4Z9AA

Crystal structure of low molecular weight protein tyrosine phosphatase isoform a complexed with phenylmethanesulfonic acid
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z9aA00
1M2FA 4HNQA 1E6MA 3L6UA 4MQEA 3O2JA 3N0XA 4RDCA 4RK4A 1S8NA 4XFKA 5TQ2B 3O74A 1QPZA 1Z2DA 1USKA 4HYEA 1C0EA 4LDAA 3DLHA 4EY3A 2R25B 1I3CA 1JH9A 1QMPA 4ETMA 1RNLA 3QEMA 4N76A 5JNRA 3IP9A 1QO0A 1EHCA 2PUGA 4ZJPA 1USIA 5HSGA 1ZAYA 4RKRA 2JVKA 4RY8A 1UDRA 3HS3A 3MA0A 5FWXA 5GQSA 2BGGA 2RGYA 3R0JA 1ISRA 2ID7A 4OG2A 2IPAB 1DCKA 1QNLA 2MYUA 3EJWA 2E4ZA 2VYCA 1DRJA 1W25A 1JDNA 4DADA 1YIOA 3FDFA 3E61A 1GCAA 3G85A 2JBAA 3OM0A 1SRRA 4F8JA 3Q41A 2IOYA 4G0OA 3H1EA 3EAFA 3JPWA 5F64A 1C4WA 1HEYA 3HM9A 3A0UA 4MQEB 3NHMA 5TQ0B 3GBVA 4OTZA 1IIBA 2PMCA 2HQRA 3EULA 1PNRA 1MB3A 1TJYA 4KQ9A 4KQCA 4EYQA 3F6CA 1RXIA 2IYNA 1MIHA 2WRZA 1BA2A 4OBBA 3HUTA 4P1ZA 4Q6BA 1JYEA 4MGEA 4W5NA 1TLFA 3A0RB 3MM4A 1ABFA 3LTEA 3UK0A 3OQMA 2ZWMA 1BAPA 1DCFA 3I09A 4Z4FA 1DBQA 3D8UA 3LOPA 4RY0A 3JPYA 2WB4A 4G0QA 3M6MD 4YGXB 2E4YA 1KRWA 2I6FA 2NZVG 4LRQA 1YTUA 4UHJA 4KZKA 4M88A 5EWJA 1DBPA 3ROTA 4FB4A 5HM6A 4KK4A 1Y1LA 2OENG 3ILYA 3NNSA 5DLEA 3TB6A 3OQNA 4NCBA 1JFVA 4MS1B 1VPWA 2R4QA 3O1IC 2PL9A 1DG9A 2QR3A 3HVRA 3OLZA 3URMA 1DP4A 1KGSA 1YMUA 4E7PA 7ABPA 1F51E 2GBPA 2JBAB 3LUHA 1SXIA 2VUHB 1L5YA 2FQYA 3EQ2A 1Z13A 3F6PA 1YS7A 1NXXA 4H3HB 4H60A 1ZESA 2WWVD 1LK0A 4W5RA 4MRMB 4QPJC 2QW1A 2QVCA 3QEMB 4YS6A 3DGFC 5JNVA 1D5WA 4QICA 4OLAA 3C97A 1QP4A 2PE5A 1M5TA 1B00A 4MR7A 3TMYA 4IRXA 4NV3A 3UKJA 3CHYA 3T38A 4EVRA 3E3MA 3HDVA 2X7XA 3O2SB 1SXHA 4S04A 4RKQA 3F73A 1QQAA 1Z17A 2QU7A 4KVFA 1QQBA 3BRQA 3H5TA 4W5TA 4KFCA 6CHYA 3SQNA 1YK0A 4RV5A 1JYFA 1CEYA 2MYPA 4MRMA 3GWGA 3IPAA 3OLWA 2WY2D 2YHAA 3N0WA 4JAVC 3CRNA 1EWTA 4XXHA 5KQMA 3OLYA 2RJNA 1RZRD 3FGZA 3OLXA 4MR9A 3VNAA 4MQFA 1BDHA 4GNRA 4ZMRA 2NZUG 3TD9A 2GWRA 1ZN2A 1YS6A 3NNNA 2PAFA 2PL1A 3CZCA 4MS1A 3N8IA 3LKBA 4EYGA 4G0XA 3GL9A 4KMRA 5TQJA 3SG0A 4UHKA 5KQLA 4ML3A 4MR8B 2IPNA 2O20A 4PYRA 3HUUA 5HKOA 1JX6A 4PZ0A 4YO7A 3Q7TA 4YP9A 3IDOA 4LE1A 4MS3A 5BQ3A 2LPMA 2ID9A 3C3MA 3C3WA 5GOTA 4G86A 1ZITA 5DGCA 3KLOA 3CS3A 4TLMB 2FSPA 4L4UA 8ABPA 3CKMA 5CNJA 1PNTA 2A9PA 3H5OA 3QLVC 1MB0A 3HDGA 3A3KA 4OLBA 4EGSA 1CYEA 5JS1A 4NICA 1ZGGA 1AB5A 4YLEA 4P98A 3HO1A 4KPYA 3FFXA 4WXEA 3EDCA 5FWYB 1QKKA 1Z12A 3OM1A 4PEVA 4RK1A 2PUCA 1XWWA 4RZSA 2IPLA 1KMIY 2MSLA 3Q9SA 2IDMA 3MQ4A 3RVSA 2PJUA 3KCNA 3GYBA 4IILA 2FMHA 4F12A 4PICA 1NXPA 3HJFA 3OO0A 3N53A 4Z99A 5KI6A 3IP5A 3CG0A 2L2QA 1DZ3A 3T6KA 1JLKA 5CNKA 3QK7A 4DQDA 2PUEA 4MQFB 3FMVA 1RXEA 3H1FA 4LDZA 2A9RA 5EWMA 2JVIA 3CZ5A 1T34A 4Z4EA 1DRKA 1GCGA 2E4XA 3H5WA 3JY6A 4MR9B 4XLTA 2MSWA 2PLNA 1M2EA 4G0YA 4WZZA 1JFSA 5BRAA 4GPAA 2NT3A 2QV0A 1JBEA 2HQOA 3TX6A 5FWXB 5KC8A 3RVRA 1A0OA 3RVJA 4EUKA 3QX9A 2QZJA 2FMKA 3O21A 3CTPA 4NCAA 3BRSA 3HV2A 3H5IA 4LE2A 4F3TA 4MS4A 3D02A 2LBPA 3LUCA 5B3JC 1Z15A 3BILA 3HSYA 3FFWA 3DLBA 4WUTA 5EWLA 1TVMA 4D74A 1BVHA 3LUFA 3EGCA 3RQIA 4O5AA 1XHEA 1TM2A 1P2FA 5EWJB 3I5AA 1DBWA 4NQRA 1E6KA 3O2QB 4ETNA 2FEKA 4Y9TA 2N9UA 5ABPA 2B1JA 1NTRA 5KQPA 4H3KB 3N75A 1LJLA 3HCWA 5JNSA 2JRLA 2CWDA 2V0NA 1OXBB 1OXKB 1Z25A 3MIZA 5IC5A 2QVGA 5FWYA 4RK7A 3SY8A 4MR8A 4S05A 1ABEA 2E4UA 2JK1A 2YHBA 4ETIA 2FN9A 3RVLA 5IX8A 3KYIB 3QLUC 5EWLB 2JVJA 5KQGA 2LIVA 6ABPA 2M98A 3KHTA 2W42A 2GI4A 2HQBA 5C5EA 3A10A 4Z0NA 2CHEA 1URPA 3ILHA 5TPWB 3T8YA 4HNSA 1RZRA 3H6GA 2LP4Y 3ROFA 3S99A 1CHNA 3HXMA 4MYRA 2PUAA 1GUDA 3OO1A 1FFGA 5FBKA 3DZDA 3KS9A 1Z16A 1AB6A 3QLTA 5PNTA 3DGEC 4IMJB 4TN5A 1PHRA 5DTEA 2FVYA 2J48A 3L49A 2IPMA 3N0RA 2PUFA 3H6HA 1JHZA 3GA5A 1ZGZA 4F06A 3IP6A 3LUKA 4LZLA 1Z18A 5JNUA 2ZAYA 5DKFA 2VUIB 2PUDA 1NXWA 1YK1A 4JB2A 5D2CA 2HPHA 3JS5A 3QELB 4D6XA 2WJWA 1Z2EA 3KSMA 2RJOA 5T7BA 1D1QA 3VNBA 1R8JA 4KK3A 3RVPA 1TMYA 2GKGA 3KLNA 4RU1A 1LBIA 3OQOA 2F8SA 4RS3A 2M1ZA 3I42A 4Q6WA 2QXYA 1E2BA 1DC7A 1RPJA 3C6QA 4Z9BA 4ZYLA 1JWLA 1SD5A 3H5VA 3QELA 3CG4A 2FXIA 4RK5A 2FW0A 4RY9A 4WWHA 4MR7B 5ED4A 3NHZA 1WETA 3IPCA 1DCMA 2R48A 1QP7A 5JS2A 1D1PA 1EWVA 3RVMA 2HJ9A 1PUXA 1MAVA 2OQRA 3BBLA 4D6YA 4MLDA 4OATA 3CLKA 4B09A 3BREA 5KWSA 4W5QA 1D2AA 3N6VA 5TPZD 1VRVA 3OMXA 1QP0A 1NXTA 1M5UA 1U2QA 1BDIA 4QYWA 1A2OA 4RXTA 3RH0A 3W9SA 3IP7A 1FFWA 2FQXA 4Z4IA 4RXUA 4RWEA 3RVNA 5KC9A 4JASB 1FQWA 2RDMA 3M9WA 1NXSA 1SXGA 3SM9A 3GBPA 4L85A 4N47A 3C3KA 3K4HA 1EWKA 3UUGA 1P6UA 4EVQA 5DCLA 3HZHA 3QX8A 3KJXA 3EODA 3P9YA 3RVOA 3O1HB 1ZVVA 4MLCA 3G1WA 3JTEA 4EYKA 3JVIA 4LX8A 4N0QA 5HQJA 1J56A 1NATA 2FEWB 3I45A 4MS3B 3QLUA 3QLVA 5I4CA 1VLZA 3O75A 3MF4A 3MYYA 2FMIA 2KYRA 2Q5CA 3CU5A 5IBQA 3LKVA 3Q15C 3FFTA 3LUJA 5TE9A 4KNYA 3KG2A 4RK0A 4RXMA 2XDYA 2TMYA 4IF4A 5CNIA 1VKRA 3CFYA 3K9CA 1NY5A 1ZH4A 3SAJA 4EVSA 3MMNA 3H1GA 2L18A 4ZPJA 3KTOA 3KYJB 4Z9AA 1KRXA 4FE4A 1FSPA 1PEAA 3LFTA 5E3JA 9ABPA 4JOQA 1EFAA 4IMIB 2H3HA 5B3JA 1U04A 2HSGA 1JDPA 3F7NA 2AYXA 2A9QA 3O1JC 4W5OA 2A9OA 1H9CA 1YVUA 1DC8A 4O1IA 2FMFA 4XASA 1LJUA 4G0PA 3GT7A 2E4VA 4JB0A 1GUBA 5CNMA 4RSMA 5EWMB 2LUOA 1P8AA 4XAQA 1A04A 2MYNA 4QYMA 3LUAA 1L5ZA 