4ZAKC

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakC02
3FQWA 4UNVA 1KIPB 5FYKD 1FYTD 4JGJA 1HHJA 3WO4B 5I9QC 1S9WB 1MRFL 4P4RB 3HE7D 3VFUA 4JO2L 2YWYA 2Q3AA 5HI3D 4XPGH 5B39A 3QUYA 4PREB 1XCTB 1X5GA 3T0AA 3VMOA 4Q9CA 2VJXA 2GYSA 4Z7VA 4DN4L 3ARUA 4P5TA 5BVJB 3C5ZD 4QF1A 4HS3B 1G7LB 5FYKH 4TQEH 1CXIA 1RIHL 1XZ0B 2G75B 3W9EB 1A4KA 4LEXH 3VRJB 3FT2A 2CRMA 4MAUL 3LPFA 2G60H 3WJJA 1PG7L 4ETQA 3DTXA 4X7TB 4DQOH 1AKJD 2W91A 5C09A 3WNOA 4PR5A 4N8PA 1QO3A 3MNVB 5LCVL 2CDEA 3LIZH 5ESQB 3MLYH 5E99H 2WZPD 1MCSA 5C0IA 4L9DA 3KDMB 3VA2C 2ITCA 4TUOB 1FFOA 2OXHA 1JZ3A 4JFOA 1E27B 1S8DB 1RIUL 4JDVB 4LSQL 4XMKL 1Q0XL 4TUJB 2DM3A 3HPJA 4ZSOE 5I1LA 2XTJE 3EYQC 2YD8A 5DMIL 1MF2H 5GS0L 1E28A 2R69H 1MAML 5IBTH 1A6TB 3BXNB 3RVTD 2IALB 2VDNL 5GQBA 1CGVA 5A3IC 2D7QA 1X3DA 2GJZA 1NC2A 4RFEB 3O3AB 4W68A 5I30L 4L8CB 2Y25A 1PAMA 2Y7QA 4U7KA 3SGDH 2F54E 3IDIB 3VGAC 3FO9B 3F8UB 1RK0B 1OP9A 5CMAA 4PPTA 3NZ8B 3QUZC 4DTGH 3H7LA 1MLBB 4KPHL 4XZUB 2BXZA 2WNGA 4G43B 2ICWJ 4P59H 2QQNH 1KB5H 1I1RA 3DV4B 3S4SA 3ARDC 5FECA 3P73B 4BA8A 5HYSB 3WBDA 1EZVX 4RWYH 5TJWK 4WUKL 2FYYB 2PTVA 5L0QC 1CLZH 1BGXL 1EO8L 5EU5B 5GS2D 1JPTH 3TO4B 3HC4L 2DJ4A 5KSAC 2H32B 5FKPA 4WUUD 3B2UD 1J8KA 3C87A 1IGCH 2A77L 1KSRA 4HQQL 4XRCB 2ATPA 5F1NB 4XVSL 4K71C 3LQMA 1T0MB 5C6TH 1S7SB 3WXWH 3GJFH 5L8KB 4JGUA 4AJ0A 4K7FA 4LMQE 3FRUB 2MKLC 3D3VD 4APQB 2EC9T 3L1OL 4NQEE 3OQ3B 1OGAB 3VXNA 3QO1B 2V2XA 1U8HA 2VLKB 2JCCE 4L8BA 5KVGL 5BJTA 3BEWB 1EO7A 5E6ID 5DJXA 5T1DH 4C58B 3DIFA 3CX2A 5MENA 3D39B 5IK3A 5KZCD 3B5HA 1QP1A 1UWGH 4U7SA 2XQBL 5F1IB 5JIHA 1BIIA 2HJKA 4KTEH 1N0XH 4HIXH 4EI5A 1HSAA 3KJ6L 4P2RE 3T0EC 5D7LD 3ZKXB 5KS9A 2OMNA 2V17L 2VISB 4FQXA 5EBWB 4IIQA 2OP4L 5DURB 4MQ7B 3U4EA 4D8PA 3MZGB 5HGAB 3BSZL 4KRNA 4XNQB 1BIHA 3UTQA 2A0LC 3MREB 4I3SL 2X4PA 5AUMA 2FECL 1AD9A 1MWAH 3GDBA 4Q2ZB 1T04B 5FA4A 3T2QA 2XQYK 3MOBL 2DQTL 1DBBH 1JUFB 3UROR 2P47B 3RVVC 3QHFH 1UC6A 1N64H 3MNZB 2R0ZL 1YEDA 5E1HB 5H37G 2O5ZL 3GM0A 2QLVB 2DMCA 1LVEA 3FQUA 4NOFA 3VH8A 2NY0B 3R1GL 3CCHA 3CVHH 2SEBB 4NQCA 2VLJD 3C08L 5DD0H 4WW1B 3GHEL 4PB0H 1OGTA 3GSUB 3LB6C 4Q9QL 1FFNA 4OSUL 1T1YB 1EJ6A 3SGKA 4S1DD 1CE6B 4P3CL 1R5WA 4LASH 4UTBL 5ANMB 5LKNA 3QUXA 2OJZL 4WEMB 1FGNL 3MCKB 2VL5A 3NMEA 1JZ4A 4Z76A 1MHHA 4L3CB 4X5LA 4DEPB 1SYSA 5JOPE 2DQGH 4TSBL 4ZXBB 1QVOA 1IAKB 4RQQA 3VI4F 2P8LB 1A6WH 2XKSA 4FFVC 3VI4E 2RB8A 4WI4A 4N68A 1KNOA 1JHKH 3G5ZA 4X0KA 2BRRL 5J9PA 2IH1B 3WFBH 3O9WA 1K8IB 5KSBF 4UIMB 1YPZF 4TOYL 5KSBE 4FQ2L 1YPZE 2ICEB 5DD6B 3L95B 5EN2B 3MLWL 1JF5A 5HYEA 3D0LA 1DE4A 3RGHA 1S7TB 4KC3B 5DK2A 3TN0C 4K2UH 4X9FA 4ODHH 2DL9A 3NABL 2VDPL 3UTSA 1U58A 4ZPVA 5FDYA 2B4CC 3O2DH 3WEXB 5JQ6L 5L88H 3PGCA 32C2B 3C8KB 1UWEL 2LTQC 5DUPH 4HIEB 5EZOL 1UG9A 4LSVL 4NQDD 5HD8C 3PWJB 1UZ8A 3EYUL 4NZUH 1E4XI 3L5IA 4ZTPH 4ZYKA 4JHAH 2YEZB 1VGKB 3VXRA 2ARJQ 4ZAKA 5JW5B 4I18C 2LQRA 1NDMB 1PYWB 1OAZL 3EYQD 4PJGA 2ZUQB 4B53A 3DWTA 5D2LA 1KCVL 1L0QA 1TVHA 2Q8AL 2JLLA 1A1MA 3UJTL 4CRPA 4Y5XB 2MHAB 5A3ID 4Y1AE 3QUMA 3VGHA 1Q9KB 5DJCB 3WS6C 1KGCD 3A6CH 4YNYB 1FZKB 2W9EH 1SQ2N 5HGBB 2G5BB 4OM1L 4DAGL 3JVGA 4WU7A 2NXZC 1WJ3A 5F7LB 4EDWH 1NLBH 1B4JH 3QIWA 4D2NA 5F7DA 4MDJA 1EEZA 4V1DE 5CKAA 3QUZD 3DMMC 3QCTL 5SWZB 4AM0A 1T7WA 3ZYIA 4OTXH 5H94B 3ESUF 3VFTA 5GZOC 3ARDD 4L8SC 2AKRB 5LXGL 4KJQC 3D0VB 1ORSA 1CGWA 5CBAB 12E8L 3QQNA 1NBVH 4IRJA 3QWQB 3FQNA 1CN4A 5FUCE 5JUEL 4OFVA 5SWSE 4IHOB 4ONHB 5GJTL 1S7UA 1MJ7L 2EDKA 2WLYA 4G8FB 4R3SB 2NXYC 1UKSA 3MV7B 5KSAD 5ACMA 2NTFA 5EIIB 2C1PA 1CG9A 1I9RL 3IXTA 2V9QA 4XC3H 4G9DA 3ZDYF 3MUJA 3VGGA 2HYMA 4DK6A 4WW2A 1H15A 3ZDYE 2ADFH 3MLXH 1RZGA 2X4NB 4OKVB 3MV9E 5ISZE 4X4XB 3B83A 4JQIH 2BSRA 3MBXL 3FN3A 3K4ZA 5DQDH 5D1XA 3NA9L 3BZ4A 3K1KC 5MEOA 2WWKT 1PX4A 4HWBH 4N0UA 3GO1L 3ISWA 3VCLA 5D8JH 5DRWB 3EUUA 4TN9A 1CFNB 4U1MB 3FAWA 2W0LA 1LDPL 3BEVA 3CC5A 4IRSB 5IB2A 5IB3A 5GIRA 3T0ED 1DEEA 2R1XA 1KB9K 1FE8L 3IF1A 4UUJA 5I1IL 2DDQH 1YMMD 3CX5K 1FZOB 4NO0B 1UZ6E 5D2NE 4E5XA 3CFJB 5HHOB 4FRWA 2A0LD 4OV5A 4M5YH 3RNKB 4PP1C 3U9UB 3VWKA 1QRNB 1S5IH 4KY1L 3R0MA 3W39B 5I15L 3GI9L 4L3EE 1I7ZA 2ADIB 5B38G 4J3XA 2XG5A 5J4MA 4JRXB 4POYA 4ODXB 3RVVD 3KXFE 4NKIH 4G5ZH 1EBPA 4NM8H 2BDNH 3QFJA 4WTZG 5JMRA 4JFPA 4KTDL 1MPAH 4JG1L 4LVOC 1ZOXA 3HZYA 1KENL 3MBEA 3NZHL 5GXBB 3CH8A 5E8OA 3SDCB 3O3EB 3FQXA 1BWMA 1F11B 1ZVSB 2IAMC 4HS8H 4H1LH 4U0RC 3O4LD 2MFNA 2ATKB 1ND0A 4UQ3A 5D5MB 3LB6D 3DX8B 3EDFA 4NFBA 4Y8AA 2E27H 3B4NA 4I9WD 4QRPE 4YGVA 4I2XE 3LD8C 2XA3A 3I6KA 5E70A 2HG5A 2QHLA 5C0EA 2IPKA 3VGEA 4N0FA 1CGUA 1KUMA 3VXSE 2Q6WA 4E41B 1XEDA 2V2TB 4ODVH 5JLZA 1Z9LA 4HWEL 4YUEL 3DSFL 4FFVD 3WFCL 3QIUB 4BZ2L 3CK0L 4M1DL 3I6LD 3SDDB 4F7CA 4LKCB 1D9KA 4QXTB 2HKHL 4IJ3C 5HYSG 3VFRB 3CXHK 2I60H 4GAYB 5I1CL 2Y06L 4MWFB 5DEFB 3TN0D 5T1LA 5EUOF 2H2PC 1NL0H 3MJ9H 4Y2DA 3VXUB 5BVPH 4G8GA 1RZ7H 3RJQB 4YHIB 3EYOA 1AQKH 1IM3A 5EC2A 2VXVL 3UYRH 1BLNB 2LE9A 4BQ9A 2MNUA 3MRHA 3IFLH 4HS6A 1I9IL 2OS7A 2X6MA 4GRMA 1TZGH 2FD6L 2X1WL 1JF1A 4X4YB 3BE1H 4DOHE 3S5LB 1X6LA 3MV8D 3PWLB 2WWKO 