4ZAKD

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD02
1MCNA 3QRGL 5HVGB 3MODH 4U1GC 4DZBB 4NZTH 5IVXB 5CJXC 1V7NH 5C71A 1T83C 3EFFA 1MJUL 4LCUB 4YBLB 4MAYB 3J7HA 3TBSB 5IVXE 5C8JB 4CVXA 5DDHA 5F7EL 3VE0A 5MEPA 2ZSVA 1LO3L 1C5CH 4M6NL 4EIZC 2CDEB 5DD3H 3T4YA 4RA0C 4XC3H 4OZ4B 3WS3A 4KPHH 2ADJB 3UTQA 3KWWB 2G5BB 3O8XB 3RWCA 4XNQA 5DJAB 2RJMA 2HG5A 2RHEA 3QNYA 2BMKB 5GS1C 3DRQB 2OZ4H 4WGWB 1VACB 3MXWL 4XWOC 5I8EA 1FIGH 5HGHA 1QRKA 3MYJA 5HI5C 1RVFH 1OQOA 1R5VB 1ZEAH 3LKRA 3PWJB 2IJ0C 4B0MM 4N1HB 5EOQL 2OYPA 4HJJH 5ANMB 5D1QD 4XMLL 2WIMA 2I27N 4P46A 3L3JA 3HZVB 4S0TD 2VIRB 3OR7A 3P77A 4BZYA 4HK3J 2ZOLB 3LH2L 4JB9L 3FFCE 4PJCB 3KXFB 5CP3A 5HHOA 3JTTB 3ARWA 2P8MA 3HR6A 2J8OA 3KXFE 2FEEI 4EQ2A 3QNXB 5IEHA 3TWCL 4W4OC 1YY8A 4WW2B 5F6HI 4TULL 1FYTB 4KTEL 5EWIL 3CLEL 1HCVA 3IS1X 1NAKH 4OKVB 4WWID 4LLAA 2WBJA 1FYTE 3K8KA 4JQIL 4ESKA 3OWEA 2VISA 3UPCA 1Q9OB 1Z0MA 1N6QL 1CFVH 3VFWA 3RWJA 5J57B 3TLRA 1W2KT 4L3ED 1HYSD 5CP7A 1BVLA 1EEYA 1JUFA 1UXWA 2DM2A 1VFUA 2VDQH 32C2B 4O2FB 5D1ZA 5EZLA 2WQ8A 2VDLL 1U3ZA 1TCRB 3IS0X 3W5NA 3ARFD 1OP5H 3U4BH 2Z31A 4L4VD 4XPAH 1ND0A 3CJJA 3LKQA 4UU9A 5IVXF 4GS7C 3QO1A 3WD5L 3JV5A 3BRDA 2FDBP 3QDJD 4H88L 1MVFA 1F11B 1U8IB 4IIQB 5CZVH 4MD5A 1MI5A 1CL7L 1UFUA 5ACLA 1Y6MR 3BP4B 4PTUA 3VXMA 4I18C 4OI8A 1BD2A 1UH3A 4NP4L 2YS4A 5LGHH 3P0VH 1E4XH 4KK9D 1NAMB 3SQBA 3TBWB 5SWSD 4WFHD 1A0QL 5J11B 3RY4A 1DE4B 2EDQA 1CFSB 2FX7L 4ZXBD 4UILL 3BRFA 2PW1A 4YHML 3D0LA 4EN3D 4X5WA 5JXEA 4LIQE 2RQ8A 1QTYT 4JM2D 1JK8B 4EI5A 4RGNC 1N4XL 1MH5B 1N5YL 1RURL 1NBZA 5DRWB 3TVMD 3CUPB 5CMAB 3FO0H 3T08A 4GKZB 4MMXC 3D0VA 3PHSA 3IRZA 2AJUL 2BSED 4PJCF 4OGXL 4XPGL 4GQPH 1PSKH 3RIFK 1UKTA 2V2TB 3JTSB 2QSCL 4LHQB 2D7TH 1D5MB 1JPSH 4R2GC 5T1LB 4UNVA 5EOCJ 3FHQA 4WW2F 1CFTA 2P42B 1M71A 2NY2D 4HWNA 1HH9B 4TOYL 4KQ3H 5F7NC 3HCVA 5ESQA 1B88A 3OKNB 5EIVA 2AP2A 4MZ3A 4WWKD 2YEZA 1WBXB 5I18H 1HHIA 3S3PA 3IFPA 4PJ5E 4MD4A 5K9JH 5DURD 1MHHA 1OGTA 3HE7D 2ATKA 3VFUA 2IGFL 3LEYH 4IS6A 5J6GA 3U0PA 1WAAE 2VL4A 2VC2L 3VDCA 4U1IA 2CK2A 1IGFL 2ZUWA 4X9BA 4KROD 4JPWH 3MUGB 3MR9B 1DQJB 1AGBB 4NQVB 1IM3A 2ZUSA 1AIFB 2MPAH 3HZVA 3LKPA 4H8WH 1KJVA 2X40A 1GGBL 3T2OA 1W0VA 5IUSA 3MJ9H 5B39B 1JNHB 3JZ7A 4JFXB 4NM4H 5DHYB 4J6RH 4ZUVA 4CMMA 3IFNH 3DUUA 2EDXA 3O3BA 4FABL 3QO0B 1BLNA 1LP9E 1FNSL 2ZUYA 4WI2A 5KANG 3CMOL 3SGJA 1YEKL 4BUHA 3ARYA 5K9OB 2X4PB 4XXCA 4JZJB 2E3VA 3WFBL 4WHTA 3FRUA 1E4KA 1B6UA 4K3EH 4K2UH 3V7AE 3GMMB 3PWLA 3E8UH 4ZUSB 3SE9H 4A6YL 2V17L 1TIUA 1YEIH 2ENSA 3CVHA 3QB7C 1K8DB 4PJHF 1J1OH 4X6EA 2O5XL 3ARBD 4MCZB 4HUKB 2Q1EA 3TZVB 1ONQA 4R8WH 4PRIA 2B1AL 5KW9L 1UM6L 3Q3GB 1T4KB 2ADGA 2WMPA 2HVKA 3JWNC 1HN1A 3RWGB 2F54A 3AU1B 5J8OA 4OCMC 4FQ2L 2KZWA 1YQVH 1F58L 1EHLL 1CN4A 3C8KB 3G5XA 5CSBA 1ES0A 5J0BA 2AJVH 1NH6A 2ZCKH 3HI5H 3P0YH 2MCPH 2Y7QB 1A7PH 2R1YA 5C07B 2BDNL 1YMMB 4QYOB 5EBMB 3THML 3GHEH 4IOIA 5FO8B 3GUTA 2OTUB 1XCTB 5C07E 3MRMA 5J1AA 1YMME 3OF6D 3BW9B 3MRNB 4JHWL 2GJ6D 2EDWA 5ICXB 5DD6A 3HNVH 4RAHA 4Z76A 5IM7A 2J8UA 4TNWK 1UB5A 1WAAF 5E2VH 1FHGA 4JPKH 1U95A 5JUEL 5DA0B 3WCYA 3SBWC 4PJHA 1DEEB 3WYRA 3TA3C 1KCSL 5GQBA 3WMSA 2X70B 3QFJA 2BCKB 2ID5A 1X5AA 1NEZB 4JQVA 4MJ4A 4U1HA 4XMPL 3C9NA 1KGCD 3IJSB 1KLUA 5DJZB 1E4WH 2N7AA 2DQDH 5CEYA 1NBYB 2R4RL 3D87B 5E6IC 5FYJE 2APWA 4GKOA 1AD9B 3LS4L 4K9EH 5DTFB 3RA7L 1OT1A 1UEYA 2BFVL 1RJZA 1ZA3B 3FB7A 1T2QH 3H9HA 4DKFL 4QT5A 2P46B 1GZPA 2HTLC 5L2JA 3V5KB 5FK9A 4YK4B 4BZ1L 4Y16A 3TEUA 4ZFGH 4WI7A 3L3KA 4V1DA 3VGGA 1KV3A 1NCDH 1UA6L 3C09C 1C16A 2CKBA 1UCTA 2ESVB 2V7HB 2AK4D 1FVEB 3BPLC 4Q6IB 5CUSL 4WUUD 3MLSH 3T2NL 2UY6A 1RIVL 3Q1SH 2IQ9L 4NPYB 2ESVE 4PYHA 5E99H 2Y5TB 1YDPB 1ZVSA 2OXHA 4GH7B 4L5FH 4PGEA 3JV0A 3SKMB 4OTXH 4D9LL 4WFGD 5A2KH 3QUZD 1ZHLB 2L7UA 4ZNEE 2YRLA 4F7CA 4BK4A 1YEDA 5F96L 1D9KA 5H8DA 3WHXA 3VJ6A 2HFTA 1GPOL 3C6LB 3D69A 4IHOB 3HFMH 3RWFB 1IC4H 3GSQB 2CRMA 2F5BH 2XQBH 3U7WH 5HI4C 2C26A 2PXYC 2H26B 1X5YA 1JGVL 1JFQH 4YUEH 4M3JA 1C08B 3IETB 4TUJB 2HRPL 1N8ZB 1F8TL 4XT1C 2HFGH 4NO5B 3WJLC 4EXKA 1GZQA 4G80A 4Y4KB 2A6KB 3UJIL 5LCVH 2M1KA 5FAAA 4U1SA 5ID0B 3MCKB 4OM1L 2VH5L 2W0FA 4IOSD 1D6EA 3FB8A 4YHZL 5FEBA 4Y1AD 4HC1H 4U31A 2E7BA 1HINL 2YD1A 4DVRH 3GSRB 3HMXL 3KPRA 2JE8A 3INUH 4NO0A 4XCCH 1FPTH 1F4AA 5IMOA 4QLRA 3N06B 1VGKA 3RPIB 4ZS7L 5EO9A 1HQRB 4MSWA 2Y36H 4U1NB 2C5DC 4F58L 1UB6A 4Y88A 3H7BB 1U93B 1JTPA 1LQSR 1P4BH 5L0QC 3RWIB 4GBXD 3IFLL 1CR9L 1NLBH 4QTIL 4QXUH 3H2WA 25C8L 1IRAY 