1ZHHA 2MYTA 4MS4B 2JCGA 2E4WA 4LE0A 3GV0A 4N41A 1ZY2A 3KKEA 1MVOA 1D4ZA 5IUKC 4CBVA 5IEJA 5JNTA 3RVKA 4O1HA 4EYOA 3SNKA 2JB9A 4TLLB 1USGA 2B4AA 4RK6A 5TPZA 4Q7EA 3NBMA 4Z4HA 4ZMSA 1U0SY 5T3YA 2PUBA 2AYZA 2FQWA 4KV7A 3T95A 1F4VA 2P9HA 2WJAA 2FLWA 2L19A 4KRFA 3Q7SA 1JFTA 1U8TA 2H0AA 4IGAA 4N0PA 3M9XA 2FEPA 3DBIA 2P4UA 1NXVA 4XARA 1E6LA 1NXOA 4G0MA 1GLGA 2CHFA 3NNDA 1LBHA 2VK2A 4FE7A 5TQ2A 5BR1A 3GRCA 5CHYA 2FTKE 3H5LA 5TQ0A 4DN6A 1P6QA 4YR7A 1ISSA 2PKXA 4MPTA 2DRIA 5FBHA 5IULC 4KREA 4YV7A 4WXMA 3TO5A 2FLKA 4WT7A 4JP1A 3HEBA 1U2PA 2MSKA 2GX6A 5IEBA 3QEKA 2FN8A 5TPWA 4YWHA 5IUNC 3RVQA 5C5CA 3LUGA 5JNWA 1JL3A 1APBA 4Z4GA 1PEYA 1ZDMA 1K66A 2NUBA 3LUDA 1W9HA 5BRJA 3OLVA 3EQZA 1FFSA 3LMKA 4PE5B 3JVDA 4N03A 4G0ZA 2FKAA 4JA2A 2CD7A 4G97A 4YRZA 1XHFA 4MAAA 2NT4A 1K68A 1YMVA 1BDJA 1Z26A 3H75A 1DJMA 3OMWA 1JF8A 3CNBA 4F11A 2L17A 4HNRA 1EAYA 2F8TA 4E7OA 4Z4CA 3Q7RA 2IKSA 2QSJA 5IUJC 3B2NA 3HK2A 2WMYA 4TMYA 1ZH2A 4YCSA 2R47A 1QO0D
chains in the Genus database with same CATH superfamily
2ISCA 1NQVA 5ALGA 1TT5B 1ZLXA 1WKCA 5DHTA 2NPFA 4LDPA 3RWOA 2H7VA 1E2NA 2HO5A 3WAJA 2YFHA 4GWLA 2WB2A 2Y92A 1YZUA 2QN1A 5C31A 5TY0A 5FUVA 1TM3E 1P0QA 2H29A 2GYVA 3I2HA 4HYEA 2OD7A 2XODA 1B8OA 1QG0A 1U8CB 4IXNA 4YAJA 4DNOA 4RSGA 4B3CA 5L95A 2HF9A 3RBAA 1BFUA 1KXZA 3WSWA 1VE9A 2W5UA 1QF7A 4LBYA 1EHCA 1JZSA 2AE2A 2IEYA 5DZSA 1C9MA 2GS9A 1NMQA 1CJSA 3AEYA 3BHMA 4W7SA 1L1FA 4B6SA 4EL0A 4QBIA 1ZH8A 2H2GA 1SC6A 3IVCA 4WNAB 1CERA 4N01A 4PXAA 2ZSAA 1O9GA 2I4OA 2IU4A 4QIHA 1IMOA 3BEDA 1ZUNA 3FUXA 1RABA 4S2EA 5J9FA 1ISRA 2PRSA 2AC4A 4OG2A 4RJKA 1XEFA 2NU8B 3ZHXA 2YN0A 1W59A 1U0HC 3IQFA 1YIOA 3H5AA 1ZUD1 1OZFA 4KCGA 1JQ5A 2WOOA 3G85A 2GZRA 4X24A 3TVYA 4V1CI 2A9KA 4OYYA 2HRQA 3O38A 5F1YA 1DFIA 2FEAA 3IEPA 3H1EA 4M0CA 4R8LA 4F4JA 1ZZGA 2IFTA 3MOGA 1XDDA 5EIHA 4BV9A 3C4JA 4CLOA 3EEIA 3ONWA 5LA6F 2HNBA 5ALFA 3RYFB 3ESBA 4GMFA 3HM9A 1OWOA 4BKUA 4LOJA 5HM8A 1ADYA 3EZLA 1BE1A 1C3JA 1GKIA 1FA9A 2OBXA 2OCAA 3GBVA 3QPUA 4GBJA 1MW8X 3B38A 1X94A 4IJ5A 1RRPA 3ZG6A 2CXTA 4F9TA 5EPEA 4TS1A 1PGPA 1J1UA 4IOLA 4OXXA 2YJ5A 1IOVA 1LPBB 2HDWA 2RHRA 2QRGA 3FHLA 2WRZA 3PXBA 2DECA 4MQ6A 3SYKA 5K0SA 3TQOA 2I65A 3GELA 2NVWA 3ZUGA 2M2IA 2VT2A 2D1SA 3QYPA 1DC4A 1Q0UA 2NPIA 2BHSA 2CVPA 5AVTA 2AR0A 4CF7A 2OFPA 1YZLA 1I6KA 4ALNA 4CG2A 2OG1A 3L8HA 5E6UB 3TCNA 4G9GA 5FTKA 4DSTA 2HR1A 1GEEA 4OHXA 4UAVA 5CT8A 3OT1B 4L4RA 4YRAA 2H1HA 4MPJA 4O3FA 3IR6A 4U8GA 1CUXA 5JASA 3P45A 3ORYA 1KI8A 4KZKA 2NGRA 1CYEA 3UWMA 3WLHA 4E21A 1PZMA 1K63A 1KZGB 1Z9BA 2OENG 1EJ2A 1GQFA 3AW9A 4FD2A 4K8RB 1A2KC 2QPAA 3PJGA 2B4KA 2C9MA 2YY5A 3JX9A 4N65A 4DARA 5I01A 2R8OA 4BUJA 2EWWA 1MJNA 1KEUA 3HB0A 1K9VF 3URMA 4EQZA 4F8YA 5GIPE 1QPBA 1U3UA 1XEXA 1F51E 3B48A 3O47A 1SCUB 3FJ1A 2JAOA 1BMDA 4QQFA 1SXIA 3DAGA 1IATA 1QHNA 4QRIA 3VR5H 1W4RA 5BNZA 5ENZA 5JSHA 1PJ8A 3F2IA 2JLAA 3NHFA 2IKQA 2WT8A 4DUPA 3RGGA 2YZGA 3CE6A 1N8KA 3AI2A 3T1HB 1TYAE 1U31A 2NVOA 3ZIAA 4MKFA 4YS6A 1JKJB 5JNVA 1CJTC 4E6PA 2IH4A 1K8YB 1GFIA 2GPSA 4RTMA 3EDYA 5BV1A 4TGLA 4ZVOA 4EHJA 4ESVA 3OCUA 3FKSD 4PLCA 2BHNA 2OHGA 1RWWA 2JARA 3KJIA 4F4UA 1PR3A 1ZVKA 3OZCA 4IF6A 4YPFA 3KHKA 3AF1A 4GVPA 3SKVA 3SZ3A 4AJPA 3I5XA 2DF8A 3FPBA 1CT9A 2JGJA 3EF3A 3CR7A 4M0PA 1AG9A 5FUBA 1Y1RA 2I34A 1XCLA 2HRCA 4OUDA 2GETA 4OYLA 4RSRA 1CP3A 1F4PA 2Y0BA 3W78A 1PUIA 1QV7A 5T3UA 1RDFA 2QD5A 1Q91A 2ABWA 1CQIA 3KWFA 4DR4B 3DONA 3HU5A 3D6UA 3V1YA 1AIPA 1VMAA 4IIGA 4RFSA 3N39C 4R6WA 3CLRD 3H2ZA 4MTCA 2BGJA 3CRNA 3A7DA 1VB3A 4Q82A 1SM4A 2C3UA 2QX6A 4QXRA 2HJWA 3ZK7A 4UMVA 1G98A 2W6MA 4BRZA 2XXBA 1GRNA 1SZCA 2XCOA 2B5VA 2OCLA 2Z9BA 3EDOA 2C2BA 3RROA 2Q50A 4AP6A 4E15A 4BNNA 3GJXC 1KVUA 1B26A 2GN6A 3CT6A 5EGNA 3OLQA 4BQIA 2X1HA 2PL1A 4Z9FA 4LOAA 4XD2A 3RS2A 1FLDA 2JJ1D 3GFGA 3RFFA 2F67A 4CNQA 5HIJA 5M2QA 2H08A 4I14A 2NZWA 2XQKA 3UMCA 3K0EA 4JBGA 3MFQA 1L5WA 1PDOA 1XYYA 4TTIA 5B1HA 4DLLA 1EE2A 2VPZA 4TS4A 2XV1A 2WUDA 3PVCA 4LHWA 1PK7A 3N6XA 1Q7BA 4YCAA 4L16A 3E0QA 4DSZA 1ZITA 1E8DA 2JIQA 3B1FA 2A4KA 1KJ9A 3L6CA 3L92A 3UK6A 4WTOA 1A72A 1M2OB 4GNKA 5AW9A 4B3HA 3U3XA 5ELXA 3TSYA 1GNSA 2A9PA 4G1EB 1UFRA 5LXTB 4RLHA 2JG3A 3B7WA 5KHOC 5CBKA 2NSHA 3D7KA 1DIRA 2IHZA 4W1SA 1EVYA 1L0BA 2ZTLA 2CLSA 5CT5A 1O54A 1UJ2A 3GARA 3WWDA 5GZ1A 3CA8A 2FPRA 1AHNA 1PNQA 2H7YA 2QTFA 3BE8A 2Q7XA 2CJFA 4UTRA 4QLBA 1SCDA 3OHSX 1XZQA 4S24A 3NHKA 5C34B 5IVKA 2K87A 5TARA 2IZ1A 4MV7A 1VPEA 5DB4A 2R6R1 1XZIA 3COZA 3OO0A 4N5NA 1AQNA 3E9EA 1XAGA 2V7QD 3CH4B 4QTUB 3C1UA 4F2HA 5IM4F 3UHOA 2K7FA 3KVRA 4I4IA 3VVMA 2I9KA 2C8KA 4F4DA 2B7CA 4FONA 4KXUA 5C7IO 2P0EA 1UDXA 3KEGA 1GCGA 4A8TA 1V47A 1AU9A 3IT1A 3E9CA 1SBQA 1QUFA 2BMAA 5BRAA 3VTAA 1HGXA 1NVDA 3LCJA 3OQPA 4FNAA 2ZRIA 3NV7A 5FYQA 3BH0A 3I32A 2VOEA 3UOWA 2QR5A 2YRWA 2ZBFA 2ZJ8A 4NNOA 1V5GA 2DX7A 4I4TF 4LXGA 2EX1A 4L8GA 3QKIA 4QHSA 1UIMA 1OHHA 3ZU2A 3AR6A 3FFWA 3I9V1 2XB4A 3SX0A 4Q0MA 4JBYA 3T0GA 4ERNA 3Q11A 5DBHX 3ZWOA 4A0SA 1GTRA 1KK0A 1E98A 1KO8A 3EGCA 3FB4A 2XF2A 2O3RA 3T99A 2DXIA 1TM2A 2GPWA 3GRAA 1LU9A 4L9SA 2DUJA 2F00A 2AF4C 3CF4G 1VXOA 