2XQYG 3TH4T 3WFDL 4PRID 3ARSA 5IT2H 5HD8D 1R3JB 2FGWH 4AEEA 1OB1A 2PYFA 3U82B 3GSNA 3QIBC 1ZA6B 2HVJB 5FYJL 2CDGB 4P2CG 4BFIB 3DX6A 1UH3A 4HK3J 4PRHB 3BI9X 3WN5B 4XPAH 3ZTNL 4ZO9A 5ADOH 2B4CH 1FJ1B 3EGSA 4Q0XH 3ES6B 4M03A 1PKQA 2BVTA 4OAWB 3TA3C 4G8EA 2V9RA 4WCYH 1M7DB 1N2RA 3HS0B 5CIPA 5LGJB 1L4IA 2V7NB 4RMVA 4YDIH 2NXZD 2BOCB 1PFCA 2CLRA 4NQTA 2YN5A 4GUPB 3K2UL 1MJJB 1YEGL 1EFXD 5IB4A 4MMXC 4NO3B 1S9VB 3UPAA 4QOKB 3RIAF 3HUJA 1A21A 3DMMD 1J88A 3RTQC 1BM3L 4PRPA 2X2YA 4XAWL 2Y5TA 2R2EA 3PHQB 4F7PB 1I8IB 1LDSA 4O2CA 3N85H 5GZOD 1OSZA 4LLYA 4KJQD 4ZUSB 1UKTA 3TBWB 3LZFH 2ZG2A 4MNQA 3L9RB 1IAII 2VUYA 5E5RB 1AXSA 3S3SA 2FX9H 1RZFH 2YD2A 3VXQA 1CICC 2ADGA 1KCUH 2H8PA 2NXYD 3GSRB 3QNYA 4BZYA 5CEXA 2P8MA 3FB5A 4JFEE 3I75B 5L2KA 4RBPK 5CHNA 1AGDA 4YLQT 4HIJA 4JZNB 4JRYE 4BZ1L 1BQLL 2PUQT 1UM5H 2K9UA 3O3BA 2ZUYA 2NW3B 3ILPB 3BRFA 3MRBB 2CRZA 4CDGC 2VLRE 1SY6H 3BP7B 3HR5A 5DHYA 3C6LC 4Z0XB 1DSFH 1ZHLA 2A6JA 3MFFA 5E9DE 4WO4B 1E4KA 4PYGA 3KYNA 1VSCA 1FVDA 4LOUC 4LPYA 4P9ML 3UDWA 1XF1A 4HC1H 4WEBH 1ZAGA 3BDYH 1N7MH 3U0TB 2YA2A 5CJQH 2V7HB 5INCA 2W0FA 2F74A 3CLFH 5TE7L 1CDJA 4QRUA 2X7LA 4HG4K 3CMOL 3MV01 3QG7H 2WIMA 1KN4H 2G5RA 2EICA 1QFWL 4PBXA 3RJDA 5HDBF 4PP1D 5EBLA 5HDBE 4YO0B 5M94B 1F6LL 5D93B 4MDIA 1V8HA 3QHZL 2R0LH 1MI5A 2MPAH 3LKOA 1SEBA 2J7LA 3O6FA 1U36A 3ZE0F 1W8OA 1XGUA 1S7VB 2F19L 5DSCA 1J1OH 3ZE0E 2RHEA 1BD2D 5KN5A 3H9ZA 1NFIB 2R4SL 3NTCH 1KYOK 1PDKA 5J6GA 2AXHA 5ICZB 4PJ5A 3CUPB 3DI3B 3MYJB 1Q1JL 4XTRC 4HZLB 4YX2L 5KG9B 4LARL 1XGTB 2O61B 1U93B 3IAPA 3OJVC 4FP8H 4PJCF 4K8RL 1M7XA 3TFKC 4KI5C 2BOBA 4QT5B 4JE4B 4PJCE 2XZAH 4HLJA 5EO1B 4YHPA 4NO5B 3ARXA 4KK9C 4C4KO 3GHBL 2AJSH 3QNZA 3DX7B 1LE9A 1AIFA 1A2YA 5TFSL 4R0LC 1BZ7A 3U83A 2VXTL 3DYMA 4LSUL 3IKCA 1PZ5B 5BZWA 2KPNA 4KVNL 5T5NF 2VH5L 1QLRA 3FN9A 1OARH 4HKJB 3VE0B 2YUWA 2R9HC 1FHGA 1T5XB 4X80H 1IBGL 5GGTA 1YY8B 4LCWA 5ESVB 2VABA 3H7BA 1ZKAA 1S5HB 1RULL 3OAUL 5TQ0L 1I7UA 1IGMH 3OKEB 4KHXL 4WY7L 1CR9L 3KLAB 5K59E 3SCMA 1D5XA 3LPWA 2B5IB 2PYED 4ZPTA 1RMFL 1I8LA 3SJVA 1BX2B 5C0RH 5JOEA 2H2PD 2IPUG 4M48L 3DXAE 3TEUA 3QPXH 1X5JA 1IJ9A 1RV6X 2APFA 2VTFA 4Y16C 4YC2B 5FYJU 5DJYB 3AB0B 1HCFX 2X4QB 1MFBL 1FYHB 2VDQL 3QPQC 1AC0A 5FO7B 5C6WH 2PETA 1D5IH 3V2AR 4O5LH 1I1YB 3HRZB 1JYNA 3GBNL 2HT2C 4HZAA 3QIBD 4TRPL 3LS4L 2XPGB 4JM2B 5MI0B 3DBXB 1DDHB 3H2WA 3S34L 5DQJA 1U8IB 1MJ8H 4XAKE 2QR0B 4G6ML 5DEGB 4KUCD 2VZVA 5C7XH 3PL6A 2Z92B 3SDXB 1P53A 3VJ6A 1ZGLP 4P2OA 4PLKC 2YPLE 4NQVB 5AZ2L 4DGIH 1KTDA 2DICA 5EBGA 1IQWH 1MHEB 3IFNL 4PJIA 3TA3D 1ITBB 4NRXA 1FFPB 3HC0B 3KG5A 2KQMA 3PABB 4M7KH 4NZJA 3CFIC 2OI9C 1DQQB 3V5HB 5IWLA 4FTVA 5C0FB 4NDMA 5J12B 5KVEL 3LKQB 3GJEB 3RTQD 1BVKB 1DFBH 3BPLB 4PJHF 4L29B 4NKQB 1AQDA 1V3KA 3QH3B 4UQ2A 1GCFA 3W0WB 1ZHKB 2ZPKH 5EIVA 3G6AA 2FEDC 3DGGB 4S1SH 1NC4A 4M1GH 4PJBF 4YDKL 2NX5E 3RWFA 1G7MA 4PJBE 2ZP0T 2X9WA 5E7FA 3QYCA 2BNUA 1P4LA 5TDOB 4O00A 3HLAA 1CICD 5FYLD 3CH1B 5EBMB 1I85A 5DJ8A 2F5AH 3QWOA 4OF8A 5F96L 1HXYB 1RY7B 1JYXA 3MRDA 4YDLB 3EO0A 5D1QB 2COQA 2DIBA 1NMCB 2ZUVA 2E7CA 3CDCA 4X7EC 3PXJA 3K7UA 1AGEA 3HAEH 4K23H 5J11B 1BOYA 1CXLA 4HWZB 1MREH 2IG2L 4FQCL 2BNQE 2WUBL 4JFZH 4QRQA 4Y2OA 3HI1B 3O6KH 1EXUB 3C6LD 3KPMA 1I9JH 2YPVL 1REIA 1CZ8H 1FVEA 1P84K 5FYLH 2GITA 3LMJL 2WP3T 4JFDA 4Z95L 4WHTB 4L1DA 3KHOA 4Y89A 5DUMH 3OBAA 4DVBB 4LOUD 4JFYA 4NYLB 4OCRH 3LKRA 4JHWH 1R3KA 3HC3L 1J1PH 3EJJX 2CLZA 2LFGA 4NBYB 5DRXA 5DR5H 5EA0L 2J12B 3OF6A 1NEZA 3UJIL 5E1AB 4AT6A 3G5VB 2BC4B 1B0GA 3NPSC 5IHBA 4UV7H 4PY7B 3E3QE 4ZOBA 1EEYB 2FX7H 2XOTA 4X7TA 5H37H 5C0BD 1AI1H 3QXWA 4LIQH 5B38A 1BFVH 3TYFB 1IARB 4EXPX 3QA3A 4EBQL 4XP9H 3R8BB 3BGAA 5IROA 3MRPB 2A6IB 4HT1L 1ACYH 4XXCA 4WFHE 5JPMA 1C7SA 1P1ZB 4ZFZA 2VN4A 4HUNB 4YHMH 3ZYJA 1TFHA 4ZSOB 2OMBA 4LHUG 3HG1D 2E6JA 4RGMC 1P2CB 4XTRD 3T0XA 3QDJB 3GSQA 3GGWB 2OSLA 1BF2A 1KULA 3V4PL 3TFKD 4KI5D 1HEZB 1HHHA 4NRZB 3RHWF 1UQSB 3IDGB 5C9KA 3RVUC 3TO4C 4LLAA 4F37F 1FL5B 2UZYB 3LPGA 3RWDB 1NCWH 1P7QA 4XPFL 4KK9D 2DF3A 4NZDA 3T0WA 3QEQE 1H0DB 3A6BH 1NAKH 4FNLL 1RK0A 3BPNB 3Q1SL 3WJLA 3P4OB 5DZOA 4ALAH 2UY7A 5T5FL 3RA7H 4RMTA 2R9HD 4APQC 1GZQA 4Q7DA 5FHBL 2DIJA 2WW8A 1I4FA 4HJJH 2GQHA 4X6CA 5E2WH 3P11L 5HYSA 1F6FB 5I1JL 3IDXH 4ZUWB 3TIEB 4WUUE 5E2VL 1IC7H 4Z0BH 2EE3A 3BZFA 2XTLA 4G7VH 4DK3A 1A6ZA 1EV2E 1MVUB 3G6JB 1KEGH 1MFEH 4Y16D 3ZKXC 5FCUL 4Z7WF 3RL2A 5HY9B 4Z7WE 2ICES 4WJ5B 4L3AA 2AJXL 2HFTA 3QPQD 4FXGB 5TQ2L 1YEJL 1T0MA 5C0JA 4WFFE 5EPMB 4ETYA 3DV6A 5E5UB 3CZJA 4U1KA 2OL3A 5F7NC 1N26A 2HT2D 1DN0B 1K9TA 5TPWL 3AXLA 4NWUL 4NQEB 1XF2B 2B0SL 5SX5K 4WWKB 2UUDK 4OZHF 4X7DC 1LNUB 3BEWA 5DGRA 2JCCB 4HGKC 4OZHE 4Y5YB 2DQFA 5F1SA 1JZ7A 1YYLL 3T77A 1FZMB 1U8PB 5D7KD 3MRRB 3L3JB 4MSWA 1E6OL 3PP4H 4TSAL 1N3NA 4NBXB 3UZEA 4AL8H 4PLKD 2NY0C 4D9RD 1BQHA 1NGWA 3OWEA 2E7BA 2XN9B 4EOWL 5GS0C 1CU4L 3QXAA 1UEMA 5EU6D 1A47A 4X6EB 2JB6A 4OZGF 4DUVA 1E4JA 2AK4A 1FV1B 4XPHH 2J6EL 4HUXA 3LEXA 4H26B 4OIIH 4OZGE 4RISL 4XNMB 1RZKH 4HF5H 1PEZA 2JJSA 4GXVL 1UYWH 1YYMH 4Z7VF 5CUSH 1T04A 2ZG3A 1CE1H 