4ZAKC

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d1
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakC02
1KN2L 3N1PC 4TVPE 3DX6B 3CNKA 4OIIL 5EO9A 4OQ1A 2BCKA 4P5TD 1YQVH 2NXZD 1J1OL 1LP9E 3IDGA 2OQJB 2R69H 5TE4H 1KB5A 3IS0X 4O00A 4F57H 1FL3A 3VMNA 5KW9H 3SQOL 4Z7NE 1I7UA 5FM5O 3SDCC 1Z5LA 5FOJA 4NQSB 5C2BH 3FTGB 5T1MB 1X6LA 3QEQE 5CIPA 1FYTA 5E1AA 4ZPTA 1L6XA 4HKZB 2ICES 3O2WH 1PEZA 1KJ2B 2AQ1A 1UXSA 1DBBL 5HDQL 1MFEH 1TITA 3MO1A 2CKBH 2ZOKA 5GS2D 2V5SA 2Z31D 1OAUL 5E8NA 1BX2B 5ICYA 2XZAH 2VAAA 2DF3A 1S7VB 1UQSB 4NN7C 3BGFB 1JL8A 4W6XB 3O45A 3OWEA 2NCMA 4KPHH 2DQUL 5IFHH 5JPNB 3INUL 5GIRA 3REWB 2OBGA 4LVHB 4LIQL 4R2GB 4N0UA 4YHIA 3WN5C 1OSZB 1MAKA 4XP4L 1DSFH 5DMJB 1R0AL 3T0EE 2C7UA 3O11A 5EBLA 1BBDH 2EDJA 4PJ5E 1AP2B 2AJXL 3BGMB 1FLRL 4YHKL 4DUVA 2K7PA 1J9CT 1G7QB 5T5NF 2GYSA 2OZ4A 3TV3L 4G9FB 1QBMH 3KPSE 5INCA 1WFTA 5DDHB 1LWRA 5DRXA 4FTVD 4R0LC 1XR8B 3MNZB 2Z92A 4MDIB 4QNPF 3TZVC 4J6RH 4JGMA 4RFOL 4WFHD 2AQ3A 4WHTB 3RA7H 1UEYA 2CGRL 3BUTA 2D7NA 4PJ7B 4R96B 4Y19B 4HUXB 5CEZL 3PV6B 2ADGA 3UYRH 4HCRA 4KRMB 1JWSB 5BV7C 3IKCA 1MEXL 4P23D 3BDBA 4XCNA 3GIZL 5EULV 5TDNB 2XG5A 1I8IA 3IAPA 1K8DA 4U6VL 4PY7B 1IEAB 5A3IC 3VDCA 2J88H 1A9EA 1AHWC 2JJSC 3TN0D 3L9RB 3BZ4A 1LK2A 1W0VA 3ES6A 5IGXH 1JK8A 5T3XH 3VGHA 4NOFA 3OHXB 3QWRA 5E8PB 2WAHA 1GHFL 4LCIL 5B8CA 2BHUA 1NCDH 3STLB 5JO5B 1VEOA 4GQ9H 4JY6A 3MRLB 5GRWA 5EC2A 4X83A 4OCXH 4OM1H 1EO8L 2OL3H 3HKFA 4Q9RH 2BSSA 4DAGH 4NZRH 5I8EA 1IT9H 4KDWA 5I75C 3QIWC 1NFDE 4WIQA 3SPVB 4M62H 5HHMB 2DKMA 3AREA 1BQHG 1FFPA 1VSCA 1MJJB 4GKZB 4KU1A 1NLBH 4W81A 4PJBF 1HHIA 4YR6B 4OLWL 3VRJA 4LRNL 3QHTC 5FYJH 4EBQH 2WBJC 2FHCA 4C58B 3MRFB 3QJFA 4HIJB 5DO2D 1J8HA 2GAZA 4KI1A 3ZTNH 2NTFA 5E9DA 5T1KA 1NC2D 4L4TD 2WV3A 3F7PC 3FO2B 1LO3L 2EDKA 4EXKA 2AK4E 4YFLF 3QWOB 4Z7UB 1RMFL 3QXVA 4PJAF 4X6DB 4Y8DC 4ZG1A 1CQKA 4LPVA 4PLKC 4XBEH 1LO5B 2YPVH 4CDGC 4DTGL 3SJVE 1FNGB 2H45A 1CE1H 1NEZA 35C8H 3EFDH 4MB5A 5BVJB 1NMAH 1KBGL 1CDJA 1DBMH 1GZQA 5I71B 3MYJA 4K3DL 4X7TA 1QR1A 4KDTC 4KTYA 4RWYL 3DXAD 4XPAH 3GSQB 1HHGA 5ALBL 1DCLA 2EDRA 1NGQH 2KQMA 1XF5B 2D0FA 4XPBL 3O2VH 5H8DA 4F15C 4PREA 3OKEA 1QA9A 2VE6A 5MENA 4LK4A 1QKZL 1T22A 3GSWB 3VFNA 2RQ8A 3EZJB 1BIIB 1Q9WA 4WFGE 4U7SA 3IU4L 2BNUB 4U6XB 5ID0A 3MOBL 1A5FL 5K9QI 4TULH 5L2KE 4XPFH 4F7EB 3H42L 4MA1B 3T2NH 4PY8I 5IMOB 1D9KB 4NKDA 4E41D 3T3ME 2ZG1A 1F58H 3IDXH 4KI5D 4L3ED 5LXGL 4KHXL 1YY9D 1NGPH 3QQ3B 1HXYB 4KZDL 5HI3D 4PV9A 2PTVA 1FGVL 4HK0A 3AXLA 1Z9SA 3D85A 4KXZH 4Q0XL 1F90H 3UP1A 1XCTB 1SY6L 4GH7B 1SYVA 3QPQC 3SDYL 1QPPA 4Y4KA 3V9FA 5DFWH 3QT2A 1ZHBB 2VXQH 1MFBH 1DQMH 3N1FC 5CLWA 1F13A 5B38G 3AB0C 3U7WH 4KQ4L 3FOLB 1OTSC 1E4WH 4FXKB 2GCYB 1LDSA 4K23L 1ZVSB 3VRLF 1TVHB 5F89B 5I0DA 3JTSA 5CINL 4ZD3H 2D31A 5I30H 4X6CB 3RDTC 5DQJA 3ZYOA 3CSYB 4I9WE 2H26A 2CUMA 1C7SA 3VWJB 3EYFB 3Q5TA 5LAXA 4C56A 4LSSH 3QFJB 3UC0H 1ZEAH 5I76B 5EOTA 4DVBA 3WJLA 1DUZB 5HYSA 2BVYA 3GSRB 2GSGA 1ZT4A 3SKJH 1FH5H 3GM0A 3MLPA 3T77A 2V9TA 2YS4A 4RMSA 5DGQA 1LO0H 2IPKB 4DKFL 4UDUA 3DX8A 2W0LA 4P3CL 5TQ0H 3SKNB 4YE4L 3NH7L 5CD3A 4B41A 1FVDA 1IKFH 3B2UC 3MV7B 2R1XA 3K4DA 4MXQD 4XVUD 3WNMA 3WSQH 1F8TL 4GS7C 1B4JL 5IWLC 5JR1L 4K3JH 3HNTH 4PJXF 3GEWB 1JZ7A 2BHYA 4LSRH 2EE3A 3AVEA 3QB7C 2ESVD 4LNRA 5IR1A 1RUMH 2XZQL 1WC7A 2ZCKH 2NY3C 4GAJH 4Q2ZB 1JGUH 4DFIA 3TBWB 1K8IA 3PWPD 4GW5A 5HY9B 1NANI 1XIWC 5TQ2H 1U92B 4IMKA 5DTFA 3KLAA 4JG1H 4NFDA 2VMFA 4NDMB 4M61A 2QL1A 5C0BE 5FA4A 4I0PB 4O4YH 2GT9B 3TT3H 2GKIA 1RZ8B 3E6FA 4KJPD 4LSVL 4JDVB 4ZFGH 1KGCD 3RWJA 3U9PL 3BH9A 1BAFH 2C4XA 5FDYA 3RWGB 3QDJD 5EU3A 4P5TC 5MI0C 1B0RB 4ONOA 3U4EB 1HHKB 1MWAB 2Z0BA 3LAFA 4E5XB 1LGVA 2VH5L 1UWGL 4JFHE 4HLJA 4DGVH 5IMLB 2A6KB 2CD0A 2R0LL 4WW1A 2JB6B 1K6QH 4OIBA 3MRBA 4PRIA 2FIKB 1PLGL 5I8OH 4NQVB 3DMMB 4OD2B 1IBGH 4H26A 4V2BA 3U79A 5EU6D 1R24A 5H37G 2NTSP 2Z31C 5HYQB 4OZIA 4FQPA 1WCBA 2APWA 3KPLB 1X6NA 3TPKA 4C4KT 1NGXA 4JVWA 2CJUL 3HNSH 4X5LA 1G6RL 2P5EE 5LGJB 4JFZL 2A83B 1T1ZB 3G5ZA 2MWCA 1I1AD 2IC2A 4ZNEA 2GJZB 2WLZA 1DVFD 1H5BA 2ZSWB 4NQCD 1KFAH 1CFBA 5ICXA 1I3GL 3IF1A 4X4ME 1N8ZB 5I8CA 1AH1A 3N06B 3PWNA 1RIVH 1RZKL 5SX5H 5CS7A 3RIFF 3UX9B 3K74B 5CEYB 1UJTA 5CJQL 1CG9B 3TIEA 5JQ6L 1G9NH 3LS5L 2RR3A 4XCFL 4OZHE 5IJVB 4JAMA 2P5WE 1F42A 2X9XA 1C5DB 2PO6B 2DQGL 1J05A 1ZOXA 4P23C 2OP4H 3QIUC 5DZOA 5EOCL 5E6IA 5CAYB 2VDMH 2X4PB 5ACLA 4UUJA 3O2DH 2EC9T 1HDMA 3GKWL 3TN0C 1B3JA 2DYPB 3HC0A 5FCUH 2A74A 3WLBA 2WK2A 3VFTB 2MHAA 3M8OH 3DGGB 1DBJH 4Y1AE 2COQA 3BDYH 4FQXD 2LVEA 1U8JA 4C83B 5CEXB 3FN3A 1QO3A 3WL9B 1KIRA 2EE2A 4LMQE 1UWEL 1A6TB 4PJIB 1T1YB 3OR7B 1MI5E 2XXMB 2DBLL 1NDGA 4JR9L 3CUPB 5DQ9B 1HSAB 1P4BL 2B20A 3BSZL 3HI5L 4QT5B 5A40E 3NZ8A 5HGBA 4PRDB 4N90E 5HVHC 4OD1H 3OAYK 1T2QH 2RFXA 5F9OH 3EO0B 1FFNA 5C07A 3ARDB 4YUEL 1DN2A 4MA8H 3T09A 4XBPB 5C8JA 5I1GL 3IDNB 4JFPA 3WFZA 5AG8A 4JRXB 1A8JH 1LK3L 4ODWB 1XGQA 4PJEE 4QHLB 2E7MA 4XWOD 5F70A 1YJDH 1LE5A 3MUGB 3WMSA 1NAKH 3MRJB 4N0CC 5DWUH 3DTXA 4PRAA 3HE6B 1NJ9B 1P4LB 1XF2A 4QXTB 5IJKC 4JE4B 3BEWB 