1Z0DA 2D0DA 4YQFA 2C4WA 3R6WA 2CB0A 4H3KB 1XTSA 4QFCA 4WK0B 3LJKA 4B84A 3HQ4O 4AJ2A 5K8VA 2FZLA 2ZROA 2ZQZA 4PYQA 1K6EA 4HPJB 2UZ4A 3JQ7A 3G5AA 2G07A 4IUCS 1YDGA 5FWYA 3FTNA 4AN1A 5KAPA 4CLDA 1CZLA 1H3FA 1K4YA 2PKQP 2BV3A 3JQ8B 4RLSA 3ENWA 4UEOA 3CUTA 2XPCA 4GZ6A 3OJLA 5DBOA 4FD3A 1JR3E 1XVIA 2DTEA 2GBCA 2JJ2A 1K0FA 2NSLA 4JBXA 1R4MA 4MYDA 4ZO4A 1HG0A 1AV6A 2IS1A 4RNDB 5CAEB 1I36A 3EASA 1ZL2A 3MVEA 3D7MA 2B3DA 2CHEA 1S3GA 4GC9A 3ILHA 2IBTA 3FOZA 5GMOA 4HNSA 2BFDB 5B7NA 5JXIA 2CDRA 4DV0B 2HY7A 2PJDA 2HOQA 4D8VA 2FKNA 4HGNA 3TQQA 1F8GA 4N3GA 3AZOA 4G5SA 3LT1A 1JJVA 1VL2A 3QUBA 4IHJA 4MYHA 4TN5A 3SYTA 5LLTA 3K31A 1XNRB 3IHLA 1B8VA 3GC6A 1EVLA 3JD2A 4BNDB 4F06A 5EQJB 1Z18A 1M2KA 2DKFA 4WINA 5ELLA 2GM9A 2VUIB 3LHKA 4MVJI 5HJ5A 2V7QA 1RTTA 4BMZA 2QIOA 2XWPA 3NPMA 1GTSA 5IC6A 1Z6TA 1QTNA 4C4OA 2VJBA 1U0RA 1QH1A 5HKBA 3PJDA 2Q49A 2O0KA 1V5WA 3H42B 5A06A 1TFRA 3UB4A 1CNFA 3MELA 4FUTA 2P9EA 3AEUB 1JHVA 4IOKA 4MTLA 2ZVQX 4YRIA 2QTVB 1ZBQA 2HDOA 1KZ4A 4KO3S 2CLEB 2I7DA 2XUAA 1K3FA 4Q6WA 4KPGA 2I8LA 1U7HA 3R24A 1YQTA 2F48A 2CMFA 2P9QA 4KWCA 4RACA 4LNHA 1VHWA 4MGHA 2Z56A 4AULA 4YUZA 2WW8A 1ONNA 4U7GA 1ZN7A 1DCMA 2A78A 1ENPA 1HFKA 1UBGA 4L5JA 1N2JA 2ZR0A 1ZGHA 2PCJA 3L8MA 4IMRA 4MYCA 4DLRA 1KEVA 4D9CA 1UWVA 3WNQA 5JTUA 1F0NA 2HREA 5TT0A 1ZD1A 4JVLA 4O4JF 3W90A 1R8SA 4AG3A 5DIZA 4D80A 3MC1A 4QECA 2MT9A 4Q3BA 7MHTA 4YX9A 4GQAA 2QI9F 2JFBA 2FPGA 1KYWA 2O8CA 3CUKA 1KPGA 5CUQA 4Y2PA 4ZOLF 4A82A 2GF9A 2B6NA 2WHXA 1DT3A 4R8RA 4AYXA 1K8RA 4E14A 3U4QB 2YWRA 5DBGA 2SICE 4MGKR 4TKZA 1S96A 1U8EA 2ATCA 5D7BA 3QX8A 3WADA 4Q4HB 4KNVA 3ULKA 4N0QA 1NATA 3PRYA 3UJBA 4EA8A 3SYLA 4IZIA 3FTEA 2A1IA 1ZHFA 1GYQA 2NO0A 5FUYA 4DYVA 4UNRA 5FIUA 3BXFA 4TTTS 4AJNA 5LQRA 1N25A 2UUAB 1VCHA 2AN1A 2GKSA 1UJBA 2VO1A 2V97A 3PT5A 4IRUB 4PGFA 1N2IA 2F62A 1R9NA 5FFMA 5FLKA 3DDNA 4LSWA 4W6QA 2YOFA 2WUGA 3AVOA 3ENZA 3IHTA 3K9CA 3KQOA 3F2VA 4M8NE 1GGEA 3T3OA 1L7PA 1PZFA 2D7CA 4ZVRA 5JDCA 5A4IS 4X41A 3DKKA 4AQ7A 4ZK6A 5TF0A 1A9ZA 1ZOLA 2FEXA 2ASVA 3GG2A 5F3WB 2R5NA 3U1BA 1MH9A 2G04A 3B6KA 1QGZA 2QENA 2Z57A 1QZTA 3BULA 1OZGA 3DEAA 4CLOB 4CL3A 1YD7A 4WZBA 1IZ9A 3GUUA 1VDMA 2AYXA 1JQJC 2IHYA 2XUKA 2XNKA 4BKQA 1DC8A 1G3UA 1Y4UA 5C1BA 3CSSA 1CC1S 1YB6A 1GILA 2SBTA 4HGQA 4JB0A 5EYPA 2X0EA 4WDQA 1VE5A 5CAEA 1PT5A 3ZWYA 4M4SA 4HUJA 1XVUA 4I1PA 4TS9A 2PH7A 5JZ9A 2EWMA 2PPVA 4DSOA 2JAPA 2AOXA 3LY7A 4I1RA 2G83A 1Y89A 4RL4A 1XZBA 4RFSB 1OGIA 1U80A 1EZ4A 2MYTA 2YIMA 4MS4B 1MHPA 4DA7A 3Q0EA 5IBPA 4D9BA 4N41A 1IOWA 3MEQA 3T7EA 3RIXA 1RACA 4YPVA 3AVTA 5KNDH 1F60A 2E82A 5I48A 3WS7A 4R0MA 5DX8A 3PEYA 1W2GA 5HVNA 4IR7A 1RHKA 4EPWA 3FI0A 4P4TA 3OLCX 2GD0A 2HV8A 5BT8A 5KTOA 1EGMB 1JEJA 1UJ6A 4N0MA 4KN9S 1IXKA 2D4HA 2KS6A 4KV7A 1EQUA 2GPJA 4OJYA 1MOPA 8LDHA 3BQ9A 2CNKA 2IYUA 2Y6UA 1N6OA 5CURA 1HZJA 1L5FA 2FMTA 5SZHB 1RLMA 1JXQA 3A4LA 1ZPDA 3ZWNA 4KI7A 2X15A 3RO7A 4B47A 1NXOA 3L1UA 4B4KA 2C07A 1Z8DA 2HHJA 1XNJA 2E49A 3GRCA 5THQA 4ENUA 2EOAA 2Q62A 3D3WA 4Y2VA 2PSDA 3K9GA 3ZCTA 4G4SO 2FG7C 3LWBA 2A9FA 2MR5A 2P9ZA 2Q5HA 5IJZA 1KQOA 3NGXA 1KK3A 2CNLA 1LV7A 1L4FA 1PTKA 4JP1A 1U2PA 5CJJA 1L7VC 1SHLA 1SCKA 2FN8A 2G1PA 4K87A 4NAHA 2HIMA 3GFRA 2XMZA 5C5CA 2FR1A 2YV4A 3G68A 1ZRNA 4JLOA 1T4DA 1Z4KA 2WF6A 2XTAA 3EUFA 3GRFA 4HMPA 4QVIA 1UMDA 1WHSA 1QZZA 1AUXA 4D9KA 1QIMA 3HA5A 3WLAA 5KS2A 2VSQA 1QFJA 3KZVA 2KPOA 1WOYA 3HHPA 3VOAA 3HKEB 1Q74A 1VKOA 1UM9A 1W581 1YCGA 5EPOA 5F9FA 3O93A 4TYPA 3EH1A 2CVHA 3G0BA 5GVRA 4KLRA 1HR0B 1SBNE 4BVKA 2XLCA 3SP1A 1BDJA 5B3LA 3HN6A 1I0ZA 3N05A 3RYFA 3IAS1 5EP1A 2JLCA 1RM3A 1X0XA 1EAYA 1DBIA 4ONEA 3VNSA 1QKJA 3T7RA 4FHDA 1SUWA 5JNLA 3E3NA 3PXDA 3VZSA 4R8KA 1C81A 1OT5A 1Z5OA 2DPMA 2ONZA 2HEGA 3HCPA 4D3YA 1JUDA 3M5PA 1BJTA 3BORA 3N2KB 4NXNB 2YC2C 3K9QO 4KQIA 2E5FA 1NUUA 3I1JA 2ZJOA 3UHPA 3ECCA 4B81A 3OFJA 2QZ9A 4RDCA 3T5BA 1NLFA 1WQ1R 1I7PA 4B5KA 2Z58A 3CUEF 4LFCB 3A06A 1W29A 2ZYIA 3R5KA 3U7QA 5GTDA 5B12A 3GLFA 3U5ZB 4JH0A 2FRXA 4LTNA 4DKJA 1ODJA 4K28A 4KXYA 4LZAA 4L76A 4TXMA 3TZCA 3K1AA 4BX8A 5DNUA 3MJTA 2LCFA 2C2MA 2H4FA 3FX2A 3HJRA 3CRRA 3Q7QA 4R54A 2TSYB 5B7PA 5C8YF 1ZVMA 2Y1GA 4ZANA 3EFEA 4MVJF 3BEOA 3PS9A 3C0KA 4CDGA 4CEHB 4GOKA 1Z6PA 2RGYA 3SF8A 1IWBB 3S55A 2CL7X 2WUVA 1FRVA 2JD0A 1EX6A 2E4ZA 2JFPA 3EJWA 3LZDA 4MRSA 3AV3A 3VV2A 2WF7A 3BMNA 2UYGA 3E61A 3F6BX 3K5PA 2OY0A 4NBUA 2VKQA 4RHFA 3GLGA 3M82A 4FK8A 4GGOA 4IGFA 3RB8A 1TKBA 3V7YA 3F49S 3GJ3A 5JW6A 4I7EA 1FFBA 1OTXA 3JPWA 5EZ5A 2AN4A 4PF1A 3SXJA 2GBGA 1WQ4A 3ZY3A 4ZOLA 1WV0A 4BCBA 1OWMA 4JD5A 2HPAA 1C7ZA 4OTZA 3RSCA 3D5QA 3GF4A 1H5NA 3KPJA 1VSQA 3H2HA 2NADA 3AIOA 2RHWA 5K03A 1A8IA 2D1FA 2QXTA 3EBPA 3T9EA 3TPZA 2Y2UA 3F5FA 3OU2A 4DRZA 2HLPA 2IYNA 1XCPA 2DE0X 3ESAA 2HMAA 3OD5A 1CFZA 1VPDA 1WD5A 3SVTA 1N2GA 1PYGA 2XGSA 2PBLA 4QTXA 3W5VA 4HVCA 3UK0A 1PK8A 1WKVA 2I1LA 2ZYDA 2GO7A 2PLRA 3IVRA 1OAOA 4JN6B 4LKOA 5SY4A 2YDYA 2XX3A 3ROPA 2QM7A 4A0GA 5INTA 3JZDA 3CEMA 4F8EA 4L0QA 5G4LA 3ZJYA 1H1TA 2WAMA 221PA 1DWOA 1IPHA 1PJ2A 1XTIA 2WB4A 4EGAA 5ICSA 1N34B 1JXMA 1MFPA 1U1IA 2JW5A 1XJQA 1QGAA 2DYKA 