4Z7VE 4DEPC 3DVNB 3U30B 2VLJE 1QSEA 4ZXBC 8FABA 3MR9B 5IV2A 2FEDD 3MROB 4P99A 4PJ9A 4NP4H 3QQ3A 4PD4J 3BISA 3RNQA 3E6FA 1W0YT 4QO1A 3NIDF 1QZ1A 3UTOA 2VQ1B 2FJHB 2P7TA 3FZUC 1DZBA 5IB5A 5IIEA 1QA9B 3PV6B 4HUKB 1IEAB 1J18A 3IETA 4NJ9L 4BM7A 4UT6H 2IBBA 3F58H 3S35X 5C09E 5AYUL 4JFQB 4XNUH 5D72L 1T1YA 2GT9A 3ME0A 5C8JA 1NEUA 3GRWA 4BSJA 4XNYH 1BBJB 1TVBA 4N0CC 5F8RC 5TH2B 2OR7A 4OLXH 2AW2A 1M7IB 3PQYD 3WLBB 2DQEH 2EDNA 2OJEB 2EKJA 1HILA 3R06A 1X6NA 2FO1A 2E3VA 3C8HA 5EO9B 1EA9C 4CDHA 1A3RH 3KR3L 3VFOB 3LKSB 1A3LL 3MLRH 2DKMA 4PJDF 5F9JB 1A1NB 4JKPL 1D5ZA 4PJDE 5F44A 3P0YL 3T4AB 5KSVB 2ZUQC 5EU7C 2J1KA 3MPCA 5I8EA 1DUYB 3O11B 2HH0L 2J88L 4CMMA 1YPZB 4AG4L 3FOLA 2VAAA 1N0LA 2PO6B 4Y5XC 4PJ8B 1CI5A 5IM7B 2D0FA 2EEBA 3ZMRA 2P5WB 1OSPL 2Q86A 4LDEB 4YZFF 4YZFE 2HRPL 4G7YH 3SKOB 4P3DB 32C2A 4MJ5B 5FKAB 2GTWA 3QI9B 4PRDA 3GUTB 1JP5A 1QFWM 5I76B 2HJLA 2BVQB 1WWAX 2PR4L 3V6ZB 1IKFL 1ZEAL 2J8UA 4JPWH 3VWJB 3Q6GH 2KL6A 5BW7C 1ZXQA 2DWDB 2X89A 1CFSA 4D0CA 5ADPL 4HIHA 4P5MB 1MCFA 4S0TD 1T03L 1TJHH 4CGTA 1IQDA 5DJCA 5GRUH 1NGPL 2A9NH 4Y1AB 1W72B 3EO9L 3W9DB 3RVUD 3TO4D 4AZ8A 3TESA 1IKNC 4Y4HB 5FGSA 5I1KL 3ZHKA 4FN0A 3RWEA 2CGRL 4LKXB 5E2UH 2FLBT 4M6OH 3ECBA 4IMKA 5IJKA 3JZ7A 4BFGA 4V1DB 1GSMA 3SDYH 4LSRL 3QHTC 4APQD 1LEKA 5MENE 4M8QA 1OGAD 4M93B 3MUZ1 3V79C 1ZT1B 2EYRB 2VLKD 5D7JB 1G0YR 1PQZA 2VZ3A 3MUGB 2YBRB 3JTSB 3ALPA 2H32H 1HQRA 2AV7A 2C7UB 5KS9F 1IC1A 1WF5A 3D85A 1EHLH 5KS9E 3D39D 3K4DA 3L7FB 4O51B 3ULSA 2OK0L 4X98B 3LHPL 3NAAL 1FNLA 4OCLC 5SWSB 4OCMC 2AK1L 3BRGC 1EEUA 1LEIB 2VO5A 4IRSC 4GS7B 3EOAB 3U7WH 3UZVB 3NCMA 1RZ8A 3MRNB 1MRFH 5T1MB 4JO2H 3STZA 5DURD 4A2MA 4GMTL 2AXGB 2X4SB 3H0TA 3VDBA 5JO5B 1G7HA 4F58L 3ARBB 4QHLA 2E8YA 4K3GA 4X4XA 4ZOAA 5ISZB 3UTZA 1JGEA 2MQ3A 1EO5A 1NBYA 5F7HA 1XGPB 1F4WL 4Q9RH 1H5BB 4XCCL 4RNRB 3B9AA 1RHFA 5DYOB 3BMVA 1CT8B 1HHKB 3C5JB 2QQQA 4DZ8A 2NY0D 5C0GB 4MAUH 1KCRL 3HI6L 3SDCC 1P6FA 2BCKB 2FNBA 5GGUB 3MCG1 5GS0D 4CADA 2EYSA 1DTUA 1OTTC 4M3JA 2C26A 1KLGA 4IMLA 4NRYA 5JHLL 3K3QA 2A6KB 5D2NB 3AREB 4XVJH 3TVMB 5E24E 4Y19A 1WC7B 3W39A 3BO8B 4LSQH 1C5DA 3PP3K 3MLVH 4PRNA 4HXAL 3OG4B 2Q87A 3SHSA 1GJIA 1BBDL 1HIML 2EDRA 5DMIH 5ICXA 5GS0H 3KXFB 4U1LB 5DD5L 3RBSA 4WGVB 3QIUC 1MAKA 4Y88A 4TVPE 3SDDC 2EE6A 1A6UH 4L4VB 1UACL 3MACL 4JANA 1T89C 3FZUD 4OZFB 5E8EA 5IKCA 2ATKA 2DKSA 4U6YB 3DVGB 5D5MA 4H1LA 4OLZH 2H3NB 4TSCL 4WWID 1P9MC 4S1QL 4KI1A 2BSTB 2WQ8A 2WBJB 4N0CD 3RI5K 4HUUA 4AEFA 5I1HL 4I2XB 4X99B 4PTUB 4RX4D 4G9FA 4KPHH 3HN3A 1W0WA 3P3YA 3VXSB 4DVRH 5E5MA 4XH2B 2AXFB 4MX7A 3VXRE 4ESKA 5D2LF 1R0AH 2UZXB 1NCDH 4L4TA 5D2LE 4KMLB 3ZKQD 3QO0A 3O4LA 1N59A 3H42H 1YNTB 4WHYH 5HDQH 1EO8H 3WE6B 2FO4B 4IDJL 1MCJA 1YEHL 2EXYC 3G6DL 4KROB 5ESAB 5E8PB 4M61A 3WIHL 1QHOA 5J89A 3WN5C 2VZTA 3P0GB 3BP6A 2CKBL 4R26H 3PGFL 4H0IA 4YHKL 4MAYB 2IGFL 5L2JA 1FP5A 4HQQH 2EZ0C 3SPVA 1AGBB 1NCTA 1CTNA 2V5RA 4HWNA 5BZDB 4NO2B 1XF4B 4GLRH 3L5WB 5FA3A 2ZNWA 3L1OH 2IMNA 3EAKA 4HPOH 4KJYB 1YQVL 5KVGH 3FAXA 4F57H 2IFFH 1FNSH 5SWZD 5CCKL 2NLJB 3E1F1 1QBML 3MJ8B 5SX4I 4LHUA 2PNDA 5C0AA 4K3DL 2V5MA 1Y18B 4LCYA 3BWAA 2CDGA 5HYQA 1S3KH 3FONB 3H9YA 5JHDB 4QRRB 5J8OA 3KJ6H 4M43L 3M1BB 4PG2A 1ZTXL 2A9MH 1G9NC 3MLSL 3MV11 1OWWA 4BSWA 3V4UL 2F8VA 4YFDB 1GHFL 2PW2B 1FQ9C 5DVOA 3EJZC 5AWNL 3BSZH 5LGKA 1SVCP 1F4YL 4MJIB 4WW2F 3MV7D 4I3SH 3OZ9L 1JVKA 2AQ3A 3F7RA 2XY1A 2BRQA 3MOBH 2F5BH 3IGAA 1F6AA 5JA9A 4PJAA 1JGVL 2Y72A 1DQTA 4YHYC 2O5ZH 4F7PA 1I8IA 1ZK9A 4NNYB 2IANA 4QTIL 1JNHB 4HEPG 3R1GH 3NPZB 3C08H 3S98A 3IRPX 2YZ1A 1LO4L 4WO4C 3GHEH 4LLDA 1AR2A 3GMNB 4Q9QH 4G3YH 5IB1A 5L8JB 2I9TA 2VZUA 4OSUH 4P3CH 1T83A 3BHBB 4UTBH 3WXVH 4K7PY 15C8L 5DT1L 3O2WL 5DFWH 4IRSD 5DJDB 2DQIL 1DQDH 1TZHA 3I02B 4P23B 4HUMB 3LVEA 1FN4A 4NO0D 4JRYB 3INUL 1MCIA 3OX8A 4QHUB 4OZIA 2X5PA 1KT2A 3QFJE 1HHGA 1TJIH 3MRJA 1P4BL 2BRRH 3B8SA 2GEEA 1KIQB 2VLRB 2M26A 5D93C 3BP5B 1SY6A 4U6VH 3CZFA 4JRXD 3IFPA 3SGJC 4TOYH 4OCSL 2AJZB 3RL1A 4LPWA 3RIAK 5CEZL 2ZOLB 3MLWH 4UIKL 4MJ6B 3L3HB 4B7IA 3NVQA 2R4RL 1ZWIB 1INDH 3SDCD 2UYLB 2W9DL 5DA4A 3NABH 3KAAA 3P4LA 1QACA 2VDPH 5C9JA 2CR3A 1U92A 4I13B 4BUHA 3SKNB 5F89A 3RDTB 1OTTD 4YR6B 5FK9B 5GS1B 1GOHA 4O02L 5JQ6H 1XIWB 3FO2B 1UWEH 2LABA 2XZQL 4WRLA 5J1AB 4MNHA 4PB9L 5C0DB 5E6ZA 4LSVH 2YUZA 1D3CA 2KQNA 1HINH 1A1OA 3EYUH 2X1PA 2ZSVB 1X5ZA 1XR8B 1LE5A 4E41D 4Z78A 5IMKA 2D9QB 2EE2A 3PNWB 4DFIA 4XPGL 5E94B 2Q8AH 3O8XA 1VFBB 3QIUD 1FG2B 4JVUA 1CQYA 3SDDD 4OGYH 4UAOB 5EZJA 4Z77A 2Z31B 2XNAA 4G8GE 1AH1A 3VW3H 5JPNB 4NPYA 1HSBA 4KKLC 1INEL 3TBSA 4HZLA 5EOTB 5FYKL 1I7RB 1JN6A 1IILE 4LEXL 3HMXL 5E00A 4HFUH 2K7PA 1K2DA 3VXUD 2G60L 2NYYC 1T22A 1A6AB 1T1XA 4NZRH 4FA8A 4JHBA 4YC2C 3AB0C 1AGCA 3LIZL 3VMNA 3MLYL 5E99L 3L3KB 3UTTE 5LXGH 3TNMA 1KJ2L 1T5XA 2RCSL 2NY1B 1UJ3B 4Y8DC 5FO8A 2IQ9L 5MI0C 5GRVL 1PKQE 2EXYD 5GJTH 2AJ3B 1TTGA 1C5BL 4PRHD 2R69L 4KXZI 3IDNA 4QWWC 5IBTL 2GJ6A 2DB8A 2RFXB 2EZ0D 4GW4B 4NUJB 4LDLB 1RVFH 3DI2B 2R2BB 2KZ1B 3HUJE 4EVNB 1MCQA 3T65A 4PRPE 5AEAA 1CDUA 1GC1C 1EHNA 2O93L 2Z35B 