3T0ED 1RD6A 5DLML 5GISH 3X13A 2CQVA 1JF6A 4JHWL 5ESVB 1TJIL 4OF7A 4JO2L 4NSKA 5LJYH 1CD0A 3UJIH 1VKXA 1NC4D 3OKDA 4D0CB 3VD7A 1AD9A 3KPSD 4KJWD 5IVXB 5DJYB 3SO3C 3DRTA 3MJ8B 1CFTB 3GB7B 2OJEB 2E7CA 4AQ1B 3V5KA 1IC4L 2LTQB 2VDRH 2N1KA 5L2JB 3O6MH 5JORB 3ARBA 1A14L 3TGXA 3IRZA 1AGDB 5A2KH 2X70A 4I48A 2VLRD 5I18L 2Y7QA 3MRCB 1RULH 3SGDH 5FYKH 4UT7H 3O9WC 4LLMA 4WHDA 1FFOA 3FQTB 3FQWA 4KC3B 1WTLA 1FSKC 3TYFB 4B7LA 5F9JB 4S1RL 1YY9C 4JM4L 2Q8BL 1QLFA 2CDFA 1H3WM 3MJGX 3AS3A 5HI3C 4PGBB 4ODHH 5HDLA 3VGGA 2HN7B 1R3IL 1NAML 5EBWB 1QSEA 3SE4C 3ZE0E 1WEJH 3D25A 5I74C 1KCUH 5T5NG 2FHFA 1ED3A 1I9JL 1IEBA 1F11A 5JPMA 3OZ9H 4D9RD 1AI1H 4ELMB 5J6GB 3SBWA 3MLTA 1K4DB 1D5ZA 1X5KA 5JHDA 4QOKA 4EN3C 2KH2B 1K4CA 1LEKA 5K9OB 2GIYA 5J6HB 3MRRA 3GSXB 1SJHA 2E8ZA 1B2WH 4MA3A 1B88A 3U0TB 4JFOA 4OKVB 1OCWH 2O61B 2CPCA 4JFEE 4BH7A 3EBAA 3PP3H 2X4OB 1MCFA 2CLVA 4MNGB 1YN7A 4Z95L 3P9WB 3MV9B 3NABL 4OF5A 4G6ML 2ID5A 4KK8D 3QG6A 2AK4D 5HHNB 1EEYA 3O4OC 1F45A 2L4OA 2ADIA 3V8OA 4YPGB 2Q76A 4RNRB 2PCPA 4OLUH 4ZO7A 3RVWC 3CU7A 1TDQA 1FRGL 1V8HA 3IFLL 5LGKA 3MRGA 1D6EA 3SJVD 1P69B 4NJ9L 1LO4H 4XAKE 5DD3L 3UTSA 1ZLUK 1OPGH 3BKML 2AJ3A 3K81A 2GTWA 5HHQA 5ISZB 3QIBB 1HEZA 4BFIB 3BVNB 5L8KB 3BZFB 5ECJE 5E94B 3KPRA 5MP6H 2FSEA 3WIHA 4TVPL 3D9AH 5EN2B 1A6AA 3GRWA 1P5VA 3TC9A 3G6JE 4UILL 3HG1A 2KKQA 4QTHA 4WO4A 3D18A 4HC1H 5DI8B 1R6VA 3WKML 4WFGD 1BIHA 4P9HC 1X5IA 3SOBH 4FQJL 1MOEA 4UNTA 3SDDB 2HT3D 3C9NB 1X5JA 3NA9L 3RAJL 4MNQE 4WW2B 3G04A 3RWEA 1DQQA 5JDJA 3RL2A 5CGMA 3IJSA 4QHKI 4U6YA 5H35A 4U1GC 1P53A 4KJPC 4TPRL 2D7TH 2GUOB 5E5MA 2ZCHH 1RZJH 4MZ2A 3MLYH 4WU7B 1BF8A 3RY6A 1TENA 1YEIL 5EUOE 4KZEH 4QWWD 2NY7L 4WWKD 3OGCA 4DVRH 5C0CB 4NUJB 1DQTA 1PEWA 1EX0A 5LGHL 3K2MC 4RWHA 3TJHD 1PY9A 2MOVA 3MOAL 4OFIA 3C60C 3F12B 4GXUM 5F21B 2ZUQC 5JHLL 4APQB 1Z3GL 3QISA 4U1MA 2DLTA 3O3EB 4EUPG 1CK0H 4NJAL 3OAUH 1QVOB 4ZAKA 4MCYA 1S7TA 1T7ZA 2QADC 3LDBC 1FVEB 4M7LT 4ODTL 5GGSY 3G08A 4I9WD 4JKKA 2PYED 5MEPB 1BQLH 2B8OT 2UUDH 4EI5A 3GI8L 4MHHI 4NFBA 3TO4D 1F6AA 2R8SL 4D0DA 2B39A 4DK6A 3DURB 2V2TB 5MERA 4FOMA 2XN9E 2Y25A 3MV8B 3SCMD 4UTBH 4PTUA 3FT3B 4PYHA 2PTUA 2VQ1A 3DLQR 2BVOB 1T6WA 4UT9L 1REIA 1S5HB 4QRPB 4RISL 2FGZA 1J1XL 1TIUA 4M5YH 4Z8FL 2E9IA 3ARUA 2AJUH 3BRFA 2VLKB 4YHNA 2Y23A 4HJJL 3DX6A 4WI8A 1A7QL 3B3IB 4P59L 1A7RL 2OQJA 4RRPA 2GJJA 2A1WH 1VPOH 3X12B 4QRRD 1CICC 1NLDL 3N85L 5HVGB 4S0TD 5ESQB 5CZVL 3K8KA 4JVUA 5L88H 4NQSA 3FTGA 5GSRB 4XPTH 4XMPH 1NL0H 5CILH 5IHLB 1F4YH 1YYLL 2J8UF 1KJ2A 5I2IA 5EIQA 2E7LC 2GTZB 3FAXA 3ZL4L 2GSIB 4ONHB 3UBXB 1UEMA 5EOQH 1QFUH 1UM6H 4FZ8L 4NO0B 1ZLSH 3JV5A 1BVZA 3P0VL 2OM5A 2FWOB 1S7VA 4KGJA 1UQSA 5DMGD 1RUKL 5C0BD 3WNLA 1XH3A 5JPNA 5E4EB 4XHJD 12E8L 1YEGL 3REWA 2AGJL 1QLRB 1PG7H 2MKWA 1U8LB 2Z9TA 3V4VH 2MQ0A 4FQXC 3ULUL 1PQZA 1CD9B 1CDCA 1AP2A 3BGMA 5DUPH 3VXRA 5DT1H 3QPXH 3L6FA 1EPFA 5GGTA 3BYYA 4HS6B 1G7QA 3MRNB 1FL6B 1NUGA 3EOYG 2RAMA 1HH9B 4G9FA 3MLVH 4L9LC 3EDJA 1XR8A 3MNZA 4MDIA 1ZAGA 4WHTA 4LHQB 4HWBL 2Z93B 1OAZH 2YUVA 4JFHD 1XGYH 3F7YB 4M7ZB 3C8HA 4U0QB 4Q9QL 2P8LB 4NM8H 4R96A 2FBOJ 4HUXA 3PV6A 5GGUB 2OX5A 1JWSA 5L7XL 3NA4A 4PRHD 4DKEL 2C4FT 3DVFA 4G6AD 5EU4A 1P6FA 3O8XA 4PY7A 5C0JB 1IEAA 1ADQL 2LU3A 3JV4B 2JB5H 1L9MA 2HWZL 3L9RA 1U6AL 1Q94A 2AV1B 2J7LA 4P2QB 3OHXA 4MVBD 5E8PA 1KG0B 5A16B 2W1NA 5J9PA 1RU9L 5TE6H 1CFVH 2YOCA 3STLA 5JO5A 1GXEA 3TO2B 4R26L 2BOCB 3MRLA 3KJ6H 4H0IA 3VXNB 1FC1A 5E2TH 2MNUA 1G6RB 5L0QC 4MS8D 2MTPA 1FYTE 1YMMB 2DMCA 4OCWH 2EDDA 1D5BB 2NYYD 3SPVA 4KJWC 1AR1C 1MJJA 4GKZA 3C6SA 3V8CA 4HXBH 5KVFL 1UKTA 3N1GC 1CQYA 1DE4B 4YR6A 2N7AA 1CGSL 2P5WD 3MRFA 5JW5B 1AXSB 4N0UE 1ZHNB 1JV5B 3U9UB 5IHUL 5AWNH 2WUBL 3G6DL 2RHEA 3MRIB 3FO2A 4NQEA 3BDXA 4XNYL 25C8L 3QWOA 4Z7UA 1HYRC 2P4AB 4X6DA 2NY2B 1E0OB 3HZMB 4DOHE 5EA0H 4RGMB 1N0XL 2HRPL 1LO5A 3QZWG 1KF9B 4R3SB 5BVJA 4LPYA 1OQXA 4Z7QE 5I1KL 3U36A 1NCUA 1BFVH 4DUWA 2J5LB 1ZTXH 1CDHA 3GSQA 1MI5D 2F54D 4O5LH 32C2B 1EVTC 2FX8H 4NUGL 1XF5A 2I25N 5CFHA 1ZT1B 2R23A 4FFZL 4N90D 1PKOA 1J8KA 3IT8D 1KCVH 5GGVY 4ODUB 4X5WB 4TOYH 3DSNA 3GSWA 1P4IH 3FO0L 1BIIA 5F7WC 4ZPVB 1DANU 2BNUA 4U6XA 1UM5L 4HT1L 3L7FB 4XRCB 4F7EA 1YNLH 2VDOH 2QKIB 43CAA 5ADOH 2QJDA 4O9HH 5IMOA 1D9KA 4MA7L 2OR9L 3BUYB 1DDHB 4TSCL 4Y4HB 1FNFA 3VG9C 4KTEH 1HXYA 1QRND 4KK8C 2VLLB 5IUSA 1KYOK 1QR4A 2XFXB 5FYKD 3MBED 2IGFL 3KXFE 1FBIH 4MSWB 4K8RL 5HYJD 4HCRH 2UZIL 3A67L 3LH2L 1NCBH 1ZHBA 2VOTA 5F9WB 4HGKC 4PB0L 3VI3F 4JG0L 4NHCL 4N0RA 5AZ2L 4J1UA 4HDIA 4FXKA 1FNEA 4S1SH 3UYPA 2GCYA 4XMKL 5M94B 3VA2C 1JGLL 3KPTA 4YHPB 5F89A 3X3FH 1QOKA 5E9DE 3EYUH 4MD5B 4ZSOE 3O3DB 3GSOB 4X6CA 2HVKB 4LLAA 3CSYA 3S34H 4JLRB 4KUZL 3EGSB 3GJFK 3VWJA 4NO3B 3EYFA 2V5RA 3LS4H 3BI9X 3MJ7B 2B0SL 3RVTD 1KNOA 1HHJB 2HT3C 1QACA 3QFJA 4UOW1 3KPMB 3RPKA 1PSKL 2W9EH 4DW2H 5I76A 3VGBA 3BX7C 1VFAB 2VC2L 3ZHDA 3WXWH 1DUZA 2HJFA 4X80L 3GSRA 4M3KB 3ARFD 5F97E 5I1HH 3OKNB 2C3GA 3JWDL 1G0XA 1YEEH 3LEYH 2CKNA 2IPKA 2YUWA 1MCWM 4OFYA 3BAEH 3SKNA 5MENE 2YMXL 4DZBB 3E2HC 3NPZB 4CU8A 2PXYD 3GBML 1NAMB 2WQRA 