2YPKA 1P9MA 3HN3A 4JFOA 4LMQE 4MA7H 4R26L 1LVEA 1XGQA 5HGDB 2P49B 2ZNWA 1OGAB 1NGWA 3SN6N 1Q0YH 1VB9A 4K7PX 1SBSH 1FH5H 3BH8A 1ZAGA 2CKNA 3V8CA 1KTLA 1MVUA 4MXWH 1OGAE 4YDKH 1A7OH 1FORH 4P4KC 3GBLA 4DCQA 4ZFOB 5K9KA 1XGRB 1QSEE 5JORA 2HVJA 3HG1A 1S7WB 4ORZC 1H0DA 4XWOD 3IDGB 3DVGA 3TYFA 3V6OA 5ENWA 2H3NB 2W9EH 3UPRB 3M1BA 2IFGA 1X5FA 1QBMH 4P9HL 4BM7A 4I5BA 3G04B 4U1JB 3L5XH 4NRYA 4DVBB 3V6BR 3OB8A 1PKQB 1J05B 4NDMB 4NC0B 4YBQC 2FB4H 1OTSD 2G9HB 4XVSH 1LNUB 2P24B 2W9LA 2GTWB 1QFUH 1D5XA 3B4NA 1JCKA 3OKEB 4LRIA 4PJIF 1RUQL 2A1WH 1KTRL 3PDOA 2GUOA 4JDTL 1T5WB 4ODHH 3MGTB 3MV9A 4Z8FL 2B1HH 3GJEB 4HEPG 5IG7B 2D7QA 3BGFC 1CQKA 3H42H 4XVJL 3QYCA 3RBGA 4F3FB 4X6CB 1R5IB 3KS0H 3IDYC 1IGML 5C92A 1JF5A 3S97C 4X6CE 4CU8A 2PKDA 3O3DB 2OZ4A 4ZOEA 1RK0A 2P8PB 1HOCB 3EYOA 5T1KD 4E0RA 3RGVB 3U4AA 5J1SC 5DHVB 2Z93B 1MCPH 2XWBB 5JOPD 2BVQB 2DQJL 2QSQA 4XHJC 4DKEH 1U8PA 5ILTL 3PGCB 1JMZA 1MEXL 4I0PA 1VFBA 4MYWB 2E7LA 5C0DB 3CLFL 4HXBL 1WIUA 2DMKA 1BAFL 4DTGH 3SDCC 4DW2H 5LAXB 3RWDA 1Q38A 5F3HB 2G75B 4PJIA 4NCC1 1R3IL 1IGCH 5TQ0H 5LGJB 1VGEL 1ACYH 1CLOL 2QR0B 3CX5K 4Y7MA 3U0WL 5GS0C 4J1UA 1AGCA 2I26N 3D18B 3UTPD 4UQ3A 3EOAB 3I6GA 5KVMC 5AD0A 4EKXA 1ZT1A 3SKUD 4IRSB 4TUJA 2A6JB 5CAYB 1CL7I 4ZUTA 3WLBB 1ZGLM 2OMNA 4LEOA 2P7TA 3TFKC 5AZ2L 3UTTA 4AIZA 4FQLL 4NC2B 4DJMA 5CSZB 4JRYB 5JHDB 1U58B 3RJDA 4JRYE 1N5AA 5JHDE 1NCCH 3SO3C 5KSVA 5ESAB 4PLNC 1KENL 3ULVL 5HY9B 3GSWA 4LLQA 3WIIL 4GAJH 2ZKHH 1FDLH 4I77H 4JR9H 1OM3L 3OAZH 5BRZE 5A43C 2I07A 3KYMB 1A3LH 5FDWA 1JI2A 4IMKC 4QOKD 5T3XD 5FHAH 3UTZB 5B4MC 4L8CA 1RZIA 2DWEB 1F90L 1UCBH 1XGTB 1YYMH 3K2MC 1FO0H 5CZKA 2D4FA 4R2GD 4RQQA 2LU4A 3I9GL 4EQ3A 3DTXA 4GO6B 3MC0A 5EU4A 2C3WA 1IAOA 4X6CF 5J13B 2OP4L 1L7TH 5F6IC 1U3YA 5CJ8A 4HQQL 5EC1B 8FABA 5F9JA 4G6FD 4PJAB 4JG1L 2X9WA 1OWWA 4PJAE 1UWGL 3P0GB 2JKXA 2EDKA 4TSAL 5IB1B 3QG7H 1T6VN 1RJLB 1BOGB 3S34H 5E5RB 3PWVA 5HBBA 1MRDH 3DLQR 4LKCA 3L3OA 4M1DL 3W9DB 3PJSB 5HYEA 2F53D 3G04A 3T4AB 2IH1A 1A6VH 3ZT6A 4R96B 3DX7A 4HG4K 3IB4A 4NDMA 5BXFA 2NX5A 2J2ZA 1NUFA 1B2WL 3Q6GL 4PGCB 5I76A 3F65A 1EO8L 3PV7A 4WFFD 5DD1H 5JPNA 4HUVA 4M4RA 3KYKL 1GGUA 4PJDA 4EIGB 1JWMB 4ODWB 4TSCL 3JV6B 2ADIB 2ICWA 3BWUC 1ITBB 3P73A 4Y5YB 2HMIC 2XFXB 3DX8A 1XIWA 3O6FC 1G7JB 1HE7A 1FFOA 4H25A 4NQEB 2Y06H 2EO1A 4LHUB 1BEYL 5JW4M 5GGRA 3NCYP 5J1TC 4NQEE 1NEUA 5C0IB 5KJRH 1BJ1J 3OHXB 4O00A 3TCLA 4GKSB 4WUKH 2XI9A 4ZUUA 3WDIA 3QEQB 2FHBA 4FXKB 1ITCA 4AT6A 5D7IF 4LVOB 2W65A 3QEQE 4TSBL 1FFRA 4XCNA 3KPSB 5JDSA 2YN3A 3RTQA 5JNYB 3VFSB 5L8LB 2A6DA 4MX7B 4R97C 3KPSE 4LBEA 3MJ9A 2OI9C 4U49A 4P48A 1A7NH 3CU1A 4CVZA 5CIPA 4FA8A 1CICB 3HAEH 4RFEB 1A7RL 2FBJL 3T2PA 3OG4B 3DMMA 2X4OA 1EMTL 3HNTH 2WM0A 1YPZB 4QHLA 4NQSA 3DHJA 3ARXA 3LS5L 4QHMA 5ICZB 1YPZE 5I8OH 3BGMA 2K1MA 1KJMB 2Y1VA 4HGWA 1AXSB 2GFBA 1B0RA 3LMJH 2PETA 1OAUH 3G08A 4TUKL 5IKCA 3LQAL 3RNKB 3REVB 4LCWD 3GMRA 3KJ4B 1J0IA 3WFDL 5GXBB 5DF0A 1IGTB 4WEUD 1MJ8H 4QHKI 3GGWA 3RX5A 4JFED 4NRZB 2ATPB 4LAQL 4BFIA 1AKJA 3SE3C 4BQCA 3IGAA 3CK0H 3VH8A 5D7IA 4NT6A 4HJ0D 2XWTB 4NFCA 1M7DB 3C6SA 1JYNA 1M05B 3ARED 2YK1L 2BVOB 1I1YA 1O7SA 3N85L 5I1HH 4O4YL 4YNYA 4OQTH 2N1KA 4QXGH 3N50A 1QBBA 3O6KL 4H26B 1D6VL 5C70A 4TPRH 3GSOA 4XWGL 5BZWA 3VFOA 4K07A 1RHHA 4JY5H 4KGJA 1ZHNB 1JPGA 4CGTA 4NO2B 4X9FA 1WF5A 4GG6E 1K85A 1QSFD 4WEBL 1NMAL 1FNGA 5M7QA 2NY0D 3QCVH 5FYKL 1DLHB 1NC2A 1J1PH 5C2UB 4IRJA 4DGYH 1WFUA 4BJLA 2EDHA 5DVOA 3RAJL 1EAJA 1H5BB 1INEH 3CZJA 2X1PA 5GGUA 3X12A 4FFWC 1HHKB 5ETUB 1DUYB 2VKXA 3WFHA 5IROC 3ARFB 1A6UL 2PYEE 2HAZA 1T22B 3NA9H 5ERWA 4FP8L 2BERA 2QHRL 4LEXL 4UOJA 4PREA 1HIMH 4Q9RH 1QVOA 5FECA 4HAFA 5ALBH 5DVMA 4PGJA 3SPVB 1J0JA 1PG7X 4RFOH 3KYNB 1IGIL 4EI6A 4OZHB 1NBVL 4XB7A 3WEXA 4WTZA 4CDGC 1FZKA 4PG2C 1HXYA 3KJ6H 1RFDH 4RX4A 1I1AC 5HI4D 5SWSB 1E27B 5D6CB 3U82B 4ZO9A 1KCVH 4ZXBB 4G7VL 5HHVH 4R7DA 4PV9A 4ZAKA 5I75B 4NKMB 4YDIL 3C60A 3O2WL 1ZLUH 3STZB 4JLRB 4XPFH 4D9QE 1SJXA 4JM2B 4ZS6D 4XC1H 3ILPA 4FG6D 1XR9A 3KHQA 5IQ7H 3MBEA 1QO3B 4M8QB 3N0PB 3REWA 4HWBH 4UT6L 3TVMB 1EXUA 2R23B 4X9HA 1IAMA 5TQ2L 3T09A 3DUSA 2ARWA 2V9TA 1QR4A 3RZCC 2VAAB 4OUUA 2DWDB 1NPUA 2MQCA 5HYJA 1FAKT 5DEFA 3VXUB 1P5VA 4HHAA 2J1KA 2Y6SC 1XMWA 3VXUE 4S2SA 1CVRA 3UBXB 1UH2A 3V4PL 3IU4H 4EVNB 4S10A 3PWPA 2AGJH 3MA7A 4HUXA 3VWJD 3QIUC 2A83B 4I3SL 2EC8A 3BI9X 4WWKB 1HHJB 4PG9A 3HE7B 2AEQL 5BVJA 2NLJB 3LQZA 3QIBC 4X8JB 4YO0A 5E8OB 5E6ZA 5KS9B 2P8LA 3P30H 2VLKD 4HC1A 4KROB 3RDTA 