1KPRB 5I18H 1E6JL 3MBXH 5FO7A 1N8ZB 5HGGS 1WBXB 5J12C 4KUCF 3NA9H 4QOKD 1G9MC 2IBZY 5MP6L 4DTGL 1WCBB 1J1XH 3BDBA 1SYVA 3CVIL 4ORGB 3GO1H 1UA6L 1RU9L 4P59L 3FHQA 2QQNL 2PYEA 5CEYA 1DDHA 4RBPH 3JV0A 3QDGA 1U3ZA 1G6RB 1Z9SA 3VFWA 4JB9H 1D5BB 4MD5A 2ARJA 5CSZA 1YMHB 1K5NB 4RWYL 4N90E 4MCZA 4PGJA 4CJ1A 5I1IH 4RA0C 5L2KE 4ELMF 1FFQA 1CLZL 4OFDA 4ELME 3EJZD 5DO2C 4U6HA 3RGVA 5DLML 3MRKA 3OSKA 3MXVL 4KY1H 4YDLC 5D1QC 3GI9H 1I1AA 1IGCL 1NMCC 3S9DB 3NN8B 2NW2B 2NY7H 3OR6B 1U8QB 4WV1C 3B3IA 4V2CB 2OBGA 3IJYB 4XC1H 4L8DA 3WXWL 3RWHB 3MMEB 4KTDH 1MCDA 3VU2A 4JG1H 4DUWA 1G9NH 2FEEI 1FIEA 3VFMA 1F3JA 1KENH 3DUSA 3NZHH 5I66B 2C3GA 1KJVA 3OKLB 3W0WA 2W65A 3AAZB 4OIBA 3V5KA 5JR1L 2NY6B 3C60A 4WO4D 4FQQB 4ZS7L 5DD3L 5T1DL 3REVB 4RAUB 4M7JL 1ZA3A 2NX5B 5DRNA 3PHOA 4HK0A 3UYPA 5JIIA 4C56A 5D6DC 1N6UA 3OJDB 1XR9A 4K3JL 2VIRA 1NMAL 1UWGL 1RK1A 2GAZB 4OZFG 1G7IA 2VRAA 4KTEL 1N0XL 1HXYA 3N0PB 4HIXL 1BAFH 3JUYA 1LP9B 4MCYA 2Z91A 2MCPH 3PV7A 1WT5C 1AP2B 5FO9A 3TWCH 3WFCH 2AJUH 4BZ2H 1VACB 3CK0H 2EH8H 4M1DH 5F6HI 1MWAL 1WTLA 1LO0L 1HDMA 4ZDHA 5JDSA 3WNKA 4Y7MA 5JW4N 1DBBL 2F58L 5CBEA 5IFJB 3QHFL 5EZIL 4KTYA 3MLZH 1KJ2B 2GCYA 5C70A 3V6FB 5JXAH 1DBAL 3B9KB 2KDGA 5DK3A 1G1YA 2XTJC 2HN7B 4P2QA 1TZIA 1NGZB 1J8HA 1IMHC 3IYLW 2CKNA 5CZVL 3QQ4B 2JIXA 5T3ZD 2BERA 4OQ1A 3EOBB 4Z7UF 2Z93A 2V6HA 4Z7UE 1NFKA 5HHXL 4G42A 4MHHG 3E0GA 4LCWE 5FYKU 1ZVYA 3NH7L 3GSXB 5FYJH 2DQGL 1P5UA 4O9HL 3ROLB 1YC8A 3AC0A 3VFGH 3ZTNH 1A6WL 1RZJC 1N6VA 2DM7A 1JHKL 4DZBA 1CFBA 3MLUL 5T3ZH 3WFBL 2CO7B 4LRIC 4U1NB 3D1MC 4A6YB 3NCYS 3X12B 4KKLD 1M05A 5F21B 4YXKH 1ZHBB 1DVFB 5D9SA 1QBAA 1YEGH 3IDGA 4JHZA 1S9YB 1J11A 4BELD 2WINB 2NYYD 4ODHL 3RWDA 3LSOA 5JIKA 4XAWH 1WZKA 4URTB 3QEQB 3ARGB 3O2DL 1IAIL 3DO7A 1OTSC 4QNPF 3MRLB 5DUPL 4Q6YA 4J1UA 5DJ0B 4QNPE 1RUKH 3ZE1F 5KBNC 2OM5A 2ZKHL 3ZE1E 3V4VL 3E2HC 3O3DB 1MCWM 3ILQD 4NZUL 2OXGA 2XV6B 4JHAL 3MX0A 5I75B 1BVLB 2BHUA 4WWKC 4PJIF 5I8CB 5HHVH 4WDIB 2QHRL 2VZOA 4PJIE 4Y5YC 1RIVH 4XXDA 1NAMA 2FJFA 4QWWD 5CWSB 1NDGB 4GAFB 2ZOKA 4BZ1H 1LEGB 1BQLH 4U3HA 1RFDL 4FTVE 5ALCL 3A6CL 3L3OB 4PJXA 4BH7B 1T5WA 5FB8B 5HYJB 5GRJH 3KYMA 3VFPA 4KQ3H 1VEMA 3GMPA 3KYAA 5HY9A 3DX9B 4S11A 2YRLA 2BVUA 2JJVA 1Z6JT 4H5SA 4OGAC 3RHWK 43CAB 5T3XE 1B6UA 1D6EB 5SWQB 4X9BA 1IEHA 4CVWA 4J3TA 4Z7OE 1U8LA 4ODTL 1A8JH 5D7KE 5J6HB 3U30C 2X09A 3LQAC 4OTXL 2DJUA 1GRWA 3P9LB 4GAJL 4POZC 4KUZL 4LVHB 1OOAA 4EN3B 2F53B 2W1NA 4P0DA 4OZHB 3K4AA 5ITFB 4HBQA 2WWMC 5DMGC 5FHAH 3ULUE 1JHTA 4LHQB 1OM3H 5TE7H 1NBVL 4MXWH 4LEOA 4N5EC 4R2GB 5DO2D 1A0QH 3FQWB 3SKJH 1IEBA 1U8JA 1HN1A 3GMQA 3NFNA 3MC0A 1AO7D 1HHJB 2IF7A 5D1QD 4XNMA 1K85A 1GPOL 3ZT5A 1UWXK 2A38A 4PLOB 5B39B 3QUYB 3KPNA 5K9QG 4K7PX 2F19H 4G6FD 7FABH 5EU4A 1YJDL 4Z7VB 1T1ZA 4P5TB 1KLFA 4JQIL 5LAXB 4ZO8A 4QF1B 5DQDL 5MERA 3RWGB 4P4KA 4YX2H 1X4XA 4LARH 3M8OH 1R3IL 4LAQL 1BJ1J 1FORL 1A4KB 2DLGA 2O5YL 2VQ1A 3LKNA 5D8JL 1QA9A 2PN5A 4L4JA 2DTSA 3ESVF 3FT2B 3G9AB 3NFPB 1MIMH 1SJEA 4ETQB 2UWEA 1H8NA 3DTXB 4JPIA 4O4YL 3GHBH 1P7KA 2PO6C 5TFSH 4PR5B 1BBJA 1HKLH 2YWZA 1QO3B 4PJ8C 4EKXA 2ZNXA 5C0IB 2J4WL 1FCCA 2B1AH 3M17A 1TQBB 2VH5H 2ITCB 3WCYA 1FFOB 4QXGH 1IBGH 3F7PC 1Z9OA 1ZLUK 3QI9C 3HPJB 5I1LB 1YEFH 3OAUH 1ZGLM 5TQ0H 4NKIL 4OUUA 4G5ZL 4YXHL 3QXVA 4WY7H 2BDNL 1E28B 3M45A 1MPAL 3B9DA 1RMFH 1RJCA 3BUTA 4JY4A 3T4AA 3VWJC 5C2BL 4OFPA 2XTJD 2GJZB 4HS8L 4NKDB 2X1OA 3TPKA 5HHPA 3HNSL 3QDJD 5ENWA 1DQJA 5DVKA 2Y7QB 4FXKA 3I50H 2E27L 3HRPA 2WMPA 2P5WA 5IJVA 4Y4HC 5CMAB 3GBNH 1NKRA 3MOAL 1WFTA 3HNTH 4MA8H 4TRPH 3LS4H 4X6CF 3S34H 4YQXH 4ODVL 4X6CE 3S4SB 3P4MA 2BVQA 4G6MH 4MYWB 3FQRA 3QBTB 2HJFA 3BD3A 3R0NA 4NUGL 3CNKA 2NNAA 1JHLL 3L3GB 1UB5A 3L5JA 3K81A 4M93C 3KWWA 3QXDA 4PV8B 3HTLX 4M6NH 5F3HA 5D7JC 3GBML 3BGMA 1VKXA 4QKXB 2I60L 1PLGL 2NY5L 5FKPB 4HPYL 5FUCC 5SX5H 4GW1A 5BVPL 2ATPB 2UUDH 4AQ1B 1AQKL 4GS7C 3UYRL 2VLLA 4MJ4A 4LSPH 4K7FB 3QZWG 3MOQA 4N8VG 3VD3A 2DLEA 3IFLL 4WVRA 3VXNB 1OTSD 1TZGL 1R24B 2VLKE 3FN0L 2CIKA 5ID0A 1MVFA 4G6JL 5GGVH 2V2XB 1U8HB 2P4AB 4L8BB 3ARBC 3FOMA 1H3PL 5BJTB 4YDKH 1OLZA 3N50A 5JA8B 1A9BA 3AS2A 5DJXB 2UZIL 4AY0A 4BUGA 2ZSWA 3DIFB 5FFLA 5MENB 2LU3A 4NQED 5IK3B 1SJHA 4WWKD 3S97C 2P45B 3U46A 5A2KH 1H5BC 1BIIB 2HJKB 5F96H 2YXMA 4EI5B 1HSAB 4XPAL 2B4CL 2IBZX 5KS9B 2AK4E 2HAZA 2WBWB 2DOCA 4NKOA 4FQXB 4IIQB 4X6DA 4I3RL 4DW2L 2BSED 2VWEE 3U4EB 1R3HA 4WCYL 3Q6FA 2XN9D 4D8PB 4FQCH 4LPXA 1QQDA 2WUBH 3BH9A 2A73B 3UTQB 4YHNA 5AUMB 4B5EA 2X4PB 5TDNA 4YAQA 1AD9B 3EHBC 4GRLA 4OGAD 5FA4B 2YPVH 2XIDA 5D2NC 4YBLB 2CUIA 3C6SA 1MFDL 3AREC 4LCCA 3TVMC 1JTOA 5F1KC 1UEYA 3QDHA 1YEDB 4JY5L 1RI8A 1ADQA 1S9XA 4AK1A 2RQ8A 3N85L 2DIAA 3FQUB 3VH8B 4X5XA 4PJFA 3CCHB 4POZD 3BOVA 1EDQA 4NQCB 5EA0H 4RAHA 4U33A 2WWMD 5DMGD 1GGCH 4YE4H 4NNXA 1OGTB 4POUB 1YNKL 1FFNB 4N5ED 2FX9L 1FH5H 1R5WB 1RZFL 2HWZH 3JWDC 4HDIA 4Y4FA 4XP6L 3QUXB 1SMAA 2YC1A 1N6QH 1P7HL 1LK2A 2VL5B 2DLFH 4Z76B 2BMKA 1JRHI 3LQAH 1Z9MA 1MHHB 2L7UA 2WBJC 3WDJA 1NCCL 1NANH 1R3LA 3LH2L 1F45A 5EWIL 3TZVC 1UM5L 4HT1H 4HKBA 1QVOB 3MYZA 2KH2B 