4N1HB 1FFRA 3MUZ1 3VD9A 1SJXA 4ZTPL 4P2RB 1NCCL 1SEBA 2NY5H 5D7SL 5F6IB 3SE9L 4KTDL 5BMFL 1UACL 1CLOH 2OTUB 4YGVB 5EU7E 1IQDB 3U48A 5FM4A 4LPWA 2PW1B 3I9GL 5J1AB 5T3ZE 4J4PC 4Q2ZA 3QUXB 1FQ9C 3NTCL 3CFCL 3CFKB 3MLSL 5HY9A 4JFED 3TO4C 4YHLL 4POYA 3SDAB 5IBLD 3TT1H 1A6VH 4NDMA 4PLJC 4G8FB 3SCMC 3OJDB 1GC1L 5HYFA 5I1CL 4IDJH 2ZG3A 1RFDH 2GT9A 4K9EL 5DSCB 1RZ8A 1MCOH 3OGOE 3RIAK 4JDVA 4JFQB 3NCYP 3QDHA 3LB6D 1FJ1B 3O6LL 2DWEB 1YC7A 5FK9B 2BY1A 2WLYA 2Y36H 3QHFL 2OMBA 3RWGA 3HZVB 4XAKD 4AG4L 9CGTA 2AEIT 1INEL 4AY0A 1T20B 2EE9A 3GJFB 4MJID 5IQ7L 4ERSH 2BFVL 2Q7YA 4P4KD 1B0RA 3C6LD 2F58L 2VN7A 3U4EA 3BZEB 1EO7A 1HHKA 1MWAA 3QDMA 4P57B 3T2QA 4E5XA 1ZGLM 4TRPL 4HZAA 5IMLA 2A6KA 2JB6A 1AQKL 3B2VH 3UPRA 4A6YL 2FIKA 3DMMA 4FG6C 3DI2B 2DBJA 2ZNWA 4YX2L 4X0KB 4WENB 5KTEL 3HR6A 1LP9B 2AERT 4V1DB 5HYQA 4Y2DB 1MCIA 1KPRA 4LCCC 4MNQD 3BKYH 3KPLA 2NXYC 4FXLA 1RK0A 2JJVA 4XHJC 2E7HA 3QG7H 2J6EH 1MFAH 2A83A 1VA9A 1T1ZA 3GIVB 4ZS6D 3TYGH 2CR6A 5IIEB 2YD3A 4HULB 1C1EH 1V5JA 3LKSB 2P44B 4LRIA 1TZHB 2ZSWA 5DJAB 4MMXC 4HIXL 4O58L 2KQNA 5I1EH 3OJMB 1N8ZA 4N9GB 2FD6L 3I2CH 5EO0B 1I9IH 4MNHB 3M45A 4CADB 1QEWB 5J11C 4H0GA 3GJEB 4K3EH 1KPUB 3IETB 5CEYA 1CLYH 1CD1B 5L9DL 4YDIL 1RJZB 2G60L 4KKCC 5C0AE 1MCWW 4YBQD 4XP9L 1RUPH 4YGAB 1IGJB 4XNXH 1H3GA 3HFML 5IJVA 1A6UL 1C16B 1C5DA 1UWXK 2PO6A 4PJ5B 4YFDB 3ZZ1A 1JMXA 4GMSL 2W60B 3HMWH 2LABA 4G6AC 3UO1L 3DYOA 4P9ML 1BQHB 4NFCA 1QBLH 1QBBA 2X4PA 4UU9B 2O26U 2DYPA 2JCCF 2XN9D 4MQSB 3QRGH 1TQBC 3DGGA 2I24N 4F7MB 2P8PB 3MLXL 1JGEB 1JI1A 4AEFA 1KPVB 2X40A 3GMLB 4YFEA 5CEXA 1VEMA 4LVOB 3U30C 3RZCB 3WL9A 3SN6N 3T0XA 1LEGB 3QUMH 5LWYH 4MAYC 1A6TA 4NQDD 4PJIA 1T1YA 3OR7A 2CIIB 1K2DB 3V6OA 3EIFA 4TUKH 4UAOB 1G7PA 1NGZB 4PRIE 4MS8C 5DQ9A 1HSAA 2HT4C 1KC5H 4QT5A 4GSDH 1BD2A 5JA9A 4KGLA 4PRDA 2ZPKL 1MH5A 5T33H 1KENH 5EZIL 3F65A 3CK0H 4OZIE 2ZZUT 3VJ6B 2HFEB 1AC6A 2IALA 2NY1C 3ARDA 2XNAB 4XBPA 2AXFA 3IDNA 3IGAB 4LCWB 4O02L 3WV0A 4JRXA 1IFHL 3KR3L 4PJDE 3S88L 3K2UH 2JKXA 4U3CA 4ODWA 5IESL 4QHLA 1OGTB 3MUGA 2AS5M 2CO7B 4DJMA 1WFOA 1F5WA 3MRJA 2V9QA 2EH8L 4WFEE 3HE6A 1NJ9A 3RI5K 4QXTA 3AFLA 4OJFH 3BEWA 3RVXC 3BMVA 3WFBH 3V0VB 1YJDC 5C71A 2EE6A 1OW0A 5ESVA 2IAND 3VXTB 2JIXB 2O5ZL 3Q6FB 4GRWH 3DSFL 2ZCLH 2VZUA 3G6JF 4WTXA 5IVXA 5DJYA 4IIQC 2YD8A 3OKOB 3GB7A 3VE0B 2OJEA 3WO4C 5L2JA 5JORA 2CRZA 5B38B 3JV6B 4HPYL 4P2YA 2DQJL 4PLNC 5TH2B 1JZ5A 1HH6B 5DVKA 3FQTA 4PUBH 1CCZA 3D39B 5KSUB 2YK1L 3DX7B 3C8DA 3PXJA 3TYFA 5F9JA 2DM4A 4JRWA 4JHAL 4ZFFA 2AJZB 3VMOA 4PGBA 1D5IL 4R97B 4NYLB 2FBJL 3MBEC 4BM7A 5JTWA 5EUOF 4PJFE 5HHOB 2AEPL 5F9AC 4GMTH 2XRAL 2P48B 2PETA 3G5VB 3W9EB 1FGNL 2ZJSH 2EDLA 3I50H 4NO2A 5C07E 4WRLA 1U8PB 1VFBB 5J6GA 1K4DA 1FYTD 2VSDA 2B2XL 2VXUL 5KSAC 4P46C 4PYGA 5K9OA 1BEYL 5J6HA 3LRGA 3GSXA 1X4ZA 2R0ZH 1PGRB 3MLWH 3RJQB 5JZ7C 4LSQL 3TVMB 1TNMA 1U3HB 2CLRA 2VWEE 4HPOH 3U0TA 5SWZB 1VADB 2O61A 2AK1H 4K3HA 3MMEA 2HH0L 2N56A 1BJ1H 3L5WB 3PV7A 5D1ZB 2XQBL 1TPXC 4OLXH 2X4OA 1QLEH 1PYWB 1QSFB 4J3WA 4MNGA 3H3BC 4KXZI 3MV9A 3D3VB 4HEME 3OKMB 1GIGH 5DVOA 5HHNA 5E03A 2DTML 3ARFC 2J8HA 4P48A 4XI5C 5J7CC 2A9ML 4GUPB 3CDGA 4YPGA 4C59B 1DBAL 4RNRA 3ZHKA 2G9HB 2DICA 4LFHG 2CDEB 3B9DA 5ANME 1GRWA 3U6RB 3QCUL 3QIBA 4BFIA 3BVNA 5LKNA 3GUTB 4U6HB 1RZIA 1EH9A 2J8OA 1F2QA 5E94A 4YDKH 3B6SA 5I19L 1EA9C 1KIPB 4WTZA 5MEOA 1TLKA 5I1IL 1IILE 5EN2A 1YY8B 4CMHC 3SDCB 3OJVC 5E99L 3V6BR 5DI8A 5BO1H 1JFQH 3U7YL 2F74B 1T21A 1AY1H 4G5ZL 4XVTL 4B53A 1NCWL 3QWRD 3MA9H 3SDDA 4U1NB 3C9NA 5IBLC 4WW2A 3HZYB 3N0PB 3U0WL 1QSEE 2FCBA 1CXHA 1K3ZA 2R4RH 4HG4K 2QLVB 3HN3A 3WD5H 3E8UL 4MGXA 4F58L 3EYOB 3LB6C 5MHSE 4UI2A 2GUOA 5KVDL 3NFSH 1U41A 3LQZA 5FGRA 4WU7A 2BDNL 2Y06H 2R15A 4KHTL 4P2OC 1I85C 5TF0A 5JHDE 3U7AA 4QOKE 4B0MM 5KS9A 2Q7NA 4QTIL 3DETD 4WGWB 3ARED 4L8BB 4NUJA 3ARYA 3D69B 4G8GB 2D7OA 4RX4A 1MRFL 3C6LC 4MX7B 1RZJC 3F12A 5F7FA 1N5YL 5IV2B 1ZV5A 1S7XB 1A7NH 1KCSL 1A7PH 1UA6H 4LAQL 1J8HD 4R0LB 1EJOH 3TZVB 5E9DD 4WY7L 5T1KD 1P9MA 1QVOA 5IFAH 1FVEA 4DWHA 3RUGF 4X4XA 4JN2A 4AIXA 3MRQA 5MEPA 4OZFH 4RFEB 3ZDYF 2FLBT 5ERWA 4WUUB 1JWMB 2YWYA 1Q1JH 1VGEL 5C9KA 3DURA 2V2TA 4I0CC 5KG9B 3MV8A 2EXWD 3VA6A 3FT3A 5JOPE 3MNVB 4AENB 3MLUL 5HHVL 3FB5B 4PJHB 2BVOA 1S5HA 4QRPA 1A6PA 3UTOA 1TETH 4I77H 5K9JH 5IW1B 1U36A 3KPRE 3LIZL 4GG6A 4JFYB 3UJJH 4PBXA 1BZQK 1UZ6E 3WFDH 2OI9C 3B3IA 4LL9A 4M6NL 5MEND 3HG1E 2H8PB 1ZGLB 4HKBB 5ENWA 3EYSL 3W0WA 5DRZB 4HFWB 4HUVB 4X9GA 5ESQA 1EV2E 4P3WA 4NRYB 5I75B 3QIWB 5FGCE 3ISWA 4NP4H 3NIDF 4ODVH 5GSRA 3C08L 1JNLH 1EXUB 4R7NB 3BZDA 4F9LA 4ZYKB 3QAZC 3VXOB 2GFBB 1JNHB 2GTZA 3MCG1 2GSIA 3UBXA 2NW3B 4F7TB 3D85D 5GGVH 2I9TA 4Z7VE 2WBJB 4TYUA 2AJSL 1H0DB 3WIHH 1JPGB 1MY7A 4NO0A 4BUGA 1ND0B 3P40A 4Y4KD 5KOVC 1OAQH 3SDXF 2FWOA 5FGBC 4YQXH 4PIRF 5INDA 3VG0H 1I3RB 5CKGA 1HZHL 1QLRA 4I1NB 1T7WA 3JZ7A 3ROOB 5FHAL 1T1WB 5I73C 3E0GA 1IGFL 3HAEB 1G6VK 1L7TH 3OSKA 5IHBA 5I1JH 5E2UH 3UCRA 1T89A 2PN5A 4Z18A 4UV7H 1DR9A 2OK0H 5ETUA 2O5XL 3FHAA 2VLME 4WHYH 2OZ4L 1FL6A 3ARRA 3MRNA 4D94A 2P7TB 3BGAA 1SVCP 