4Z0XB 5E8NB 3IKKA 5KS9E 5IHUH 1MWAH 4KFZC 2XZQH 3C2SA 5EBLB 1HSAB 4UUJA 4X7TB 5BMFL 5D1QA 3B3IB 4KKBD 4XZUA 3C8HA 5DK3A 3GJFK 2VLLB 4OIIL 2K9UA 3MLVL 2Z4QB 4E5XB 2ITDB 4HPOL 4UBDD 5FHBL 1CCZA 5IFJB 5GRYA 4X6DB 4U6VL 5I8KH 5HDQH 1NANI 5A16A 1DBBH 4OZHF 3G5VB 4X6DE 5CJ5A 1UT9A 4X7FC 3S5LA 4NYLB 1JPTH 2WINA 3MGOA 1FZJB 3GK8L 4UT7H 3OJMB 2NY5L 5IB5B 1U8NB 4N5EC 1WCBB 3RRQA 3WJJA 4PUBH 1ZMYA 1TVBA 3STBA 2F9BT 3ARBB 3FO9B 3ZKXB 5BS0D 1AHWC 4L3EA 3BEVB 5MERA 3IXAA 1QFOA 3LRSA 5BO1H 1RZ7L 4JM2F 4JDZA 1UJ3C 4MJ6B 3QUYC 5C3LD 4S1SL 3MUY1 1RK1A 3O4OC 1IC1A 3TYGL 4WI5A 4ZPVA 2XV6B 3RWHA 1MRFL 3SHSA 2AEWA 4Y19D 4OFVA 3SKNB 4Z7WB 3UMTA 2IADA 4L4VA 1SQ2N 1KG0A 1X3DA 2ED8A 1TZGH 4HCRA 1JZ7A 5KSAD 1MPAH 3QDJA 5T3XH 3MUZ1 2E9JA 1QBLL 3QAZC 4GG8B 1DCLA 5EPMB 3HKFA 3UDWA 3BWAB 4P9ML 3T1WA 1VKXA 4WV1A 5EU6B 1INQA 5I17A 4KAQH 3A67L 1QPXA 4GXUN 4POYA 1NCWL 3U7AA 1OT2A 5B39G 3RY6A 1DSFH 2VQUA 1OCWL 5EU6E 2VDNL 1U8OB 5CHNA 3KLHC 2ICCA 5CD3B 5F1SA 4EN3A 2AS5M 3V7AG 4UTBL 4U7KA 4PB9L 3O6MH 4Z95H 1YNKH 2GT9A 3BX7C 4YHYC 1KGCE 2XQYG 1AR2A 4APQC 4M8QA 3U6RA 4ZSOA 4K94L 3ZO0A 4PY7B 4C55A 4XBPA 3WUWB 3NGBC 1MHPH 1JHKL 1H3PH 3HAEB 4XMKH 2CKBL 5D93C 3SE8L 2Q76A 4ALAL 4H20L 1G7HA 1OLZA 1GVIA 1HHHB 4X6DF 4L8SC 2VXVH 4IJ3C 4FXGB 2NYYD 4AL8H 4ODXA 3MLXL 4UAOC 4OLVH 2X4UB 3LEVL 1S9VB 4KHXH 5E7BA 2C1OB 4P59H 5FKPB 1KELL 3L3HB 4F7EA 3MRHB 3EO0A 4WUUB 3VXME 5I1JH 4LDLB 3U9UB 4ZDHA 3MV7B 1BD2E 1EIBA 1DBJH 5CJOH 4BKLA 4WUUE 1CGSH 5TE7H 3MV7E 2C4FT 5EZOL 5FA3A 3MRPB 2ED9A 3PP3K 4YGVA 5DRXA 1FAIL 3BZEA 5IESL 1U3JA 1A3RH 3MLUH 2FIKB 3B9DA 5KSUA 3HNSL 4ZOBA 1IBGL 4IOFC 4Z7VB 4Z0BH 4FFVC 5I1KL 1JV5B 4NOFA 2RBLA 1CLZL 2EDJA 3F7QA 4Z7VE 3QXTA 3BXNA 5F9WC 4LGRB 5E4EC 1LE5B 1CXEA 4Z7WF 4LSDA 5DO2D 3QXDA 3FT3B 1T21A 1NEZG 3BMWA 5DJ0B 1FO0A 2YD7A 4OLUL 4DQOH 4YE4H 2O61B 5BOPA 3T1FB 5A2FA 2YD3A 3BAEH 4WY7L 4YHPB 4LLMB 2QSTA 2ZCHL 3V6ZA 3A6BL 4P23C 1DFBH 4PJEB 1AGDB 1I75A 5F1IB 3BHBA 1QR1B 3SGDH 4Y1AB 3O3AB 4PJEE 2YD5A 5T1DH 2AXGB 4OT1L 3VFGL 5BV7L 3DROA 3QH3A 4KKLC 3VG9B 1OPGH 4Y1AE 3BPCA 1KYOJ 2WSKA 1QFWI 4MA8L 2P45B 2NR6D 5DJ8B 1H3GA 1QNZH 2X4SA 2VUOA 5EORL 1CDUA 3ZE1F 1L6XA 3QWOB 5D2NC 5JHLH 3U48A 1P1ZA 1PEZA 3QUMH 4YJZL 1J1XL 3AY4C 4GBXB 1S3KL 3H9ZA 4P5MA 5TDNA 4Z7NE 1Y18B 3U79A 4RRPA 4FQ1L 4PD4K 4HXAH 5IJVA 2COQA 4EUPH 4Z7WA 1DN0A 1E28B 5DS8A 4NQDD 4GMTH 4F7MA 3QA3A 1I9JL 1TMCB 1JGDB 5HJ3A 1F02I 2QEJA 3VWKC 4UDUB 3C5SA 3MODL 2OJEB 5C09D 2GJ6A 5ID1A 4NZTL 5D1XC 5F7UA 1V7NL 5KVFH 5D6DC 2BNUA 3EYVA 1C5BH 1NSNH 4OV6F 3EYFB 2OSLB 1OSPH 1TZIA 5DD3L 4OSUH 4XC3L 1JL8A 2AW2A 4X4XA 4KPHL 4Y4FB 1SYSB 4LPUA 4KI5D 4ZPTB 1XEDA 2XKNA 3DETD 4TVSa 1IT9H 5FYLE 2ZG1A 1UACH 2OZ4L 1T89A 4JVPA 3DO7A 2YWYA 1FIGL 2VLRD 1RVFL 1PLGL 1ZEAL 2MHAB 3O3EA 4YXLH 4YXKH 2VERN 3HC0B 4L3AA 5C0GA 4HJJL 1N6UA 4I1NB 1BREA 3VXSD 2EKSA 3B8SA 2AV7B 4OV5B 2CLZB 2PYFB 4Z7UA 5T1KB 5HPMA 1J7VR 1W72H 5H37G 3GNML 2ZOKB 2BSSA 4NNPH 1OY3B 1NUNB 4RZCB 1MWAB 1WT5A 1GC1H 4JFDD 2AK4A 3U36B 2GSGB 2QTEA 3PP4L 4QEGA 1KXVC 3L3DA 1T7YA 2YD8A 3WXVH 4QHNA 4L1HA 3BKJL 1NAKL 2A9MH 1IVLA 5DI8A 4N0CD 5J12B 2KH2B 1B0WA 2AJZB 5I66A 4QTHB 3QUZA 5IBTH 3ULUE 1IMHC 4P2OD 1CFVL 2FWOB 3OJ2C 2ZUXA 2Q86A 2O26U 4AZ8A 4W6YB 5IBUB 3RP1A 5FM5M 1CGYA 2AJXH 3DVNB 1LE9A 3UTPE 4HKBA 2VDQL 1EV2E 1SJVA 3RWEB 3AUVA 5DT1H 5CBAA 1FIEA 2C3XA 2BVPA 3L95A 3FB6B 5DRNB 5D2LF 3O4LA 2ZUTA 5M95B 4FQXD 3U4BL 1S9XA 4Y4HD 3TN0A 3ZKMD 2CQVA 4J3UA 4Y5VB 4XPAL 3RL2A 5IFAH 4PJBB 1LO0H 3L7FA 4MA3A 1GL4B 1HCFX 4QCIB 5CZVL 2JB6A 1U8MB 3KNBA 1C1EH 4XH2A 4PJBE 3I6KB 4ONHA 1IZKA 4FMFA 3PGDA 4PJ8C 3TO4C 3UYOD 4K3HA 3P0VL 3O2DH 2CDGA 3W9EA 1Y0LB 1NJ9A 3AAZB 2BP3A 3KDMA 1V8HA 5CJXA 1T83A 2EE2A 1INDH 5T3XE 4IDJH 2X05A 2BXYA 2VXUL 5CILH 4BH8B 2LFGA 1MCFA 4ZD3H 4I8DA 1AO7D 1CFQA 6FABL 5KVGL 5EC2A 4LQFH 3QEGL 3QIUD 5T3ZD 5DJDA 3EDFA 3WN5C 2YD6A 1GYAA 3OKLB 1TZHB 4G6FB 4RA3A 1W0WB 5D2LA 3VXTB 5CINH 3FO0L 3P4NA 5GS1A 4Y89A 1BFSA 1KJ2H 3CGTA 3C2AH 3FQTB 1PSKL 3OXSB 2D7TL 3DV4B 1JE6A 3D2UD 4HWBA 2A74A 3NPZB 2DBLH 4IMLB 3QDGD 4PGBB 5DK2B 4KQ3L 4NGHH 4CNIA 2AABH 1E4JA 2EEBA 4CADA 4LVNC 3VD7A 2Z92A 2YPLB 5K9JL 3LEYL 3KPQB 5K59F 2NY1B 3OJDA 1BFVL 1EEZB 2YPLE 3NFNA 1JHLH 4OZFG 1PZ5A 3SDDC 1PEWA 1ZSDA 2BVYA 2EZ0D 2DLGA 4JPWL 1I8IA 3MGAA 4W4OA 5MEOB 4MAUH 1RHFA 3HMWH 1BBJA 3M17B 2ICES 5D5MA 2BNQB 4XX1E 2MPAL 1CD1B 4H8WL 1OP9A 1Q72H 2BNQE 4LLDB 1EEQA 4KGLA 5EBWB 3ULVC 3MJ9L 1I3GH 2Q6WA 1CF8H 3GMNB 1FNAA 