3T04D 2IADA 4RQQB 3BO8A 3LN9A 3HMWL 4OF0A 3V6OA 4ISVA 1KNOB 1VCAA 3G5ZB 4X0KB 5J9PB 4R90L 2GUOA 2R0WL 3O9WB 4M7ZC 5JOPD 4N9GA 2AJVH 3AMKA 2R8SL 1DSFL 3B2VL 4U3XA 1CGSL 4NCC2 4HAGA 3V4PH 1T20B 5CP7A 3D0LB 1DE4B 4KROC 2AEPL 4HC1L 4F9LA 4XPFH 4M5ZH 2XWJA 1N7ML 3UTSB 3TV3H 2PO6D 5CJQL 3RPKA 1U58B 4ZPVB 1FBIL 2CPCA 4FNLH 4MAYC 4JKKA 4PJ8D 5CLWA 4H0HB 3CLFL 3PGCB 4X99A 3Q1SH 4PTUA 5KTEL 3QG7L 1KN4L 5T5FH 3QNXA 1G84A 3IJSA 1OAQH 1UZ8B 2J8UF 4XH2A 1RAMA 1L6XA 4ZYKB 2J8UE 3QI9D 3QEHA 3VXRB 1UVQA 2R0LL 2AGJH 2VUOA 4ZAKB 2I26N 2MPAL 4PJGB 5DD1H 5D2LB 5I1JH 5I8OL 1TVHB 1YNTA 1UADC 1A1MB 3VWJD 1VEOA 3QUMB 3UAJC 2C3WA 5F88A 1MJUL 3DUUA 1LO2L 2FATH 5FCUH 1FAIL 3KYKL 4WU7B 4W81A 2VQTA 4FP8L 1AGBA 4Y1AD 3QIWB 2XWTA 3KPRA 2CXKA 2DQUL 4I0PA 1EEZB 4MDJB 4Y4HD 3UPRA 1XF4A 5LBSL 3L5WA 5SWZE 5D6CA 1OAYH 1IE5A 2AJSL 4EDXA 5DXWA 4AM0B 5K9JH 2B0SH 5JNYA 1KPVB 1T66C 4V1DD 2PF6A 4WI8A 2W9LA 3DROB 1ORSB 5DRZA 4YBQC 1H3WM 4MZ3A 2GK2A 4TSAH 2YRPA 4TTGA 4WI9A 3V7AG 1W72H 3T4YA 4IRJB 3FONA 3FQNB 5D7JD 1S7UB 1JZ6A 5J13B 2PXYA 2J6EH 2NTFB 1JMZA 2C1PB 2PW2A 5C0RL 1CG9B 5C3TA 5SWSD 4XVUC 4OCNC 3OKMB 3IXTB 5AAWA 3U0WH 4G9DB 5T1KA 3RUGA 3WLWC 3G08A 4WW2B 1H15B 4P23C 1BVZA 4HCRH 1RZGB 5FGBA 2BSRB 1FDLH 5F7EL 5D1XB 3ARBD 1AHWA 4O5LL 3GSOA 3BZ4B 1WIUA 5MEOB 1IAIM 1ZS8A 4HX1A 5B39G 1D6VH 1JNHA 4N0UB 2APWA 5ISZD 3F5WA 1YN6A 2FL5A 3JXAA 1Y0LA 4W4OC 3VCLB 5I6XB 3AU1A 4I5BA 3FMGL 5I71C 3WFEH 4JFHE 4J3UA 4NJ9H 1BWWA 4JFFA 1IKNA 3BEVB 3CC5B 2JK5A 5IB2B 5IB3B 5GIRB 1DEEB 2R1XB 5GGRA 3IF1B 4JREC 4UUJB 1NH6A 3PP3H 1F13A 4DGIL 1MLCA 5HHOE 4QCIA 1IQWL 4E5XB 3IVKA 3SGEI 4FG6C 1QRNE 1FVCA 5GGRY 4OV5B 5GS1C 3VWKB 5GISH 1F3RB 3EHBD 1XIWC 3UTPD 1I7ZB 4JRXE 4L1HA 5A1AA 3EOYG 3MSPA 3TJEH 4DKAA 3ARED 3TVMD 5E03A 1A5FL 4KWUA 2FZ3A 1DFBL 3QFJB 4JFPB 4ENEC 4GW5B 5A2JH 4JKPH 2E9WA 4FFWC 3MBEB 3P0YH 3MRQA 1JWUB 4ZUVA 2KZWA 3FQXB 2ZPKL 3BQUB 2ZOLA 5D5MF 1BJ8A 3KXFD 1NMBL 2C4FT 4S1SL 5D5ME 4I4WA 3UBXA 1ND0B 4UQ3B 3KLSA 1D7FA 4UAOC 4L4VD 4JQXC 4UDUB 2Z31C 2A6DA 4G9FE 4B0MM 4MMZC 3RDTA 3I6KB 4Y4KA 3MQIA 2HG5B 1G0DA 2EDLA 5C0EB 2IPKB 5D96B 2H1PL 2HRPH 2WBJD 3SE3C 4E41E 2Q6WB 4Z5RA 5HJ3A 4P48A 5C0DA 3TZVD 5JLZB 3FB8A 4L4TE 4K23L 5IEKA 3CXDL 4NC1E 1MRDH 1IKFH 3VXSD 3O6KL 3FT3A 1ZEAH 2DI8A 4RMWA 4GBXC 2Y6SC 4OZFH 3S3JA 1I9JL 1EUTA 1CZ8L 4OQTL 3JWDH 3QAZB 3WIIL 5FYLL 2NY3B 1D9KB 2W60A 5ADPH 1HK6A 2FIKA 4ODSL 1UJ3C 3S3PA 1T03H 5GGQL 3U79A 5INDA 4KROD 4JHWL 5T1LB 2XZCH 4F7TB 1J1PL 1L0YA 5JPNA 3F12A 4Y2DB 3U4BL 1OT1A 4G8GB 4AYFA 4GSDL 3PWUA 3EYOB 5FOBA 5I1KH 1IM3B 5EC2B 3EW3B 1INQA 3MRHB 5C07A 2NR6C 4MAYD 4UV7L 4HS6B 4HHAA 4GRMB 3SO3B 1IAOA 1V5JA 5E2TH 4ZFOL 1AI1L 4LSRH 4LIQL 2D03L 2MMXA 4HIIA 1BFVL 1OB1B 3QCUH 4OI7A 3CLEL 2BY0A 5C0AE 3GSNB 1Q9OB 4UI2A 4XP9L 1FO0A 1KELH 1MRCH 2CH8A 1JBJA 2VR9A 3GMLA 3DX6B 5M7QA 1KB9J 4U3CA 1XF5A 3EGSB 3IU3A 3S36X 4XWGL 3LHPH 3NAAH 2EIBA 3CDFA 1PKQB 1V3LA 5JHDD 3UAJD 4BSVA 2H26A 4QRRD 4G8EB 3SQOH 2ESVA 5ALBL 1N2RB 4XCEA 5CIPB 3HA0A 1JGDB 1HCVA 2CLRB 4GQ9H 1RUPL 3IDYB 4GMTH 2R2BA 1IZJA 4QOKE 3FCTA 5IB4B 4EVNA 4PP2A 2M1KA 1JF6A 4MJID 1Q94A 1J0HA 2BX5A 3HUJB 3QDAA 4PRPB 5H8DA 2C4FU 2Y5TB 2L7JA 2IANE 2R2EB 5DDHA 1N8ZA 1NAKL 1M6OB 4R97B 4O2CB 5GGTL 1F4WH 1OSZB 3TPUB 5E4EB 1T66D 4LLYB 5LQBL 5MHSD 3GMOA 4YBQD 4Q6IB 5IUSA 2EECA 1OP5K 2Z4QA 4MNQB 3MZTA 1KCRH 2V5YA 1G6RA 1AXSB 1JIBA 5F9DC 2NY6C 3VXQB 2ADGB 1YDPA 2H8PB 5IFHH 3QNYB 2NY4B 5CEXB 3IDXL 4GKZA 2HFEB 2P8MB 1TENA 3FB5B 4XHQA 1IC7L 5L2KB 5JHLH 4S10A 4Y5VA 3WDIA 5CHNB 1AGDB 1MQ8A 1J5OL 1TIUA 4XVUD 3O3BB 4M7LH 4G7VL 1B9ZA 3QZWA 3MJ7A 4N8VA 1BFTA 3WLWD 1KEGL 3QULA 1MFEL 5CJXA 1U3HA 4P23D 4PJEB 4HXAH 4H20H 5HSFA 3HR5B 1HIMH 4JRYD 5DHYB 3WUWA 2CIIA 5ITBL 3RWHA 1ZHLB 4NWTL 2A6JB 5DD5H 3MFFB 1CL7H 1YZZA 3KYNB 2ARWA 5JQHC 1U2HA 1UACH 2VLRD 3MACH 2OTPA 2R1WA 3CFBA 3HB3C 1MH5A 4XP5H 1Q0YH 2ZCKH 2IH3A 5E9DD 4P46A 1FPTL 4C57C 4QHKI 2P44B 1K6QH 2L4OA 2FB4H 4S1QH 5INCB 4PRBA 3PP4L 4AL8L 1B2WH 4WFEE 2W0FB 3B9KC 4DCQA 5IOPA 2F74B 5I1HH 5CD3A 4QRUB 2X7LB 2XZZA 5DZLA 3D2UA 5EC1A 4NCDA 4FG6D 3O6MH 1XIWD 3U9PL 5EBLB 2PTTA 1QBLH 4HV8B 3E3QC 5T3XL 1MI5B 4ZO7A 4HF5L 4NSKA 4TULH 4J4PC 5F9AC 3LKOB 5EOCH 1SEBB 3O6FB 1UYWL 1YYML 4ENED 1MSPA 1XGUB 3OPZL 5DSCB 4FFWD 1FC2D 4CU7A 1TNNA 4IDJH 3NFSH 4LAJH 3U2SA 3G6DH 3CPLA 5IFJA 3Q3GA 3BD4A 1F3DH 5J6GB 4NP4L 5JW4Q 1WZLA 4PJ5B 1PG7X 2CKBH 5IHLB 1IM9A 4L9LA 4XBPA 3PGFH 4YHKH 2Z31D 4NHUA 2BVEA 1K3IA 2BOBB 2FRGP 4UT6L 4YHPB 3F58L 1DVFC 3QNZB 3GB7A 1LE9B 1AIFB 1A2YB 1BZ7B 4XNYL 3FT4B 3EOBA 2QJDA 4UT9L 5TF0A 3IKCB 5LGHL 1GZPA 3D69B 4X7FC 1EAPA 2PKDA 4LPVA 4NM4H 5IW6A 1QLRB 5CCKH 2DQEL 2FR4A 1QBMH 3ARGC 4K3DH 4GBXD 2Y6SD 1IFHL 2APXA 2AP2A 5TDPA 2VABB 3H7BB 3RZCA 4X7CC 1ZTXH 2VR5A 1I7UB 1CD9B 1EGJA 3MLSH 3SCMB 3BKYH 1D5XB 2DYPD 4JPKL 4ZPTB 5I75C 4MB4A 4U1NA 3QDMA 3SJVB 3ZE2F 1GHFH 2WM0A 4WI2A 1F4YH 3HCVB 5LJYH 5J3HC 2EKSA 3IJHA 3DPBA 1OW0C 2NR6D 3QWRD 4DFHA 5F7WC 1T4KA 1H9VA 1L9MA 3DXAD 4JQVC 3DGCR 1AC6A 4MNGA 3TYGL 3ARFC 3PWPA 5HGHA 4JM2F 4KMQA 