2KX7A 3D0OA 3DSRA 3ASZA 3GO4A 4B40A 2BFWA 1OXTA 4CG0A 3GLIB 4QDXA 3NHJA 2Q6OA 4ITUA 3HN2A 2WAAA 4OYRA 3ZLVA 1KI4A 2FSFA 3EOAI 4HPWA 4K1XA 4QDOA 3PCXA 1QAOA 3VFDA 1EIZA 3JARB 5THXA 5CA1B 1N3LA 1FUEA 3HKBA 4NNPA 1N9GB 1T8UA 3W4JA 2YCBA 4MYUA 1N2OA 1REQB 4GL4A 3U39A 1VJ0A 1H2RS 3EZ9A 3LQ1A 5FNVF 1O1YA 3MTIA 2I4IA 3OQVA 3PKIA 2EKLA 2CXUA 1UEIA 3NEAA 4QHYA 4S0XA 5H70A 3UUGA 3EQ8A 4O4IF 1YBAA 4PBTA 4U2BA 1II8B 2FQYA 4IWYA 1FP6A 4FR2A 4BO0A 4I50A 1NR7A 2FZ5A 3VR5A 4C6SA 1BHJA 1X14A 3NHWA 4RC9A 2ZJ7A 3S2IA 4QTTB 5DNVA 1Z22A 3QEMB 3SEQA 4B4WA 1SULA 3D2AA 2E0IA 3BTUA 4J29A 4JR2A 3WVNA 3T5AA 3DV0B 2HCJB 2JFVA 1L7XA 3AP1A 4LMRA 3SR4A 5J23A 3OZVA 1IUOA 3IBFA 3NALA 1E6EA 3P0JA 1PWHA 3HGQA 4NE7A 3PQ7A 2MWMA 4U2FA 4QUHA 1A95A 3OZUA 3USZA 2YUIA 3L4BC 2QN8A 1J22A 4JX8A 1EUDB 3GVHA 3CHYA 3OH8A 1K6XA 3DFMA 4OY3A 5D1HA 3ZW7A 1FBNA 3E3MA 4C76A 1RRKA 1V41E 3VPSA 2BFCA 4L4SA 3QVUA 1YS9A 4CQMB 2HU8A 2FSVA 1NJGA 1ZVJA 1H4QA 1HURA 3UOGA 4U7PB 1U9IA 3TQRA 3ZHUA 1VG9B 1KI3A 3JV7A 3OT5A 3K0AA 1H0KA 4HWPA 4OA8A 3O4FA 2O8BA 2WTEA 4DXDA 2A94A 2YHAA 4IQ4A 2Q3BA 4ZOEA 5ETJA 4INJA 4YCLA 1NYRA 3FYCA 3ZZ0A 2XEXA 1BMFA 5JMWA 4YRTA 3AF6A 1M10A 4G81A 3RS4A 4PCAA 1WW3A 4B74A 1IM2A 1I2CA 1ZIYA 3MUFA 3WNCA 2QJOA 4BXOA 4W9RA 4CDRA 5B55A 3RADC 1AZTA 3AUTA 3E23A 3WJ7A 3GL9A 3A70A 2YVLA 4Y6RA 5EFZA 1NI4A 2G7ZA 5I7WA 1CUBA 1W52X 3E7XA 3FR7A 1UAGA 2Q0QA 1E2QA 1CNEA 5KSPA 1E2HA 2O5RA 3RRBA 3GEDA 1KL7A 3C3MA 4IDEA 1CRQA 2Z43A 1CFJA 5CFMA 4QNNA 5D85A 3D1VA 4FHEA 4M9XA 4XCXA 4NFLA 3MINA 4QNRA 2HM7A 5HK8A 8OHMA 1OBOA 1QGUA 2QQFA 3TRHA 2G77B 1DDGA 1MB0A 2GSDA 2JHCA 2QTHA 3A3KA 2EFDB 3OPYB 2VP2A 4JMPA 4LJSA 4FILA 1NKTA 1HTBA 4B3BA 1L7QA 3VNRA 4YLEA 5BYBA 1H8HD 2BI4A 2HXYA 5CX1B 3TQSA 4E46A 3LHFA 4DR5B 3AHFA 3BSYA 3L4BA 4MUGA 4RK1A 5DHAA 2PUCA 2H2WA 1HDOA 1RJWA 5J5VA 3SOZA 3V1LA 3AM3A 3ANLA 4JJ7A 1ILWA 2WM8A 3E8SA 1UC9A 3R44A 4M1KA 5G41A 4BNUA 1C1XA 4BVHA 2XCUA 4IEIA 4F84A 5CLQA 4FHCA 2JJYA 4A03A 3D2CA 1PL8A 3H9JA 3DVAA 4EYSA 4WI1A 1JA1A 1BNCA 4HX2A 4OFWA 3WLTA 4ZDJA 2BDTA 4JY7A 1UPCA 1DV1A 2CLOB 2Q4BA 2Q6KA 4P38A 3RTEA 3SMVA 2PUEA 3HB9A 4OI0A 5K3CA 5EWMA 4M86A 1EFLA 4PLGA 1W88A 2C9BA 3DKVA 3H5WA 1W5EA 4J0FA 2FW6A 4BO6A 4J7CA 4XLTA 4QZVA 5I3CA 2AEJA 3I76A 4TYNA 5ECWA 1WZCA 4CTNA 1EAMA 2NT3A 4B85A 1Q1ZA 3K16A 3KELA 3JZAA 2EW1A 2X5OA 1ACJA 2OD9A 3CMMA 2B9EA 4EK9A 1XAJA 1KJNA 2VFAA 5KTNA 5IVHA 2VRBA 4MS4A 3WL4A 1PZEA 3MD0A 3N76A 3LRXA 2AEMA 1OGJA 2QK4A 4ZPXA 3IMFA 4DIEA 1EDOA 4WUTA 4XQEA 4RD4A 1YVPA 1CP2A 2PV0A 3RUPA 4R1OA 3X2FA 2VSXA 5FPHA 1KVTA 1ZRSA 4Q9DA 5EWJB 3I5MA 4AURA 4NQRA 2BOVA 3O2QB 3MCUA 1NE2A 1SC9A 4FZRA 3DEYX 1Z68A 4RPGA 1U3VA 4G84A 1PYDA 1JBKA 4BZPA 2V0NA 1UKEA 4RVSA 1CF9A 1S8OA 5J4VA 4GICA 4I5DA 4AP5A 1P33A 4HAYA 5MN6A 1G7TA 3L04A 3O9VA 1FNSA 4CG3A 3KT0A 4GBED 4XB1A 3ZI7A 4YAKA 2WDZA 4MR8A 4D9NA 1ZQ1A 2E4UA 1QCYA 4V24A 3QBEA 2FPPA 5KEIA 5SV2A 4L02A 2FY8A 4RANA 5G0UA 4G9BA 4D41A 1H23A 2I80A 5L53A 5IANA 1W4ZA 2ST1A 5ISMA 1JTVA 4X93A 1Y8RB 1ZUHA 3COJA 4XX0B 5KYYB 2AF3C 3F4KA 1UWLA 2R2GA 4FOSA 4UPEA 5IFLA 5HNKA 1HNXB 3ED1A 2BM8A 3ZNNA 2BDUA 1A5TA 2ZI5A 4ZODA 4DG9A 2I0FA 3EUAA 3X43A 4CKBB 5FR1A 4D3DA 3F3KA 4EELA 1AQJA 2FSSA 3MT9A 2NYUA 1K97A 4Y98A 1AB6A 3QE3A 5TGTA 4IMJB 1GWNA 1PHRA 2AWOA 4OGKA 1NBWB 2BR4A 3N0RA 4QYIB 3S1AA 1NNEA 1T4CA 1JJBA 5GIOE 1L4GA 1ZGZA 2BWJA 3CISA 3PE4A 1GN8A 521PA 3OJCA 4Q16A 1OBCA 3VKFA 5JNUA 4OB6A 1EDDA 4YJKA 4BDTA 5ADHA 2UUPA 3OURA 3UGKA 3LOQA 1FRNA 1T5SA 1VSUA 4KODA 4LHSA 2BI8A 3A4NA 4N7BA 3SHQA 1YQQA 3U40A 4MA4A 1GPNA 4O4IB 5H82A 3QUQA 3S4YA 3OE7D 4FCWA 4CIXA 4WLVA 4BFVA 1WMEA 2TMKA 5JO9A 2ZRQA 1G2PA 1ZR4A 5IW8A 3DVQX 4MWCA 3V2IA 2YASA 2ZITA 4X45A 4YB8A 2WWXA 4BFZA 1LQTA 3U81A 5AOBA 1TJ3A 5BSMA 4EEXA 1F06A 1MEOA 1K06A 3HU3A 3IEXA 3Q2IA 4G37A 4EG5A 5LWQA 1I3MA 1MO6A 2PV7A 4YLGA 1E4OA 3BBLA 1MUUA 1Y8AA 3G89A 3DWFA 3L8EA 4JLUA 3STUA 1RKXA 2PZFA 4NBRA 1GRCA 4C2TA 1X1CA 4DEXA 1H8HA 2CNBA 2LRHA 5KU7A 2R68A 5CVJA 1CS4C 2XDAA 3SOPA 4BE4A 3OMXA 3E9QA 1U1GA 2XMSA 4GR9A 1P0MA 2HWYA 3TBFA 2H8GA 4JYCA 4QYWA 5BW8A 4CIAA 5CIYA 5A2GA 1P5RA 3UA4A 4R1MA 2HF2A 1I4LD 1JIJA 1TTQB 1HOXA 1GQ2A 1LY1A 2ZIZA 1T6BY 2CJPA 3SM9A 3W1VA 1FZTA 3DNFA 3RTGA 1M5RA 1LQ2A 3CN9A 1CDOA 3TRKA 2OK7A 5DT9A 3ENKA 1AKVA 3DYVA 4L73A 5L4SA 5DX1A 4RY2A 1YOVA 2NUPB 1N3BA 3GZNB 1FFAA 2VCEA 2R7MA 4HH3C 4JB8A 5F4ZA 5JJKA 2F1IA 1B16A 3TNFA 1V4BA 1NURA 2AK3A 2R0QC 2PX0A 2QZ4A 4TLDA 2O7QA 1T5BA 3NBUA 5JWHA 2E3JA 3F9CA 5EP2A 1IH8A 4S1OA 3DH0A 1OREA 4Z86A 1DQNA 1C4KA 3LX5A 1LWNA 2P9BA 3B5EA 2FW1A 3NKFA 4JQOA 4KKXB 3ZGNA 5EJEA 4WFIA 2C98A 1NY5A 2ZRHA 3GCZA 4DVGA 3LW7A 4M46A 3BMNB 3IIEA 4FE4A 5A1TA 4CLRB 4MW9A 2BM0A 1KAQA 3A2KA 3J7TA 3RNLA 1F9AA 4J2OA 5BMOA 2FWNA 2DETA 2OZVA 5M5BA 3NBYC 2VEOA 2HSGA 3E22B 1Z0JA 3O1JC 2AG1A 4G5GA 4PTZA 3TJMA 4CCYB 2Q6LA 3HR7A 3I6IA 1AZSC 2E4VA 3AR2A 1PR4A 1TYDE 1JSLA 4JP3A 3I92A 3K20A 3EC1A 1I4DD 4KQ6A 5DBEX 1Y1QA 5K8CA 4RKFA 2QTBA 1CQXA 2F9FA 4RUKA 1RWNA 1X7XB 5B4VA 1Y4AE 2NN3C 1JQAA 1RP1A 5ITVA 2FV8A 1V3TA 3HCCA 4MZDA 5HA5A 