3IAGC 4NM4L 1MWAA 4J6RL 5SX5K 1T03H 3UTOA 3IFNL 4AG4L 3P9MA 1BVKB 4BSWA 1KLFA 2ZSWB 1JMXA 1I8KA 3ZTJG 2EDYA 3V6OE 5I1EH 5E2UH 5MHSD 2GYSA 3FB5A 4K3EL 2D7OA 3OGOE 2KQMA 2OR9L 3B9AA 1CDHA 4NZDA 2VZSA 3KPMB 1A6AA 1PX3A 3E8UL 3SE9L 1K6QH 2PCPA 3ARDC 2KL6A 2X1QA 3U9PH 4K23H 1J1OL 1A6PA 4R8WL 1XH3A 4GW5B 4HV8A 1NQBA 1JVKA 4PLKC 4RBPH 2VZOA 4I18A 1F4WH 2JJVA 3PUCA 1YQVL 5E8EB 3IDJB 3OKOB 4M7KH 3S37H 4BH7B 2X89A 5J89A 4QRUA 3VI4F 1MFCH 2AJVL 3JWOC 2ZCKL 3KLHD 3HI5L 3WKMH 3P0YL 1TQBC 2MCPL 1A7PL 3IJHA 4Y2DC 2NW2B 3LKSA 3LQMA 3GHEL 3TF7C 1RUPH 1ZGLA 1RV6X 4HFWB 4LHUG 1X4YA 4APQD 4EUPB 1M7IB 3AREB 4DWHA 1UZ6E 4XAWH 3HNVL 2AEPH 1S78C 2GHWB 1ZLVK 1DZBA 2DAVA 1U41A 4JPKL 4LLWA 4QOKA 3ZKNC 5J6HB 1MF2H 3TV3H 1LO2H 3C5JA 3WBDA 1ZV5A 2IPKB 4G9DB 2EYSA 2JK5B 4KJYB 2NY6D 1QSFB 2FX9H 4HX1A 2NY0B 3VCLA 1KJ3H 1MCJA 1CXLA 4CN4A 3DARA 2IPTH 2DQDL 5T5FH 1QSFE 2JJTC 3DYPA 1CT8B 3O81A 5E95B 1SHMA 4QRQA 2EIZB 4M93C 4TVPE 4KKCD 4YAQB 1RZJH 4BQ8A 1B9ZA 2NZIA 4K9EL 1LO5B 5F9OH 4JANA 4FNLH 1SJEB 3D9AH 1BECA 4P5TD 3TBTB 2E6JA 4OFIA 2IBBA 3ZSSA 3PHQA 3CNKA 1NKOA 3E2HB 4XGZB 2CMRH 1DBKH 2F53A 4F7PB 2XWJA 3CFKB 2QADD 3X11A 5E00B 4F9LC 1NCDL 1S7SB 2YUZA 5DHXB 3B6SA 3U83A 2D9QB 3F5WB 3EKCA 3EOBA 3Q1SL 4G6MH 3ULSA 3EUUA 1NCBL 5E99L 4G42A 1TQCB 4NN7B 3O0RH 4L5FL 5C0EA 1KLGB 4AIOA 3NCJH 4OTXL 2GJZB 4KY1H 5FOBA 3UO1H 2VQ1A 1E6OH 1T7WA 3EYQD 3MRKA 4G9FD 3QEUB 1KTKE 2VQTA 3HFML 1KT2B 4KKLD 5I74C 1FNLA 5DUMH 5C0BD 2F5BL 2XQBL 3U7WL 2P5WD 5T33H 4YDLB 5IIEA 1JFQL 3W11C 4YUEL 1QKZL 2X7LB 4PP1C 1JTOA 4WI6A 3RKDC 2HFGL 4D0DA 3ROLA 2VLJD 1UZ6F 1OVZA 5LCVL 1U8LA 1R3KB 1GGTA 1QFPA 4M00A 1ZKAA 2ENYA 1BQHA 1FVCA 1S8DB 4XNUH 3W39A 4HC1L 1MCLA 5C0CD 4DVRL 5I1GH 1FPTL 3MLYH 1U91A 1YC8A 1IEBA 3QDHA 3RZWA 1QLRA 3SKOB 1OP3H 4NKDA 1QD0A 5C0NC 4OGZA 2Y36L 4M62H 1IZJA 5DYOA 3VGEA 2VLKB 3GRWA 3L7EA 1WCQA 2UUDK 1LD9B 4JHBA 2JIXD 1P4BL 1VADB 2XG5A 4DOHB 3TT1H 4K71B 3VMNA 2VYRE 2XN9D 2DYPD 3FTGA 1F3RB 3O9WC 4QXUL 4LCWA 3IVKA 1P7HL 3SBWA 4DOHE 3TA3A 4JFEA 1Q0YL 1SBSL 1F42A 4QXTB 5ITFA 3BT2H 3QUXD 4MXWL 2OM5A 4YDKL 1A7OL 1FORL 2J7LA 2AI0H 2Y9RT 3QUMA 1CDBA 5E6IA 3C5ZC 4X7DC 3L1OH 3X14A 1M7IA 1JNLH 3H0TA 3SGKC 1A8JH 1PDKA 1Z5LB 5FA4A 2W9EL 2P5EB 2H6PA 3K4ZA 4JFPA 4N0RA 5I2IB 1ORQB 2EEAA 2HFFA 1FVDB 4R6UA 1UM5H 1WEJH 1KFAH 2P5EE 1KPVA 1WWCA 1T80A 4O58H 2NNAB 1EFXD 3C8DA 2FB4L 5FGSA 5FV1L 4NZUL 3ZE2E 1TFHA 2APXA 1QFUL 2QHLA 3V0VB 4YBLC 3LKNA 4MAYC 4ZUWA 2A1WL 2BK8A 3GIVB 1KIUA 4I2XA 2R1WA 5GRJH 4ODHL 3UBXG 2B1HL 5JLZA 1Q9KB 4HCRL 2ED7A 2ICEA 3D5OF 3QDMA 3H42L 4WU7A 4J3TA 3NA4A 3O8XC 3C87A 2P43B 3ILQD 3QQ4B 4JFZH 4HH9B 4ZQKA 1KEGH 2FLBT 4R0LB 5DWUH 1I3RA 2E8ZA 2XPGB 3N1GC 4FTVD 1LEIA 2IAMB 4WHYG 5TH2B 2EYTA 1RULH 3ZT5A 1TETL 1XR8B 2Z35A 1BQUA 1XF5B 4DKEL 4J4PD 1G9MC 2YKLH 1I1FB 4JO2H 2YUWA 1G7IA 3N9GH 5T3ZH 5L2KA 1W72A 4YDJB 4DTGL 2VSCA 4KUZH 4DW2L 3ZYOA 4V2CB 5DFVD 3O6LH 3SGJC 5HHXH 5TQ0L 4F2MA 5I1AB 4WW2C 1ACYL 1Y6NR 5DUBB 3BE1H 2RFXA 1CIDA 3X3GH 3LN5B 1CTNA 3AMKA 5CEXA 4PRBB 1JGLH 4I9WD 1ORSB 1VERA 3TO4D 1J8HB 5L88L 1ZT7B 3BDYH 4PJXB 1B0GA 2V5YA 4KVNH 4MNQD 4B5EA 4WDIB 1J8HE 2IG2H 1MLBB 4LCYB 1JWUA 2X4TA 4DAGH 1FN4A 5FB8B 4TTDD 2NY5C 3PF2A 3SKJH 1U36A 3BZ4B 3VWJA 1HXMA 3MRCA 1NCCL 5SV4A 1MIEL 3T3PE 4E41D 1UVQA 4M8VA 1GGCH 2CIIA 4MLIA 5E94B 3SY0B 2PUQT 4GAJL 4GXUM 3QJHA 4M1CC 4P4KA 2ZKHL 3R06A 2FJGA 1FDLL 4X9GA 5JMOC 4JR9L 43CAA 3QULB 2H45A 4IIQC 1A3LL 5FHAL 5HGBA 2AV1A 2X09A 3E3QE 1UCBL 4P3CL 1KIQA 4L4TA 1FO0L 2RB8A 3QNZB 3MRLA 3ARPA 1OLLA 1NDGB 2FJHB 4MJ2A 4Q74A 3CX5J 1H3XA 4NHCH 3T8XB 3DSNA 43C9A 3QJFB 5DSCA 3P9LB 1L7TL 1JPFA 1WZLA 2J4WL 1A9EA 5AUMA 3RX7A 4JG0H 1BF8A 2DLIA 1QA9B 3IU3A 2ICWI 15C8H 5GSRB 2LTQC 1EFQA 1NGYB 1A1MB 5EN2A 5I1DB 1MY5A 4C83B 4CJ1A 2DLTA 3SDDD 3QG7L 2CXGA 5HYQB 3HC3L 3HZYA 5C6TH 1KIRB 5HHQA 3S34L 3E6HA 1G7MA 1O7VA 1WWAX 1LO4H 1MRDL 4ONGH 1XGUA 1CLCA 1TXKA 4MNGA 5JW5A 4JZNA 4OBRA 3HAEG 1A6VL 2XYCA 3DIFA 3V6FA 2FSEB 2EE9A 1KJ2A 1DLFH 4XNMA 1AQDA 5BS0A 3TBVB 5CEZD 5DD1L 5GSVA 4XI5C 1CLYH 4X99A 3V5HA 7FABH 5ITBL 4QY8B 2HWZH 5DA4A 1TTGA 3H6JA 3HB3D 4K94C 5E03A 3IKCB 4X5LA 3QUKA 4NFBA 1BQLH 4FZEH 5H2BA 3V79C 1QEWB 3QXAA 4JKPL 4OD3H 1RU9L 2GKIA 3S4SB 3VFMB 4PFEA 3E6FA 5TE4H 1SJHB 4Y19A 4PJXF 4ZFZB 4MDIA 1NLDH 3TO2B 1BZ9B 4L8DB 3CSYA 5KSAA 1IQDA 5ADPH 2WAHA 3JWDH 3HE6D 3B5TA 4MD0A 3SQOL 3EDKA 5KJRL 4WUKL 5B38B 1U8HB 3IDMB 3EYSH 4MB3A 3T3PF 5C09B 1T5XB 3JUZA 3PQYA 3FQRA 4N1EA 