4G7YL 4JG0L 3B5TA 3H9SA 4J3WA 4YDVA 1LO4H 4KKAC 5DQJB 1Q9LA 3SDXF 4PLJC 1GVIA 3SDXE 3EYVA 4NJAH 5F70A 3VJ6B 3ALXA 1BVLA 5DS8A 4P2OB 4JPWL 3Q6GL 1KTDB 4UNUA 5DT1H 4FXLA 4LVHC 4EN3C 4AENA 1F58H 4PJIB 4NRXB 4XAKD 1ZLSL 2VE6A 3GSWA 2FSEA 1FG9C 3TH3T 4U6XA 1LEGA 4N0YH 1HH9A 5CZXC 1TJHL 4LDOB 4R2GC 2A9NL 3MA7A 3GI8H 4FTVB 1DCLA 4NDMB 4HMEA 1M71A 4HLZH 4CAGA 4O2EA 4QGYA 4R4BA 5E2UL 5IBUB 3W0WE 1AQDB 4UQ2B 4M6OL 2ICWA 5ILTL 1FRGH 1YEEH 3G6AB 1PSKL 3WNPA 1N5YH 3QUYC 3SDYL 1NC4B 2Q76A 2R4RH 1BZ9A 1QSZA 3IT8D 2XFXA 3RWFB 1G7MB 4YWGH 4XNXL 4P5TC 3K0WA 2W9DH 2BNUB 1P4LB 3S37X 2NY6D 3HLAB 1X5FA 1DBMH 3OAYK 5E8DL 3FFCA 3U0PA 4OLWH 5I1AA 2ZUUA 5DJ8B 5FDWA 3QWOB 2ICCA 1MHCA 1NUGA 2NX5D 1E4XH 3MRDB 1IGTA 2X1QA 4YHLL 3EO0B 3STLA 4PB9H 5K93A 3S7GA 1J0JA 2JE8A 3WJJC 2E9IA 1AGEB 1O7VA 2Q20A 4D94A 3VG0L 1OAXL 3U7WL 3CFEA 5CINL 4LCIL 4QRQB 3U48A 2I07A 4QHMA 1BECA 3KPMB 1FVEB 1TQBC 2GITB 4M4RA 4MHHI 4JFDB 1Z2KA 1T6WA 2BNQD 5LAXA 4AMKL 4JFYB 2BNRB 3LKRB 1J0KA 3HB3D 1R3KB 3TH2T 2CLZB 4P2QE 1INEH 4Q9RL 5IBLC 3RWGA 4Y0GA 3SE4A 5DRXB 1J8HE 1NEZB 2GKIA 4XWOC 4XPTL 3RBGA 1CFQA 4AT6B 4KU1A 1AO7A 3HMXH 2R0KL 1FYTB 1I1CA 1J7VR 1B0GB 3B9KD 3VA6A 5C92A 1TCRA 2MSPA 3NFPA 3VG9B 5J1TC 1WWBX 3IS0X 3ARZA 1WBZA 5TGBA 4OD3L 4PV9A 5B38B 1XMWA 3TT3H 3D9AL 1Q9WA 1SM3L 3QA3B 2WK2A 2EEAA 1CD8A 3BZEA 4J4PD 2P24A 4XVJL 3BJ91 1KJ2H 4OFYA 2RCSH 3LN5A 5JPMB 4TPRH 1QKZH 3J7HA 3F6IA 2IQ9H 3ARWA 1W8NA 5IG7A 1B88A 3MLVL 4ZFZB 4IEFB 2JB5H 4I77H 4KRLB 3WD5L 2FHBA 1C5BH 3PGDA 3QDJE 1YECL 4JR9H 1YC7A 4WFHD 4H88L 1MNUL 4RFOH 1QEWA 3GSQB 1NCAL 4UTAH 4LGSB 4U4BA 1A6UL 2OSLB 1H8SA 4NKDA 4RSVA 1HHHB 2YK1H 3ZKNC 4QYOA 2FH6A 1CL7I 1P7QB 2C3HA 1FIGH 4OLZL 1DVFD 1FNHA 3RVWC 3OKOA 1E6JH 5K33A 4L5FH 5DTFA 4QEGA 5MP6H 2X1XR 5JORA 4J7RA 2CUMA 3CVIH 4J6RL 4MZ2A 1UA6H 1RU9H 3QEQD 3ARGD 1GZQB 4DVRL 3LKPA 4A6YH 1I4FB 1BFOA 3T08A 1R0AL 3AM8A 4X6CB 1IGIL 1NCDL 1U9KA 3L3GA 4FMFA 1YJDC 3H42L 4PV8A 5BRZA 1C5CL 5HDQL 3MRGA 3G6JF 3R8QA 1F90L 1HOCA 3BZFB 2CK0L 4PJXE 3F7YA 3G6JE 4GKOA 5DLMH 4XGZA 2IBGA 5J3HD 1VESA 3LV3A 1A6ZB 4EI5C 3KPLA 1U0QA 3MXVH 4R26L 2FEEL 3DURA 1T21A 3N9GH 3RL2B 2K1MA 3SN6N 5GGSA 1VFAA 4FQXC 4IIQC 2F54A 2ZG1A 1Z3GH 2Z8VC 5C0JB 3BKML 2YXFA 2VZSA 4FQLL 2YA0A 2D0GA 3ARFD 3DV6B 1XH3A 4U49A 5D1ZA 4U1KB 4R6UA 2OL3B 4AH2B 3BDXA 2B39A 3AXLB 1R24A 4HPOL 1HHIA 2JCCF 5JR1H 5GS2H 4YBLC 3T1WA 2OZ4A 2Q7YA 2W59A 5K9QI 3QG6A 4KKAD 4WFFD 4ZS7H 5DD3H 4F57L 2CRIA 1MFCH 2IFFL 4PLJD 2DQFB 1FNSL 4JPVH 4M7JH 3T77B 4MSWB 1N3NB 1CIDA 1S9KC 4K3JH 4JO3H 1NMAH 1VEPA 1S3KL 2XN9E 4EN3D 1UWXH 2F53D 4KJWC 1BQHB 1NGWB 1VPOL 2WSKA 2D3VA 5GSVA 3QXAB 1A02N 4EUPH 2A9ML 2JB6B 5CZXD 4NNPL 2AK4B 3SGKC 3PWVA 4HUXB 3LEXB 4R2GD 4WU5A 4FFYL 4M4PA 3QUXC 1JPSH 2A73A 4UMGA 4WNQA 1WK0A 1KFAH 3T3PF 1LO0H 5FV2A 1KIUA 2F5BL 4ZODA 3T3PE 2C1OA 5F7FA 2F58H 1QSEB 4LRNH 4X83A 8FABB 5IV2B 4WTWA 3QUYD 5EZIH 4PJ9B 5E8NA 3DYPA 4GOSA 3QQ3B 3KS0J 1AGFB 1DBAH 3RNQB 3E6FB 1MEXL 4LCUA 4P5TD 3NCYP 3O9WC 2WBKA 2P7TB 1QR4A 4YXLH 5IB5B 3TF7C 5IIEB 3CVHB 2UWEE 3IETB 5CZVH 4G3YL 5ETUA 4P2RA 2YN3A 2GT9B 2JF1A 5C8JB 2HVKA 1CLCA 1R5IA 1ZLUH 3WXVL 1TVBB 2DM2A 1PY4A 1KIRA 3TBTA 1CWVA 1WIPA 5HHXH 4JKMA 1DQDL 3HPLA 5C09D 4OCWH 2WANA 3T0DA 1AD0A 4F33A 2NY5C 2OR9H 5H35A 3GMMA 3NH7H 1HILB 3R06B 5E08H 4O9HH 1CLOL 3QP3A 3V6BR 2Z9TA 1J86A 1DLFH 4YFEA 2J2ZA 1TJIL 4PTTA 3DVFA 3GEWB 3MLUH 2EDOA 1A6PA 3T1FA 1D5ZB 2QTEA 4ZAKC 3BVNB 4U6VL 2XKUA 1QLEL 5IBLD 5I8EB 4MGXA 1ZE3C 4M6MH 4MB5A 4XWOD 1T20A 4CMMB 4F2MA 3FOLB 2VAAB 1INDL 3U6RA 5HBBA 5E6YA 4Q74A 2VDMH 2P5WE 1NC2D 2VXUH 2AJYL 4BK5A 2Q86B 5IF0B 2Y36L 3JVGC 3ARQA 2YD6A 1I3GL 1IAIH 1EAJA 3JV6A 3QIWC 2VAJA 2GTWB 4LK4A 4PRDB 4BFEA 1A4JA 3UJJL 3T2NH 1PG7W 2ZKHH 2HJLB 1HINL 3V4VH 3JV5A 4HXBH 4BFBD 2V2WA 2FIRT 4LFHG 5T5NG 2J8UB 3QUKA 2QHRH 4PG9A 5JTWA 5DQ9A 4KHTH 1I8MA 3FO0L 1JK8A 3WL9A 5KSBA 1CFSB 4D0CB 1KBGL 3QJFA 4HIHB 4OGYL 4CJ0A 3G9VA 1RFDH 4IRJC 4JZJA 1IQDB 5ALCH 3ZKND 2YUVA 1IC4H 2MQ0A 3VW3L 4RZCA 4CVXA 3DRQA 4M9OA 3RVWD 3KNBA 1SBSH 5J13C 4NQDB 4S0SD 3RWEB 4QXUL 4JVPA 3VXMA 3IB4A 4HFUL 4KQ4L 2QADB 3ECBB 3RWCA 3C8DA 4G80A 4LLVA 4ODTH 4NZRL 4UU9A 4BQCA 4WW2C 2R56L 1LEKB 2DAVA 4M8QB 4GAJH 1KPVA 4JVWA 5IBUG 1EVUA 4KUZH 1OQOA 4HULB 3KPSA 5D1XC 3DROA 2D7TH 1PQZB 3FHAA 5IQ7H 5IR1A 4KGJA 1HQRB 2AV7B 2HFFA 2P8PA 1F02I 3L6FA 3D85B 5MEND 2ORBH 5I6XC 5IGXH 1HWHB 3ULSB 5EOQH 1R5VA 1UCBL 3LEVH 2W38A 2BY2A 3SDAA 3NIFF 4EI5D 4PLNC 3NIFE 4B50A 1RZ8B 1GPOH 4FQXD 1IGYA 2J6EA 3STZB 5DJ6A 3OKMA 1RVFL 3AGVA 3H0TB 1G7HB 5FGRA 1K4DB 4QHLB 5ERWA 1YJDH 3HI5L 3VWKC 3QSKB 2E7LA 2H45A 5I18L 5BV7B 3UTZB 4PJFF 1TNMA 4LBEB 1JGEB 1NBYB 4YFLI 1T1WA 4PJFE 1IRAY 2WUCL 4CU6A 2AEWA 4LP5A 1J1XL 1R3IH 2GFBB 4LAQH 2O5YH 1FORH 2HMIC 5KSAB 3MBEC 3MRFA 2H6PB 5KW9H 3RI5F 4DZ8B 3DYOA 5FV1L 1K3ZA 4NQCD 4JB9L 4KJWD 1WZMA 2ED7A 4O4YH 4K71B 3RRQA 4CADB 2EYSB 4R7NA 2APTA 2IPUK 2YD4A 1NEZG 1UZ6F 3UTPE 1KLGB 2J4WH 4IMLB 4NRYB 1WFUA 1G7PB 3VRLE 3E6HA 3QUXD 1EHAA 1K8DA 4Y19B 5D96C 4XT1C 3V6OE 2KKQA 5GSRA 1WIOA 3TBVA 