1PWEA 2DQKA 1T91A 1V39A 4UVIA 1G7RA 3QVLA 2ZUDA 2W2VA 3QRWA 5JIBA 5KNCH 2PXXA 4MW5A 4DPLA 5BUSA 1RBYA 1VJRA 3R9KA 1UIRA 1HTWA 3LSYA 4GLOA 4NYJQ 3I8SA 1LX7A 3IMKA 4IQ8A 1P0FA 4JL5A 1KC3A 1U0SY 2AJDA 4UZSA 5T3YA 1KIMA 2PS0A 3A6LA 3CKKA 3PNPA 3T0IA 1Q12A 1CUAA 1A96A 4M99A 4F86A 3SQMA 3JAKA 2FLWA 3ONDA 3THXA 2PZGA 1ZAKA 1BD4A 1Q6YA 1GXSB 4OQMA 1KAHA 1W36C 2OM6A 5E4YA 4XVUA 2V3VA 3FTCA 4OHRA 1GLGA 1DDOA 1LVGA 3I61A 2AC7A 1U0OC 2WF5A 1EH5A 1RBMA 4D8UA 1BX3A 5CHYA 3ZX4A 4X62B 4JI7B 1W76A 3ORFA 1VBKA 5BN5A 4Y6LA 4AO8A 4ZZ0A 2V03A 1P6QA 2BFDA 2LXNA 2RG1A 2VCYA 3EGXB 1MGPA 3I37X 4PYJA 1HETA 4R05A 1T6YA 3P7MA 2E18A 1MDBA 2Z4SA 4RVCA 5BSFA 5JYBA 4OP2A 5IAKA 2IHUA 4QQ8A 3ZPXA 4DXHA 1E5LA 2C61A 3HDQA 4RZ2A 1CEXA 1H8ED 4ZT3A 1VE7A 1J23A 1FXUA 2Q5FA 3TX2A 1APBA 3G82C 4YCSA 4FEYA 3GGOA 5EHXA 1T36A 2VPYA 1XTTA 1S9HA 3CZ4A 3JZMA 3RV3A 1ZHOA 3H87A 2J07A 3OLVA 3TMKA 1GYPA 2ATEA 5H4HA 2P6UA 3ZJTA 4H0NA 2XAAA 1KBZA 1V7CA 1X3SA 2IIVA 2G5TA 1TQDA 1YKFA 1VECA 2FW8A 3N2GA 1P60A 3G59A 2IUFA 3R6TA 1DBSA 3G0DA 2RARA 1JF8A 1AGRA 2I76A 1EP9A 3ZEIA 1F0YA 4M1YA 5HXAA 1QRRA 4BLPA 1EESA 1QANA 3U4MA 3FCYA 1WZUA 1XZDA 2A3NA 4AN4A 3SKYA 3JAMA 1NN5A 3OCZA 5I7SA 1AT1A 3H3FA 1IWOA 3UPUA 1COWD 3PD7A 4XYBA 4TVOA 5LZ2A 4AF6A 1KS9A 4MQUA 1XTVA 1ELOA 2QORA 2YWHA 2A33A 4K8OA 1PKXA 5ITZA 4B3TB 2O2CA 2Q5JA 2QA5A 5HUJA 3HK2A 5KOIA 4K26A 3TQFA 3NTVA 2BKUA 3AJ8A 3ANTA 3DOFA 3K9WA 4JUFA 1G20E 1QIGA 4MQEA 4D4JA 5HKKA 1TU4A 4IDDA 4AZ3A 2JAQA 2P6NA 1TK9A 1M2NA 5EHIA 2VJAA 3NAMA 2GWHA 5HILA 5DXJA 1UT6A 2NUAA 3JAKB 1L5GB 3WWYA 1Z2DA 1ZJWA 4UD2A 1P9LA 1JLMA 3ZZNA 4GMXA 4QQNA 1TNDA 2YQ4A 3M70A 2YKGA 1DAOA 2X2EA 1OR8A 3PHLA 1YDHA 5GGXA 1Q14A 3TNDA 2OV3A 3CLTC 5TNXA 5K0BA 4V0LA 2BMWA 2WMDA 4RQUA 2ZR7A 3TZQA 4HDCA 1Z33A 1S4QA 3ZHTA 3MJFA 4HG2A 4RDHA 3VMFA 5FT9A 3NTOA 4OK3A 2BE9A 1J8QA 1Z82A 1XXHA 1QS0A 5JISA 2GRUA 4IJUA 2ES4A 3ZH9B 4ME6A 4MP3A 2P7HA 4QU9A 2R7AA 1QTQA 1E7RA 3HCFA 4DJ5X 4BU1A 4EY8A 3A28A 3MW8A 2OHVA 1LTKA 3DAOA 3BYZA 3JQPA 1E1QA 2IOFK 3X2EA 3R3YA 5I4BA 1QLJA 4AKHA 3HP1A 3JARA 3FA2A 3VZCA 3HACA 2QIPA 3PUWA 4PVCA 2OHXA 2WWFA 4TKMA 5CK5A 4DB2A 1C2TA 3HKCA 2NO1A 4D1YA 2FUCA 4KHZA 2ZATA 4EKDA 3FOFC 3H65A 1DOZA 1D8TA 1SVWA 3OZSA 3BRWA 5AHRA 4PXSA 1J7JA 1TM1E 1B93A 2Q2VA 3NDRA 1CUUA 3PX2A 5DTIA 3VYRB 1T26A 5CP8A 4C0XA 4DNXA 1M33A 5K99A 1IBRA 4BO9A 1I4OA 2NZ8A 1Y7TA 4G9EA 4IZOA 2O8DB 3AIMA 2R86A 4OXKA 4FYIA 2GXUA 5EIBC 2UUBB 1YHZA 5DCUA 4UXIA 2DOKA 4PAQA 3RUHA 3L9XA 3CF0A 1QU3A 3THYB 1C9NA 3H9GA 1DEXA 1GUYA 4LBVA 5D51S 4Z7NB 4TROA 1XPOA 1RYZA 3KVVA 5DIFA 1REQA 5IBCA 3BXGA 5CGZA 1XDBA 3N7UA 1QOQB 1QRAA 2BFMA 3M8KA 3TW8A 4KXVA 5E38A 1YFLA 3EPHA 1ID8A 5IH7A 1M8FA 1HNNA 4F7WA 1GFSA 5AUPB 2XVYA 1ODIA 4ARAA 4LF6B 5DXAA 4KK4A 1Y1LA 1R6TA 3H7IA 1Z5WA 4I3FA 1T0PA 3C5HA 1M6NA 3ZBQA 4PSVA 1DTWA 2Q2OA 3Q40A 5M3BA 5CFOA 4YCNA 2X3YA 4ESEA 1XN4A 1U6JA 1W87A 1UF9A 1Y0BA 1QIDA 3C6ZA 3L7JA 1DQSA 3OOYA 5EPUA 4ALMA 2VS1A 3HYTA 2EL7A 1CUJA 2CFRA 2PIDA 2GUGA 1R0YA 3AR5A 5AYVA 1DGQA 1GQRA 3DTTA 3LC2O 3MBIA 4FFSA 3U4DA 4DANA 5C8YB 1VP3A 4V0OA 4GL2A 4IDHA 4PVDA 3HEMA 4S1VA 3VU3A 3DOEA 4I55A 4WEQA 5BMVF 1JE0A 3UC5A 3K70C 2OXFA 2FFQA 3Q3CA 4TKLA 1T13A 4GKJB 2WKSA 3QPCA 4FQ5A 2Q0HA 4W99A 3DFKA 5E4JA 1BE6A 4HNUA 4ITVA 5AHKA 4YT2A 2H1FA 1NUHA 1RCFA 2Z98A 2VHEA 3GYGA 3MGKA 4ZQCB 3AFMA 5J5CA 4DJJA 3BCUA 2ATVA 1U7ZA 3QWFA 4MVWA 2F1OA 4XSGA 3LQKA 3TD6A 3ZWCA 5JBNA 4EFNA 2OXEA 1SD1A 2K2QB 1O5TA 3EHEA 4NCKA 4WZ6A 4WXPA 5FA6A 1AD2A 1Q0PA 3T7AA 1JU4A 5A6SA 6CHYA 3F9RA 2EYUA 5FD8A 4ZIRA 1KDOA 7YASA 3OLWA 1Z6XA 3FVWA 1H6BA 3DW3X 3GAZA 3RUDA 4GYJA 4C6TA 1N0UA 4HLUA 2GQ0A 2QN7A 2WICA 4HAXA 1MRNA 4CM5A 5D6OA 4NOMA 2Z1NA 2GILA 4J4BA 4NZPA 3GUVA 1GDHA 5DULA 5EJ9A 4Q9KA 1JLLB 4HNAB 1YS6A 4LQLA 3TN7A 2UYCA 1SHKA 3MWLA 5DHPA 1C50A 2C2GA 2C5FA 2YVAA 2ZUBA 3SG0A 4BWYA 4IVRA 3IIJA 4UHKA 1NBHA 2C1EA 4XEUA 5DW3A 3FSGD 1SXJC 3QG1A 1KOFA 3O9ZA 3IPLA 4PZ0A 2J45A 3IV7A 4UFPA 5JTTA 3W05A 1GFWA 2V7VA 2VZEA 1AGNA 1Q11A 2VBGA 2D2XA 2LPMA 4C07A 2X76A 3A1FA 3QWBA 1ZXLA 3C74A 4QOJA 5HCUA 1WBBA 1HK7A 3LW8A 3GPCA 5LKAA 1XNGA 2WSMA 3MWFA 4WZAE 4N3NA 2WJYA 2WWGA 2YWCA 1AKWA 4L4UA 5EQTA 3S70A 1Z4IA 3C6BA 3W7BA 2I6UA 1JDBC 1G8HA 3NTXA 2YYAA 4MNTA 2IXAA 2B21A 3DBHA 1OKKD 1CUWA 5JPCA 1FFEA 1MOZA 1JEAA 3D0RA 2C0CA 2O0JA 3VO8A 1E4EB 3HXQA 5L45A 5L3SA 1BU8A 1EFUA 1FMTA 2C7BA 1KPHA 1Y1SA 1ZICA 2AVNA 2H0RA 2QD2A 3A4IA 4XSVA 5E2IA 4BYGA 1KEEB 4C01A 2HTFA 3MQ4A 4ZO8A 4B75A 3VPFA 3BRWD 3AERA 4NR0A 2PSJA 3KCNA 3RASA 4CODB 3KV1A 5JC8A 3MGBA 2LD4A 4OYHA 4IP0A 3VPDA 2ZU0C 2FEOA 3FDXA 2JFHA 3NH6A 2H9IA 3C7KA 3QF7A 3T4PA 4XWKA 1RCTE 1EXDA 3KXPA 4POAA 3T6KA 4KQHA 1X2EA 3AX6A 1XLWA 3LV8A 3T5TA 4RA9A 1SURA 1PX0A 4BZXA 3GU3A 3L5OA 3M83A 5EHZA 4ZD6A 1TT7A 2H2FA 1K8ZB 3E9NA 1WCIB 1YFZA 3OC0A 3QP9A 5KVAA 2EZ9A 3A1WA 2OHIA 3RK0A 2ZB7A 3RC7A 2B0CA 2IYTA 4AUMA 4FE3A 2RHMA 4FYVA 3HABA 2XQGA 1H65A 5I47A 3PITA 3T0FA 2BGMA 3KBBA 2V7TA 1JLSA 5CB4B 3S5JA 1E58A 1NDHA 2J3LA 1UAYA 3PDCA 2JLUA 3DLBA 1TVMA 1TF2A 4LN1A 5H59A 2CJYA 2FU5C 1IPEA 1WSDA 