4P49A 4L9LB 4BQ9A 1MUJA 2BOCA 3OGCB 3GHBH 5IVZB 4MQ7B 5KVDH 3KG5A 1AGFA 1UM4H 1A7NL 4KKAD 4HG4J 3HLAB 3HPJB 4FOMA 4JZJC 2Q8AL 2VMFA 2DKMA 1F4XH 5IBLC 4BZ2L 2IC2A 2XY1A 5IP4A 4ZTPH 3QG6B 4C56B 5IEKA 3VG0H 2GTZA 5I8OL 2PO6D 4C56E 1S9WB 3LCYA 4PP2B 3LMJL 2DQUH 2PNDA 3BVNB 3DVFA 3TZVC 3J8F7 5BW7C 3NMEA 3MACL 5L9DH 4IMKA 3KPLA 2CPCA 4KK8D 4HIIA 4J2XA 3SE4C 3VXSB 1MJ8L 3QXWA 1YEJL 4QGTA 2R2EB 4NNYB 1U92A 1A2YB 2APVA 4NZJA 3UZEA 1P7KB 3X13A 4DZ8B 5C2BH 1I7ZB 2FL5B 5I1IH 3CK0L 3IJYA 3VFVB 1NGZA 1TJHH 3NFSH 4JFDB 3TPUA 2HLAB 3CH1B 2Z8WC 3HPLB 4JFDE 2V5MA 5I1HL 1NUGA 1KPRB 3PIQB 3CSGA 4OQTL 4UQ2A 1PD6A 4QXGL 5IFHH 5E9DD 4D8PB 1I7UA 3D39B 5INCA 4TPRL 1Q1JH 2M26A 4XPHH 3ECBB 4M6MH 3B83A 5C6PB 3D39E 2WP3O 2E7HA 1EK3A 3MNZB 4P2OB 3HUJB 3QCVL 3MNWA 1J1PL 3CFDB 3D48R 3HUJE 3FJTA 4WFED 4DGYL 4GAYA 4WIQA 4X6FA 4YHNA 2V2XA 3MMEA 3T3ME 1YEFH 2VXTH 4UI2A 3O11B 4XP4H 1JNNL 5DFTA 1WJ3A 2Z8SA 4GOSA 5GHWL 1FFQA 5IK3B 5DMKB 4NCC2 2FECI 1F00I 4FQXB 3FT4A 3NA9L 4XXDA 4Y4HB 5MENA 2HLFC 4JN1H 3RVXC 3O6FA 4LSUH 5EO1A 4Q9RL 2HT2C 3HI1B 2OXGA 3AMLA 5ALBL 2HTKD 4KDTA 4RFOL 3BQUB 1G7QA 1FFPA 5IR1B 1MJJB 2YRZA 4NC1E 5E2TH 1FG2B 1SYVA 4JN2B 3KJ6L 1RFDL 5F8RC 3K80A 1JPST 2BSTA 4KI5F 4R90H 5C0JB 2VSDA 2ZG3A 1KCVL 2DM7A 3RKDD 4JREB 4Q6IC 2M8XA 5HHVL 3QI9B 5EIIB 3MV01 3FQWB 2E7LC 4XPFL 2BVTA 2F8VA 4AEIH 3S96A 3V4UH 1AO7B 4RAVA 1IE5A 4XC1L 4NQDA 4PRPD 1Q94B 4PBXA 3BD4A 3OBAA 4OD2B 4HWBL 1C5DA 3D3VD 4Z5RB 1L7IH 2R1XB 4NQCB 4AH2A 3MRBA 2NY4C 4XPBL 5ESVB 5C09A 3C6LC 5I16B 5GRXG 4BSVB 4NQCE 4LVHB 5IBUG 1YYLH 5EOTB 4YR6B 1SVCP 4OZGF 3WXWH 4M6OH 3VI3E 5CWSA 3PV6A 3D2UB 3JVGC 1P7QD 4RAUA 4ZO6A 5D7LA 2QSVA 4X7EC 3O9WD 4MQ7A 3IU4L 1SM3H 3ZDYE 5HGGS 3RVUC 3I75B 5IW1A 3KGRA 3MROB 1K8IA 3DXAA 4Y4KC 5FYKU 3ARTA 4NKQB 4Q9CA 4NO3A 3SE3A 4OFYD 2XICA 5H94A 2WLYA 3CCHA 5HDBE 3P30L 3NH7H 2KKQA 2VLRA 4HFUH 3T3MF 2OMBA 1S7VA 3CFIC 1BM3H 1MWAL 2XZQL 4OLYH 4UOW0 2WUBH 1B3JA 4JRXB 1VPOH 4P57B 4TNVF 2VL5B 4JRXE 3WIFA 4G8GA 1D5ZA 1RAMA 5IB3A 1VEPA 4OZGA 1T04A 1CK0H 5HDQL 4FQIH 3QZWB 1IARB 1UWXK 1DBBL 1R3JB 2AQ2A 4X4YA 1FZMB 3T65A 3KLSA 4X5XB 3SJVB 3QWQB 4JHAL 5E1AA 4OAWA 1JPTL 4X4ZA 5IROA 2N4IA 3SJVE 1LEGA 2ZUQB 4UT7L 4ELMF 3EO9H 2EO9A 3P9WB 4K3JH 3EAKA 3FN0H 2A6IA 5JMRA 4PV8A 3OKKA 3T0EB 5F88B 3S7GA 1TLKA 1WBZA 5F7KC 5D4QA 4BSJA 3DV6B 3T0EE 1N3NA 4ZTOH 5C0AB 5DRZB 2HP4A 3QHFH 3B2VH 2AVGA 4PG2A 1DBAL 1I1AA 5C0AE 3O11A 1YQ2A 3FFCD 1M6OA 1A1NB 4HSQA 3GMPB 1QSZA 3MRQB 1IC7H 5DZOA 3Q6FB 3Q5YA 3KXFD 1JF1B 1L0QA 2R2HA 3MLRH 5CD5D 4O9HH 3VI3F 2IALA 1TZGL 2YBRB 1U8QA 4OIBA 3QIWB 1MPAL 4EDWL 1IQWH 4WO4D 4HIXH 1XIWC 2O5ZL 4YDVB 1FYTD 4XX1G 1R5WA 5AAMA 4NJAH 1WVZA 1D3CA 1FSKB 1MCBA 2E7CA 3FOLB 3OXRA 1Q9LA 1FG2A 3ZYJA 2H8PB 4LOUC 2J6EH 2HA1A 3RGVC 4KAQL 4ELMA 1IL1B 4PTTA 1QYGH 1BVZA 1DSFL 1I8MB 5HVFB 1KCUH 2R4SH 3UYRH 1KB5B 4PJ7A 2GSIA 2BRRH 4QO1A 4FXLA 4Z95L 1OB1B 1YNKL 4KRPC 3BIKA 2WIIB 3MQIA 3QIUA 3FOMB 1G6RA 1FL3B 2L4OA 4YIQB 2Z91B 4P4RA 4V2BA 1N64L 2IF7A 4O2EA 1PKOA 3NZ8A 4HPYL 2VITB 3ARZA 1MHPL 3WO4B 4JGUA 1H3PL 4U6HA 4XMKL 4GAGH 3PWUB 3O4LE 4XPTH 5CEZH 1QRNB 5IHZA 1A7BA 4H0GA 4F33A 3UZQA 4OCXH 3HZKB 4G8FB 2DQEH 4AL8L 5MEQB 3D2UA 1QRNE 4G8EA 1LEKA 2QADB 4N1CA 4OLVL 3QDGA 4U6XB 3VFTA 2FR4B 4KHXL 2EICA 2C1PA 1TTUA 3CPLA 4XCFL 2X44D 2EIEA 2IFFH 4AK1A 3TC9A 5DJCB 4HK3N 1XZ0B 2W92A 5I1JL 5CJQL 2H2PD 1SEBB 4RMRA 4U1GB 4PRDA 2Y5EA 1DBJL 5CJOL 3QFDA 4NHUB 3IDNA 3ARGB 3PWNB 1CGSL 4PJ9D 4MDJA 5TE7L 4N5UA 4ETQB 1XF4A 3E0GA 4Z18A 1BIIB 2QQKH 1A3RL 2WLZA 3P11H 1RZFH 4EUPG 5GIRB 2J3SA 4R3SA 2BC4A 4Z0BL 2NQCA 5DC4B 4URTB 4W6WB 5FXCH 4WNQB 4GW1A 2ARJB 4JY6B 3BZFB 3BRGC 4NKOB 2P5WB 1IGJA 5SWQB 5T1LD 4DQOL 1WWBX 4YE4L 1FRGH 1ZLWH 3DSFH 1JZ3A 3JWOH 4F7TB 4HUWA 1UJ3A 3BAEL 1PGRB 3QUYA 4IRJC 4PJ5D 2E6QA 2VLJB 4G5ZH 1DFBL 4JFYA 4NZRH 2VLJE 4UT9H 3QPQD 1DQQB 2DKUA 2F19L 1A4KA 5C0CB 3NVQA 4ZNCD 4AYFA 1YUHA 4LPXA 1UXSB 5C0CE 4NQXB 4YFLF 4JEGB 1ED3B 5BZDB 2I25N 4MJIB 3TIEA 1QNZL 1K4DA 4K9EC 5C08B 4IRZH 2VDPH 1A1OA 5JHLL 4MJIE 2AQ3A 3F7RA 3QUML 5C08E 1G7LA 5T1MA 1HH6B 2XN9B 2HJLB 2DYPB 1A3QA 1JYWA 4HXAL 2LU7A 5D5ME 3WLWC 1BPVA 1IFHH 2XN9E 5IWLA 1EHAA 4P3DB 4GMTL 1UYWH 3QUXB 4Y5YC 2UZXB 1JWSB 4ZAKC 3WO3B 2NW3A 3U2SA 1ZHBA 2W60A 4G8IA 2PR4H 3I85A 3R1GH 4JDVB 2EDEA 5DUPH 4DUXA 5D71H 1WTGT 3TIDA 5I8CA 1NKRA 4APQA 1XF3A 1B6DA 1ZANH 5F1KC 3LPFA 3WFCH 1CXFA 2FJFA 1L0YA 5KVFL 3F7VB 4BUGA 3MBEC 2ADFH 4F57L 2WP3T 3TZVD 3ZTNH 3MLZL 4QNPE 