4ZA3B

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd)-native-3
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
260
Chain Sequence
b'EQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA N-glycosidase
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule tags Hydrolase
total genus 81
structure length 260
sequence length 260
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4za3B01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4za3B02
2RSTA 1M2TB 1HKNA 3WINA 1ISXA 6I1BA 5HPZA 1G82A 4I37A 1G9DA 3UD7A 3RTIB 1HWMB 1A8DA 3C9ZA 3ZC8A 2Y9GA 4D0ZA 3OGGA 1V6VA 1HWPB 3OJ2A 1DQOA 4JRAA 2FFVA 1K5VA 4G9MA 3AKGA 2QN4A 3O44A 4EKXB 1II4A 1PZZA 2Y9XE 3P53A 4AN6A 3V0AA 2DRZA 2NM1A 4I7IA 4EFRA 2IHOA 2X2SA 3O49A 4A7KA 1EPWA 3FGMA 8I1BA 3IM7A 5BP5A 1DZCA 3CAHA 1P63A 2D24A 1AVUA 5F8YA 2X2TA 5GAQA 1R8NA 3D7WB 1MC9A 4OEEA 2ESUA 3QYDA 1ITBA 21BIA 3NBCA 3AKIA 3POKA 4I96A 5EC5A 3BRDA 4USOA 3O4BA 1L2HA 1QXMA 3O4DA 4DCKC 3I29B 3FJEA 1JLYA 1W3GA 3BAVA 3HALA 1NZKA 4G6MA 2E4MA 2NP0A 4Q9GA 4P0JA 4IY9A 4I4SA 1TOOA 1WBAA 4PC4A 4HA2A 1JT7A 1DFQA 1HIBA 1KNMA 2RG9B 3N0KA 4L4IA 2D22A 3BRFA 2AQZA 3IM6A 3FUOA 4GAIA 4X39A 1TIEA 1TFMB 3R4UA 3FJIA 2NTDA 4IQPA 5DVHA 3ZXGA 4YOLA 1F31A 3CQAA 5BXPA 3FJFA 1AF9A 4IHZA 3FFZA 2Q3NB 4HR6C 5DZUA 3WO3A 4QD2C 1FMMS 1BFBA 1DFCA 4OEFA 2R9KB 2F2FC 3B9UA 4JAWA 5BXRA 4GAFA 4XFTA 5EG6C 1BLAA 3H6RB 4I3NA 4A7YA 1MD6A 1SR4C 1S0FA 2VLCA 1Z0HA 1FV3A 3CRIA 1BFGA 4XFSA 3BA5A 3WINC 4Q91A 2BEBA 3CRHA 3HBWA 2DREA 1YF8B 1QQKA 2FFUA 3BAHA 1SZ6B 4ZLBB 2HWAA 4R6UB 4I4YA 1AFCA 4ZFUB 1J0SA 3RMYA 3NBEA 1PWAA 1XZZA 2MIBA 3AKFA 1SR4A 1HCDA 1FQ9A 1BASA 3AJ5A 3BADA 5BP5C 3SNVA 1T4QA 4OWLA 1IRAX 1TP0A 9ILBA 4KC3A 2VU9A 3W9TA 1V6WA 4D8HA 3EF2A 1AVWB 2YUGA 5FNXA 4Z9WB 3IAGC 1S0DA 3OBTA 1S0CA 4GOVA 4FVVA 4LO8B 3FJDA 4LO3C 3BB2A 1FGAA 2I1BA 3OGFA 3RTJB 3N7JA 4JPZA 1FMZA 1BFCA 2M49A 1G9AA 1E0OA 1PUUB 3WMUA 3CA6A 2E4MC 2ZQNA 4WBCA 1NUNA 2XOAA 3VT2A 5BQUA 3NJ5A 4P6AA 2Y9WC 5DSSB 3AH4A 4QBVA 5B2HA 2ZR1B 1BA7A 1Q03A 3VSFA 1ONKB 4LO0A 3A07A 2MLLB 2KI4A 3A23A 5I1BA 3VT1A 1AXMA 1Z2VA 3BA7A 2AFGA 2ET2A 2ZQOA 3N7MA 5FZUA 4ZKTB 4II0A 4IZEA 2WBCA 1JQZA 3IM5A 4H9WA 3S8KA 4LO3A 4I4OA 1S0EA 2D20A 3A21A 1EVTA 4F83A 1IJTA 5BVPI 1CE7B 4JKQA 3UJ0A 3AZVA 4OEGA 3VEQA 4ZFYB 1BARA 3CA5A 4A7ZA 1YTOA 3FJ8A 3FJHA 4JQ0A 2WRYA 3O4CA 1T9FA 3BRGC 4USPA 2IWTB 2FDBM 1DZDA 3F62B 5FZYA 2VUAA 1I1BA 1YXWA 2K8RA 4X38A 2K4AB 2Z48A 3QR5A 4D0TA 4EFQA 3MALA 3FJAA 4J2YA 2GZBA 2UUSA 1WD4A 3Q7WA 1N4KA 1RZOB 2AAIB 4QO3A 1IHKA 2BFHA 4P0KA 1CVSA 3FJKA 4KBBA 3ZXDA 3K1XA 3IIRA 4EEEB 1ISWA 3Q7XA 3FJCA 2KKIA 3FJJA 5D63A 5EHAA 2AXMA 1JT4A 4G9NA 2VSAA 3AKHA 1DQGA 1ISZA 4I2SA 4G6JA 1W3AA 3BAQA 3AZWA 2L5XA 1D0HA 3CA0A 4ZGRB 1V6UA 1YBIA 3TC2A 5D62A 3UD8A 3FJ9A 4KEIA 3O3QA 1RMLA 3A22A 31BIA 2NVHA 1JTCA 2NZ9A 1PC8B 4J2SA 3PG0A 4LO2A 3RSJA 3CA4A 1PUMB 4ZOTA 5F8WA 4CJMA 2F8XC 1XYFA 5BQUC 2HZ9A 4LO1A 5JMCA 4DEPA 4ENDA 4LO0C 3BAGA 3V79C 3AH1A 3WA1A 4FGFA 3HN1A 3JUTA 4GP0A 3CU1B 1HWNB 3AJ6A 3CA3A 1IRPA 2J3PA 3CA1A 2KLLA 2VXTI 3H6QA 1G9BA 1FV2A 4GP3A 2MC2A 1EYLA 2LIEA 3S8JA 1V6XA 4I4UA 4QKRA 5JLVA 4J2XA 2QYIB 1AVAC 1W3FA 7I1BA 1UPSA 1K5UA 1HWOB 1S0LA 3V0BB 3WMVA 1I1EA 2BEAA 2DRYA 3PHZA 3ZC9A 4F34A 2ERMA 3HSMA 4IONA 4OW4A 1HCEA 3HMYA 2GO2A 4IYBA 4I4PA 5FZZA 4DENA 2Q9XA 1EV2A 3O4AA 4I1BA 2HWMA 3ZX7A 1ISYA 4OWJA 1RY7A 4I4VA 1XG6A 1FWUA 2D1ZA 3KMVA 3N7KA 3E8LC 1FWVA 3OJVA 3UJ4A 3UD9A 4ISRA 1ISVA 4I8MA 4P0LA 3VT0A 3CRGA 1TTUA 1GGPB 4H04A 4I4RA 1IT0A 3O4OA 4OWKA 3BAUA 2D44A 5DUYA 4L4HA 1RG8A 2Z49A 2D7IA 3NBDA 3ILAA 3AH2A 4QBCA 4Z8SB 4OUJA 3V0BA 1YYNA 4IY8A 3F1RA 5BOWA 3I2XA 3OJMA 1DIWA 1R8OA 4X3AA 1S0BA 1DLLA 2Y9FA 1AVXB 1TWEA 1IILA 3PMEA 3NBNA 4XKIA 4TLPA 1JT3A 1JT5A 4X37A 1S0GA 1JY0A 3FJBA 4XFUA 4G1RA 3JRRA 3UDAA 4I6IA 1BLDA 4EFPA 3N7LA 2P39A 2D7RA 4ZFWB 41BIA 