1Z73A 2P2DA 1QIFA 3N8KA 4TZTA 1QE0A 4B7CA 1P0CA 4BWGA 5AJXA 2X6RA 4RVFA 3P9KA 4LAFA 4CMIA 3U5TA 2JRLA 1Z3IX 1T9GR 4XIIA 1D6SA 1GV1A 3MIZA 1C0IA 1TVKB 4ZVUA 3H2GA 2VJPA 4DSNA 1Q7TA 2UVPA 4GGMX 2J6IA 4KGZA 4L0MA 2VSYA 2KJQA 3OE1A 1IMJA 1O8CA 1N5MA 1KY4A 2ZVJA 4FHFA 2WWYA 2F4VB 3STVA 4QRHA 5IAOA 3I2JA 2V98A 1ECLA 1E1YA 3DMTC 3EHDA 2XWQA 3OX3A 3RT1A 5JSYA 4C29A 4RGVA 1JEQB 1W1UA 2CLHB 3ZDBA 1PW7A 2WV7A 3AOEC 4AD8A 4HDSB 4FX2A 2NAPA 5TPWB 1WQ3A 3LT5A 2IQ5A 1VJDA 1KO1A 4H1UA 3GLIA 3EF1A 1GZUA 3DL2A 3ROFA 3GD7A 3WGJA 2QRLA 2FZKA 5E4TA 4GLBA 1T4MA 1VZ3A 1V9SA 3NIBA 4JL8A 1Z16A 4F2PA 1JWAB 3DGEC 4YMSA 1Q0ZA 1O4VA 4BMPB 2VL7A 1G16A 3SQOA 4FU0A 5KTMA 4LF4B 2DBZA 1M6VA 1PSWA 2IPOA 1GKYA 1NR1A 2Z09A 2ZBEA 3LUKA 5EJAA 2DH5A 3A9TA 2JJ1A 4CKZA 4GRDA 1CVRA 3AKEA 1MO2A 2GEFA 4HX9A 4JB2A 5D2CA 3ESRA 4M8SA 3HZRA 4RPCA 4DS3A 3DMHA 2WP8J 5AVWA 3DBLB 2XA9A 5LMZA 1PBNA 4MWSA 3DEFA 3O95A 2VP3A 5K8LA 2BUBA 2HI0A 1TMYA 3HFJA 3WK4A 1RC1A 5JANA 1L4LA 4M1ZA 2KI5A 3C24A 4MOWA 2UUCB 5CH8A 3NXKA 5DSXA 3UUEA 4MW0A 1EUDA 3QU5A 1DJNA 2V5UA 2HSZA 4NMHA 3P2IA 2FW0A 2JAUA 4BMVA 1KU0A 4NABA 2Q6VA 1HG1A 1HWYA 2XWBF 1HQDA 4TRRA 1MA0A 2P9GA 4LC9A 3L4KA 1PZHA 1WHTA 5HRCA 1QP7A 1EWVA 3BICA 3RVMA 3TVDA 3FPJA 5I5EA 3HC7A 3SJZA 2F3SA 1O7JA 4G3XA 1J8FA 1KYYA 1ORDA 3MCTA 5EIWA 1YB4A 1QH1B 5C0OE 4BO1A 4UHDA 5EJ7A 1VIDA 1Q3HA 2ZUVA 1JSRA 4R16A 2B25A 2ODPA 3A11A 4K9KA 3K70B 4BNDA 4H15A 2QMEA 4RHEA 4XD7D 1PR9A 5B58T 1KI2A 1N9KA 1X13A 3E5RA 4JLPA 3DBVO 4WK4B 4ZAZA 3KWLA 4LF9B 4Z4IA 4AJ1A 1DDIA 1EXWA 5DHRA 2JGEA 2XZTA 3W5BA 5EMKA 2RDMA 1O0SA 2PWAA 2EW2A 1UPFA 3HYCA 1MJHA 4XCVA 1U3DA 2OV6A 2XIJA 2I6TA 2B83A 2JIZD 3KTFA 4KX5A 2N75A 2COKA 3C6YA 4EG0A 2H92A 3ID6C 3KJXA 4CTOA 1T5IA 1FQKA 3FPEA 2O8BB 5BOVA 1DIOB 2VAMA 1LSUA 3MWEB 1IVNA 4IKPA 1HE5A 4F5EA 4OMCA 3FYUA 3QLUA 2NVUB 3G5UA 4R7GA 1NF9A 3MMSA 1I1OA 2FMIA 2EC5A 3GLTA 1KR5A 1VLQA 5FO0A 4FM9A 3QEAZ 2BMEA 3Q15C 2B8JA 2LW7A 3G8BA 4WV3A 4DGSA 2PRZA 1XTRA 2RHCA 3TZKA 4NV0A 2YW9A 1AXGA 1MAHA 4IF4A 2OG2A 3PUIA 3U0BA 1DAMA 2WWHA 1SWVA 2WVJA 5LFAA 1IQRA 1N7GA 1RLUA 3ZDDA 2WE8A 1XBTA 3B89A 1A9YA 1QBKC 1R4ZA 2PZ8A 2W2LD 3HKDB 1QYDA 2VDQB 3FH0A 3OWOA 3QSGA 4F97A 3AEKB 1UBCA 2P5SA 3FPGA 4XPZA 7AT1A 2GLUA 2J9YB 4TPKA 1T24A 2ET6A 2NYRA 1AV7A 1ZNYA 2QJFA 4H4EA 4IMPA 4KIJA 1XQ9A 1CY6A 3KJFA 4R0NA 2VPQA 5BN3A 1Y3CE 1AHPA 3B70A 4J0DA 3KVYA 5JAHA 2J87A 2A9QA 5F9MA 1NJ2A 2IZ0A 3V8EA 2BGLA 2PTGA 4CZ2A 1PUJA 3QHPA 4GLLA 3WQQA 4GT1A 4P4SA 4US0R 4ZU3A 3CUSA 4X64B 3A9RA 5FX2A 1GA1A 1I1NA 2GZ3A 3JYQA 5CCDA 4QL3A 4MB6A 1CJVC 1XA0A 2VT6A 3LCMA 1YR7A 4CFYA 4UBLA 4CIYA 4HGRA 1V48A 1RFGE 4CI9A 3CVWA 2WSBA 2DWCA 4L8YA 4WADA 2I4RA 3GV0A 4ZEXA 5JZSA 1TAUA 3LXXA 3DVRX 3QVJA 4CCWA 1RADA 5C52B 2M6KA 2J3DA 4MVJM 4QU0A 1IBSA 2OZEA 3FF4A 1UWCA 3TIVA 4KPUB 4LRSB 2JB9A 2R6GA 1USGA 4ZVPA 5BRNA 3I05A 2CZCA 2D5IA 3O31A 2R6HA 3MJSA 2QXUA 4CLXA 3KLPX 4QBTA 3TDKA 3DLPX 5KWEA 3N1UA 1KKUA 1F4VA 8MHTA 1FPMA 1KO4A 4TLEA 3KOWA 4CKWB 1T0HB 5T4BA 4EL5A 5H9WA 1TF7A 1YS1X 2P2SA 1RHJA 1TUEA 2OOSA 3JTMA 1F3LA 4MITA 4X7BA 2VYVD 1LBHA 3IGFA 1L8QA 3RRYA 2GN1A 3VJKA 3EY4A 2RGBA 4GBMA 4AQYB 2AI3A 2CXSA 3PNKA 2ZIXB 1N2XA 4XWWA 1WXIA 3BJEA 1Z7YA 1M34B 2FLKA 3QFSA 4GKBA 4F21A 1GZSA 3ETLA 5EGSA 4DMLA 1T2DA 2QPLA 4B3IA 4P4SB 3S8YA 2DR2A 2ZS7A 3PSHA 4JI6B 3G8CA 1UT8A 3UTCA 4JJAA 3OVMA 4QGSA 1D7OA 1IU9A 2RSLA 4DSUA 1RPTA 1E1CA 5CK4A 1XT6A 2JLVA 1TD9A 1UXIA 1V8DA 4KQJA 4AMGA 4DMCA 1XMIA 2K6GA 2FKAA 5ESDA 1Q0HA 2IWHA 2YJ3A 4L50A 1ADBA 1POWA 2G4VA 3AIIA 4OHPA 4R3NA 4DLUA 4U7WA 4HRYA 4H7IA 5CA1F 4AXBA 1PDWA 5EJ8A 1N36B 2L17A 3AQ4A 4HWKA 1Y3HA 4XGKA 3B3QA 5KU1A 2VLIA 2AJLI 2JDIA 4UUQA 2ZJAA 3TE6A 3FZEA 5FUQA 2A5FA 3MWJA 3PA8A 5EKSA 3TE7A 2WVHA 3VYTB 1DIGA 1E3MA 1EVZA 1ZNWA 3TF5A 1EBFA 4RDIA 2A0YA 5K8UA 5FNZA 1YF3A 3AFGA 1YCDA 2HRRA 2IWRA 3FROA 3UAXA 5K3SA 1QO0D 4H1HA 5BPFA 1UMCA 4AMBA 3PB3A 2C7RA 5BSRA 2RGNC 3D3KA 3I1YA 5DSTA 4XPIB 3RS0A 5JLAA 5JDIC 1NUSA 3V6LA 3PFWO 2X19A 1UMKA 4N82A 3WGKA 2COEA 3QOWA 1DQZA 4XWYA 5JH7A 2GO1A 2Z5VA 4FYKA 4D82A 1H1DA 3HZOA 3UJ7A 2DCMA 4UNPA 5UKDA 2Q1XA 4KDRA 5D3MB 5H0IA 1BQEA 2ZZKA 4ZP1A 3RTCA 4TWAA 1WAMA 3UWPA 1S1MA 3MN1A 3I2FA 4KEAA 2Y9PB 2P69A 5DHUA 3IOBA 1YQEA 2GJ4A 2JVKA 1G66A 1Y1PA 2W2MA 3CZ9A 5GQSA 3S1SA 2BE7A 4OLHA 1B6GA 4GSKA 1E2FA 1R10A 3H2YA 3E27A 1SCJA 3PSAA 4EA7A 1W25A 3BDAA 5J1TB 3EXFB 2R6JA 2TYSB 1QAMA 1GCAA 4KFTA 2DPHA 2Z5FA 1E6CA 1SVMA 3WLKX 3LT2A 2MINB 2ZB4A 3O7WA 1D2NA 2I1QA 1C4WA 3FBGA 4BPRA 4U4AA 2JNWA 4EUEA 1WSAA 3REQB 1MENA 1YJBA 1OU0A 3IX7A 1LTHR 3K6SB 1W46A 4JGBA 1FQOA 2BIFA 2TMDA 4KQCA 3F3SA 2OSBA 3P27A 4O2BB 3LLSA 4WBNA 3F6CA 1RXIA 1IVYA 1IUNA 2CDCA 3A27A 3WNDA 1MIHA 2QAIA 2Z8YA 4Z3DA 2WKQA 4LOLA 5IYZF 3A0RB 1QMGA 4AF7A 3HXTA 3R3VA 1XU7A 2XUJA 1FQJA 2AH5A 2AK2A 1KSFX 2PKEA 5EZSA 3JVVA 5TS3A 3VM6A 5DLQC 4Z4FA 1VRWA 1TM4E 4CLRA 3A58B 1PS0A 1XF9A 2WMNB 4Q5IA 4TMKA 1CULC 3TSZA 4P81A 4AUNA 5CA0F 2F6RA 3TRIA 1TMKA 3QVGB 2ID4A 2HU2A 1E3SA 3I30X 5E2AA 5T41A 4GX0A 1UPBA 4LYFA 1V0JA 2G3YA 2D4AA 2Y4OA 3V1UA 2VNKA 3ZBPA 