1BWWA 1MCOH 5KG9B 1NDMA 1C5BL 3CDGB 4GS7B 3BJ91 2E27H 5FUZH 1OSPL 4LVOC 4X4ME 3CFJA 1A6ZB 4MXVE 4CN6A 1IEAB 1KPUB 1X5ZA 1CD0A 1OAYH 1U8JB 1UACL 3NN8A 4LNRB 1KIPB 2B0SL 5F7DB 2RGSA 2B4CH 1RJYB 3VXPA 2FBOJ 1I7RA 5C07D 5GGSY 2DB8A 4YXLL 1YMMD 4P5TA 1BHGA 4PD4J 2VABA 1JN6A 3RNQB 1S7QB 5F97E 3CXHK 4YXHH 1F3JA 1R6VA 3ROOB 5EU7E 1W72L 3RI5F 4ODBD 4FTVB 4NNPL 4MLSA 2FHFA 2X6MA 3V0WH 4HIHB 2EYRB 4FTVE 1GC1L 3KJ4C 3VXOB 5D1QC 5CS7A 4HS6A 4KHTH 4MWFB 5EUKA 1I4FA 3WXVL 1OD7A 2CD0A 3LKOA 5FYJD 4DK3A 2A9ML 2E8YA 3QWRD 5DMYA 4P23A 4OD1H 1EBAA 5IBTL 5IT2H 4F37F 2Z8RA 3VXNA 1NUDA 4G9FA 4MA1B 1YNLH 3PABA 2OS7A 2AJXL 4X0KA 2AQ1A 5C0BA 2WV3A 2DQTH 2P5WA 2B39A 4MCYA 1K4CB 5SWQA 3WJJC 4MNQB 5DT1L 5DVKA 1TDQA 1EUUA 1MHEB 4LSSH 3VD4A 4MNQE 4NSKB 2BVUA 5D2NA 2BOBB 3AY4A 1EAPA 2AJ3B 2DQGH 5D72H 1VHPA 4HKXA 1H5BC 4C58B 5TGBA 4QNPF 1RSFA 1LO0L 3S35X 5IMMB 4R4BB 1C1EL 1PYWB 3ARFC 1S7TA 3MRDB 3PL6D 3RGHA 4M5YH 3VGDA 1UQSA 5FO9A 4MXVF 4OF5A 1AP2B 2IBZX 3G6JF 3O2DL 5GGSB 2HJKB 3UJJH 4HZLB 1PAMA 4WU5B 4QHKJ 4XRCA 3QEHB 5B8CB 5D1XA 3GSVB 3FFDA 3UDWC 2JIXA 5D6DA 4GRMA 1INDL 4IDJL 3FO2A 2R8SH 5CILL 4KK9C 4XAKD 3EGSA 2CK0H 3UAJD 1T1ZA 3LN9A 4ZD3L 4JKWA 5ALCH 2Q7NA 5CLTA 4J8RB 4LQFL 5F3BA 1G1CA 4ZXBC 4KZEH 3SDAD 1AE6H 3FQUA 1DUZA 2NY7L 1K2DA 5I75C 4YH6A 4JCLA 5T5NF 3SDYH 5CINL 4JM2C 1KJ2L 4WTXA 3GSNH 4QRSA 3C2AL 4S1QH 1OF2A 3QQ3A 4JY4B 3NIGF 3TVMC 2EIBA 4XVUD 1X5LA 1RIUH 3S36X 3WHE1 1G9MH 4HGKC 1LK2B 2DQCH 1EFXA 4NGHL 5FV2A 3AGVA 3G6JA 2AABL 3RVVD 1A7QL 3BP5A 4KJWD 3RPKA 4ONFH 1WUNT 4WRLA 1I3VA 5F1NA 2BVEA 4CJ0A 1OQXA 5CEZE 1UC6A 3FAXA 4JKMA 1QSED 2VE6B 4WWKC 4MAUL 2FNBA 4XP1H 3MLWH 3MLTA 4O51B 4P99A 3VFPA 4EDXA 3HE7C 4U1MA 4NUJA 3BEWA 4L8BA 3TJHD 3DGGA 5DEZA 5JPMB 2CO6B 4PRAB 2B5IB 4G6KL 4QRPB 3H3BC 4KROC 3HE6B 3ARRA 3FQXB 3O3UN 1EBPA 3W82A 5FO7B 1CD9B 4QRPE 1CF8L 1T03L 2P47B 5C9JB 2Q7YA 3F6LA 3EO1B 5KTEH 3LEXB 2GITA 4YZFE 5TDPB 1V5JA 5D70H 5KSBB 5I1EL 4RNRB 2QQLH 4HWUA 3CFBB 1BFTA 3MA9L 5KSBE 4JAMA 5IJKC 3FT2A 2FGWH 3M8OH 4TUOB 1S7RB 1MELA 4JO3H 1K6QL 3LV3B 1QG3A 3ELAT 3PNWA 3T04D 4X80H 4K23L 1J88A 4O2CB 4K3GA 4LDOB 1A6TA 5I73B 1X44A 3WHE0 3WE6B 3X3FH 1FNHA 1A14H 4LLUA 4IBLT 4UDTB 2IH3B 2N56A 2WWKT 4KUCD 4ORGA 3TO4A 4Q2ZA 2N7BA 2PO6B 4POZC 1F4WL 5C0FB 3RGVD 3ARBC 3ZKXC 3I02B 4MNHB 4M7KL 3S37L 3HI6H 1SY6H 4LIQH 1XCQB 1Q9WB 4P2QB 1MFCL 1AGEA 3WKML 1H15A 2A73A 4P2QE 3IF1B 5EZJA 1YMHA 4GKNA 3H9SB 2H32H 3B43A 4E41A 5H35B 1H9VA 2PXYB 3H9SE 4G3YH 4XAWL 5GGSA 1SVZA 2AEPL 1ZTXH 3BDXA 3O45A 4LCCA 1BP3B 4HBCH 4C54A 5B38G 1FBIH 1MF2L 3TV3L 5ACZB 1LO2L 2A0LD 4XNYH 4XCYA 4ZMAT 3U4EA 3MUHL 2FX9L 1CVSC 1H8OA 3OKDB 4IRSD 4I3RL 1KJ3L 2J6EA 1QQDB 5LWYL 4PRHB 2IPTL 4XTRD 1GRWA 1HEZA 1J12A 2WANA 4PRHE 2OBGA 1GGIH 2IANB 4HWEH 1F6AA 4JRYD 5AG8A 1RZJL 5JHDD 3IDIB 3RL1B 3LHPH 3BPOC 2IANE 5F9OL 3MRIA 3CSPA 3D9AL 3O2VL 4JE4B 1ZA6A 3SDDA 3L3IA 2R9HC 1R24A 2XG4A 3FQNA 3D6GA 1YA5A 2DTSA 4UZGA 4QRRA 4WW1A 3GSXA 3GSUB 1AFVH 5BRZD 2CMRL 3K8LA 2CIKA 5C3TA 2CDFB 3OX8B 3B2UD 1CWVA 3MJ6A 3A6OA 5DLMH 5CKAA 4Q6YA 5ICYA 3MNVA 2CRZA 2C3GA 1ZHKA 1H8NA 4G6ML 3MRJB 3BP6A 5I15H 3OAZK 2R0WH 3O0RL 4PIRF 4PJFF 2UYLA 1WT5C 2AJYH 4N9GB 4F9PC 3MRGB 1FJ1A 1EGJH 1NCNA 4KY1L 1JZ6A 2AKRB 3UO1L 1EJOH 5HHMD 3G6AA 1E6OL 3LSOA 4I4WA 2I9LA 3AS1A 3MOAL 4G43A 1UADC 2FYYA 1MJUH 3K1DA 1X6NA 1IAKA 3ARDA 1U2CA 2OR7A 5DUML 3QUZC 3BISA 3NIDF 4XBGA 4MJ5B 2MCG1 4P2YA 3SGDI 4P5KB 5BQ7B 2VDMH 1N59A 1GHFH 3D85D 4PR5A 4UIKL 3AM8C 3JV4B 1UH4A 3OZ9H 1P4IH 4D0CA 4GUPA 5DQ9A 5EU3B 3HS0A 4N0UB 1UKQA 1S5HA 1P7QB 2EEDA 4GFTB 5LG1A 1Z3GH 2XKUA 1WZ1H 2OL3H 4N0UE 3WLWD 4XNUL 1E0OB 4H5SB 4IM8A 4CW1B 5I1GL 3MBXH 3WL9A 1DTUA 4Y2DA 3PHOB 4A2MA 3MLYL 5HVWA 3FONB 4PJFA 3HRZA 1ZWIB 4NQED 2HRLA 4HMEA 4M62L 4M7ZB 4W4NA 1FV1A 4LHUD 2WW8A 4U3CA 3MO1B 1AD0A 1ODAA 3SDCB 4X7SH 2I9TB 3TT1L 2IPUG 3STLB 2Q8BH 4ELKA 1JI1A 1KOAA 3U0TB 2VZVA 4HLZG 3D25A 3QEQD 5CSGA 1X7QB 2DJUA 4LHJB 2BNRB 2XNAB 3CD4A 5EWIH 3BT2L 3KPSD 5FYJH 4GBXC 5E8PA 3UROR 2BNRE 5HHPB 4JQIH 2AI0L 3AXLA 3FRPG 1MLCA 2JJTA 3LZFH 3NTCH 5EU5B 5IB2B 2OQJB 1NGXA 5J9PB 5JTWA 4JFQB 2W38A 4TTGA 3L1OL 3OSKA 2O93L 1JNLL 3KR3H 1CICD 1QLFB 4TQEH 5E9DA 3BESR 2JCCB 5M94B 4YPGB 5IW6B 2VDLH 3MJ7B 2JCCE 3MFFB 1UM5L 2VZ3A 5MI0C 1KFAL 3P2TA 5DEGB 4O58L 3A6CL 5INDA 3RUGA 3GSNB 3BUYA 4JFFB 4RWYH 4F9LA 5LJYH 3GMOA 1QLEL 5GRJL 2MFNA 5TDOB 4ISVA 4JFFE 1KNOA 2K3TA 2X4NA 1N2RB 2YWZA 3VFRA 5FGRA 3A0OA 3TBYB 1OTSC 1RZ8B 3FFCB 