4LO2C 2HW9A 4QD2B 3BA4A 4QKSA 3VUOA 4I1EA 3T8SA 4I0YA 2D23A 2VXRA 4LO1C 2KH2A 4QALA 3BTAA 4JP0A 1FN0A 3MPPG 1ILR1 4J2KA 1OQLB 3LLPA 2FO1A 3R4SA 5D61A 1JLXA 5F8SA 3VWCA 4HJJA 2NYYA 4QC4A 3I2AA 4KEJA 3BAOA 5F90A 1VCLA 2D43A 4ZA3B 4Q9PA 5E24E 1XHBA 3RMXA 1IOBA 4AN7B 4ZBVB 1Q04A 2VSEA 3P6JA 2KI6B 3LTQA 5BXTA 4LO7B 4KEKA 1WD3A 3Q7YA 5G00A 1G9CA 4I4QA 2P23A 4EB2B 2FGFA 3V0AB 4GOYA 4LO7C 3OBRA 1BFFA 3BX1C 4ISQA 1ABRB 5BXSA 2LIQA 3VSZA 2F2FA 3FUQA 4JKXB 4IZXA 3O5WB 1Z4SA 1WBCA 1QQLA 1M16A 3P6IA 4J23B 1DJSB 4I4XA 3WO4A 1TWMA 2K43A 2DS0A 2RQ9A 3HOMA 3PUBA 5FNWA 3WO2A 1Q1UA 3H6RA 3H6SE
chains in the Genus database with same CATH superfamily
2RSTA 1M2TB 1HKNA 3WINA 1ISXA 6I1BA 5HPZA 1G82A 4I37A 1G9DA 3UD7A 3RTIB 1HWMB 1A8DA 3C9ZA 3ZC8A 2Y9GA 4D0ZA 3OGGA 1V6VA 1HWPB 3OJ2A 1DQOA 4JRAA 2FFVA 1K5VA 4G9MA 3AKGA 2QN4A 3O44A 4EKXB 1II4A 1PZZA 2Y9XE 3P53A 4AN6A 3V0AA 2DRZA 2NM1A 4I7IA 4EFRA 2IHOA 2X2SA 3O49A 4A7KA 1EPWA 3FGMA 8I1BA 3IM7A 5BP5A 1DZCA 3CAHA 1P63A 2D24A 1AVUA 5F8YA 2X2TA 5GAQA 1R8NA 3D7WB 1MC9A 4OEEA 2ESUA 3QYDA 1ITBA 21BIA 3NBCA 3AKIA 3POKA 4I96A 5EC5A 3BRDA 4USOA 3O4BA 1L2HA 1QXMA 3O4DA 4DCKC 3I29B 3FJEA 1JLYA 1W3GA 3BAVA 3HALA 1NZKA 4G6MA 2E4MA 2NP0A 4Q9GA 4P0JA 4IY9A 4I4SA 1TOOA 1WBAA 4PC4A 4HA2A 1JT7A 1DFQA 1HIBA 1KNMA 2RG9B 3N0KA 4L4IA 2D22A 3BRFA 2AQZA 3IM6A 3FUOA 4GAIA 4X39A 1TIEA 1TFMB 3R4UA 3FJIA 2NTDA 4IQPA 5DVHA 3ZXGA 4YOLA 1F31A 3CQAA 5BXPA 3FJFA 1AF9A 4IHZA 3FFZA 2Q3NB 4HR6C 5DZUA 3WO3A 4QD2C 1FMMS 1BFBA 1DFCA 4OEFA 2R9KB 2F2FC 3B9UA 4JAWA 5BXRA 4GAFA 4XFTA 5EG6C 1BLAA 3H6RB 4I3NA 4A7YA 1MD6A 1SR4C 1S0FA 2VLCA 1Z0HA 1FV3A 3CRIA 1BFGA 4XFSA 3BA5A 3WINC 4Q91A 2BEBA 3CRHA 3HBWA 2DREA 1YF8B 1QQKA 2FFUA 3BAHA 1SZ6B 4ZLBB 2HWAA 4R6UB 4I4YA 1AFCA 4ZFUB 1J0SA 3RMYA 3NBEA 1PWAA 1XZZA 2MIBA 3AKFA 1SR4A 1HCDA 1FQ9A 1BASA 3AJ5A 3BADA 5BP5C 3SNVA 1T4QA 4OWLA 1IRAX 1TP0A 9ILBA 4KC3A 2VU9A 3W9TA 1V6WA 4D8HA 3EF2A 1AVWB 2YUGA 5FNXA 4Z9WB 3IAGC 1S0DA 3OBTA 1S0CA 4GOVA 4FVVA 4LO8B 3FJDA 4LO3C 3BB2A 1FGAA 2I1BA 3OGFA 3RTJB 3N7JA 4JPZA 1FMZA 1BFCA 2M49A 1G9AA 1E0OA 1PUUB 3WMUA 3CA6A 4MZHA 2E4MC 2ZQNA 4WBCA 1NUNA 2XOAA 3VT2A 5BQUA 3NJ5A 4P6AA 2Y9WC 4MZFB 5DSSB 3AH4A 4QBVA 5B2HA 2ZR1B 1BA7A 1Q03A 3VSFA 1ONKB 4LO0A 3A07A 2MLLB 2KI4A 3A23A 5I1BA 3VT1A 1AXMA 1Z2VA 3BA7A 2AFGA 2ET2A 2ZQOA 3N7MA 5FZUA 4ZKTB 4II0A 4IZEA 2WBCA 1JQZA 3IM5A 4H9WA 3S8KA 4LO3A 4I4OA 1S0EA 2D20A 3A21A 1EVTA 4F83A 1IJTA 5BVPI 1CE7B 4JKQA 3UJ0A 3AZVA 4OEGA 3VEQA 4ZFYB 1BARA 3CA5A 4A7ZA 1YTOA 3FJ8A 3FJHA 4JQ0A 2WRYA 3O4CA 1T9FA 3BRGC 4USPA 2IWTB 2FDBM 1DZDA 3F62B 5FZYA 2VUAA 1I1BA 1YXWA 2K8RA 4X38A 2K4AB 2Z48A 3QR5A 4D0TA 4EFQA 3MALA 3FJAA 4J2YA 2GZBA 2UUSA 1WD4A 3Q7WA 1N4KA 1RZOB 2AAIB 4QO3A 1IHKA 2BFHA 4P0KA 1CVSA 3FJKA 4KBBA 3ZXDA 3K1XA 3IIRA 4EEEB 1ISWA 3Q7XA 3FJCA 2KKIA 3FJJA 5D63A 5EHAA 2AXMA 1JT4A 4G9NA 2VSAA 3AKHA 1DQGA 1ISZA 4I2SA 4G6JA 1W3AA 3BAQA 3AZWA 2L5XA 1D0HA 3CA0A 4ZGRB 1V6UA 1YBIA 3TC2A 5D62A 3UD8A 3FJ9A 4KEIA 3O3QA 1RMLA 3A22A 31BIA 2NVHA 1JTCA 2NZ9A 1PC8B 4J2SA 3PG0A 4LO2A 3RSJA 3CA4A 1PUMB 4ZOTA 5F8WA 4CJMA 2F8XC 1XYFA 5BQUC 2HZ9A 4LO1A 5JMCA 4DEPA 4MZGB 4ENDA 4LO0C 3BAGA 2NS2A 4UY4A 3V79C 3AH1A 3WA1A 4FGFA 3HN1A 3JUTA 4GP0A 3CU1B 1HWNB 3AJ6A 3CA3A 1IRPA 2J3PA 3CA1A 2KLLA 2VXTI 3H6QA 4H75A 1G9BA 1FV2A 4GP3A 2MC2A 1EYLA 2LIEA 3S8JA 1V6XA 4I4UA 4QKRA 5JLVA 4J2XA 2QYIB 1AVAC 1W3FA 7I1BA 1UPSA 1K5UA 1HWOB 1S0LA 3V0BB 3WMVA 1I1EA 2BEAA 2DRYA 3PHZA 3ZC9A 4F34A 2ERMA 3HSMA 4IONA 4OW4A 1HCEA 3HMYA 2GO2A 4IYBA 4I4PA 5FZZA 4DENA 2Q9XA 1EV2A 3O4AA 4I1BA 2HWMA 3ZX7A 1ISYA 4OWJA 1RY7A 4I4VA 1XG6A 1FWUA 2D1ZA 3KMVA 3N7KA 3E8LC 1FWVA 3OJVA 3UJ4A 3UD9A 4ISRA 1ISVA 4I8MA 4P0LA 3VT0A 3CRGA 1TTUA 1GGPB 4H04A 4I4RA 1IT0A 3O4OA 4OWKA 3BAUA 2D44A 5DUYA 4L4HA 1RG8A 2Z49A 2D7IA 3NBDA 3ILAA 3AH2A 4QBCA 4Z8SB 4OUJA 3V0BA 1YYNA 4IY8A 3F1RA 