFLA 3I62A 3D3KA 3MMNA 2RGDA 2BI7A 3LYAA 2R4UA 1N3IA 1NXPA 3H2BA 4JIGA 2QJTA 5AQEA 5IP5A 5JCZA 4DV3B 3UG7A 4BEBA 2XA9A 2Y1OA 2WT4A 1U9ZA 1FRVA 4BNXA 4QM6A 2YXEA 2E4VA 3JASB 1M7HA 1WZIA 3AM4A 3D8NA 3HVKA 1C3JA 3NVDA 3PHGA 4J0DA 4LZZA 5FOWA 3L0OA 1Z38A 4XA8A 2O59A 4RENA 2QT9A 1GG8A 1YS7A