1C5DB 3MV9A 1ZLVK 1F5WA 4KFZC 4PRNB 2NY7L 1P69B 2E9BA 1JNNH 4YXHH 5ICXB 5EO0A 4XC1L 4K7PL 3RP1A 4GW5A 2N1KA 1G9NL 4L4VE 1KACB 2HLFC 1JWUA 4JANB 3O9WD 4Q58C 5C2BH 3BQUA 3QAZC 1YMMB 5E8EB 2MJWA 5IKCB 2NY3C 1D9KC 3HNSH 1MY5A 3VXTA 4LF3A 4H1LB 4TVPD 3MRMA 4UDUA 1SBBA 1X7QA 1WTGT 5GPRA 1KCSH 5DZNA 2EDXA 4Y2DC 2JJTA 3PE9A 4HUUB 3UO1H 3P2TA 4N9OB 4G9FB 3SY0A 1PW3A 3MOAH 3UTSD 1BAFL 1W0WB 3FFDA 4K55A 1D5MA 2GSGA 2MCPL 5E5MB 4L3EA 2XXMB 4MX7B 3K74B 1ODAA 3SO3C 1FFRA 4EI6A 3TWCL 4L4TB 4NUGH 4JJ5A 1RQ5A 2AJUL 3QO0B 1JHLH 1TDQA 3O4LB 4TVPH 3VXPA 1MCOH 2EH8L 1N59B 4J23A 5DF0A 4X5WA 3VXRD 1QPPA 4ZAKD 3WO3B 3GBMH 1XCQA 4P57A 2ICWI 4M6AA 4M61B 5IHZA 3MLZL 4IOSD 3WYRA 3RPIA 1PLGH 2NY5H 2W07A 3BP6B 2B2XH 5JXAL 4HPYH 4KZEH 4YIQB 4F7TA 4F15B 5L2JB 1JZ2A 2VN7A 1B90A 4QRPA 5L7XL 3SPVB 1OL0A 2AABL 3TZVA 5HVFB 3Q5TA 5FA3B 2O26U 2Y5EA 3ZZ1A 1UJTA 2CRYA 4GG8A 3OMZA 2Z8WC 3IDYC 3QIWD 1JI1A 3FN0H 4G6JH 4OLUL 5IFAL 1H3PH 3LRGA 1GGIH 2UZIH 1BF8A 5C08A 1QFWI 3TCLA 4LU5H 2GIYA 1Q9OA 4NC0B 4R97C 4LHUB 5C0AB 3QUMH 4CU8A 5JHDE 4LCYB 3BWAB 5E4EC 5L9DH 3U1SH 4QRRE 5HYQB 3C2AH 1HI6A 3ULVC 3VFGL 1XGYH 2HA1A 4QTHA 4F9PA 1OWRM 2D7MA 5T3ZL 3P9WB 4I3RH 4IRJD 4DW2H 4BSWB 4P9HC 4MJIE 1WEJL 5LG1A 5EUOA 1JGDA 2NY4C 2B20A 1BQHG 4YXKL 2DBJA 2L0DA 3X3GL 3ARPA 2YD7A 3IGAB 1F6AB 3DHMA 2QV2A 5DEZA 1MFDH 1EUUA 4PJAB 3H3PL 4LL9A 3CSYA 5MHSE 4JY5H 4C4KT 3I3DA 4XMLH 1IVLA 5DK0A 1M6OA 2IANB 1X5IA 4KDTA 3TPUA 4NFCA 3EFFA 3NIGF 5D1XD 4XP4L 1RUKL 3LEYH 3NIGE 4JFFE 4Q6IA 2NZ9C 1E4KC 4LLDB 1YNKH 5IB1B 2I9TB 4YHZL 3KPTA 4R96A 4PGBA 5HHVL 3UDWC 1V3JA 2VDLH 2DLTA 2MQCA 4XP6H 1EFXB 2Z8SA 1RIVL 1JNLH 1MFNA 2HFEA 3DMMB 3OHXA 5C6PB 1L6ZA 5CD5C 1TZHB 2ITDA 2C3VA 1LO5A 1ZLWH 1NCCH 3LH2H 4CW1A 5EWIH 5CSBA 1FN4B 1JZ5A 5L6YH 1U6AL 2A1WL 4ZS6C 3OX8B 4OZIB 5GRJL 1KT2B 5LWYL 3HMWH 5EFIA 2UVFA 4KQ3L 4PJEA 1MUJA 1BQUA 1HHGB 3MRJB 3VWKD 4ODBD 3MUY1 4GH7B 4MS8C 4R90H 2R0WH 4OLVL 2R8SH 3B2VH 4U1IA 3CZFB 3IFPB 3KYOA 1CGSH 4UB0H 3RL1B 3O6FC 4QRSA 3QFJD 4U1GB 3V95A 4DKFH 3FTGA 2HMID 1DL7L 2F8XC 4LPTA 3MBED 2AEPH 1XGRA 3K8MA 1FCGA 1U8KB 2VZ1A 4OZ4A 4EZMA 5J56B 5ICYA 3BGFB 3DETC 5C9JB 2V9TA 1U92B 5I1DA 1GC1L 5F89B 5FHAL 1FBIH 2LAAA 4JFEA 5EUKA 1OM3L 2W92A 2QQKH 1FNEA 4MXWL 5KTEH 4MNHB 1G9ML 5F6IB 5EULV 1A0QL 1WLHA 3O45B 2C4XA 3SKJL 1JMXA 3VFVA 2OR8A 1A1OB 1P4IH 4JZOA 1X5YA 1SMOA 1A7NL 1B0RA 4NHCH 2A2QT 3RVXC 4HV8A 3MGTA 1LE5B 3TIDA 4Z78B 5IMKB 5EDXA 4UBDC 3L3DA 2BFVH 4FFZH 4XB7A 2FLRT 1F2QA 5I8OH 3O8XB 4RA3A 5EB9A 7FABL 3N1FC 4XNZB 2HLFD 4ONOA 1NKOA 5A16A 5EZJB 4Z77B 1OF2B 1QSFA 3MCLH 5B8CA 2XNAB 3O6LH 2IAMD 1MJUH 1W2KT 4AEHL 3EYFA 2NY3D 1D9KD 1LO2H 3X17A 4NPYB 1HSBB 1MCKA 1BQSA 1U91A 3TBSB 3WIHA 2NPLX 1FAIH 3M8OL 3KYKH 5IMOA 3BUYA 2BSSA 5C07E 3S96A 4XBGB 1JN6B 2Y23A 5JXEA 3QXUA 1I8LC 5T1LD 2DL2A 5E00B 5BS0A 4Y2DD 1K2DB 2DQUH 4G8GD 3BPOB 2BHZA 5LBSH 1T22B 1MIML 8CGTA 1Z0MA 1T1XB 1KLUA 3FT4A 1HKLL 1AGCB 3PHSA 3D69A 2B1AL 1GH7A 3TNMB 1JPGA 3TBYA 3ARTA 3CFKA 2X4RB 2ZWLT 1ZHNA 4QXGL 3WIFA 5HPOA 5IEHA 5FO8B 3HE6A 3VDCA 5C0NC 3UTTD 4NQSA 3P30L 1YEFL 5K59F 1FLRL 2Y07L 2ESVE 4HUVA 3OXSA 2X42A 1RD6A 3PL6C 3IDNB 1KJMA 2GJ6B 1NGQL 2EO9A 4P2OC 4XCYA 3HCVA 4PJCA 1ZSDA 5I2IA 3T65B 2FHFA 3KVQA 3G5XA 1OP5H 5K9OA 3I50L 1CDHA 1CGTA 2DD8H 3GM8A 5IWLC 5F7EH 1NSNL 2VDOL 4PRPD 1FL6A 4KV5F 1SYVB 3HNTL 4KV5E 5FF6A 4MA8L 1F4XL 2PYEB 5CEYB 4HKXA 3FMGH 3QDGB 1Z5LA 4YQXL 3VFWB 4YEEA 4MD5B 2JKXA 5FGCB 3ULVD 5CIPH 2ARJB 5CSZB 2P5EA 4I48B 4D9LL 4LVNB 1CD0A 3EDEA 4MCZB 4MNQD 4M6NL 4U6HB 3RGVB 1ETZA 1A9EA 2NY4D 2OTUA 5C0CA 3MRKB 4N90D 3ULUC 1CLYH 5L2KD 1RUML 2EDWA 3TNNA 1I1AB 5I73C 1NPUA 5K9KB 1MOEA 1A5FH 1I3UA 1MCPH 3B3IB 4RCAA 4N8CL 2AQ2A 1RZJL 4L8DB 1FNGA 1PJ9A 1W0VA 3WO4C 5DI8A 2HKFH 4LSPL 3VFMB 1F3JB 3ZYZA 3DUSB 1KJVB 2W65B 2G9HA 3OB8A 4P9HH 5H2BA 3V5KB 1NMBH 4HGWB 4ORZC 5GGVL 1C8PA 4XMPH 2NZ9D 3C60B 3MA9L 5DJZA 2A74A 3N1PC 4U31A 1ZA3B 5DRNB 3PHOB 4R9HA 4KKBC 4HK0B 1F3DJ 2YPLA 3VRIB 4C56B 1XR9B 1LP9F 2VIRB 4C59B 3GKZA 3S35H 1RK1B 1LP9E 1G7IB 1QD0A 1NFDA 5DHVH 2H1PH 5CD5D 2ILLA 4MCYB 4H1LG 1S7RA 1WCQA 2Z91B 3VG9C 4ZS6D 3IU4L 2EIDA 2FWOA 3CXDH 4I0CC 5FO9B 1JV5A 3KPQA 1Z0NA 5I8KH 3HZMA 2P42B 2GY5A 1LQSR 4W70A 4MS8D 1A7OH 4JO4H 1HDMB 4M8VA 2E8ZA 4ZDHB 4JAMA 4OQTH 5JDSB 5IROC 5HDOA 3WIIH 1MI5D 4PJHA 3FB6A 5CBEB 1B3JA 2D7NA 3O6FD 4ODSH 5EG6C 4XXCC 5IP4A 4LSSL 5GGQH 4JEGB 2GCYB 3RWJA 2BNRA 2ZCLH 1O7SA 4PJBA 2EIEA 4OD2A 3U4BH 4E0RB 4GSDH 4UILL 3BH8A 4P2QB 1TZIB 3DETD 4YBHA 5DJAA 4PJ5D 2E7MA 1J8HB 1GGCL 1FYTA 4YE4L 3IXAA 1LGVA 3MO1A 4YFLF 3HE7A 2JIXB 1FH5L 2HWZL 1A7RH 3O81A 2D03H 2Z93B 1N6QL 2DLFL 3V52H 3CLEH 4G42B 3LQAL 3FO1B 3MXWH 4R7DA 3RVXD 3T0VA 2QSCH 5F7YC 2P1YA 3C5ZA 4UBDD 3WJLC 4UV4L 1AY1H 3X14A 2R29L 4XWGH 4DZBB 4LCWD 2XYCA 3BYYA 2AJVL 5ALBH 1AKJA 5J06A 1M05B 4WHDA 5D9SB 2XKNA 3MODL 3WFHA 5CJOH 1DQLH 1MIEH 1RUPH 3B43A 4H8WC 5HTSA 3EYSL 1GGTA 4FQ1L 2EE9A 4EJ1C 3LN4B 4MNGE 3LSOB 4NT6A 4WI3A 1EX0A 1XGQA 4M5ZL 3TV3L 3AY4A 4J12A 1QR1A 4YK4B 5GGTH 1S7XA 3H9SE 3DO7B 4IRZH 4J1UB 