4JANB 4LSTH 1HH9A 4AIOA 5BW7C 1OTTD 4WCYL 4EKXA 4N9OB 4OCNC 1FPTL 1NBYB 4OFPA 3OKKB 15C8H 2Z93A 3GMRB 3VXUB 3F7YA 3QUYC 4C56D 4F15B 3J8F7 2P8LA 4O2FB 2A6JB 2FB4L 4OZGF 3KHQA 3KYOB 5GGUA 3RNKB 4YZFE 2ADFL 5CP3A 3FQUA 4KVNH 5BS0B 5DJZB 1ZLVK 3V6ZA 3P9LB 5C0JA 1JYVA 2JE8A 3JV4A 4JZOB 1CXEA 1OP3H 2M1KA 3BIKB 3GO1L 4AT6A 4ZMAT 2AV1A 3AC0A 3CVIH 2NY0D 5J4MA 3U1SL 3FRUB 1S7WA 4P2QA 2JK5B 4JQVA 1KG0A 1IAMA 4X9IA 1DBKL 3AM8A 1HKLL 4JPWL 4I2XB 2W38A 3TO2A 3GI9L 4F7CB 4EQ2A 4PS4L 3AUVA 3VXNA 2WUCH 3S5LG 4M6OH 1IGIL 2B1AH 1G6RA 1G7MB 1Y6NR 1EVUA 2OXGA 1BZ9B 1YMMA 3AB0B 3UXFA 1D5MA 4JPKH 2UWEE 1D5BA 1DQDH 2HG5B 2IPTH 2BX5A 1J18A 4H0HB 3MOQA 2R0KH 2EYRB 2DM3A 2ZKHL 3R8QA 3OBAA 2P24A 3FONB 4X98B 1DE4A 4UV4H 5CSZA 3RDTB 4IRSC 5JW5A 1AXSA 1S7SB 1ZHNA 3U9UA 3P0YL 1IJ9A 1KLUB 2ADJB 3MRIA 5TE7L 3RNQB 3BISA 4CL7A 1CLZH 3OXRB 4UBDD 3HZMA 4L4VB 1IL1B 3PGDB 5GJTH 4YWGL 1CYGA 3QEHB 1MCHA 1RUAH 2HT2C 4NZTL 1BPVA 1QRKA 2Y5TB 4PG2C 4XX1E 5E7BA 5C7XL 4N5UA 1OLZA 4PJ7E 4Y19E 32C2A 3QNYB 2Z8WC 4L1DA 4PRID 2I5YL 5T1DL 1ZLWH 1H3VA 2R69L 1ZT1A 1NFIB 3C2AL 4X99B 5J1TC 3PDDA 3SGDI 4ODUA 4OF3A 4GS7B 4X5WA 4NN5C 5D7LB 1MIML 1AE6H 4ZPVA 5C2BL 4LCUB 4XRCA 2QKIA 4NKIH 4YIQA 1U0QA 1WJ3A 2NY3B 2QHRH 2YPLB 5ESAB 4Z7OF 1DDHA 2YD5A 1JPSL 4Y4HA 1JN6B 1XIWB 2ENSA 5E2VH 4G42B 1MCKA 5T3ZL 3UDWA 4BSWA 1MCDA 2LQRA 2PW2B 2XZAL 2XFXA 3L5HA 4UB0L 3ET9F 4XP6H 4QRQB 2VDQL 4MSWA 4KPHL 3QUKA 1N6QH 1CDIA 3CLEH 2F19H 4PJAB 1S5IL 4ZUSB 1BBDL 5HVFB 1YEDB 1VHPA 3BMWA 2P8MB 1FLTX 2GITB 4MXWL 2NY6D 2X4SB 3PIQB 4I3RL 3HB3C 3LY6A 2Z91B 3A0OA 5FO7B 4YHPA 5E6ID 1N26A 1QBML 2WW8A 5F7DB 3O3DA 3V4UH 1MELA 3GSOA 3FN0H 5AAMA 2I07B 2HVKA 2AEQL 3H3KA 1LILA 1DL7H 4Z7UE 3EGSA 4X6DE 4NO3A 2MCPL 3MJ7A 2QBWA 2XV6B 3PDOA 2CK0L 1XT5A 1JPTH 1HHJA 2XTLA 5GGRA 5K93A 3UYRL 4EUPB 1JTTA 3KPMA 5B8CC 3QNZB 1KJMB 5IB2B 2XIDA 3REVB 1VFAA 5IW6B 3DVIA 2J88L 3KGRA 5D1XC 3OKNA 4LASH 4AK1A 3Q1SH 2VTFA 4TUJB 5T3XL 4D9LH 5JIKA 1MAJA 3ZKMD 1ZMYA 1M05A 3AREC 3L5JA 4PB9L 5BVPH 4KMTH 4DZBA 3NCMA 3PQYB 2GJ6B 4TTDC 1NAMA 4OAWA 5C07D 2FGWH 4HMCA 1YQ2A 5IHZB 3BESR 4OCXL 1L0XA 4LAJH 4P2RA 2OL3L 1OB1B 5FAAA 4HUKB 4NZRL 1ZGLP 1I3VA 1NBVH 4GRLB 5KVEH 2FEDD 4W68A 5DK0B 4G7YL 2OTUA 4YGVA 4N5ED 1IQDA 1CVRA 3HPJB 5IROA 4OQTH 5L6YL 5J1AA 2D9CA 1NMBL 3CXHJ 4FRWA 2NY5C 4MD4B 3CFKA 3WYRA 1N6UA 3SDAA 4XP5H 5IVOA 4EBQL 3QIUB 4G8FA 1BP3B 3OJDA 5DSCA 1J1PH 1EBPA 2VITA 4JFQA 1JZ8A 3GMPB 1X5AA 1GAFL 2YN5A 2QTEA 4JEGB 5FK9A 4RGOH 3F7VB 1RIHL 2IG2H 4YHYB 4XBEL 2YPVL 1T20A 1ZSDB 3B9VA 3GJFA 5HDBE 5C0FB 4X6CE 2Z8SA 3ARBD 3VXQB 4WI9A 1QFOA 3BZEA 5C6TH 1KACB 4P57A 1JIBA 4ODBD 3DPBA 4I18B 4OUOA 4OZIF 2V6HA 4GRWF 5D72H 2WIIB 1YPZF 2RCSL 1NGQL 3DGCR 3DIFB 3QFJE 5HVHB 1YYML 5KSBB 3JWOL 2G2RB 1KCKA 3CFEB 3WIIL 4HEPG 3V52L 3MRMA 3BHBB 5F7YC 4KY1L 1FAIL 3L1OL 3ZKXC 3ULVE 3W2DH 1LP9A 3NCJL 4V1DA 4Y2DA 1RV6X 4KQ3H 1RZ7H 1LEIB 4Y4KC 4TSBH 1DLFH 1IARB 1QSED 3VFVA 3HMXH 1FZMB 3KJ4C 2NLJB 5GSVB 4H20H 3IDIA 3MV7E 5MHSD 5FUZH 3RIFK 3GIVA 1X4YA 2JELL 5IIEA 3QEQA 1F90L 5JHDD 4QOKD 3LKSA 1TZHA 5DJAA 4CJ0A 3U4BH 4OUUB 5FYLL 1I1FB 2HTLD 3JSSA 3MGOB 3OMZA 1DQML 4N9GA 1IAIH 2EDYA 3HPLA 3K8LA 4OB5L 4X9BA 4M4PA 3GSVB 2Y72A 3MC0A 5A43C 1QNZH 4MNHA 3DXAB 4CADA 1QEWA 1OTTC 2H1PL 1KCRL 3GJEA 1E4WL 1KPUA 3FO1B 4C4KO 5I8KH 1FCGA 4S1QH 1RJZA 3VI4E 3SO3B 1LVEA 1U8IB 1YNKL 2R2BB 4MQ7B 1S9KC 1N7MH 1IGJA 1XF4B 4GAYB 1C16A 1NCAL 4PJ5A 5B22A 3WJLC 4NWUL 3OAZK 5HGAB 2Q8AH 1OD9A 5D7JC 2W60A 1BQHA 3C5ZC 4KJYB 2ZNXA 1BJ8A 3O9WB 4UU9A 4U1LB 5E2WL 3GSNH 2DQIH 3H3PL 3S6CA 4M9PA 3UTSD 1FSKB 3TESA 4TVSa 5JOPD 3UC0L 2NY0C 4BZ1L 4K94H 2Z35B 3CVHH 3OPZL 2P8PA 2BRQA 1FO0H 1SMOA 3KPRD 1BWMA 1WBZB 3RZCA 5CSGA 2D2OA 1U95B 1QYGH 1LEGA 3P4OB 4JO3H 1IC7L 5I74B 1A3LL 4HMEA 2CIIA 1K2DA 3HG1D 3JWNC 4WO4D 4TNWF 3AY4A 1NGZA 3QEUB 1EAPB 5FM5M 4LHUG 1MREL 1L7IH 4HV8B 1EEZB 4XMLH 1GGCH 1VESA 1IKFL 1P2CB 3QZWB 2A9NH 3QEGL 1XGRB 4P4RB 4EN3B 4IMKC 4PRPB 5IEKB 3RHWF 2HFEA 3V0WH 3LPWA 5AD0B 3VFUB 4NWTH 1EDQA 3SO5A 1RHFA 3QHZL 1WWCA 1CF8H 2DQTH 1SYSB 4BKLB 3IGAA 4LCWA 4V2CB 1OM3H 4C55A 3RX7A 5E8EB 2XKNB 1OGTA 5CUSL 1EHLH 4UIKH 5IT2L 1QFWI 3TT3L 3O4OB 1J87A 2QSCL 1C5BL 1P84J 3DO7B 3LKNB 4ZFGL 1HI6B 4E42B 1WBXB 5CKAA 3BQUC 4F7PB 2WWKT 2JIXA 3Q6FA 2P49B 2HP4A 2VLMD 4ELKB 3BN3B 4ZAKD 3BJLA 3L95B 2V17L 3JXAA 3QO0B 2V5MA 3ALPA 3P0GB 4EI5D 3QWQB 3OKOA 3VE0A 4RIRB 1T5XA 3DNKA 3I3DA 5B38A 1I1CA 3VD4A 5GS0D 4AEHH 5TH2A 4HIEB 4UT6H 1X7QB 2R0WH 2E3VA 4XTRC 3P77B 1ZT7B 3D39A 3PP4L 5KSUA 1U8NB 5D7IF 3PWPB 3ZMRA 5C0IB 4RGNC 4Y8AA 2JTDA 2AJZA 4YEEA 3QCTH 1RAMA 1H5BC 2X4TB 5GGRY 3K4AA 4NYLA 5J12B 4PJIE 3ZT5A 5EU5B 2IQ9H 5HHOA 2N4IA 3UJTH 3BW9A 1ADQA 5DK2B 3W9EA 2AABH 4L8SA 2VABB 2DQCH 4WU5B 5L2KA 1AJ7H 5DFTA 1VFBA 3UPCA 4CGTA 1HYSC 3NACH 2NY6C 2A2QT 1RIVL 2QQLH 4JRXE 3C60B 3A6CH 2CSPA 3BKJL 2Q6WA 5E6IC 3RBGA 1ONQA 2DD8H 2BVPA 1WFNA 2JJTC 3KXFB 4JQIH 1U3HA 1KJ3L 4KV5E 1VADA 4JFXA 1SEQH 3IAGC 1G9NL 5I15L 5D1ZA 2QADB 3L5WA 4DUXA 3LDBB 4R2GD 1PYWA 1QSFA 4YXLH 2OP4L 1KN2H 4U1IB 3D3VA 4U0RC 