5BOWA 3I2XA 3OJMA 1DIWA 1R8OA 4X3AA 1S0BA 1DLLA 2Y9FA 1AVXB 1TWEA 1IILA 3PMEA 3NBNA 4XKIA 4TLPA 1JT3A 1JT5A 4X37A 1S0GA 1JY0A 3FJBA 4XFUA 4G1RA 3JRRA 3UDAA 4I6IA 1BLDA 4EFPA 3N7LA 2P39A 2D7RA 4ZFWB 41BIA 4LO2C 2HW9A 4QD2B 3BA4A 4QKSA 3VUOA 4I1EA 3T8SA 4I0YA 2D23A 2VXRA 4LO1C 2KH2A 4QALA 3BTAA 4JP0A 1FN0A 3MPPG 1ILR1 4J2KA 1OQLB 3LLPA 2FO1A 3R4SA 5D61A 1JLXA 5F8SA 3VWCA 4HJJA 2NYYA 4QC4A 3I2AA 4KEJA 3BAOA 5F90A 1VCLA 2D43A 4ZA3B 4Q9PA 5E24E 1XHBA 3RMXA 1IOBA 4AN7B 4ZBVB 1Q04A 2VSEA 3P6JA 2KI6B 3LTQA 5BXTA 4LO7B 4KEKA 1WD3A 3Q7YA 5G00A 1G9CA 4I4QA 2P23A 4EB2B 2FGFA 3V0AB 4GOYA 4LO7C 3OBRA 1BFFA 3BX1C 4ISQA 1ABRB 5BXSA 2LIQA 3VSZA 2F2FA 3FUQA 4JKXB 4IZXA 3O5WB 1Z4SA 1WBCA 1QQLA 1M16A 3P6IA 4J23B 1DJSB 4I4XA 3WO4A 1TWMA 2K43A 2DS0A 2RQ9A 3HOMA 3PUBA 5FNWA 3WO2A 1Q1UA 3H6RA 3H6SE
chains in the Genus database with same CATH topology
2RSTA 1M2TB 1HKNA 3WINA 1ISXA 6I1BA 5HPZA 1G82A 4I37A 1G9DA 3UD7A 3RTIB 1HWMB 1A8DA 3C9ZA 3ZC8A 2Y9GA 4D0ZA 3OGGA 1V6VA 1HWPB 3OJ2A 1DQOA 4JRAA 2FFVA 1K5VA 4G9MA 3AKGA 2QN4A 3O44A 4EKXB 1II4A 1PZZA 2Y9XE 3P53A 4AN6A 3V0AA 2DRZA 2NM1A 4I7IA 4EFRA 2IHOA 2X2SA 3O49A 4A7KA 1EPWA 3FGMA 8I1BA 3IM7A 5BP5A 1DZCA 3CAHA 1P63A 2D24A 1AVUA 5F8YA 2X2TA 5GAQA 1R8NA 3D7WB 1MC9A 4OEEA 2ESUA 3QYDA 1ITBA 21BIA 3NBCA 3AKIA 3POKA 4I96A 5EC5A 3BRDA 4USOA 3O4BA 1L2HA 1QXMA 3O4DA 4DCKC 3I29B 3FJEA 1JLYA 1W3GA 3BAVA 3HALA 1NZKA 4G6MA 2E4MA 2NP0A 4Q9GA 4P0JA 4IY9A 4I4SA 1TOOA 1WBAA 4PC4A 4HA2A 1JT7A 1DFQA 1HIBA 1KNMA 2RG9B 3N0KA 4L4IA 2D22A 3BRFA 2AQZA 3IM6A 3FUOA 4GAIA 4X39A 1TIEA 1TFMB 3R4UA 3FJIA 2NTDA 4IQPA 5DVHA 3ZXGA 4YOLA 1F31A 3CQAA 5BXPA 3FJFA 1AF9A 4IHZA 3FFZA 2Q3NB 4HR6C 5DZUA 3WO3A 4QD2C 1FMMS 1BFBA 1DFCA 4OEFA 2R9KB 2F2FC 3B9UA 4JAWA 5BXRA 4GAFA 4XFTA 5EG6C 1BLAA 3H6RB 4I3NA 4A7YA 1MD6A 1SR4C 1S0FA 2VLCA 1Z0HA 1FV3A 3CRIA 1BFGA 4XFSA 3BA5A 3WINC 4Q91A 2BEBA 3CRHA 3HBWA 2DREA 1YF8B 1QQKA 2FFUA 3BAHA 1SZ6B 4ZLBB 2HWAA 4R6UB 4I4YA 1AFCA 4ZFUB 1J0SA 3RMYA 3NBEA 1PWAA 1XZZA 2MIBA 3AKFA 1SR4A 1HCDA 1FQ9A 1BASA 3AJ5A 3BADA 5BP5C 3SNVA 1T4QA 4OWLA 1IRAX 1TP0A 9ILBA 4KC3A 2VU9A 3W9TA 1V6WA 4D8HA 3EF2A 1AVWB 2YUGA 5FNXA 4Z9WB 3IAGC 1S0DA 3OBTA 1S0CA 4GOVA 4FVVA 4LO8B 3FJDA 4LO3C 3BB2A 1FGAA 2I1BA 3OGFA 3RTJB 3N7JA 4JPZA 1FMZA 1BFCA 2M49A 1G9AA 1E0OA 1PUUB 3WMUA 3CA6A 4MZHA 2E4MC 2ZQNA 4WBCA 1NUNA 2XOAA 3VT2A 5BQUA 3NJ5A 4P6AA 2Y9WC 4MZFB 5DSSB 3AH4A 4QBVA 5B2HA 2ZR1B 1BA7A 1Q03A 3VSFA 1ONKB 4LO0A 3A07A 2MLLB 2KI4A 3A23A 5I1BA 3VT1A 1AXMA 1Z2VA 3BA7A 2AFGA 2ET2A 2ZQOA 3N7MA 5FZUA 4ZKTB 4II0A 4IZEA 2WBCA 1JQZA 3IM5A 4H9WA 3S8KA 4LO3A 4I4OA 1S0EA 2D20A 3A21A 1EVTA 4F83A 1IJTA 5BVPI 1CE7B 4JKQA 3UJ0A 3AZVA 4OEGA 3VEQA 4ZFYB 1BARA 3CA5A 4A7ZA 1YTOA 3FJ8A 3FJHA 4JQ0A 2WRYA 3O4CA 1T9FA 3BRGC 4USPA 2IWTB 2FDBM 1DZDA 3F62B 5FZYA 2VUAA 1I1BA 1YXWA 2K8RA 4X38A 2K4AB 2Z48A 3QR5A 4D0TA 4EFQA 3MALA 3FJAA 4J2YA 2GZBA 2UUSA 1WD4A 3Q7WA 1N4KA 1RZOB 2AAIB 4QO3A 1IHKA 2BFHA 4P0KA 1CVSA 3FJKA 4KBBA 3ZXDA 3K1XA 3IIRA 4EEEB 1ISWA 3Q7XA 3FJCA 2KKIA 3FJJA 5D63A 5EHAA 2AXMA 1JT4A 4G9NA 2VSAA 3AKHA 1DQGA 1ISZA 4I2SA 4G6JA 1W3AA 3BAQA 3AZWA 2L5XA 1D0HA 3CA0A 4ZGRB 1V6UA 1YBIA 3TC2A 5D62A 3UD8A 3FJ9A 4KEIA 3O3QA 1RMLA 3A22A 31BIA 2NVHA 1JTCA 2NZ9A 1PC8B 4J2SA 3PG0A 4LO2A 3RSJA 3CA4A 1PUMB 4ZOTA 5F8WA 4CJMA 2F8XC 1XYFA 5BQUC 2HZ9A 4LO1A 5JMCA 4DEPA 4MZGB 4ENDA 4LO0C 3BAGA 2NS2A 4UY4A 3V79C 3AH1A 3WA1A 4FGFA 3HN1A 3JUTA 4GP0A 3CU1B 1HWNB 3AJ6A 3CA3A 1IRPA 2J3PA 3CA1A 2KLLA 2VXTI 3H6QA 4H75A 1G9BA 1FV2A 4GP3A 2MC2A 1EYLA 2LIEA 3S8JA 1V6XA 4I4UA 4QKRA 5JLVA 4J2XA 2QYIB 1AVAC 1W3FA 7I1BA 1UPSA 1K5UA 1HWOB 1S0LA 3V0BB 3WMVA 1I1EA 2BEAA 2DRYA 3PHZA 3ZC9A 4F34A 2ERMA 3HSMA 4IONA 4OW4A 1HCEA 3HMYA 2GO2A 4IYBA 4I4PA 5FZZA 4DENA 2Q9XA 1EV2A 3O4AA 4I1BA 2HWMA 3ZX7A 1ISYA 4OWJA 1RY7A 4I4VA 1XG6A 1FWUA 2D1ZA 3KMVA 3N7KA 3E8LC 