3LN4A 3VRIB 4UIMA 1X5HA 2YZ1A 5GGQH 1NC4B 4JFZL 3L5JA 4K7PH 3VA2C 3UTSB 4YHKH 1N0XH 3IFOB 1KEGL 1A0QH 5JR1H 4OJFH 3OL2A 1RMFL 4WO4B 4FQQB 5D7JD 5DWUL 3UTSE 4UILH 1YJDH 3RX8A 3HZMB 1KXQE 1P4LB 2WQRA 2ZUUA 4YHMH 3B8YA 5CBEA 3M45A 1FNEB 4Y5XB 4KJQD 1RULL 4AENA 2F5AH 1A4JB 2YKLL 1T0NB 1D5BB 2VNCA 1HI6B 5EFIA 3FKUS 4JO2L 4DKAA 1WC7A 5T3ZL 3GMQB 1G6RL 2D03H 2LU3A 4HDIA 4QF1A 4KUZL 3B9VA 5DGRA 1FC2D 3O6LL 3QZWG 4R7NB 4NWTH 5GS3A 5HHXL 2AJUH 2XZCH 4OGXH 2CLRB 2PYED 1C12A 3BE1L 4P3WA 1EZVX 2FZ3B 4PRPA 3X3GL 1FL6A 3ULUC 3U46A 5J12C 4U6YA 2FATH 2CLVB 2R2BB 1HHGB 2CRIA 4FQCL 3WIHH 4AM0B 3D3VA 3BDYL 1VFAA 4KVNL 4LP4A 1T7ZA 3F7YA 4GW4B 5HHNB 1JRHH 4HKZB 5EBGA 2IMMA 5H37H 2IG2L 3NFPA 1DQMH 1LDPH 4DAGL 3F12B 2R39A 1R3HB 3O9WA 1FGNH 3L5WB 1BF2A 2DQFB 2IQAA 4OLWH 1GGCL 2EDBA 1NFIB 2X4RB 4LLVB 4D9QD 3FN3A 4Y5VC 1RD6A 4OFYA 2AXFB 4XVTH 4KDVA 4PJ9B 1P53A 2V2WB 2CJUH 3BKYH 3C5ZA 1CG9A 4X6BB 1G7PA 1AR1C 3OKMB 2H32B 4R97B 3SGKA 3VXRB 3S88H 2YOCA 3OAYK 3BPNC 3CMOH 4WI9A 3VXRE 3MREA 3BYTA 1U3HD 4G7YH 4N0YH 1ZLUK 4ZYKB 4HIJB 3DX6B 2XRAH 4DZBA 5ISZB 4PY8I 5IVXA 4PS4H 3WUZA 4LCUA 4BQBA 4JG0L 3VXUD 2SEBB 4GRLB 5ISZE 4MAYA 3TBSA 2HKFH 5JO5B 5C8JA 5F70A 2V17H 5E8DH 4Q9QH 2CDEA 5C6TL 1EVTC 4OZ4A 4PJ5B 3U7YL 4QRTB 2ADJA 2MTPA 1P84K 3KWWA 2G5BA 3O8XA 4ONGL 1LO4L 1XGPB 5DJAA 4DUWA 4WVRA 5DJYB 3DURB 2GEEA 2BMKA 8CGTA 5E08H 4OQ1A 3DRQA 1VACA 1EHLH 5DHVH 1R5VA 3PWJA 1DLFL 1XT5A 1ADQH 4J3XA 4HULB 1CLYL 1JBJA 3QHZL 2HWZL 5ANMA 1HILB 1JF6A 5I1LB 4GRWH 1V3MA 5A3IC 4FZEL 2VIRA 2A77H 2YSSB 5JW4R 2ZOLA 2HT3D 5KN5B 1LP9B 3GJFB 1PVHA 4PJCA 3KXFA 4JZOB 5J4MA 2NY1C 2NCMA 3JTTA 1DL7H 1NLDL 1T1WB 3G9VA 5ADPL 2NY3B 3JWDL 3QNXA 2VO5A 3KYOB 4WW2A 3ZHLA 3OMZA 1FYTA 5L8KB 1KCSH 4OKVA 2G2RB 3EYSL 3KPNB 3G5ZB 1O0VA 4N0FB 4JPIB 3ZDXE 3ES6B 1Q9OA 4FQHB 4POZD 3DBXB 3TNNB 5B21A 5I6XB 3IAQA 1BIHA 5KVDL 5SWZB 1MCSA 3LS4H 1UM4L 32C2A 4O2FA 4NUGH 5SWZE 4OZFH 4XBEH 4DKFH 1HSBB 1BGXL 1TCRA 4P46D 3MRRB 2DI9A 1LDSA 4RIRB 3OKYA 3FCTB 2J5LC 3VG0L 2OL3B 4K7PY 4YX2H 2NXYD 4HS3B 2MQ3A 1UA6H 1BFOB 3SDXB 1K5NB 1F11A 1U8IA 4IIQA 3MLPA 5L9DL 5LBSH 1RIVH 5F7FA 3SDXE 2DM3A 3BP4A 2LAGB 3IXTB 5IMLB 2Y07L 5C2BL 5FM5O 5AWNH 1NAMA 2XZZA 5EU6D 3TBWA 5I1IL 2WBJD 1DE4A 1CFSA 3ZTJH 4NNXB 3PDGA 1TJHL 3NFSL 5EO0B 2UVFA 5F96H 3GBML 3RZCB 4Q0XH 2KDGA 3V9FA 1GPOH 3GI8H 2EDLA 1JK8A 2X4QB 1RI8A 4HJ0C 2EH8H 3V4VH 1Q1JL 5D1ZD 3IYLW 2R9HD 5BJTB 4M6ML 1JGVH 1MH5A 5I19H 4ODUB 4PYGA 12E8H 2DJ4A 5DRWA 3AREC 1PQZB 3CUPA 2D7MA 2L0DA 2UZIH 1F8TH 4CAGA 4CMHC 5CMAA 3KHOA 4GKZA 3QCTL 1LP9F 2Z31D 3QR2A 4P2CG 4OM1H 1KXTB 2SEBA 2V2TA 4JGMA 3JTSA 1YEFL 3QIBB 1D5MA 2VXTL 5T1LA 4XP4L 5E5MB 2NY0C 5K9QI 2ZJSH 3VXMD 1HH9A 3ZDXF 1BD2D 5FOJA 1IKNC 3RU8L 3OKNA 4JN1L 1WAAA 1WBXA 3OTTA 4LSUL 3MV7D 1FNFA 1T20B 1YN6B 4K8RD 3KAAA 3PL6B 5F89B 3WSQH 3WV0A 25C8H 3TJEH 3E2HC 2C7UB 5E2TL 3MUGA 1ETZB 2OTWB 3MR9A 5E2JA 1DQJA 1AGBA 5T5NG 4NQVA 1CDIA 5HYSB 2HFEB 4EI5D 1AIFA 4H1LH 4R90L 4DN4H 3FMGH 2D0FA 5DK0B 3GMLB 3TT3H 4WEMB 2HJFB 1HDMB 5KN5A 2C3VB 3EYUH 5B39A 5DJXB 1JNHA 4JFXA 4XP5H 1CGTA 3HR5B 5DHYA 4LARH 1J5OL 4AEIL 1TQCC 3QO0A 3V4UL 4NN7C 4XAKE 3ZYIA 1AHWB 5K9OA 1CQYA 2X4PA 3SDAB 3RJQB 4JZJA 2W59A 1GC1C 4J3SA 4KWUA 1RZKH 5DD0L 2PF6A 4HJGB 1T1XB 1EGJA 1L7IL 2VLME 3NACH 1NANH 4POUB 1AC0A 3GMMA 4PJGB 4ZS6C 1U8KB 4ZUSA 1BBDH 1S7XB 4FG6C 1RUQH 1YYLL 4PJGE 1K8DA 3WXWL 4M6OL 4UNUA 3CFEB 4MCZA 4AEEA 3DRTB 5IB4B 3MFGB 1PG7H 3TZVA 5BW7A 3OB0K 4D3CH 2Q3ZA 3CZFB 1J11A 4YDLC 3MJ8B 3Q3GA 1T4KA 1SM3L 1ACZA 3SE4A 4XVJH 4MQXD 2NTFB 4XNXH 3N1FC 4ZFFB 3RWGA 3AU1A 4M9OA 3BSZH 1Z9OA 1FZOB 1HYRC 2NMSA 4HUUB 1OARL 4ENED 3C8KA 2H9GB 3VWJC 1S7UB 3NH7L 4HFUL 2G60H 1F5WA 2Y7QA 5HVHB 4W81A 5D9SB 1QSEB 5C07A 1YMMA 4QYOA 5EBMA 4AMKL 5ILTH 5FO8A 2OTUA 1XCTA 4OLYL 5F1OB 2WUBL 2EIDA 3BW9A 1YN7B 1ZVYA 1VPOL 3ZL4H 3MRNA 5ICXA 2VKWA 1CZ8L 1N7MH 1KC5H 4HF5H 4U1LB 5DD5H 5I71B 4K71C 1I9IL 2R0ZH 5SX4I 3RQ3A 1R3IH 4ODTL 4U0QB 1MREH 2QKIB 3NGBB 4KKBC 1DEEA 2CUIA 2X70A 4LSVH 2OK0L 2BCKA 1NEZA 4Y4FD 3T0XA 1AH1A 4RMVA 3IJSA 5DJZA 4UBDC 3HHRB 5FYLD 4L8SB 3VFNB 1NBYA 2F54D 3QWRA 4A6YB 3EO9L 3CC5B 3FN0L 4A2LA 5JIPA 3GBNH 1AD9A 5DTFA 2ORBH 5DJ6B 4RDQG 2GK2A 2D7PA 3BKMH 2D3VA 4I48B 4KK5D 1ZA3A 2DMBA 3CH8A 5F9DC 2A38A 3QHFL 1GAFH 1KACB 1JGEB 2D2OA 3G6DL 3V5KA 3I3DA 3VXQB 1DDHB 4HKJB 1KENH 3MV8B 1F97A 2VXQH 1DVFD 2ESVA 2V7HA 1FVEA 1MJ7H 3MV8E 4Q6IA 3MLRL 4O9HL 5IOPB 1TVHB 4GRWB 4JO4H 4NPYA 3VRLE 4PRNB 4L29B 