4OIIH 3OKMA 2AJYH 1XCQA 1JE6A 1J1OH 1AIFA 3P73B 4U05A 4LIQE 4GUPA 4OLZL 2G9HA 1WISA 2H9GA 4G9FD 4JJHA 2CDEA 3SQOH 3ZKMC 5GZOD 5IVXE 4U33A 3U6RA 1JYNA 3GMQA 1UH2A 4I4WB 3GUTA 4U6HA 1DZBA 4CW1B 4Z76B 4LEXH 4NQUA 1KIPA 3GRWL 1YY8A 5HDQH 4H5SA 1CICB 3O8XD 3SDCA 1EO5A 4N5EC 4MJ2A 3ABZA 5CEZE 1NEZG 3QA3A 3LKPB 3INUH 2CXKA 1NBZA 3KPQB 3UTQB 4JKPL 4UDTB 5IB3B 1I1RA 2EYSB 1FG9C 4U1NA 4XP4H 1R0AH 5F88B 3B5HA 1MJUL 2DMKA 2B7DT 2AJXH 1FLRH 1W2KT 3ILPB 4YHKH 4G7VL 3ARGC 4XZUB 4OM0L 3GMOA 2IAMA 4P5KB 4ALAL 4ELME 3TPUB 1E4XH 1I4FB 3TV3H 2FYYB 3PHQB 5F7NC 1FP5A 2CKBB 5HHMD 5D4QA 4RFOH 3VRIB 3D5OF 2FZ3A 2XA8H 1YNTB 3D69A 2FJFB 4G8GA 4Y16B 1RI8A 5DC4B 2EH7L 3ARBC 2P42B 4OCMC 5CEZH 1OLLA 4Q97A 4IOFD 4NCC1 5IV2A 3HE7A 1S7XA 3OQ3B 4N0YL 3ZE1F 1KT2B 4Y5XB 4KK5C 3GIZH 5K9KB 4L9LB 4TUOB 3B43A 4MNGE 2EEAA 3LOWA 2HLAB 1S9VB 4M43L 4NQED 5ACMA 4C54A 3O6ML 1K5NB 1Q72L 4RFEA 4P0DA 3FOMB 4KWUA 4WUUA 1JWMA 2I60L 1GHFH 1RULL 3VW3L 1A0QL 3KVQA 5GS0L 5KG9A 4YXKL 1A4JB 3BP4B 4AENA 3FB5A 4PJHA 5ISZE 4BK4A 3QNXB 1EO8H 1MCEA 5IW1A 1GGUA 3SBWC 4JFYA 1V3MA 2QEJA 1IVLA 1EFXB 4P3DB 1M7DB 4XAWH 4QRUB 4HS8L 3ARQA 2VZOA 5HI4C 2H8PA 1ITCA 1YECL 4XPGL 1F4AA 1WEJL 1ZGLA 4HKBA 3VH8G 2X2YA 3EYQD 4OLWH 5DRZA 1CGYA 4HFWA 3VWKB 4HUVA 4LRNH 5L0QB 5IBUG 4X7DC 2VR5A 3DBXA 4JFDB 4NRYA 3QIWA 5CJ8A 1D9KD 4PV8B 4MXVF 1LD9A 4Y4FC 2P5EA 2W0PA 1UB5A 2YA2A 3EOAB 1EXUA 1LO3H 2VQUA 3BE1L 4WEMB 1U8KB 4ZYKA 5EORL 3H0TA 1KJ2L 2XICA 5H94B 1RMFH 3VXOA 4QGYA 2GFBA 1JNHA 2OL3B 3GBLA 5DJ6B 3D2UA 2IWGA 2NW3A 1OCWL 2WBJA 4DTGH 4GG8A 4X4MA 4IDLA 4F2MB 1ND0A 2Y07L 1KBGH 1U2CA 5C0CE 1I3RA 2DAVA 4RWYH 4CVXB 2FX9L 4LDEB 3ROOA 5ALBH 3MXWL 1U8OA 4QRTB 1T1WA 1DEEB 3ZO0A 1TQCC 3HAEA 3TA3C 3IYLW 4OLUL 3ZDXE 4CVWA 1TZIB 3FCTB 6CGTA 4MJ5A 5GGTL 1QKZH 4F9PC 4Q6IA 1I9RH 4M3JA 4WO4C 3IFOB 3QXDB 2VLJB 2P7TA 3MCLL 4OGXH 4JANA 3IU4H 5DJ0B 3OTTA 4KAQH 4L8CB 3VWJD 1CXIA 3H42H 5D8JH 1FAKT 1GOHA 4AH2B 3GMRA 3VXUA 1CFSB 4Y1AA 5LXGH 5EBMA 3EO1B 4KHXH 4O2FA 2A6JA 3QFJD 3MV8E 3KYOA 3RNKA 4KZDH 3DYPA 4JY5L 4NNPH 2Y6SD 5BS0A 5DJZA 4W4OC 1SY6H 1GYAA 2VLKE 3P9LA 3ULVD 1D6VL 3SDYH 3SOBL 4F80A 3LRSB 2DLFL 4JZOA 4OFYD 3RY6C 5TPWL 3BIKA 1A3RL 4LARL 3K46A 2HLFD 2J8UB 2VDLL 3FRUA 5F7EH 3UZEA 2JK5A 4ZFOL 2OYPA 1WUNT 2DI8A 2P46B 4J3UA 1ZWIB 4K23H 5CCKL 4IOIB 5E00B 4I2XA 3N1MC 2ZCHL 4F7CA 2HA1A 4M93C 4KZEL 3W39B 1G7MA 4PJCF 1FZOA 1R5VB 5EB9A 5D6CB 1Y6MR 4ZAKC 5HPMB 2HG5A 2V9RA 3L5IA 2MKLC 3MJ9H 4EI5C 2FJHB 2EYRA 2NW2B 2HKHL 3IFNL 3CFIC 3P9MB 4JM2A 4X6DF 3CZFA 3FONA 4X98A 4HKJA 3TBYA 8CGTA 3KWWB 1ZHKB 3RDTA 4XNZC 2D4FA 2X4QB 1S7SA 1F3JB 3DHMA 2OXHA 1T03L 2VZTA 5CZXD 5DJ8A 1KLUA 2ADJA 1BQLL 3OF6A 4N8PA 3RNQA 2I9LA 4P3CH 4YE4H 3NH7H 4XPHH 3OXRA 3VD3A 4FQCL 4L4VA 1IL1A 1ZANL 3PGDA 4U3HA 4JGJA 1YA5A 1Q0XL 5F8QC 3S3PA 3QDMD 2R2HA 3PNWB 3LZFL 3QEHA 1B4JH 4L29B 4MAUL 5JR1H 2AJUL 2Y5TA 4MJ6B 1IGMH 1X44A 3QNYA 2FATL 1F4HA 4GOSA 3DMMD 5JQHC 4NC2B 4FP8L 1NFIA 4UMGA 4M1DL 2APVA 1BVLA 4Y88A 3NN8B 5A1AA 3AU1B 1GZPA 1JCKA 5D7LA 1Z0NA 5IB5B 1MCRA 4LCUA 3BGFC 4NQXB 2YA0A 2PYFB 4LSVH 4ODSL 4P2QE 1UYWH 3MTRA 2YPLA 4QXGH 4LVHC 3I6GB 4PFEA 2GK0B 4R2GC 5CILL 2UVFA 1AGEB 2PYEB 1BJ1J 5ESAA 1X5XA 1NBQA 5ADPH 3TO4B 4ZUWB 1JN6A 4G42A 1KOAA 4G8EB 4HWZB 5EOQL 1UM6L 5DFVD 4PP1D 2PW2A 2APFA 4YXHL 4PGJA 3H7LA 3M1BB 3ZLQC 3KLSA 4QRQA 1VENA 1YMME 4ZTOH 4K7PH 4HXAL 5GZOC 5SX4H 1E6JL 1VERA 4RMVA 5TDOB 2QQNL 2VH5H 4PJAA 1YEFL 3LN5B 4ZUSA 5JXEC 2D03L 4OCYL 1YEDA 5ACZB 3FT4B 2R0LH 3RPIB 1OARL 3TFKD 2P8MA 1J7VR 1IZKA 3QPXL 1IC5H 1PLGH 5D5MF 1DLHB 3QO1B 3PIQA 5I9QC 5GPRA 3UBXI 3KPNA 2PO6D 2Z91A 3NVQA 5FO7A 1X5YA 3A6OA 4M6AA 2IBGA 3ILQD 3O8XC 1Q9OA 5F7DA 1RUQH 2EZ0D 1FNHA 1WWWX 1HCVA 2I07A 5DURB 1OF2B 2DYPD 1JZ6A 3IVKA 1OAZL 1XGUB 2F53B 3IJYB 1ZK9A 1C5CL 5ANMB 3I75B 4HJ0C 5SV3A 4EUPA 1JZ3A 3GKZA 3P11L 3THML 3WHE0 5IM7B 5EZOL 2DI9A 3QNZA 1KJMA 1PW3A 5IB2A 3REVA 5IW6A 1CS6A 3FKUS 4LCCB 1YN6B 4HGMA 4X4ZA 3ULVL 2NXYB 2WWMD 1EZVX 1RZKH 1F4XL 4PGCB 4TUJA 4MLIA 2OCFD 4X7FC 3OB8A 5KANG 5CJQH 5CSBA 5DMIH 1T66C 3LS5H 1ETZB 5SWSB 1QFWL 3PQYA 2GJ6A 1MIEL 3CCHB 2W9DH 3ARDD 4XCFH 4MNQA 4W4NA 4G6JL 4HAGA 5IHZA 2DQGH 3VI4F 1OB1A 5EOCH 2Y5EA 4GRLA 3FRPA 1NEUA 4JRXD 4YDVB 5IKCB 4QRSB 5J11B 5AZEH 4JPVL 3X11B 2R2EB 4LQ1A 3QULB 4GAFB 1M4KA 1EUTA 3HPJA 3HCVB 3VXSB 2QSTA 4GT7A 1TMCB 4U1HB 5GRYA 3O6FC 4RMRA 4MD4A 1OAKL 3LMJL 3HE6D 4OZFG 4UQ3B 1JNNH 3QIUA 2DKSA 3FN9A 5AWNL 2RBLA 5IK3B 5I71C 1WTGT 5KANI 1N5AB 3GMPA 2DBLH 4JR9H 3GHBH 1P4BH 1TQBB 4M6MH 3HI5H 3F7VA 1WVZA 2VDPL 4LP4A 4P5MB 1Y6KR 3HI6L 4O51B 4LF3B 1F3DH 1AGCB 3KPPA 2IH3A 5JUEL 5C0FA 1ES0B 4DZ8B 4LU5L 3RWDB 4JJ5A 3VXQA 1AGFB 1NUNB 3EYQC 1MWAL 4JO1L 4MAYB 4YUEH 1BFVL 5EUKB 1HINL 4FABH 5I1GH 4I18A 2YD7A 3CC5B 4YH6A 4MQTB 4X8XA 5D71H 2WIIA 3RBSA 2J2ZA 4LVNC 5LCVH 2FX8L 4RFNC 4XC3L 3SHSA 1D9KC 3DIFA 3GMMA 5KSBA 2G2RA 4P9HH 4E0RB 5BRZB 4LLQB 3EDFA 5CEZD 4U1SB 1P4IL 4O2EB 3CMGA 2NY1B 3TNMA 1MHCB 5GZND 3X3GL 4K3GA 5E4IA 4RA0C 1PZ5B 4K2UL 2VDOL 1LEIA 5ADOL 5DLMH 1FZMA 4M1CD 1WWAX 3E3QC 1PX4A 