1FWVA 3OJVA 3UJ4A 3UD9A 4ISRA 1ISVA 4I8MA 4P0LA 3VT0A 3CRGA 1TTUA 1GGPB 4H04A 4I4RA 1IT0A 3O4OA 4OWKA 3BAUA 2D44A 5DUYA 4L4HA 1RG8A 2Z49A 2D7IA 3NBDA 3ILAA 3AH2A 4QBCA 4Z8SB 4OUJA 3V0BA 1YYNA 4IY8A 3F1RA 5BOWA 3I2XA 3OJMA 1DIWA 1R8OA 4X3AA 1S0BA 1DLLA 2Y9FA 1AVXB 1TWEA 1IILA 3PMEA 3NBNA 4XKIA 4TLPA 1JT3A 1JT5A 4X37A 1S0GA 1JY0A 3FJBA 4XFUA 4G1RA 3JRRA 3UDAA 4I6IA 1BLDA 4EFPA 3N7LA 2P39A 2D7RA 4ZFWB 41BIA 4LO2C 2HW9A 4QD2B 3BA4A 4QKSA 3VUOA 4I1EA 3T8SA 4I0YA 2D23A 2VXRA 4LO1C 2KH2A 4QALA 3BTAA 4JP0A 1FN0A 3MPPG 1ILR1 4J2KA 1OQLB 3LLPA 2FO1A 3R4SA 5D61A 1JLXA 5F8SA 3VWCA 4HJJA 2NYYA 4QC4A 3I2AA 4KEJA 3BAOA 5F90A 1VCLA 2D43A 4ZA3B 4Q9PA 5E24E 1XHBA 3RMXA 1IOBA 4AN7B 4ZBVB 1Q04A 2VSEA 3P6JA 2KI6B 3LTQA 5BXTA 4LO7B 4KEKA 1WD3A 3Q7YA 5G00A 1G9CA 4I4QA 2P23A 4EB2B 2FGFA 3V0AB 4GOYA 4LO7C 3OBRA 1BFFA 3BX1C 4ISQA 1ABRB 5BXSA 2LIQA 3VSZA 2F2FA 3FUQA 4JKXB 4IZXA 3O5WB 1Z4SA 1WBCA 1QQLA 1M16A 3P6IA 4J23B 1DJSB 4I4XA 3WO4A 1TWMA 2K43A 2DS0A 2RQ9A 3HOMA 3PUBA 5FNWA 3WO2A 1Q1UA 3H6RA 3H6SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RST A;  1M2T B;  1HKN A;  3WIN A;  1ISX A;  6I1B A;  5HPZ A;  1G82 A;  4I37 A;  1G9D A;  3UD7 A;  3RTI B;  1HWM B;  1A8D A;  3C9Z A;  3ZC8 A;  2Y9G A;  4D0Z A;  3OGG A;  1V6V A;  1HWP B;  3OJ2 A;  1DQO A;  4JRA A;  2FFV A;  1K5V A;  4G9M A;  3AKG A;  2QN4 A;  3O44 A;  4EKX B;  1II4 A;  1PZZ A;  2Y9X E;  3P53 A;  4AN6 A;  3V0A A;  2DRZ A;  2NM1 A;  4I7I A;  4EFR A;  2IHO A;  2X2S A;  3O49 A;  4A7K A;  1EPW A;  3FGM A;  8I1B A;  3IM7 A;  5BP5 A;  1DZC A;  3CAH A;  1P63 A;  2D24 A;  1AVU A;  5F8Y A;  2X2T A;  5GAQ A;  1R8N A;  3D7W B;  1MC9 A;  4OEE A;  2ESU A;  3QYD A;  1ITB A;  21BI A;  3NBC A;  3AKI A;  3POK A;  4I96 A;  5EC5 A;  3BRD A;  4USO A;  3O4B A;  1L2H A;  1QXM A;  3O4D A;  4DCK C;  3I29 B;  3FJE A;  1JLY A;  1W3G A;  3BAV A;  3HAL A;  1NZK A;  4G6M A;  2E4M A;  2NP0 A;  4Q9G A;  4P0J A;  4IY9 A;  4I4S A;  1TOO A;  1WBA A;  4PC4 A;  4HA2 A;  1JT7 A;  1DFQ A;  1HIB A;  1KNM A;  2RG9 B;  3N0K A;  4L4I A;  2D22 A;  3BRF A;  2AQZ A;  3IM6 A;  3FUO A;  4GAI A;  4X39 A;  1TIE A;  1TFM B;  3R4U A;  3FJI A;  2NTD A;  4IQP A;  5DVH A;  3ZXG A;  4YOL A;  1F31 A;  3CQA A;  5BXP A;  3FJF A;  1AF9 A;  4IHZ A;  3FFZ A;  2Q3N B;  4HR6 C;  5DZU A;  3WO3 A;  4QD2 C;  1FMM S;  1BFB A;  1DFC A;  4OEF A;  2R9K B;  2F2F C;  3B9U A;  4JAW A;  5BXR A;  4GAF A;  4XFT A;  5EG6 C;  1BLA A;  3H6R B;  4I3N A;  4A7Y A;  1MD6 A;  1SR4 C;  1S0F A;  2VLC A;  1Z0H A;  1FV3 A;  3CRI A;  1BFG A;  4XFS A;  3BA5 A;  3WIN C;  4Q91 A;  2BEB A;  3CRH A;  3HBW A;  2DRE A;  1YF8 B;  1QQK A;  2FFU A;  3BAH A;  1SZ6 B;  4ZLB B;  2HWA A;  4R6U B;  4I4Y A;  1AFC A;  4ZFU B;  1J0S A;  3RMY A;  3NBE A;  1PWA A;  1XZZ A;  2MIB A;  3AKF A;  1SR4 A;  1HCD A;  1FQ9 A;  1BAS A;  3AJ5 A;  3BAD A;  5BP5 C;  3SNV A;  1T4Q A;  4OWL A;  1IRA X;  1TP0 A;  9ILB A;  4KC3 A;  2VU9 A;  3W9T A;  1V6W A;  4D8H A;  3EF2 A;  1AVW B;  2YUG A;  5FNX A;  4Z9W B;  3IAG C;  1S0D A;  3OBT A;  1S0C A;  4GOV A;  4FVV A;  4LO8 B;  3FJD A;  4LO3 C;  3BB2 A;  1FGA A;  2I1B A;  3OGF A;  3RTJ B;  3N7J A;  4JPZ A;  1FMZ A;  1BFC A;  2M49 A;  1G9A A;  1E0O A;  1PUU B;  3WMU A;  3CA6 A;  2E4M C;  2ZQN A;  4WBC A;  1NUN A;  2XOA A;  3VT2 A;  5BQU A;  3NJ5 A;  4P6A A;  2Y9W C;  5DSS B;  3AH4 A;  4QBV A;  5B2H A;  2ZR1 B;  1BA7 A;  1Q03 A;  3VSF A;  1ONK B;  4LO0 A;  3A07 A;  2MLL B;  2KI4 A;  3A23 A;  5I1B A;  3VT1 A;  1AXM A;  1Z2V A;  3BA7 A;  2AFG A;  2ET2 A;  2ZQO A;  3N7M A;  5FZU A;  4ZKT B;  4II0 A;  4IZE A;  2WBC A;  1JQZ A;  3IM5 A;  4H9W A;  3S8K A;  4LO3 A;  4I4O A;  1S0E A;  2D20 A;  3A21 A;  1EVT A;  4F83 A;  1IJT A;  5BVP I;  1CE7 B;  4JKQ A;  3UJ0 A;  3AZV A;  4OEG A;  3VEQ A;  4ZFY B;  1BAR A;  3CA5 A;  4A7Z A;  1YTO A;  