1NVAA 3ZE9A 1U3WA 1ML3A 2GN2A 4IWNA 3UTDA 4IHQA 4ABTA 1IBMB 3Q6NA 2B20A 5AUQA 5FQOA 4YIHA 2LKCA 3FOWA 3JQ6A 3PWZA 1MCZA 2EVWX 3R7DA 2WJ3A 2QUKA 3ABSB 3W3ZB 5LMCA 1WX1A 2NPOA 3ELDA 4KUGA 5BUQA 2C9CA 2QT1A 1IEVA 4MJ3A 4BVGA 3KZ1E 2H3EA 3T3DA 5AO9A 1Z4QA 2QVYX 1XLUA 1BW9A 3SPXA 3GX1A 2A1UA 2CFOA 2H7CA 4PRKA 3RJ9A 4WNIA 2N3ZA 4II3A 3HCNA 4Z51A 2OV4A 2OFFA 5JDIA 5D8DA 1QHSA 3LM8A 1RWOA 5KJ6A 1D5WA 1TC2A 4TKUA 1X1QA 2CV0A 1C30B 1KMQA 3C97A 4DDMA 3KPUA 3R5XA 4BN4A 3AFNA 1GKKA 2F1RA 3CX8A 4POOA 3LD9A 3USCS 3PGKA 3RFUA 3W9BA 1FFCA 2J5BA 1OOEA 4XW2A 3TMYA 2CVQA 3ONFA 4ND4A 3VUFA 4UFOA 1T2AA 1OV6A 4E32A 1A9XB 4LV6A 3BL6A 2H06A 1UDAA 4FDLA 2JFWA 4G0WA 2OXIA 2RK6A 3V33A 2XTJA 1VB5A 2P41A 1C7IA 1TQ6A 2I7VA 2DUMA 1CLEA 5EOVA 1U7TA 3N28A 1CEYA 3EA5A 1BDMA 1SMKA 3DHNA 4P54A 1ZCZA 3IJRA 1UJMA 3NAZA 4UUNA 4XXHA 4N18A 2IITA 2XOEA 3MMPA 5JCZA 4DCCA 2HT1A 4AICA 4ZFNA 5DM60 3L0OA 1BDHA 1IBCA 4ZMRA 1BU5A 2YYYA 3WMRA 4BNIA 4BCCA 1MXFA 3D3NA 4KXQA 5SY9A 1HT3A 2AKEA 3R7NA 4C4AA 3NONA 3OQ6A 3GLQA 2OZKA 4O4IA 3UMGA 3LKBA 1F2UB 1R66A 4ZU6X 1V7PC 1DC6A 2NVUA 3FYUB 5DBFA 3W8FA 2P27A 1YAHA 2QP3A 1P7ZA 1A7KA 1WMSA 4O2BA 1UT5A 1FVHA 3QIVA 1IDOA 1A2BA 3VI4B 4D4IA 1KJIA 3V3TA 4W5WA 4URHA 2RGCA 3FVQA 2XUGA 1HFJA 4YO8A 4YVFA 1W4BA 4XIJA 2PT9A 2OYCA 1MW9X 4DT1B 3AP3A 4MP8A 5BNTA 1FU8A 1Q1GA 3RSQA 1PT7A 2ZE7A 1QOZA 3KT3A 3Q2KA 3UGJA 5LDHA 3DTVD 1OE0A 1R4NB 1QRUA 3OQHA 5IKOA 1WPXA 3IBSA 5DOVA 5TX7A 3OT1A 3J81A 3HO1A 4FFBA 3CO5A 4RJ2A 2QAGB 1GZHB 1X74A 3I9JA 4LIPD 8GPBA 2ZK7A 3W5UA 2HCTA 2GOYA 1O94A 4J6EA 1KMNA 1WKBA 2XVXA 3IQEA 1IOZA 2J08A 3Q9SA 2EG9A 2EZ4A 4U0KA 5DE3A 2G1UA 1QYCA 2AX3A 2PJUA 3ZDFA 4A16A 2X4GA 4EY6A 4YXFA 4QE3A 3ZX5A 4F12A 3PI6A 4MVCA 3U19A 4UM7A 1VHJA 3EWAA 2L2QA 1FFDA 3P9ZA 1E5TA 1I3LA 1YAJA 2IYPA 2DWUA 5I4IA 5MN4A 5LP6C 4PW0A 5AKLA 3A9SA 2A0WA 4YUXA 3A26A 2JVIA 1BZYA 1QLWA 1EK0A 3JY6A 3K35A 4P9NA 4YDRA 2MSWA 1NLUA 3D9QX 1KI6B 3E7FA 3IVXA 4J3JA 4PSUA 5BNFA 3VR4A 4Z0PA 4B82A 4B35A 3Q7EA 4ZC1A 3Q6IA 1UZAA 3OICA 4M9SA 4FPXA 2ZRKA 4BX2A 4NCAA 5LZ7A 1A8PA 3JATB 2YFKA 3P2JA 3PP8A 2FMXA 4OUKX 4Q48A 3GJQA 2RD2A 3GDGA 4NBLA 1BDBA 1LPPA 1P1KA 1JSXA 1RRGA 4G07A 1OFGA 3DVAB 2J85A 4U2GA 4DR2B 5ICEA 5AVUA 3GGDA 1Y3IA 1KWKA 2A4MA 4K03A 5LQSA 2V6JA 3Q9LA 5HMMA 3NIGB 3RR2A 3U7QB 1SB8A 3PF9A 1CRLA 3NM6B 1E6KA 1QM5A 2GK6A 2FEKA 4ECEA 4GPIB 4M1EA 4UTZA 4ZTBA 2H5IA 4IIEA 1AN9A 3ZQ4A 2GZHA 3JCZA 2QAGA 2CWDA 1KH2A 1VI2A 2JIOA 2XDWA 2NYVA 3NETA 3ZGYA 1USVA 1PL0A 4U2EA 3BWXA 4URXR 4BTLA 1RJFA 2P2GA 4OB7A 4PG6A 2OP0A 1EFPB 5E6SA 4AUKA 4OLJA 4ZEOA 2VQ3A 5D86A 4QGHA 4L8LA 4RETA 2AMLA 2UAGA 4J16C 2QLJA 1NHWA 3JALB 3W2TA 1KZ6A 3DC2A 1E1CB 1P80A 2B3TA 1Z38A 13PKA 2VYFA 4U1RA 3F6EX 3S2GA 1PEKE 4LDJA 2WF8A 3FBWA 2J0UB 3RLFA 1ZL0A 4Q05A 4D5GA 2WJ6A 5JXHA 3C8MA 4IDBA 3G13A 4OQ4A 4RIIA 3IDAA 5B6JA 2WJIA 3LCUA 3C43A 3OO1A 1QORA 1G8JA 1FXWF 2XA1A 4B7XA 1JKMA 2WWWA 1XMOB 1J9ZA 2JAHA 2FVYA 3RS8A 5C7LO 1O96A 1MVLA 1PT9A 2H1LA 3CVJA 3RWMB 3UJPA 4XKJA 1ECGA 3PTZA 3N3BC 4HHEA 4JUCA 4L3VA 4I19A 2Q5EA 3DAPA 2O3JA 4UPDA 4XWAA 5DTMA 4OLFA 2DPYA 4NDZA 2P2LA 4HB0A 4CTKA 2XW6A 3G6KA 4ER7A 3DQQA 1QIEA 4HFMA 3QYJA 1TRHA 4A0QA 1N5KA 2HKIA 3FMFA 1FK8A 2OCDA 3EYAA 4DR3B 1M6HA 4NZOA 2M6RA 3GD5A 5ED0A 4N7RA 1FDRA 4KK3A 4BMDA 3I9V6 3EXIA 3QU7A 2B5WA 4RELA 1XKTA 3KLNA 4HDNB 5IM5A 1KJWA 3B7GA 3T7JA 1E2LA 3H8SA 4FC7A 3W77A 4NMWA 3H13A 4ZIRB 3D4NA 3EEFA 3JQBA 1VCOA 3IBYA 1UBEA 2GHTA 3LHSA 4LBWA 2BZGA 3V2GA 3VO1A 3ZV3A 4DA4A 3QELA 4IHKA 2IK8A 2PQ6A 4AP9A 3WG9A 1RWXA 3MT7A 4WJKB 1SG6A 5B7GA 1MOQA 4A27A 3QNMA 4P5DA 3CW2A 3SD7A 2BSAA 3KQLA 2FZ4A 4O5OA 2GARA 2PYIA 1MF7A 3K9FC 1LW7A 1JKIA 4BEJA 1PQPA 1GTJ1 4V3CA 4KXMA 4WNCA 3GUZA 3R7BA 3SHWA 5DVZA 1X38A 1E0AA 1Q3KA 1AC5A 1HQCA 4M21A 3QV1A 4QEZA 3NYQA 1Z0FA 5HYVA 1VTKA 4Q3AA 2IOFA 4F4FA 5LP6A 1E32A 3W3AH 3COWA 1VFPA 2ORYA 3F46A 2EJUA 3A9WA 3L8ZA 4HS9A 1BHSA 1IDN1 3H2IA 1Y6RA 1EUZA 1J2JA 1NNSA 2PX6A 2R7LA 4UDOA 2C59A 4EVQA 2Z1MA 5K05A 3ASUA 2VXCA 1DO0A 1EG2A 1SUCA 2JH8A 3BFJA 4Q4DA 3PUKA 2YWJA 5A9TA 3CF2A 3D8BA 4Y1RB 3TM5A 1GPUA 4CQLB 1E6WA 2AHRA 4MV9A 4M1SA 4NK4A 4A4DA 1WPQA 3NW9A 2PXHA 1V37A 4RV9A 5EESA 3FFAA 3U13A 3UWOA 3UMMA 4NXMB 2DFDA 1DZIA 1R5OA 3TIGA 5JV5A 3A6DA 4R1NA 4R81A 4XDGA 2KSQA 4UNSA 3ZVRA 3I39X 2CJXA 4ZCSA 2HYIC 3SAJA 1N6HA 1L4NA 2HH9A 3MMNA 3QYAA 5TDHA 2GYWA 4K86A 3R6LA 4OIFA 2R84A 1BTOA 3KNZA 4RD3A 4MKHA 1M7HA 5ALYA 4EAQA 3UHAA 1CY4A 1NW9B 1Y33E 1XZKA 2ZYHA 2BI7A 2PGJA 3ETCA 4C5AA 3QM1A 4BLWA 1UK9A 2X13A 3KB8A 3AUYA 4YQEA 2A9OA 2YQZA 1SA0A 1P17A 5AOCA 1LH0A 3H04A 3VDMA 5BYKA 7REQB 3SZMA 2H17A 1H5QA 2BGWA 4H9GA 5I45A 3GG9A 5TIIA 4ERXA 1G6Q1 1CRZA 1YB5A 2C2XA 3BQMB 4DDWA 4BVLA 4LJLA 1SKQA 4BTVA 5I9BA 2VPWA 5K3FB 3VR3D 3FCXA 1RI3A 3K09C 1DKUA 4QYMA 1Z28A 1H2ZA 2QQGA 5K0GA 2DPGA 4QT4A 1FRQA 1RZ3A 1XZ8A 2IZZA 3IT3A 3P0IA 4MUEA 2VI5A 4BU0A 4ALLA 5JR3A 2GBIA 1R3UA 4QODA 5BQFA 3ZQKA 1ABBA 1E9EA 5E6UA 4KR2A 4LV8B 5CH5A 2Y0PA 1BW9B 3R0IA 3EXHB 3G7SA 3PYLA 4IO0A 4Q21A 3LZCA 1ONPA 1QTRA 3HYNA 2ZXEA 1T6ZA 3JQCA 1QO7A 