3DVNB 1DQJB 1G0YR 3LKRB 4U49A 3T65B 1TJIH 2YXMA 1JYWA 4P2RE 1S9YB 1F3RB 1FBIL 5IJKA 3TIDB 2K3TA 1JF1B 4OUUA 5JW3L 1I1FA 1QPXA 2ENYA 5A2LH 4U4BA 2FNBA 1T3FB 3GSVA 4WHYG 5I18H 5FOBB 2EDWA 2F54B 1YUHB 3EDEA 3WNPA 4IMLB 3FO1A 1MCCA 1W0WB 1CBVH 1U8IA 2R2BA 3CIQA 4IIQB 4JM4H 2Q8BH 1KV3A 1T80A 3MV9D 3PP3K 3X3FL 4NZUL 1XF4A 5FYJU 4GAYA 5HGAA 2Y6SC 1W8NA 2RIKA 5IFJB 1NAMH 4KJYA 1U2HA 3O9WA 2H6PB 2V2WA 3LS4L 4U1LA 3GHEH 3WIFB 5C0ND 1GJIA 2YC1B 1IRAY 1H3TA 4HX1B 2DQHL 2Z35A 1XFPA 1I9JH 4POUB 2VR9A 3QIBD 2W9EL 1QRNB 1OP5H 3V79C 1IM3B 5I1AB 2XXCB 1PG7W 1UJ3C 3LSOB 3NCBB 1WBZA 3K4ZA 1BHGA 5CMAB 1YEEL 5E08H 1T83C 1U95A 3P4OA 3SE4A 2IMMA 3QEUA 3NBNA 1EAPA 3PWJB 3QUZC 2PKDA 4N0FB 3OX8B 4HV8A 3U82B 3BP5A 3QZWA 1P2CA 3F8UB 3FQNB 3PUCA 1FL5B 1XGRA 4KV5F 4V1DE 4EN3A 5D2NB 3SDDD 4JB9H 4HGWA 5KSAB 3IS1X 4P46B 4PRPA 4Z95H 5LBSL 5IEKA 5AD0A 2VDKL 3VFUA 3NABH 3ZDZE 1UZ8B 1X5ZA 4G6MH 3FFDB 3GJFH 4BKLA 1SYSA 3BT2L 3LHPL 5M95B 1RIUL 5FO9B 5IB4B 5ICZB 4IRJB 4TSAL 5CZXC 4PRBB 1FRGH 1SJEA 3IFLH 1W72H 4Z9KB 1TPXB 2XKNA 4J3SA 4LLWB 5DD3H 3V6FA 3BN9C 2QV2A 2NNAA 2UWEB 4OLVH 3FMGL 1A6VL 2DM2A 4LSPH 2W07A 4PR5B 3LQAL 4RX4D 1RFDL 5IVXF 5IMKB 3DO7A 4TVPH 5DRWB 3ALXA 1HI6A 4E42A 1T04B 4WTWA 1EEQA 4F7PA 2Q86B 4KJQD 3C5JB 4UTAL 4HWNA 1NMCC 4ELKA 1ORSB 5F44A 3L95A 4ERSL 4FQJH 2DL2A 5HGHB 3ZKQD 2BJML 3F62A 1ZA6A 1BM3L 3NA9H 4QF1B 2BNQB 3MRDB 1INQB 3MV8D 1ERNA 5FDWB 4DGYL 1I8KB 4H8WL 1MHPL 4HKXB 3LN4B 1WZKA 3LV3B 1NH6A 3B2VL 3AMKA 4BH8B 3P77A 3CX5J 4QRPD 4LLYB 3HHRB 5IF0B 4ZFZA 5C0IA 4ZODA 4PGDB 2NY7H 1HKFA 1L4IA 3GMNB 1P7HL 5DFVC 1DEDA 2BMKA 2WBKA 3BP7A 1HE7A 4PP1C 3PJSB 2CDGB 3BO8B 2QQKL 5EU5A 1MAMH 1R3KB 1JUFB 5LGHH 2BXZA 3W0WD 3MOAH 5DK2A 5JHLH 3H9SB 3RTQA 4IRZL 3QG7L 1JGVH 1MFAL 2J6EL 2VABA 4P2OB 4WU5A 2J4WH 3N1QC 5CP7B 1OGAB 4NJAH 4ZFOB 3TFKC 1B6UA 4QHMB 4MJIB 3VCLB 4ODTH 1R3JB 3CD4A 1FVCB 3C6LB 4LCWE 3GI8H 2X4NB 3C60A 3FFCE 3I84A 2R9HD 4H25B 3KXFA 4ZXBC 4NO0D 1PKQB 2C3HA 3O81A 1G0DA 2ED9A 5A2JH 1TXKA 1KB9K 2VL5B 2GHWB 3CU1A 5HDOA 1MRDL 2KZWA 4F3FB 4RISH 1J1XH 2YD2A 5F1KC 3TNNB 5CBAB 5L8LB 3P4MB 4U1IA 3R0MA 3B9KB 5EWIL 1A7QH 1YZZA 3P73A 3R4DA 3CFDB 1A7RH 3NOIA 3GNML 3V6OC 4FFWD 3VFSA 2FEEL 1MRCL 2R4SL 4ZSOA 3ULUE 1I7TB 1MLCB 1NLDH 1FZJB 2AXGB 4GQPH 3SKUD 1RZFL 2OI9B 4HWEL 5TJWK 4Y5YB 4CW1A 3ARDC 3NCFB 1DN0B 5JNYB 3S3SA 4TUKL 2C1PB 2X42A 3ZL4H 3D39E 1CICA 5GRJH 4GSDL 3D0VB 4QHNB 4XNQB 3DUUB 4FXGB 1L0YA 3VFOB 5LQBL 3CK0L 3LKPA 1LNUB 2HYMA 3NCEB 1YEGH 3KPQA 3UTQA 2AGJH 4FMFA 4UDTA 5IB3A 5KS9F 1MUJB 4NC0B 5HHOE 4P2QD 2YSSB 1TJGH 3QAZB 1WSST 5DYOB 3HE6C 2EDHA 1MVUB 4RMQA 2E7LA 5F88A 1XEDA 4XC1L 2BOBB 3JBG7 2DMBA 4EVNB 1IEHA 1TTUA 1PDKA 1LO2H 3EHBD 3JVGC 4AMKH 3ILPA 1A7BA 1A02N 3S7GA 5HXMA 1N6VA 5D2LF 5DS8B 4XZUA 1JPFA 4P5KA 5DEZA 3LEVL 3TPUA 1I4FA 1U3JA 2FYYA 3PHQA 1YMMD 3KDMB 3T0DA 4NRZB 1KN4L 4GKNB 5EO1B 4Z0XB 2CKBA 3ECBB 2UY7A 2BVQB 3VRIA 1FORL 4KDVA 4HWBH 4PJ9B 1YNTA 2LTQC 2FJFA 4PD4J 4Y16A 4Q9QH 1P7KA 1TFHA 1DQLL 4GW1B 2WIMA 5SWZE 4N8VG 4OCSL 4DKEH 1KT2A 4Y5XA 4AIZB 2ZWLT 1P6AB 1N3NB 5K9KA 4H1LA 3PWVB 1QSFE 4TUOA 2IQAB 1N59B 1E6OL 1ADQH 3S36H 2Q1EA 2HLAA 3D3VE 1S9VA 2HWZH 1U6AH 3QUYB 4YC2C 1JHKL 1SJVA 5FEBA 1K5NA 4GG6F 2NY2D 1F97A 2RJMA 5GZNC 3FOMA 5AYQA 4QGTA 2VNCA 2CRMA 1AD0B 2VXSL 1V7MH 4LLUB 2EDFA 1P84K 3RVVC 1A4JA 2ZUXA 3BP4A 1UCBL 3UTTB 1H8OA 2YKLL 3MFGB 3HC4H 3QNXA 8FABA 3T4AB 1P7QA 4AEIH 3ZKSD 1CR9L 1QSVA 4OGAD 3BRGC 1E4KC 1EFXA 4P3DA 4Y7MA 1M7DA 4HF5L 1HQRB 1CE6A 4LCYB 4JY4B 3VFPA 1CL7I 3VWKA 2IANB 5CBEA 1CGSH 1CGUA 4JFDA 3PWLB 2WUBH 4PV8A 1L9NA 3G6DH 3MREB 4AEEA 3EOAA 1NGYB 4KKLD 4JN1L 4Y4HD 3ROLB 2QR0A 4RBPH 1U8KA 3PE9A 25C8H 2R0ZL 3LPFA 5H94A 1UB6A 3F58H 2OL3A 4LHUB 4PRNA 5DJ6A 3WCYA 1G9ML 3ME0A 1WWBX 1N0XH 3CFBB 2HRPH 4HZLB 4JZNB 2AK1L 4IRSB 1L0QA 3IDJB 4KRPB 1MHHB 3B9AA 5C0NC 4OLXL 4FN0A 3RUGB 5I1KH 3BYTA 4KROD 3BD4A 3KHOA 4R6UA 3DHJA 4G8GE 3QIBC 3MCKB 4K71C 3GGWB 4QRTA 3AAZB 5C0AA 1DEEA 3V4PL 1FIGL 4NUGH 4NM4L 1IAII 2V7NB 4L8DB 3S4SA 4DN3L 1TZIA 3FCTA 4M4RA 1UKQA 4GKOA 2KBGA 3IFOA 3QXDA 3FO0H 2VLJA 1HOCB 1NKOA 5DJ0A 1UM5H 4HT1H 4L8CA 2YPKB 2NXZC 4WUUE 5F96H 3IFPB 3Q2CA 4L5FL 4PJ8A 4AH2A 2OR9H 3SDDC 1CFSA 2ICWJ 3EO1A 4TSCH 4RQQB 1URLA 4NN5B 3LKQA 4PJHE 5ICYB 2EEBA 4DKAA 4KMLB 2IGFH 3PG2A 2BERA 1EZVY 3S3JA 4OFKA 1WAAA 3TH2T 4K8RH 1GPOH 3I02B 3SKOB 3LRSA 2AXJA 3BWAA 2UZIH 4JHBA 4PB0H 4KI5F 2J8UA 4JG0H 4PPTA 2C7UB 3EUUA 5AZ2H 1KTDB 4GLRH 3ARZA 4UINL 3WD5L 1ZWIA 3BPLC 4CN1A 3SDXB 2XZCL 2R1YB 4IOIA 4XMKH 5E00A 2EXYD 5D96C 1J10A 4P2RD 1JGLH 1JWUB 4G43B 3DOSA 4S1DD 2AI0L 5INCB 2VISB 5DRXB 3W39A 3UTPE 5C3TA 4PJDA 4KJQC 2H32A 2M26A 1G7JB 5D6CA 4GAGH 4QY8B 1R3LB 4KUZH 5HPMA 2DDQL 4DEPC 4BFGA 2C3XA 2C3VA 3QI9A 1A6ZB 2FJHA 1V3KA 1N2RB 1A7NL 4GJTB 3SDAD 3P9MA 2LU4A 4RDQG 3QFDB 4XVJL 2VC2H 3KWWA 3DUSA 1ZHKA 2JLLA 5E2JA 1A3QA 2X4QA 3JWDH 4LKCB 1F3JA 2NX5B 3TJEH 3VFGL 2XWJB 4CVZA 2XY1A 2R2CA 4OZGB 1JK8B 4Z6AT 1AFVH 1Q1JL 1PD6A 4FFVD 5B8CB 1MQ8A 1FDLH 1OWRM 4WV1C 1U8MB 2VXTL 5D1XB 1JHLL 4ZTPH 1NCCH 3PNWA 5D7SH 