3FJ8 A;  3FJH A;  4JQ0 A;  2WRY A;  3O4C A;  1T9F A;  3BRG C;  4USP A;  2IWT B;  2FDB M;  1DZD A;  3F62 B;  5FZY A;  2VUA A;  1I1B A;  1YXW A;  2K8R A;  4X38 A;  2K4A B;  2Z48 A;  3QR5 A;  4D0T A;  4EFQ A;  3MAL A;  3FJA A;  4J2Y A;  2GZB A;  2UUS A;  1WD4 A;  3Q7W A;  1N4K A;  1RZO B;  2AAI B;  4QO3 A;  1IHK A;  2BFH A;  4P0K A;  1CVS A;  3FJK A;  4KBB A;  3ZXD A;  3K1X A;  3IIR A;  4EEE B;  1ISW A;  3Q7X A;  3FJC A;  2KKI A;  3FJJ A;  5D63 A;  5EHA A;  2AXM A;  1JT4 A;  4G9N A;  2VSA A;  3AKH A;  1DQG A;  1ISZ A;  4I2S A;  4G6J A;  1W3A A;  3BAQ A;  3AZW A;  2L5X A;  1D0H A;  3CA0 A;  4ZGR B;  1V6U A;  1YBI A;  3TC2 A;  5D62 A;  3UD8 A;  3FJ9 A;  4KEI A;  3O3Q A;  1RML A;  3A22 A;  31BI A;  2NVH A;  1JTC A;  2NZ9 A;  1PC8 B;  4J2S A;  3PG0 A;  4LO2 A;  3RSJ A;  3CA4 A;  1PUM B;  4ZOT A;  5F8W A;  4CJM A;  2F8X C;  1XYF A;  5BQU C;  2HZ9 A;  4LO1 A;  5JMC A;  4DEP A;  4END A;  4LO0 C;  3BAG A;  3V79 C;  3AH1 A;  3WA1 A;  4FGF A;  3HN1 A;  3JUT A;  4GP0 A;  3CU1 B;  1HWN B;  3AJ6 A;  3CA3 A;  1IRP A;  2J3P A;  3CA1 A;  2KLL A;  2VXT I;  3H6Q A;  1G9B A;  1FV2 A;  4GP3 A;  2MC2 A;  1EYL A;  2LIE A;  3S8J A;  1V6X A;  4I4U A;  4QKR A;  5JLV A;  4J2X A;  2QYI B;  1AVA C;  1W3F A;  7I1B A;  1UPS A;  1K5U A;  1HWO B;  1S0L A;  3V0B B;  3WMV A;  1I1E A;  2BEA A;  2DRY A;  3PHZ A;  3ZC9 A;  4F34 A;  2ERM A;  3HSM A;  4ION A;  4OW4 A;  1HCE A;  3HMY A;  2GO2 A;  4IYB A;  4I4P A;  5FZZ A;  4DEN A;  2Q9X A;  1EV2 A;  3O4A A;  4I1B A;  2HWM A;  3ZX7 A;  1ISY A;  4OWJ A;  1RY7 A;  4I4V A;  1XG6 A;  1FWU A;  2D1Z A;  3KMV A;  3N7K A;  3E8L C;  1FWV A;  3OJV A;  3UJ4 A;  3UD9 A;  4ISR A;  1ISV A;  4I8M A;  4P0L A;  3VT0 A;  3CRG A;  1TTU A;  1GGP B;  4H04 A;  4I4R A;  1IT0 A;  3O4O A;  4OWK A;  3BAU A;  2D44 A;  5DUY A;  4L4H A;  1RG8 A;  2Z49 A;  2D7I A;  3NBD A;  3ILA A;  3AH2 A;  4QBC A;  4Z8S B;  4OUJ A;  3V0B A;  1YYN A;  4IY8 A;  3F1R A;  5BOW A;  3I2X A;  3OJM A;  1DIW A;  1R8O A;  4X3A A;  1S0B A;  1DLL A;  2Y9F A;  1AVX B;  1TWE A;  1IIL A;  3PME A;  3NBN A;  4XKI A;  4TLP A;  1JT3 A;  1JT5 A;  4X37 A;  1S0G A;  1JY0 A;  3FJB A;  4XFU A;  4G1R A;  3JRR A;  3UDA A;  4I6I A;  1BLD A;  4EFP A;  3N7L A;  2P39 A;  2D7R A;  4ZFW B;  41BI A;  4LO2 C;  2HW9 A;  4QD2 B;  3BA4 A;  4QKS A;  3VUO A;  4I1E A;  3T8S A;  4I0Y A;  2D23 A;  2VXR A;  4LO1 C;  2KH2 A;  4QAL A;  3BTA A;  4JP0 A;  1FN0 A;  3MPP G;  1ILR 1;  4J2K A;  1OQL B;  3LLP A;  2FO1 A;  3R4S A;  5D61 A;  1JLX A;  5F8S A;  3VWC A;  4HJJ A;  2NYY A;  4QC4 A;  3I2A A;  4KEJ A;  3BAO A;  5F90 A;  1VCL A;  2D43 A;  4ZA3 B;  4Q9P A;  5E24 E;  1XHB A;  3RMX A;  1IOB A;  4AN7 B;  4ZBV B;  1Q04 A;  2VSE A;  3P6J A;  2KI6 B;  3LTQ A;  5BXT A;  4LO7 B;  4KEK A;  1WD3 A;  3Q7Y A;  5G00 A;  1G9C A;  4I4Q A;  2P23 A;  4EB2 B;  2FGF A;  3V0A B;  4GOY A;  4LO7 C;  3OBR A;  1BFF A;  3BX1 C;  4ISQ A;  1ABR B;  5BXS A;  2LIQ A;  3VSZ A;  2F2F A;  3FUQ A;  4JKX B;  4IZX A;  3O5W B;  1Z4S A;  1WBC A;  1QQL A;  1M16 A;  3P6I A;  4J23 B;  1DJS B;  4I4X A;  3WO4 A;  1TWM A;  2K43 A;  2DS0 A;  2RQ9 A;  3HOM A;  3PUB A;  5FNW A;  3WO2 A;  1Q1U A;  3H6R A;  3H6S E; 
#chains in the Genus database with same CATH topology
 2RST A;  1M2T B;  1HKN A;  3WIN A;  1ISX A;  6I1B A;  5HPZ A;  1G82 A;  4I37 A;  1G9D A;  3UD7 A;  3RTI B;  1HWM B;  1A8D A;  3C9Z A;  3ZC8 A;  2Y9G A;  4D0Z A;  3OGG A;  1V6V A;  1HWP B;  3OJ2 A;  1DQO A;  4JRA A;  2FFV A;  1K5V A;  4G9M A;  3AKG A;  2QN4 A;  3O44 A;  4EKX B;  1II4 A;  1PZZ A;  2Y9X E;  3P53 A;  4AN6 A;  3V0A A;  2DRZ A;  2NM1 A;  4I7I A;  4EFR A;  2IHO A;  2X2S A;  3O49 A;  4A7K A;  1EPW A;  3FGM A;  8I1B A;  3IM7 A;  5BP5 A;  1DZC A;  3CAH A;  1P63 A;  2D24 A;  1AVU A;  5F8Y A;  2X2T A;  5GAQ A;  1R8N A;  3D7W B;  1MC9 A;  4OEE A;  