5I0ZA 5LQBH 2Z0BA 1MQKH 5GRYA 1T7ZA 4LFHD 1OAQL 1XT5A 3CGTA 5E0QA 5C0ND 5IESH 1F4AA 1KB5A 2AGJL 2DMKA 5DD1L 2FBJL 4XXDB 3X11A 4QY8A 1NAMB 2FJFB 4R4FL 3PL6D 1U3JA 3S36L 4P2OD 2N7AA 1I8KA 1IGJA 2ZOKB 1J5OH 2IEPA 5HYJE 43C9A 3BPCA 4QRTA 3QEUA 4PJXB 1T5WB 3VFPB 2EYTA 3KYMB 2VKWA 5FM5O 2FATL 3VXOA 2XWBA 3GMPB 2CDFB 2P48B 2Q7NA 4WI7A 4H5SB 1U8OA 5ITBH 3TO2A 4FTVD 1RHHA 2VWEC 4V2BA 1T3FA 4NWTH 4PS4L 2JJSC 3V7AE 3GJFA 3OAYH 4XCNA 1U8LB 3PWNA 1KCKA 1OAYL 3O0RL 4AH2A 1ZV5A 1HH6A 5K9JL 5DVNA 1B4RA 5E7BA 4EIGB 4PY8J 4C55A 5T3XD 4PGDA 1GGBL 2F53E 3THMH 4U1JB 1FPTH 4PJ9C 1NC4D 4DGYL 3FFCE 4MA1B 1T7XA 2AV1A 1DP0A 2R2HA 5F7MC 3L3IA 4WUUA 1JHTB 1W72L 1HE7A 3REWA 5MEQA 4LEOB 5IMMA 2PW1A 1QLFA 3KLHC 2P43B 2YD3A 2FHCA 1IEBB 1U8JB 3B6SA 3ARFA 3GMQB 3NFNB 2X4TA 2MWCA 3ULUD 3DHJA 3U9PH 3D3VA 2YOCA 4EUPA 4UT7L 4Z7WA 5T3XH 4HKZA 4FABL 3RY6A 2OTWA 3U0WL 5E6IA 3KPNB 5JOFA 1OPGH 1DLHB 3EBAA 3OPZH 5EU4B 4HCRL 2ED9A 1MWAA 4GKNA 5KSUA 1T1ZB 4KKNA 3RX7A 1FDLL 5JMOC 3W5MA 4KAQL 1EK3A 4JFDD 2J5LB 5MERB 2ZUTA 1AGFA 4UDTA 3OR7B 2YZ8A 4P4KB 3ULUH 5D7LA 1D6VL 5I16A 4KKBD 3LKNB 3UZQA 5E56A 2OI9B 4DGVL 3BN3B 3CVHA 1CDYA 4RGNB 3WFEL 2CK2A 5C2UB 1SJEB 2UWEB 1X5KA 3OF6D 4HSQA 4JPIB 1P7KB 5SX4H 4D9QD 1TTFA 4OZGA 1QSVA 3WV0A 4UT9H 1CF8H 5LGHH 5DWUH 1A6VL 3M17B 4TVSa 5SV3A 2YR3A 3HZVA 4JRWA 4NQXA 25C8L 1ADQL 4JLRA 5GISL 3KPOA 4J2XA 1IFHH 3J8F7 4TUKH 2D9CA 5AZEL 2EDFA 2VLJA 3TJEL 4RAVB 5KVDH 2QSQA 4OUUB 3PDOA 1NBQA 3GIVA 1OAUL 2HLAA 3SBWC 4JPKH 4ELKA 3LRSA 2I5YH 3DARA 5D71H 3BVNA 3HNVH 4JY4B 4AIXA 1CDGA 1ITCA 5HHPB 1CBVL 5HHNA 2O5XH 3PQYB 1F97A 5ENWB 1DQJB 5GHWH 2EDTA 4B41A 1J0ZA 2EO1A 4FXKB 4M62H 3VFSA 3V5DA 3TYGH 5IJVB 5IF0A 1XF3A 1ZVHA 1P7QD 3EFDL 3DRTB 1BMGA 4JG0H 2VLME 2EDQA 3O2DA 2QADC 1T2JA 1DQML 4IMKC 5IJKC 4HFWA 3P4MB 3F62A 3K46A 3FQRB 1MRDL 2HJFB 4X8XA 4OFKA 2NNAB 4BH8A 4MA3A 2HRLA 1TETL 1UB5B 2GSIA 3EZ8A 3OXRA 5BRZE 3MLTA 3KWWB 3NPSB 3QXDB 4PJDA 4OKDA 3JWDL 5HVGB 5F3HB 3QQ9C 1ZLSH 5JW3L 3BGMB 1VKXB 3MGOA 2HFGH 4AIZA 1NCNA 1WAAA 1L7IL 3V8CA 2XY2A 2DJSA 4GXUN 3WS3A 4U05A 2XZCL 4GW1B 4KDWA 1YNLL 1NGYA 3UP1A 3BYTA 1UXWA 2VLLB 4NQDA 3RWIA 5ILTH 4ZFFA 4ZUUA 2D0HA 2CIKB 1PSKH 5ID0B 5E2TL 1RSFA 3FOMB 2DRUA 4RGMB 4GRWB 1A9BB 1C08A 5I1GL 4XNXH 2ZSWB 3QCUL 4CKVX 5BV7C 4H8WH 1FZJA 4YDJA 2GY7B 1PGRB 1KELL 1MRCL 2ZCHH 1SJHB 3U46B 4BKLA 3NACL 1YN7A 5E8DH 1BOGA 1H3GA 4YHLH 3V0AC 2R2CA 1EJOH 4NKOB 2PCPA 4X6DB 2IWGA 1R3HB 4JO1H 3SQOL 1EVTC 2E5EA 3Q6FB 1ORQA 3QUZA 1OAXH 2OL3H 3VG0H 4EEEA 4WFGE 5CINH 1QQDB 4LCIH 3BH9B 4WI5A 4YHNB 5TDNB 4YAQB 2AK4D 3RX5A 2X9XA 4GO6B 2AXJA 4GRLB 4GQ9L 5CILH 1F8TH 3ARDA 4YHOL 3C6SB 5TE6L 1K4DA 1C12A 4LCCB 4NN7B 3T8XA 1G7JA 3S88L 5D70L 4AMKH 3HAEG 4LBEA 5CAYB 2B1HL 1S9XB 4QHNA 5FM5M 3VD9A 3WHE0 4NQCE 1QSED 4X5XB 3PDDA 4PJFB 3LS5H 1ED3A 4PJ9D 2GFBA 4XPTH 5KSAA 3FKUS 2R0KH 2N56A 4NNXB 4HWBA 2H6PA 5A40E 2MKWA 1GGUA 3S37L 1AE6L 2R23A 5BCAA 3KLDA 3KLHD 4HDIB 4Y4FB 4OD3H 3CDGA 5IFHL 2YC1B 3QRGH 1KPUB 1LK2B 1T2QH 5IW1A 2DKUA 3D9AH 2BMKB 1SM3H 4RRPA 4LLUA 5F3BA 1G7PA 1R3LB 2HTLC 2V5TA 1CFVL 2FJGA 4M7LL 2N4IA 4HKBB 3QEGL 4NN5B 4KXZH 1MHPH 1DBJL 1KEMH 2IADB 3IDJA 4IOIB 4ISVB 1HQ4A 4H20L 2VXQL 4ZXBD 2GUOB 2XICA 4N9GB 3WD5H 2FGZA 2YPKA 1YECH 5CGMA 5ACLA 4JN2A 4NC1C 4H88H 5F8QC 1CL7L 1MNUH 3CIQA 1NCAH 4RFNB 3T0EA 1NGXA 2APBA 3GRWH 2NY2B 1WVZA 5CP7B 2D4DA 4JFXA 1YMMA 4RMUA 2DQDH 4XP5L 3VGBA 2X70A 1Q0YL 1QHPA 2ZCKL 1IGFH 3UTSE 3BRDA 2WIIA 2CUHA 2XWJB 1K6QL 2FB4L 1B2WL 2BVPA 4F15C 4MLIA 1V05A 3W2DL 4D0DB 2ZJSH 4J6RH 1ZT4A 3FL7A 2I9LB 5CJBA 3IAQA 3SKUD 5F9WB 1J12A 3QNXB 3U7YL 3IJSB 3O6ML 3BIBX 4PJGF 3CJJA 3HKFA 1QBLL 3QEHB 4PJGE 1UVQB 1IGIH 5IMLB 3DOSA 4TULL 2ERJB 5EOCL 4YPJA 2YKLL 4ZQKA 2QQLL 1C5CH 4C83A 3NFSL 1NUFA 4YEFA 1F90H 4X6BA 2EC9U 2CK0H 4F7EA 4PGCA 5F88B 2X89D 5T33L 1ES0A 5ID1A 3DUUB 5JW4R 4PG2C 1IC5H 4YIQA 3VXME 3OKKA 5FUZH 5DC4B 3BKMH 2XWTB 3MJ9A 3KPRB 4IS6A 4FQLH 4I0PB 3UPRB 3A0OA 2LU4A 4M7LT 5D6CB 4EDXB 1U95A 2QADD 3VI3F 2X9YA 2HTKC 3KPSE 3VI3E 3ZO0A 5JNYB 2VERN 4NM4L 4S2SA 3WMSA 5IVOA 4ZG1A 5DRZB 5MEPA 5EZLA 2JELH 3T3MF 1A14H 4ODUA 3TN0A 5C3LD 3T4YB 3T3ME 4KMTL 3QQ9D 1VPOH 2YRZA 4PY8I 2VSDA 1GIGH 3OKNA 2VITA 3D85D 4NNPH 3BKYL 2PXYB 1T83C 1EIBA 5AD0A 4FFYH 1FL3A 4K9EC 1S7WA 2YSSA 3MV8A 3ABZA 4QGTA 1MAJA 4PRIA 5T1KB 3RUGB 2DQHL 4Z6AT 3G08B 5A2LH 3ETBF 4LVEA 1RURL 1C1EL 1KOAA 5BO1H 1FO0L 4I18A 5C86A 2OQJA 2X4UA 1AHWB 4NGHH 3GSOB 2Y9RT 4N0UE 1ZS8B 3A67L 4HX1B 1MEXH 3F5WB 4ONGL 4N0RA 1BHGA 1YN6B 2FL5B 2IPTH 1Y0LB 1HWGB 3WS6A 3AU1B 4I5BB 1TITA 3Q5OA 4JFFB 3L7EA 4U1GC 4E9LA 3QJHB 2X40A 2JK5B 5KAQG 4NJAL 3SOBH 5GGRB 1QYGH 4HEME 1ZLVH 3ZHLA 1EBAA 1YEKH 1EFXA 4XP1L 1MLCB 2CJUH 3PIQA 4LSTL 2EDBA 4QCIB 4JFHD 3BGFC 1F58L 3DMMA 3IVKB 1LHZA 3ROOA 4X6FA 4PJ7B 1FVCB 3AFLA 4OIAA 5BV7H 4N0YL 2VOTA 3JV4A 1FNFA 1CLOH 5HHOD 3GI8L 5BMFH 2RGSA 4L8SA 5F6IC 4M02A 3BP4A 2ID5A 2YMXL 4Y19D 3P77B 2FZ3B 1QRND 1L7TL 2QSVA 1O0VA 5ACZA 2G2RA 3P0VH 4P3WA 1J87A 1G6RL 3SGDI 1I1FB 1QLEH 3MRQB 3NGBB 4ZUVB 1FRGL 1YEEL 1N5YL 2DQCH