3SE9H 4L29A 4KTDH 4LSUH 5BMFH 1FNSL 1UACH 4FQLL 4MJ6A 1J0YA 3MLRH 3VXUE 4IJ3C 2VDNL 5E8OB 3MZGB 3AREB 3WFDL 4JCMA 1FFPB 2F15A 3W11D 3I9GH 5EPMB 4F9LC 1Z9OA 3PWUB 3NTCH 5BS0E 4TVPD 3CFCH 3V7AG 2K7QA 4YHLH 4TNVF 1CU4L 4HIIB 5AEAA 3NN8A 4V1DD 2E27H 4PJFA 3HAEH 4Y2DD 5FA3B 2K9UA 5DD1L 4WI6A 5IB5A 5GRZA 1J8HB 5I1CH 2XTJB 4NQXA 4XHQA 4K9EH 4XVSH 2PYFA 3KG5A 5T1KB 4CU7A 1MFDL 3PL6B 4YHML 1B4RA 1JNLL 3WFCH 3RP1A 5D9SB 3J7HA 3O6LH 4NCDA 4J4PA 2EDXA 3QHFH 4I2XE 4ZUWA 1MCQA 3QEQD 3W5MA 4AG4H 4RMUA 1INEH 4G8EA 4HWZA 5FUCC 1DANT 3KYKL 5IQ7H 1NEZB 2D7MA 2BFVH 3M1BA 2R29H 4FQ1H 5DO2C 4AZ8A 4EDXB 4FFWC 1GZQB 1V3LA 3VG0L 3MYJB 4X7TB 1QR1B 2IADB 5C70A 3S35L 1BGXL 1QD0A 3WEXB 2XOTA 5TDOA 4KVCL 4TRPH 3LN5A 1DFBH 4R8WH 1L7TL 5ACZA 3FT4A 5I1JL 3RPIA 1B0GB 1HNFA 1AQKH 1BF2A 3OKEB 5TF1H 1QA9B 3GBNL 3S98A 4A6YH 3QDGB 1DLHA 1MF2H 5CGTA 2PR4H 4ZUTA 1ZS8A 4QNPE 4PJ5D 3JTTB 1M7IB 2V5TA 5KTEH 4PJGB 1FV1B 1MCLA 5DXWA 3ETBF 1U8QB 1OF2A 2Z4QB 1XGUA 2F53A 3IJYA 4L4VE 2DQEH 3I75A 5ANMA 1CN4A 2ZUSA 4OF8A 4JQVC 4WEUD 1I1YB 3AM8C 4KVNL 1ITBB 1KEGL 5IM7A 3ZKXB 1CFQB 3CFJB 1U91A 3RZCD 1SYVB 4LCCA 1YN6A 4S2SB 4Y4KB 1IAOA 2PTTB 3H9ZA 3NIFF 2ORBL 5DD5H 4KI5C 3FB6B 5JXAL 4HMDA 3N50A 3HUJB 3BRDA 4LEOB 4YDIH 2G60H 3R1GL 2BK8A 5D7LE 1ETZA 5SWSA 3S8WA 3CCHA 5K59E 3ARXA 4U1KB 3HFMH 4NBYB 1RZKC 5KN5A 1BBJA 3JTSB 1A6UH 2F8OA 2B1AL 4YDLC 3TH3T 2ICCA 4LCWD 3WBDA 2YPLE 4YDVA 5IKCA 4QRSA 4CU6A 1ACZA 1DQDL 3X11A 1DP0A 3LEXB 2IPTL 3KS0H 5GRUL 5B39G 3MXVL 3QULA 3HCVA 3VXSA 4BQ6A 2HFFB 4C56B 1A1MB 3VH8B 4U1HA 3FT2B 3QR2A 1WIPA 2NY2C 3OKYA 3DVGB 3BD5A 4RGMC 3L7EA 5IBUB 3LD8C 4OCLC 4UQ3A 4NT6B 1EGJL 4OD3H 2FLRT 5TDPA 5D7JB 2X6MA 4GBXB 2AQ2A 3C5ZB 3C2SA 4ZO6A 4PJAE 1E4XI 3MSPA 2W9LA 1N5AA 4A2LA 1I8LA 2JIXD 1T4KA 1CLZL 1OD7A 6FABL 3ULUD 2ARJQ 4P5MA 1AR2A 4CN4A 4O51A 4LF3A 1HWGB 1AGCA 4BSJA 3O2DA 1ES0A 3FB7B 4DZ8A 3RWDA 2N7BA 3WS3B 1AGFA 4M48L 4MAYA 1J88A 5EUKA 1WZ1L 1LP9F 3CC5A 4WWID 2ERJC 4HBCL 1BMGA 5IW3A 1IFHH 3KR3H 4UNVA 3S88H 5AYUH 3D39D 5IESH 3RU8L 4Z7NF 4MXQC 4XVUC 4KKLC 2E6QA 2Z8VC 3Q6GL 5E6YA 4Y4HC 2P1YA 4U1JB 5BRZA 3QUMB 4LLQA 1CZ8H 2FHBA 5T1LB 4U1SA 1DUYB 3UDWC 4O2EA 1MHCA 5FA4B 2EH8H 1AE6L 1JP5A 5GJSL 5HHOD 1SQ2N 2B4CH 1PZ5A 4QEGA 1RSFA 5ALCH 2HFGL 3KYNB 4KROC 2CLZB 4NPYB 5L2KD 1DQJA 5C92A 3T65A 1MQKL 3PQYE 2GJ6E 2Q20A 2YRPA 3F7QA 1T1XB 1ORQA 1S9YA 3RIAF 3TIDA 1JF1A 5LVEA 3VMPA 2IEPA 3OXSB 3CLEL 3MLZL 3BQUB 4Z7VA 4HPYH 1U3HD 1T3FA 2DQJH 2ITCB 3IDUA 1JZ4A 3HRZB 4BK5A 1YUHA 3VRLE 4IMLA 5D1ZD 2PUQT 3WS6A 5CD5D 1QSFD 5DVLA 5FECB 1R24B 3D3VD 4XCCH 3AS0A 1NUFA 4P2CG 2FBJH 3KLDA 3N9GL 1RZGB 4GRWB 3V4UL 1YPZB 3FN0L 5IFJA 4OCRL 1RVFL 1YEJH 3RGVA 4YHOH 2H6PA 1T7YA 2EICA 2XRAH 4YFLI 1FGNH 2YC1A 1JPTL 4K7FB 4RGNB 4TNWK 1HN1A 3DV6B 2MSPA 3WDIA 1IM3A 5I1AA 4OTXL 3WLWD 3LSOA 2B2XH 2EXYC 2VXUH 3UZVB 5I8CB 5DJ2A 5CMAA 1BEYH 1QHPA 5F6IC 4BQ8A 4G9DB 4G80B 2D0GA 4L4JA 1M6OB 3SDCD 3RHWK 5HYIA 5KSBE 4LSQH 5GGSB 3B83A 3T04D 3PWJA 1FN4A 1I1AC 3TIEB 1FFQA 4KUCD 3OX8A 1DVFC 2HH0H 4PJXE 1K3IA 1OVZA 2FGWL 3FQNA 4PBWD 4JAMB 5KSAA 5D2NA 1NFDF 4P46A 3SDAC 1JGDB 4D8PB 1G1YA 4WNQB 1NBVL 1YEKL 3FFDA 5JW4R 2YXFA 1BOGB 3EFFB 4OSUL 2A9MH 2BRRL 1B0WA 5FO9A 5IB4A 5F7UA 1DBAH 2A74B 2IAMD 4IRJA 4Q9BA 1TVBB 2DQFB 3IDYC 4PRBA 1T0NB 5ICZA 4FZEL 5T1MA 4LLWA 4R4FL 4HKZA 2UWEA 3RL1B 4ETQB 4CAGA 4XP5L 1I7ZB 1U8JB 2FRGP 3QCUH 3CX2A 4ZOAA 4JZJC 4PR5A 3E1F1 3ULUF 1XF3B 4G8GD 3QCVH 4FNLL 1BX2A 4F33B 3DXAE 5IMKA 4K8RD 5DRWA 5I19H 2JF1A 3HE7D 2GY7B 1T04A 1NDGB 4GRMB 4WGVB 1CTNA 4RGOL 3SY0B 3NZ8B 2Q86A 1OSZA 5E99H 3C5JA 4M5ZL 3BKCL 3U7YH 3TEUA 3W11C 1HWHB 4HLZH 1OT1A 4IEFB 4XVTH 5C6TL 4WUUD 1Q0YH 3U0WH 2BNQA 3MRDA 1JRHH 1S3KL 4XB7A 1INQA 1CL7L 5FDWA 5DDHA 1I8KA 3E8UH 4HKXA 3LN4A 3LV3A 4F58H 4BH8A 3C09C 3FHQA 4LLYA 4EOWL 1ACYL 1IM9B 1KTLB 2WWKO 5IF0A 5JIIA 5KVDH 2BDNH 3QYCA 1E28B 4KHTH 4PJ7A 5KZCB 4Y19A 3GMNA 4QTIH 1QTYT 4JCLA 5F1OB 3T3MF 2LAGB 2CDGA 3BO8A 1DLFL 5TDNA 1R3KA 1MRFH 3KLHD 3ARGB 4YK4B 2W65B 4XWOC 1N5YH 5EH1A 3H9SA 4WI7A 1KCSH 3BPOC 3FAWA 1AO7B 5DJXB 4M03A 4P2OA 3UAJD 4LAQH 2OJZL 3QIWD 4LSDA 5FKAB 3IAQA 4D0BB 4PRPE 5CP7A 3P4LA 1OGAA 1HIMH 4ZFOA 4WY7H 2P5ED 3GM8A 3UTPD 2IFFL 3T0EC 2ZOLB 1R3JA 1IKNC 1FVCA 3ARBB 4ORGB 5DD6B 2X4NA 1IAIL 5D70L 4LGRB 3D2UD 1CD8A 1IQWL 1QNZL 3EO9L 3F6IA 5C0EB 4I3SL 3OG6B 1VGEH 3WFEL 4H25A 2WBJD 5DRNB 2X1OA 4LLMB 4N8CL 1PKQA 3NMEA 2Q3AA 5ILTL 3MLUH 2VL5A 5HHVH 4YLQT 4YHZL 1N7ML 1QQDB 5IBTL 5DHVH 3LIZH 3TNNA 2QHLA 5CBAA 4YDJB 4PLKD 3B9KA 4M6NH 3CFDA 4HIJA 1KB5H 3TF7C 5SX4I 3EYSH 4UAOC 3AY4C 1I7RB 3HC3L 3PGFL 5D7IB 4K94L 1J0IA 4BFEA 4OZFB 1MLCA 1I7TA 5JPMB 1FZJA 1H3PH 2AXGA 4XNUL 1FO0L 1EHXA 1N64L 4DQOL 5KJRL 1G7IB 3B5GA 4KUCF 2HVJB 3EDKA 3VXUD 1LEKB 4Y1AD 3K1DA 5CIPH 4Y5YA 1FNGA 1UM4L 5DJCB 1DN0A 3BPNB 5JNYA 1EUUA 4R90H 4WFFE 4L3AA 2C1PA 2ED8A 5GHWL 3U2SB 5BS0D 4QHNA 2AJSH 4JDZB 2Y1VA 5EOCJ 2AP2A 3PWPE 4XNQA 3DUUA 3V7MA 1AKJB 4BH7B 4FXGA 4S11A 3VFOA 4Y4FB 1LNUA 3STZB 1J86A 1YN7B 5CZKA 1QG3A 5HGDB 4RMWA 3ALWA 1OP3K 1HZHH 1MUJA 2YSSA 