2ESU A;  3QYD A;  1ITB A;  21BI A;  3NBC A;  3AKI A;  3POK A;  4I96 A;  5EC5 A;  3BRD A;  4USO A;  3O4B A;  1L2H A;  1QXM A;  3O4D A;  4DCK C;  3I29 B;  3FJE A;  1JLY A;  1W3G A;  3BAV A;  3HAL A;  1NZK A;  4G6M A;  2E4M A;  2NP0 A;  4Q9G A;  4P0J A;  4IY9 A;  4I4S A;  1TOO A;  1WBA A;  4PC4 A;  4HA2 A;  1JT7 A;  1DFQ A;  1HIB A;  1KNM A;  2RG9 B;  3N0K A;  4L4I A;  2D22 A;  3BRF A;  2AQZ A;  3IM6 A;  3FUO A;  4GAI A;  4X39 A;  1TIE A;  1TFM B;  3R4U A;  3FJI A;  2NTD A;  4IQP A;  5DVH A;  3ZXG A;  4YOL A;  1F31 A;  3CQA A;  5BXP A;  3FJF A;  1AF9 A;  4IHZ A;  3FFZ A;  2Q3N B;  4HR6 C;  5DZU A;  3WO3 A;  4QD2 C;  1FMM S;  1BFB A;  1DFC A;  4OEF A;  2R9K B;  2F2F C;  3B9U A;  4JAW A;  5BXR A;  4GAF A;  4XFT A;  5EG6 C;  1BLA A;  3H6R B;  4I3N A;  4A7Y A;  1MD6 A;  1SR4 C;  1S0F A;  2VLC A;  1Z0H A;  1FV3 A;  3CRI A;  1BFG A;  4XFS A;  3BA5 A;  3WIN C;  4Q91 A;  2BEB A;  3CRH A;  3HBW A;  2DRE A;  1YF8 B;  1QQK A;  2FFU A;  3BAH A;  1SZ6 B;  4ZLB B;  2HWA A;  4R6U B;  4I4Y A;  1AFC A;  4ZFU B;  1J0S A;  3RMY A;  3NBE A;  1PWA A;  1XZZ A;  2MIB A;  3AKF A;  1SR4 A;  1HCD A;  1FQ9 A;  1BAS A;  3AJ5 A;  3BAD A;  5BP5 C;  3SNV A;  1T4Q A;  4OWL A;  1IRA X;  1TP0 A;  9ILB A;  4KC3 A;  2VU9 A;  3W9T A;  1V6W A;  4D8H A;  3EF2 A;  1AVW B;  2YUG A;  5FNX A;  4Z9W B;  3IAG C;  1S0D A;  3OBT A;  1S0C A;  4GOV A;  4FVV A;  4LO8 B;  3FJD A;  4LO3 C;  3BB2 A;  1FGA A;  2I1B A;  3OGF A;  3RTJ B;  3N7J A;  4JPZ A;  1FMZ A;  1BFC A;  2M49 A;  1G9A A;  1E0O A;  1PUU B;  3WMU A;  3CA6 A;  4MZH A;  2E4M C;  2ZQN A;  4WBC A;  1NUN A;  2XOA A;  3VT2 A;  5BQU A;  3NJ5 A;  4P6A A;  2Y9W C;  4MZF B;  5DSS B;  3AH4 A;  4QBV A;  5B2H A;  2ZR1 B;  1BA7 A;  1Q03 A;  3VSF A;  1ONK B;  4LO0 A;  3A07 A;  2MLL B;  2KI4 A;  3A23 A;  5I1B A;  3VT1 A;  1AXM A;  1Z2V A;  3BA7 A;  2AFG A;  2ET2 A;  2ZQO A;  3N7M A;  5FZU A;  4ZKT B;  4II0 A;  4IZE A;  2WBC A;  1JQZ A;  3IM5 A;  4H9W A;  3S8K A;  4LO3 A;  4I4O A;  1S0E A;  2D20 A;  3A21 A;  1EVT A;  4F83 A;  1IJT A;  5BVP I;  1CE7 B;  4JKQ A;  3UJ0 A;  3AZV A;  4OEG A;  3VEQ A;  4ZFY B;  1BAR A;  3CA5 A;  4A7Z A;  1YTO A;  3FJ8 A;  3FJH A;  4JQ0 A;  2WRY A;  3O4C A;  1T9F A;  3BRG C;  4USP A;  2IWT B;  2FDB M;  1DZD A;  3F62 B;  5FZY A;  2VUA A;  1I1B A;  1YXW A;  2K8R A;  4X38 A;  2K4A B;  2Z48 A;  3QR5 A;  4D0T A;  4EFQ A;  3MAL A;  3FJA A;  4J2Y A;  2GZB A;  2UUS A;  1WD4 A;  3Q7W A;  1N4K A;  1RZO B;  2AAI B;  4QO3 A;  1IHK A;  2BFH A;  4P0K A;  1CVS A;  3FJK A;  4KBB A;  3ZXD A;  3K1X A;  3IIR A;  4EEE B;  1ISW A;  3Q7X A;  3FJC A;  2KKI A;  3FJJ A;  5D63 A;  5EHA A;  2AXM A;  1JT4 A;  4G9N A;  2VSA A;  3AKH A;  1DQG A;  1ISZ A;  4I2S A;  4G6J A;  1W3A A;  3BAQ A;  3AZW A;  2L5X A;  1D0H A;  3CA0 A;  4ZGR B;  1V6U A;  1YBI A;  3TC2 A;  5D62 A;  3UD8 A;  3FJ9 A;  4KEI A;  3O3Q A;  1RML A;  3A22 A;  31BI A;  2NVH A;  1JTC A;  2NZ9 A;  1PC8 B;  4J2S A;  3PG0 A;  4LO2 A;  3RSJ A;  3CA4 A;  1PUM B;  4ZOT A;  5F8W A;  4CJM A;  2F8X C;  1XYF A;  5BQU C;  2HZ9 A;  4LO1 A;  5JMC A;  4DEP A;  4MZG B;  4END A;  4LO0 C;  3BAG A;  2NS2 A;  4UY4 A;  3V79 C;  3AH1 A;  3WA1 A;  4FGF A;  3HN1 A;  3JUT A;  4GP0 A;  3CU1 B;  1HWN B;  3AJ6 A;  3CA3 A;  1IRP A;  2J3P A;  3CA1 A;  2KLL A;  2VXT I;  3H6Q A;  4H75 A;  1G9B A;  1FV2 A;  4GP3 A;  2MC2 A;  1EYL A;  2LIE A;  3S8J A;  1V6X A;  4I4U A;  4QKR A;  5JLV A;  4J2X A;  2QYI B;  1AVA C;  1W3F A;  7I1B A;  1UPS A;  1K5U A;  1HWO B;  1S0L A;  3V0B B;  3WMV A;  1I1E A;  2BEA A;  2DRY A;  3PHZ A;  3ZC9 A;  4F34 A;  2ERM A;  3HSM A;  4ION A;  4OW4 A;  1HCE A;  3HMY A;  2GO2 A;  4IYB A;  4I4P A;  5FZZ A;  4DEN A;  2Q9X A;  1EV2 A;  3O4A A;  4I1B A;  2HWM A;  3ZX7 A;  1ISY A;  4OWJ A;  1RY7 A;  4I4V A;  1XG6 A;  1FWU A;  2D1Z A;  3KMV A;  3N7K A;  