3PDIB 2O2DA 2P7IA 4IGKA 4AY6A 1Z36A 3OWXA 5K0CA 2P9HA 2JJMA 4WMLA 4ZVSA 1Y81A 4AJHA 2WD8A 2F3TA 2DHEA 4EO4A 3MSXA 4ZI7F 5JVDF 1JFTA 1UMCB 2C5SA 2Y1KA 3ERCA 2BBSA 4UE2A 3D4OA 1DAKA 1E6LA 2SKCA 3OPYI 4J0QA 3QG5A 5DNDA 3V34A 4JNKA 1A4XA 4FE7A 5G2OA 2X2OA 2OECA 2OAGA 1QDEA 2X6TA 5BWMA 1J4AA 3I72A 1B1CA 4CVNA 5JJCA 1OWPA 4YR7A 1ESZA 4NHEA 5LM3A 4PR3A 2UU9B 2VP6A 3KQVA 2FFHA 2G9ZA 2OCKA 1OH8A 3EEQA 4QKQA 3CIFA 3M9LA 3VHXB 3LP6A 3GHHA 1LBTA 1L5MA 4A0HA 4JIMA 2BTEA 4HNVA 1F1JA 1O6GA 1S3FA 1Z4NA 3CH6A 3QBDA 1PEYA 4NULA 1Z29A 2PUWA 4Q03A 1OFHA 3UJHA 4B6RA 2FNAA 3O4GA 1W9HA 1T6NA 2QUAA 5IVPA 3VAYA 5GWXA 2PWYA 4EY7A 4PE5B 2D8AA 3C15C 5HRAA 4G36A 1HQYE 3Q3VA 5FJIA 2J3MA 1NJSA 4MAAA 4NBSA 4GUDA 2W71A 5TT1A 1XUOA 3D8RA 3QVSA 3UMJA 5BOSB 3CPSA 4F60A 4OXYA 4FFBB 1MPTA 5JS6A 3LCCA 1T5DX 3E9MA 3EYWA 4G65A 5LSAA 1O03A 4FQ8A 5C80A 4M89A 4AZSA 3CUWA 3JQEA 3NYRA 1G21A 5HIIA 3Q7RA 3RQSA 4R1SA 2IKSA 3HWX1 3OCYA 1WB9A 4BGVA 3A6HA 4TMZA 1ZCFA 1FUKA 4RZHA 2POQX 2R47A 5AI9A 3WGGA 1AXEA 4CM1A 1ISJA 5JBIA 1IFXA 4GZ5A 2PSFA 3GDWA 3C70A 4RV4A 2JGDB 2VTDA 3EBLA 4G1UC 4WOCA 3WAKA 3AYZB 3FD8A 4YQYA 1RMQA 2DVMA 2B37A 2V4UA 3TS1A 3NV9A 5DRYA 2OL4A 2ZYRA 5EEHA 4E11A 1QMPA 2EGGA 4OJMX 5SZIA 4B3FX 2GBLA 3KFXA 1NR5A 4FIZA 1CF4A 1QNFA 1KPIA 4MDYA 2AOTA 4RADA 5F5XA 2XXAB 1DLJA 4CM4B 2PWPA 3A3NA 3SHOA 2IEBA 4B73A 1H0SA 4JQSA 1B42A 4RY8A 3HS3A 5LWHA 2P1DA 2G4LA 4PGAA 4QVGA 1MQ8B 1AUOA 3HDYA 1PU2A 1TO2E 1XLVA 3P2KA 3I62A 5FTNA 4GPEA 2J7PA 2Y76A 2I9PA 2OBFA 4JXJA 1RKBA 3ESQA 1CVIA 1AQ6A 3E5MA 1IPFA 5JRZA 5BOSA 1DKNA 4FIDA 4HGOA 4QGBA 2UDPA 2QZPA 1Z74A 1II8A 5JSQA 1BRTA 1Q84A 2F1JA 3O6VA 4KBFA 3NIWA 1PLJA 2QDXA 4GEKA 1BS9A 1HYHA 3GGPA 1GSAA 4XE5A 4P33A 2X4IA 4EHKA 4N3AA 5EXPA 3RIMA 1I33A 1TJYA 4IZ6A 4QDKA 4PSDA 4Y0VA 1GUFA 4RF4A 3DVSX 1GR0A 5AW3A 3L7DA 3NH9A 4BHTA 4DBLE 5DM4A 1BA2A 4BLTA 4Q6BA 2RGXA 3ST7A 2VA9A 1TLFA 1XZCA 1D6NA 3F47A 4PGMA 1DL5A 4JUDX 3ZK9A 2YZNA 4XQCA 3GJ0A 1C1YA 2ZRDA 5EMNA 2PD4A 4IV0A 5GOZA 3WYAA 3OJOA 1WXEA 2X41A 5T4HA 1DUSA 3HYSA 3JQGA 1L8OA 4KN8A 1JEDA 1NMYA 3QF4B 3MERA 3GLKA 4OFBA 5GPBA 4ASUA 5CG1A 4G0UA 1U2TA 3IALA 3JPYA 2Q8NA 2P3LA 4IIJB 1IY0A 1WF6A 4A5SA 4ZJZA 2W6ZA 1UBSB 1YA6A 2UXCB 2J3IA 2I6FA 3DWGA 3LQ2A 1OI4A 4KITB 5A3SA 4BV2A 4V39A 2YOGA 2ZQ5A 3OESA 1N8SA 4MUBA 4QVKA 4TTVA 3IMCA 2D1RA 1H8EA 1LI5A 2PIAA 3AJ9A 3DZHA 2BEVA 4K3UA 1E9SA 2P0YA 3OLZA 1OB2A 2O14A 1RXUA 1YMUA 2Q1WA 1QS0B 2VRCA 3GT0A 3LG2A 1PT8A 3IURA 4M1QA 2ZE8A 3JD0A 2OO5C 1X19A 3R3ZA 4BLUA 2YWDA 2O4CA 4KFUA 3F6PA 3AVUA 4RCZA 4MKXA 4LYEA 2IVFA 4JVOA 1ZX1A 4I9GA 1EFHA 3CX6A 2G72A 4GZMA 4Q4LA 3BWEA 1NJ6A 2JGDA 3ZGXA 1X7XA 1IZZA 3ESZA 1X7ZA 4M0FA 1CJUC 2C9ZA 1S3SA 1FFXA 1NKVA 3BDIA 2A3RA 3ZYZA 2W6QA 1ENZA 4KGVA 1RQ7A 2FPGB 2OVFA 2X2PA 1TMGE 2IELA 2VDJA 3EOBI 1KP2A 2B98A 3BIWA 2VQDA 4JODA 1PJLA 1WMDA 4JDUA 1SXQA 1QP8A 1IG0A 3PC8A 2Q2NA 4LI3X 4MICA 3T52A 4EZBA 5BVHA 3ZJ4A 4DCTA 4U2KA 1JNXX 1N1MA 4BKMA 5HCIA 3F73A 3SC3A 4QT0A 1JJAA 3FPFA 1H22A 3I2IA 5JVDB 1E5QA 2X9NA 2XUZA 1VKZA 3AZPA 3BRQA 4ZDKA 1Q17A 3HBMA 1ORRA 4NU6A 1TECE 4OQQA 3VSEA 2IH2A 3OFNA 4RV5A 3F8SA 1FDTA 3N86A 4G24A 3UB2A 3PHCA 1D2HA 1YOBA 4PCVA 1EBUA 2Q9AA 4DIBA 4JKOA 5IF9A 5DXFA 5ALKA 1QZ3A 3E53A 4M0MA 1CIVA 5A71A 3WV4A 2BFBA 1MO5A 4GMHA 2RJNA 2WM3A 1US8B 3CUUA 3TW4A 1G1AA 3AEUA 3QQPA 4NCHA 1P44A 2JGLA 4URZR 2O3SA 2QL6A 4NF2A 5A3VA 2J67A 3L9WA 5CD1A 2V5AA 1UJ4A 1EP3B 1BO6A 2JZNA 4YJ3A 4MCIA 4YRDA 5EUCA 2W2TA 2H59A 3RDPA 4ZYXA 1ODSA 2JLSA 2PJZA 1Y4DE 5E95A 3E15A 4G6ZA 3HUUA 4DQLA 1T1GA 1L7BA 3KZXA 2EFEB 5F51A 5C3UA 5DISB 5IHXA 4EZEA 1KXJA 3CNNA 4HATA 2XOKA 5BV2P 1V3UA 1FU4A 5JQWA 4XX0A 1NW4A 1QX3A 1P5HA 4UM9D 3S0JA 1CZNA 3WWCA 4B7ZA 4CTJA 3ZH2A 4BX3A 3SR3A 1IXYA 1DEHA 2UXDB 2AFIB 5A7HA 3PHBE 1AMUA 1LA2A 2P35A 3C6XA 4ZCLA 2VNAA 4J7XA 4OD0A 1P1IA 1AB5A 1X7GA 2I7CA 4BNFA 3COSA 1SVUA 4CR8A 1CUVA 5LQDA 4KPYA 4P8RA 3EDCA 4X8MA 5BR7A 2VTBA 3FTPA 3L46A 4LBZA 3A6PC 3ZU5A 1ZJYA 2IZ6A 3EXHA 4NECA 4UXHA 1KKMA 4QG3A 1X80B 2VJKA 4IV5A 1FC0A 2X0DA 4JCCA 4M0EA 2JHAA 3EEBA 2DBRA 1JYSA 3PHIA 4UAGA 1TGYA 4NFSA 3MRXA 4JEUA 4UUPA 1EX1A 3RRMA 2IUEA 2AFVA 2QLMA 3N53A 4UVGA 5DDIP 4OB8A 4S1PA 1ZI6A 2OCYC 1ESMA 4KR9A 3ME5A 3RAFC 3CH5A 2F64A 3CM0A 4BNHA 4B8WA 1NP6A 1I2BA 1UBKS 3QVOA 3WRXA 1YQ9A 1VE1A 3KEMA 1UCFA 1UPTA 5KCZA 2E4XA 4MW6A 1AKMA 3ADCA 4AI6A 3BZUA 1ORTA 2QGFA 2X4DA 4F0JA 2BEUB 5C4MA 3DM9B 3DPSA 2C5BA 1G8AA 1L4YA 1E2EA 5EXSA 1A0OA 3UENA 2UV8A 1HRKA 4BNJA 1OLOA 1CB0A 2PK3A 3A4YA 4I9NA 5DM1A 1BMQA 1FJXA 3V8BA 1LV8A 2E55A 4G1MB 5B30A 2IZOA 1RMYA 3FGNA 3OFND 3PC6A 3COPA 2XMBA 1HNWB 1T4CB 1NG9A 2HHCA 2NXCA 2Q21A 4W7IA 3HI4A 2P5YA 3QXGA 2FQ1A 1QK3A 1UL1X 1BG6A 3AB8A 2QNBA 4G1VA 1P2FA 4L74A 1WNTA 3NJ4A 1YCHA 2ACVA 3AIKA 1XNHA 3WRYC 2O2XA 1OBFO 2DFKB 2FCAA 4P4NA 1YRWA 3AERB 3UAGA 3VHRA 5JNSA 5LP1A 3O8OA 4BLSA 1Z25A 3D5EA 4I1OA 4RORA 3A14A 5IC5A 2HFJA 4YAUA 2R8YA 4RD6A 4JYMA 1V1RB 5E6RA 1YBFA 3PFBA 5KNCD 1V11A 3EPRA 3D1LA 3WYGA 1YZVA 2CKDA 1CWUA 3O8QB 1OXVA 1LK5A 1BFKA 1LUAA 2RHLA 3KKKA 1IZYA 2MINA 4PAWA 5H7XA