5DYOA 5FHAH 4NC1E 2C1OB 3PGCB 1MVUA 1CF8L 1IGFH 5C2UB 5F1SA 4EVNA 5ITBH 4NKOB 3MRGB 1IAIM 1D6EB 3HNVL 5DS8A 1XR9B 5FGBA 3UTSB 1EHLL 2OZ4H 1J12A 4ZUVB 3KDMA 4HHAB 2XG4A 3QQ3A 4NRZA 3ULUC 4R7DB 5EO1A 4Z0XA 4WCYH 1YDPB 3ECBA 3FO9B 2BVQA 1FPTH 4PJ9A 5HJ3B 3TA3B 1F3DJ 1XCTA 3WHE1 2FB4H 3LPGA 4JM2D 3VGFA 1HXMB 3G5XB 1SM3L 5T5FL 2ADFH 2XACC 4Z7WB 4L1HA 5JW4N 3VU2A 3RDTD 4AIZA 1N3NA 3CGTA 2IQAA 1N59A 3FOLA 2DKUA 3OF6D 5DQDH 1ZVSA 3GO1H 3QUYA 2YEZB 1XGTB 2EDNA 1TVHA 3T8XB 4L4VD 5BV7L 4AEHL 1DBKH 4UT6L 5H35B 1HKLH 5C6WH 1AD0A 4JPWH 4LOUD 1C8PA 2YD4A 1OSPL 4LLUA 1B90A 5FIEA 3GI9H 4BQBA 3UTTA 4L8SC 3ARPA 3TWCH 5C0DB 3EJJX 3T4AA 4DGIL 5F3BB 3QCTL 1TJHL 5DHXB 1P5UA 4M7KL 3WNKA 1CWVA 2GW5A 1BFOB 1ZLWK 3H8NA 1HQRA 2AABL 4LCYA 3R0NA 4U1MB 3EKCA 2D7QA 3QJHB 5D7LD 2DQCL 1U3HC 5HPOA 5DJDB 4M93B 5DEGB 4IOSD 2A77L 4QWWC 1I3UA 1KXQE 4WWKC 4RAHA 4ZAKB 4MCYB 4OT1L 3P0YH 2YPLD 3KYAA 3PWLA 5CD5C 5I6XB 3H9YA 3MREA 3CX5K 3TBSB 2F5AH 4EI5B 5TE7H 3MV7A 1D7FA 1NGYA 3TJHC 3AMLA 1F6AB 3EOTL 4D0DB 4JQIL 4LHUA 5C08B 2NY4D 3CFBA 4PTUB 5J13C 5I16B 4HZLA 4OZHF 4NN6B 1RURL 1Z6JT 4JZNA 4IRSA 2VQ1B 4XNZB 5FGSA 1SMAA 4EDWH 3IDJA 2WQ8A 1AC0A 1MHHA 4NZTH 3RUGA 1W8OA 4HK3J 4YXLL 3TBWA 2ARJB 2B1HL 5C7XH 3CXDL 3MCKA 1KYOJ 1U92A 2AJYL 3GGWA 3C8KB 3AAZA 3T0BA 2I5YH 1FHGA 3WLWC 5T1DH 4I0PA 5J57B 4Z0BL 3C2AH 1IGCH 2V7NA 4L8DA 5F7HA 3SE3A 4QHUB 1MIMH 2OTWB 1HOCA 4PG2A 4Y5VB 5CGYD 4ZOBA 4RMTA 2YPKA 2MPAL 2KZ1B 4LEXL 3IFPA 5GRVK 1NDMB 3GK8L 4FQHB 5I2IB 1JPSH 2FX7L 4RQQA 4KKAD 4I5BB 3PDGA 5T3ZH 4ESKA 3IJHB 3JUYA 5DK3A 4UB0H 1KJVB 3ZT6A 3LVEA 2EDTA 2VDQH 1XH3B 2DQDL 2IAMC 5CJXA 3I02A 5GQBA 3SKOA 2RB8A 4GXVL 4LGSB 1Q38A 4M1GL 5GS1B 4NQVA 1MFCL 1NFKA 4OD2A 1S5IH 4H1LH 1PQZB 4PJEF 1VGKB 2B5IC 1KTDA 2W92A 3F5WB 3VXRB 3PQYD 3L6FB 2GJ6D 2AXHA 5IVZB 4K8RC 4MXWH 2R1YA 3SDXA 4I3RH 5T3XE 5DMGC 3HE7C 2FIRT 4JDTH 1JWUA 1X4XA 3O6KH 4G43A 4JFDE 4JM2F 2IFGA 5F7LB 1E4XL 4GRLD 4LP5A 4OLYL 4BUHA 2VISA 2YWZA 5LGJA 5BXFB 2VB5A 1G7JA 1QP1A 1XZ0B 2AEQH 1R3LA 2XA8L 1HCFX 4QY8A 1EIBA 2GJZA 2MCPH 1XF1A 5DD0L 2VLRE 5GS3A 1A6ZA 1FNLA 1MCSA 2CK0H 4YBLC 5I9QB 1N2RA 3QIUD 3QFDA 5EU4B 4DN4L 3O8XB 1EK3A 1A7OL 3MACL 3CSGA 4ONGL 4LKCA 2XA3A 2NX5A 2YHGA 1CG9A 1Q94B 5FYJE 2XWJA 4IS6B 4TQEH 4OZGA 4POZD 2XPGB 2CO6B 1SHMA 2IPUG 4PB9H 4LQFL 2F5BL 5J9PB 4YO0B 4YAQB 1S7RB 2VLJE 4M7JL 3KLHC 1U8MA 1S9WB 3JWDC 4PD4K 5D1XA 2XWTB 3CJJA 4D9RE 5DHYB 3VFTA 1T7XA 3UAJC 3F7RA 5K59F 4G7YH 5E8OA 3ZE0F 1XMWA 4MVBC 1D5XB 4XAWL 5HVWA 4QXUL 2FL5B 3C6SB 4C83A 4O2CB 2EDBA 5EPMA 5L6YH 1NUDA 3PWUA 3EOBB 1WZMA 1NMBH 1IC1A 3HZKB 1WAAE 4HIIA 5KVGL 3MPCA 4PJCB 1U9KA 5FA3A 3CUPA 2M8XA 5D1QB 2NYYC 2J8UE 1H8SA 2IBBA 3PL6A 4NQEB 5D9SA 5K9QG 5C0RL 1GAFH 4BJLA 3O6FB 4PY8J 3EO0A 4N0CD 1SBBA 4HIHB 1RIHH 1Z2KA 2AJVH 1N4XH 1GC1C 4FQ2L 4K9EC 5D93B 4EDXA 3D1MC 4Q6IC 3FFCB 3U36B 2IADA 3WE6B 3WEXA 1OAYL 3RQ3A 2RCSH 5FYLE 5FXCH 1P4LA 1B0GA 1YYMH 2R23B 5C86A 3JWOH 3WIIH 3QDGA 3V52H 2H3NB 1I9RL 2AAVA 4KY1H 1FAIH 3L1OH 3JTTA 1M7IA 4OGXL 3NCJH 2IJ0C 4PJGA 1FV1A 3T0VA 4KAQL 3CLFL 3O4LB 3O9WD 5DVNA 4XP1L 43CAB 2VL4A 4J3OC 5D8JL 2L7UA 2ZUUA 4LVNB 4RFNB 1U8QA 4W70A 5C09B 4D0CA 2Z4QA 4N8VB 3MJ8A 1CFTA 2H32H 1I1YA 4NNPL 1KULA 2JELH 3FZUD 1AGDA 1PZUB 2DRUA 3WJJC 1CFQA 3RKDD 3MRCA 1MCJA 3CFJA 4S2SA 5FYLH 2PTTA 4PG9B 3FQRB 3VXPB 2V7HB 2OR7A 1S78D 3L5XH 4OB5H 2J1KA 3FB6A 3FQXB 5F7EL 1MVFA 4J1UB 2H1PH 4HDIB 2C5DC 1KCRH 1FNEB 5CJOL 1FZKB 2W0FB 3HUJA 3S37L 4LEOA 2HN7A 4EN3D 1E27B 1YNKH 4PRPD 3B8SA 5EBWA 4JM2C 1IAKB 3I85A 4U1KA 1WLHA 2X5PA 1NCAH 4NWUH 1X5HA 2J6EA 2PYEE 3LEXA 3MJ9L 4ELMA 5E2WH 3H3PH 5D5MB 1KNOB 4XWGH 2HFFA 4F8TA 4JRYB 5IEHB 1A1MA 3VH8A 3FT2A 4ZQKB 3G5YB 2DIJA 4BZ1H 3A6BH 3OPZH 3DVGA 4HFUL 2I27N 5C1MB 4OFDA 1SBSL 5DR5L 4NT6A 2HJFB 4BFBD 4LOUC 5D7JA 4GBXA 5BJTB 3WXVL 3DJ9A 3C5ZA 4OKVA 5GGQL 5E70A 3VXMB 3RVWD 1AXTH 1IC7H 1UT9A 1A3LH 1NCNA 3RVTC 4WI3A 3L3HB 1ZHLB 4XPHL 43C9B 2WP3T 1FE8H 1MREH 2SEBB 4ZDHB 5KSBF 4QRRE 3QEGH 1UJ3B 1EAJA 1KEML 4PBVC 3Q5YA 1SEBB 3FB7A 3GSNB 3WS3A 5F8RC 3T1FB 4X4YB 4JREC 1IGML 2F53E 3QHZH 3CVHB 4WFFD 1CVSC 3QUZB 1FO0B 5ISZA 5CJ5A 1J5OH 2EIZB 2PXYC 3BZFA 4M7LL 5CUSH 4U1JA 3QUMA 4JO4H 2VXVL 5T1LA 1DUYA 1FIEA 5C3LD 3QRFM 5IT2H 2NY4C 2CMRL 4OI8A 2QSCH 1C5BH 2BY0A 4QXWA 4U31A 1UYWL 4MLSA 1CDUA 2ICWB 4QXGL 2BVUA 3RTQD 3KYNA 2CLZA 2V2XB 2GK2A 4NPYA 5ADPL 1OAXL 3CMOL 4X7CC 5SWSE 3U0PB 1A21A 4D3CH 1T1XA 2B4CC 2V17H 2DWDB 2Q7YB 3NPSC 3VI3E 1A64A 1MJ7H 3O0RL 4ZTOL 4K7PL 3C60D 3QDMB 4NN7B 5HYEA 1C12B 2DLGA 3OXSA 3BQUA 3HA0A 3KXFD 3VXSE 2ITCA 1OY3B 5CGYC 3WN5B 3HRZA 1NMCB 5DUML 3UPRB 3NZHL 5C0CA 2QADD 1IC5L 3PP4H 4HUNB 4J12A 1F4WH 4PRHE 4P4KC 1MPAL 4KKAC 5FECA 4APQA 1KPRB 1RUQL 1RZGA 3O3EA 1YPZA 5ID1B 1KIQB 2X1QA 1O5DT 3OB0H 3I6LE 1RK0B 4OGYL 2E5EA 3NFPB 4FFYL 1R5WB 3K7UA 5F1IB 5FHBL 4K7FA 3S35X 3HI1B 1U42A 3SGKA 3DV6A 2A6DB 4NKMB 5BV7B 4KFZC 1UENA 4WEBH 3DUHA 4K07A 1AHWB 3BKJH 1RK1B 4G9DA 4G80A 4GRLC 2J12B 1CICD 1M6OA 5BOZG 4CJ1A 4ZS6C 2VLKA 5GGSA 1KJ3H 5BRZE 5DMIL 4EEEA 5I15H 1H9VA 1U3YA 2W9DL