3E8L C;  1FWV A;  3OJV A;  3UJ4 A;  3UD9 A;  4ISR A;  1ISV A;  4I8M A;  4P0L A;  3VT0 A;  3CRG A;  1TTU A;  1GGP B;  4H04 A;  4I4R A;  1IT0 A;  3O4O A;  4OWK A;  3BAU A;  2D44 A;  5DUY A;  4L4H A;  1RG8 A;  2Z49 A;  2D7I A;  3NBD A;  3ILA A;  3AH2 A;  4QBC A;  4Z8S B;  4OUJ A;  3V0B A;  1YYN A;  4IY8 A;  3F1R A;  5BOW A;  3I2X A;  3OJM A;  1DIW A;  1R8O A;  4X3A A;  1S0B A;  1DLL A;  2Y9F A;  1AVX B;  1TWE A;  1IIL A;  3PME A;  3NBN A;  4XKI A;  4TLP A;  1JT3 A;  1JT5 A;  4X37 A;  1S0G A;  1JY0 A;  3FJB A;  4XFU A;  4G1R A;  3JRR A;  3UDA A;  4I6I A;  1BLD A;  4EFP A;  3N7L A;  2P39 A;  2D7R A;  4ZFW B;  41BI A;  4LO2 C;  2HW9 A;  4QD2 B;  3BA4 A;  4QKS A;  3VUO A;  4I1E A;  3T8S A;  4I0Y A;  2D23 A;  2VXR A;  4LO1 C;  2KH2 A;  4QAL A;  3BTA A;  4JP0 A;  1FN0 A;  3MPP G;  1ILR 1;  4J2K A;  1OQL B;  3LLP A;  2FO1 A;  3R4S A;  5D61 A;  1JLX A;  5F8S A;  3VWC A;  4HJJ A;  2NYY A;  4QC4 A;  3I2A A;  4KEJ A;  3BAO A;  5F90 A;  1VCL A;  2D43 A;  4ZA3 B;  4Q9P A;  5E24 E;  1XHB A;  3RMX A;  1IOB A;  4AN7 B;  4ZBV B;  1Q04 A;  2VSE A;  3P6J A;  2KI6 B;  3LTQ A;  5BXT A;  4LO7 B;  4KEK A;  1WD3 A;  3Q7Y A;  5G00 A;  1G9C A;  4I4Q A;  2P23 A;  4EB2 B;  2FGF A;  3V0A B;  4GOY A;  4LO7 C;  3OBR A;  1BFF A;  3BX1 C;  4ISQ A;  1ABR B;  5BXS A;  2LIQ A;  3VSZ A;  2F2F A;  3FUQ A;  4JKX B;  4IZX A;  3O5W B;  1Z4S A;  1WBC A;  1QQL A;  1M16 A;  3P6I A;  4J23 B;  1DJS B;  4I4X A;  3WO4 A;  1TWM A;  2K43 A;  2DS0 A;  2RQ9 A;  3HOM A;  3PUB A;  5FNW A;  3WO2 A;  1Q1U A;  3H6R A;  3H6S E; 
#chains in the Genus database with same CATH homology
 2RST A;  1M2T B;  1HKN A;  3WIN A;  1ISX A;  6I1B A;  5HPZ A;  1G82 A;  4I37 A;  1G9D A;  3UD7 A;  3RTI B;  1HWM B;  1A8D A;  3C9Z A;  3ZC8 A;  2Y9G A;  4D0Z A;  3OGG A;  1V6V A;  1HWP B;  3OJ2 A;  1DQO A;  4JRA A;  2FFV A;  1K5V A;  4G9M A;  3AKG A;  2QN4 A;  3O44 A;  4EKX B;  1II4 A;  1PZZ A;  2Y9X E;  3P53 A;  4AN6 A;  3V0A A;  2DRZ A;  2NM1 A;  4I7I A;  4EFR A;  2IHO A;  2X2S A;  3O49 A;  4A7K A;  1EPW A;  3FGM A;  8I1B A;  3IM7 A;  5BP5 A;  1DZC A;  3CAH A;  1P63 A;  2D24 A;  1AVU A;  5F8Y A;  2X2T A;  5GAQ A;  1R8N A;  3D7W B;  1MC9 A;  4OEE A;  2ESU A;  3QYD A;  1ITB A;  21BI A;  3NBC A;  3AKI A;  3POK A;  4I96 A;  5EC5 A;  3BRD A;  4USO A;  3O4B A;  1L2H A;  1QXM A;  3O4D A;  4DCK C;  3I29 B;  3FJE A;  1JLY A;  1W3G A;  3BAV A;  3HAL A;  1NZK A;  4G6M A;  2E4M A;  2NP0 A;  4Q9G A;  4P0J A;  4IY9 A;  4I4S A;  1TOO A;  1WBA A;  4PC4 A;  4HA2 A;  1JT7 A;  1DFQ A;  1HIB A;  1KNM A;  2RG9 B;  3N0K A;  4L4I A;  2D22 A;  3BRF A;  2AQZ A;  3IM6 A;  3FUO A;  4GAI A;  4X39 A;  1TIE A;  1TFM B;  3R4U A;  3FJI A;  2NTD A;  4IQP A;  5DVH A;  3ZXG A;  4YOL A;  1F31 A;  3CQA A;  5BXP A;  3FJF A;  1AF9 A;  4IHZ A;  3FFZ A;  2Q3N B;  4HR6 C;  5DZU A;  3WO3 A;  4QD2 C;  1FMM S;  1BFB A;  1DFC A;  4OEF A;  2R9K B;  2F2F C;  3B9U A;  4JAW A;  5BXR A;  4GAF A;  4XFT A;  5EG6 C;  1BLA A;  3H6R B;  4I3N A;  4A7Y A;  1MD6 A;  1SR4 C;  1S0F A;  2VLC A;  1Z0H A;  1FV3 A;  3CRI A;  1BFG A;  4XFS A;  3BA5 A;  3WIN C;  4Q91 A;  2BEB A;  3CRH A;  3HBW A;  2DRE A;  1YF8 B;  1QQK A;  2FFU A;  3BAH A;  1SZ6 B;  4ZLB B;  2HWA A;  4R6U B;  4I4Y A;  1AFC A;  4ZFU B;  1J0S A;  3RMY A;  3NBE A;  1PWA A;  1XZZ A;  2MIB A;  3AKF A;  1SR4 A;  1HCD A;  1FQ9 A;  1BAS A;  3AJ5 A;  3BAD A;  5BP5 C;  3SNV A;  1T4Q A;  4OWL A;  1IRA X;  1TP0 A;  9ILB A;  4KC3 A;  2VU9 A;  3W9T A;  1V6W A;  4D8H A;  3EF2 A;  1AVW B;  2YUG A;  5FNX A;  4Z9W B;  3IAG C;  1S0D A;  3OBT A;  1S0C A;  4GOV A;  4FVV A;  4LO8 B;  3FJD A;  4LO3 C;  3BB2 A;  1FGA A;  2I1B A;  3OGF A;  3RTJ B;  3N7J A;  4JPZ A;  1FMZ A;  1BFC A;  2M49 A;  1G9A A;  1E0O A;  1PUU B;  3WMU A;  3CA6 A;  4MZH A;  2E4M C;  2ZQN A;  4WBC A;  1NUN A;  2XOA A;  3VT2 A;  5BQU A;  3NJ5 A;  4P6A A;  2Y9W C;  4MZF B;  5DSS B;  3AH4 A;  4QBV A;  5B2H A;  2ZR1 B;  1BA7 A;  1Q03 A;  3VSF A;  1ONK B;  4LO0 A;  3A07 A;  2MLL B;  2KI4 A;  3A23 A;  5I1B A;  3VT1 A;  1AXM A;  1Z2V A;  3BA7 A;  2AFG A;  2ET2 A;  2ZQO A;  3N7M A;  5FZU A;  4ZKT B;  4II0 A;  4IZE A;  2WBC A;  1JQZ A;  3IM5 A;  4H9W A;  3S8K A;  4LO3 A;  4I4O A;  1S0E A;  2D20 A;  3A21 A;  1EVT A;  4F83 A;  1IJT A;  5BVP I;  1CE7 B;  4JKQ A;  3UJ0 A;  3AZV A;  4OEG A;  3VEQ A;  4ZFY B;  1BAR A;  3CA5 A;  4A7Z A;  1YTO A;  3FJ8 A;  3FJH A;  4JQ0 A;  2WRY A;  3O4C A;  1T9F A;  3BRG C;  4USP A;  2IWT B;  2FDB M;  1DZD A;  3F62 B;  5FZY A;  2VUA A;  1I1B A;  1YXW A;  2K8R A;  4X38 A;  2K4A B;  2Z48 A;  3QR5 A;  4D0T A;  4EFQ A;  3MAL A;  3FJA A;  4J2Y A;  2GZB A;  2UUS A;  1WD4 A;  3Q7W A;  1N4K A;  1RZO B;  2AAI B;  4QO3 A;  1IHK A;  2BFH A;  4P0K A;  1CVS A;  3FJK A;  4KBB A;  3ZXD A;  3K1X A;  3IIR A;  4EEE B;  1ISW A;  3Q7X A;  3FJC A;  2KKI A;  3FJJ A;  5D63 A;  5EHA A;  2AXM A;  1JT4 A;  4G9N A;  2VSA A;  3AKH A;  1DQG A;  1ISZ A;  4I2S A;  4G6J A;  1W3A A;  3BAQ A;  3AZW A;  2L5X A;  1D0H A;  3CA0 A;  4ZGR B;  1V6U A;  1YBI A;  3TC2 A;  5D62 A;  3UD8 A;  3FJ9 A;  4KEI A;  3O3Q A;  1RML A;  3A22 A;  31BI A;  2NVH A;  1JTC A;  2NZ9 A;  1PC8 B;  4J2S A;  3PG0 A;  4LO2 A;  3RSJ A;  3CA4 A;  1PUM B;  4ZOT A;  5F8W A;  4CJM A;  2F8X C;  1XYF A;  5BQU C;  2HZ9 A;  4LO1 A;  5JMC A;  4DEP A;  4MZG B;  4END A;  4LO0 C;  3BAG A;  2NS2 A;  4UY4 A;  3V79 C;  3AH1 A;  3WA1 A;  4FGF A;  3HN1 A;  3JUT A;  4GP0 A;  3CU1 B;  1HWN B;  3AJ6 A;  3CA3 A;  1IRP A;  2J3P A;  3CA1 A;  2KLL A;  2VXT I;  3H6Q A;  4H75 A;  1G9B A;  1FV2 A;  4GP3 A;  2MC2 A;  1EYL A;  2LIE A;  3S8J A;  1V6X A;  4I4U A;  4QKR A;  5JLV A;  4J2X A;  2QYI B;  1AVA C;  1W3F A;  7I1B A;  1UPS A;  1K5U A;  1HWO B;  1S0L A;  3V0B B;  3WMV A;  1I1E A;  2BEA A;  2DRY A;  3PHZ A;  3ZC9 A;  4F34 A;  2ERM A;  3HSM A;  4ION A;  4OW4 A;  1HCE A;  3HMY A;  2GO2 A;  4IYB A;  4I4P A;  5FZZ A;  4DEN A;  2Q9X A;  1EV2 A;  3O4A A;  4I1B A;  2HWM A;  3ZX7 A;  1ISY A;  4OWJ A;  1RY7 A;  4I4V A;  1XG6 A;  1FWU A;  2D1Z A;  3KMV A;  3N7K A;  3E8L C;  1FWV A;  3OJV A;  3UJ4 A;  3UD9 A;  4ISR A;  1ISV A;  4I8M A;  4P0L A;  3VT0 A;  3CRG A;  1TTU A;  1GGP B;  4H04 A;  4I4R A;  1IT0 A;  3O4O A;  4OWK A;  3BAU A;  2D44 A;  5DUY A;  4L4H A;  1RG8 A;  2Z49 A;  2D7I A;  3NBD A;  3ILA A;  3AH2 A;  4QBC A;  4Z8S B;  4OUJ A;  3V0B A;  1YYN A;  4IY8 A;  3F1R A;  5BOW A;  3I2X A;  3OJM A;  1DIW A;  1R8O A;  4X3A A;  1S0B A;  1DLL A;  2Y9F A;  1AVX B;  1TWE A;  1IIL A;  3PME A;  3NBN A;  4XKI A;  4TLP A;  1JT3 A;  1JT5 A;  4X37 A;  1S0G A;  1JY0 A;  3FJB A;  4XFU A;  4G1R A;  3JRR A;  3UDA A;  4I6I A;  1BLD A;  4EFP A;  3N7L A;  2P39 A;  2D7R A;  4ZFW B;  41BI A;  4LO2 C;  2HW9 A;  4QD2 B;  3BA4 A;  4QKS A;  3VUO A;  4I1E A;  3T8S A;  4I0Y A;  2D23 A;  2VXR A;  4LO1 C;  2KH2 A;  4QAL A;  3BTA A;  4JP0 A;  1FN0 A;  3MPP G;  1ILR 1;  4J2K A;  1OQL B;  3LLP A;  2FO1 A;  3R4S A;  5D61 A;  1JLX A;  5F8S A;  3VWC A;  4HJJ A;  2NYY A;  4QC4 A;  3I2A A;  4KEJ A;  3BAO A;  5F90 A;  1VCL A;  2D43 A;  4ZA3 B;  4Q9P A;  5E24 E;  1XHB A;  3RMX A;  1IOB A;  4AN7 B;  4ZBV B;  1Q04 A;  2VSE A;  3P6J A;  2KI6 B;  3LTQ A;  5BXT A;  4LO7 B;  4KEK A;  1WD3 A;  3Q7Y A;  5G00 A;  1G9C A;  4I4Q A;  2P23 A;  4EB2 B;  2FGF A;  3V0A B;  4GOY A;  4LO7 C;  3OBR A;  1BFF A;  3BX1 C;  4ISQ A;  1ABR B;  5BXS A;  2LIQ A;  3VSZ A;  2F2F A;  3FUQ A;  4JKX B;  4IZX A;  3O5W B;  1Z4S A;  1WBC A;  1QQL A;  1M16 A;  3P6I A;  4J23 B;  1DJS B;  4I4X A;  3WO4 A;  1TWM A;  2K43 A;  2DS0 A;  2RQ9 A;  3HOM A;  3PUB A;  5FNW A;  3WO2 A;  1Q1U A;  3H6R A;  3H6S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...