1IQWL 4HIXL 4N8VB 3BOVA 1S5IH 2Y5TA 1YDPA 4GRWE 1F90H 5E4EB 1OSZB 1V3JA 1WGOA 1TTFA 3FHAA 4KMTL 1UZ8B 4NJAL 3L3GB 3D1MC 5FCUH 3ULUD 3SKMA 2GK0B 3QFJD 3EOTH 4ZNEA 2NXZB 1S9YB 3V52H 5KSAC 1T3FB 2GCYB 1ZHLA 4M1GH 4R0LC 1P2CB 2J6EL 3QQ9D 2OP4H 2DLFH 2DOCA 5TFSL 3C6LA 4IHOA 1QYGL 4JG1H 2IAMC 5GS2D 1NGPH 2DQIH 3RWFA 4B53A 3EOYG 3GSQA 1AY1L 4L3CB 3CSBA 3DNKA 3UYRL 5JXAH 3JVGA 4JM4H 5IF0B 2H26A 4MMZC 4P2RB 5CLWA 2BRRL 1C08A 3IETA 1T0MB 1T1YB 4XNZC 1N8ZA 4P2RE 4NO5A 3AC0A 4Y4KA 2A6KA 4Y16D 2ITCB 4FS0A 4HJGA 3MCKA 5ID0A 1JYXA 4KXZH 3F8UB 4OZFB 1B2WH 4GAGL 1CE6B 4HIEB 4LF3B 4OLZL 1AR1D 1TJGH 3GSRA 4OCXL 2DQEL 5BRZB 4WHYH 5IMKB 5JQ6H 3GM0A 3RPIA 3WIHA 1HQRA 1NMBH 2EDTA 4LU5H 2UWEB 4U1NA 3L6FB 3VWKB 4GT7A 3H7BA 1U93A 2IFFL 2UWEE 3RWIA 1QFWH 5FFLA 2NYYC 1WFOA 1MFAH 1D9KD 1YZZA 4Z77B 4NWUL 1HQ4B 4QGYA 4WJ5B 5HGDA 3B9KB 1OGAA 1NFDB 2V7NB 2QQNH 35C8L 1R3LB 1X5GA 3P11L 4PGDB 4KUCF 1RZFL 1NFDE 4UINH 4YC2B 2R69H 5HHMB 4ZFOA 3KPOB 1XGRA 1JNJA 3E3QC 1S7WA 5HHME 5DQJB 1IKFH 2JELH 3IDGA 4OB5H 3EJYD 1ZS8B 4XCEB 3VRLF 2PW2B 2DD8H 2H3NA 4OCLC 3VA6A 4GRWF 3UPRA 3ZKQD 4B50A 5IV2B 4U1JA 1FRGL 3DSFL 3JWOL 5KBNC 4DVBA 3BJLA 3D85B 3KPRD 3K2UH 5BCAA 4NO0D 1PKQA 5A3ID 1J05A 3GZKA 2G9HA 1LNUA 1ULVA 2P24A 1MQKH 2GTWA 5DO2C 3OKEA 5FUCC 5FKAB 1TENA 2YPLD 4U7MA 2DN7A 3NCFB 4UT9L 4YFDB 1T5WA 4OZIB 1CS6A 4D9RE 4HK0B 5DJ2B 3MGTA 2NY1D 3GJEA 1IAIM 5IG7A 3BH9B 1ROWA 4TUKH 4OZIE 1T6WA 2VWEE 3FO1B 3L5HA 5FF6B 2RAMA 2R29H 2KZ1B 3P4OB 4F3FA 3DX9B 1R5IA 3BFOA 4X6CA 4YHIB 4KDTC 1RZJC 4LAQH 4QHUB 4RGMB 1LGVA 3GB7B 2BNQD 4Z78B 4H0HB 3O3DA 4IRZL 2VDPL 2P8PA 1HOCA 3RGVA 2WBWB 4AEFA 3RHWF 5DHVA 2Z93A 3HG1D 3OR6B 2XWBA 2BVQA 2NR6C 1I9RL 1IFHL 3L9RB 3HC4H 3PGCA 1MCQA 4H1LB 4L29A 4LLYB 5J56B 4G6JH 5C0DA 1J8KA 2PR4L 3R1GL 5DUPL 5LAXA 5D71L 2UWEF 5F3HA 2G75A 5EUOB 1ZANL 3WFCL 3TGXA 5LGJA 4RMWA 1RQ5A 5IW3A 5EUOE 3WNNA 2ADFL 2QR0A 4OCRL 3ZTNL 3D18A 3U30B 5EOCH 4KZDH 3EOAA 3RAJH 2XY2A 1BQSA 2E27L 5FUZL 4NIKB 3CDCA 5JOFB 1JZ2A 2ICWJ 3E1F1 2B7DT 5GGVH 3V0AC 4IRSA 1A6UH 3P4MB 4L9LC 5HD8D 2A6JA 4PJAF 2HN7B 1FFNB 2P44B 3SCMB 2FO4B 3WLBA 4PJ8B 4CVUA 3BO8B 4HWZB 2CUMA 1OAYL 2DL9A 3S3JA 5CSZA 4JRYA 4OIAA 3SOBL 5KANI 4JJ5B 1IGIH 5JHDA 1U58A 1NBVH 4KI5C 4G6AD 4K8RH 1BJMA 3DETC 4P0DA 1A5FH 5ESAA 1OAKH 1I85C 4M03A 3ZE0E 5HY9A 4OF7A 3NCYS 2CH8A 1DBML 1OD9A 1PW3A 5D7JB 1UG9A 4D0BB 4G7VH 3KYMA 3WN5B 1DR9A 1FL5B 1D5IL 3V0WL 3UCRA 2H41A 4X98B 3UTZA 1CGXA 2DWEA 4B7IA 4HAGA 4KHTL 4GG6B 1XGTA 1JHTB 4X9IA 1ZT4B 4W70A 3RVWD 4BYHA 2ARJQ 4NRXB 4UT6H 4TVPD 5EC1A 4PJAA 4K7FB 4OD1L 5IT2L 3GKWH 3W0WB 4IDLA 4AQOA 1M1SA 2PYEB 3W0WE 1YNLL 4KTDH 4LVNB 5IB1A 4N0CC 3GIZH 2F74B 1RJLA 3RVTD 1BOGA 4M43H 2E9IA 1XF2B 2DQTL 4P2OC 3ZDZE 4R4ND 3W9DA 2DTMH 2NZ9D 4YFEA 3PJSA 4RGOL 3S8WA 4I3SH 3T4AA 2BSRB 4R96A 3KPPB 4LSSL 3TNMB 4EOWH 1T66D 3JXAA 3ORJA 5JZ7D 1YNTB 4QRRE 5IQ9B 2JB5H 5EUOF 4PGCA 3CXHJ 2DQGL 5D72L 1Z9LA 3SGEI 1JJUA 1JWMA 1ZK9A 4ODWA 1I7TB 3JV6A 1BX2B 3W5MA 2ADIA 4U7SA 4FQXC 1YPZF 4M5YL 4Y4HC 1CD8A 2APTA 4Y5YA 4J12A 3VRJB 2XFXA 3ZKMC 3ET9F 3ULVE 3QXUA 5GRUH 1G7JA 5HSFA 4H0IA 1HWHB 3UJJL 1G0XA 4NQEA 1RZGB 4OIIH 4HW6A 4LHUA 1J87A 3BN9D 3IDXH 4NC1C 5CCKH 5IHBA 5C0IA 5DR5H 2GI7A 5CZXD 2W91A 2R8SL 4U6VH 3OHXA 1YC7A 4GKSA 1OW0C 5HGAB 3MCLL 3ZSTA 3CVHH 2CK0L 3QEQA 1U3HB 4FXKA 4CU6A 1FGVH 5ALCL 1YEEH 2HT4D 5I0DA 4U1KB 2YC1B 4DEPB 4JREC 4Z7QE 3KPSA 5FYLH 1AE6L 5JNYA 1EA9C 3QI9C 4JCMA 4OCWH 4PBVC 3VFSA 4PLJD 4MX7A 3SDYL 4AJ0A 2NX5D 1BZ7B 3BD5A 3CXDH 4LKXB 3G5YB 1IEHA 4UV7H 2PTTB 1MHCB 1CICA 2BHUA 2GAZB 4RFEA 4GG6F 2LVCA 1IM9B 4HUMB 1MFDH 5D7SH 3W2DH 1YPZA 4M61B 4S1SH 1RIUL 1G9ML 2FD6H 5ICZA 2DQCL 4NN5B 3QXVA 5GZOD 4LVHC 1KJMA 1AXSA 1KTDB 2DS4A 4ONFL 3ISWA 1MNUL 3T0AA 3RNKA 2D31B 3REVA 1IGYB 1IGTA 3KLAB 1OP3K 3NIFE 4NRZA 2ATPA 1MAML 3IDUA 1TPXC 2V5SA 4LL9A 4XP1L 3MLWL 3BGAA 3ULUH 2EC9U 3R4DA 2XWTA 4OLXH 3EFFB 1M7DA 3RTQD 1M05A 1LK3H 2EZ0C 4CVXB 2BVOA 5DDHB 2WWMD 1GGYA 2VDNH 3VE0B 5MEPB 2ZSVB 5GS2H 4H26A 4OUOA 3QPXH 5CGYD 2P5ED 4M93B 3T4YB 1H3VA 3EJJX 3WS3B 5JA8B 3UTQB 5KTEL 1ZHNA 4NO2A 3DMMD 1RPQA 5D70L 4XNQB 3RWCB 2HG5B 3QNYB 2QQLL 4M48H 1DLHA 5GGVY 1A47A 5I8EB 5HGHB 2FGWL 3MYJB 2UZYB 4RFNB 3LKRB 3K0WA 4JO3L 1H5BA 3RUGE 4X80L 1BZQK 3I50H 1HHKA 5ETUA 1DUYA 3UEZA 1CXHA 2P4AB 4P46B 3L3JB 3I6LD 4TNVK 3ARFA 3OR7B 3P77B 3X3FL 1T22A 3BYYA 1AKJD 2VUYA 4LRNH 4Q7DA 2NXYB 1NAML 3K3QA 2AK1H 5HHOB 3SPVA 3KYNA 2P8MB 4OZHA 5HHOE 2IAMD 4LIQL 5IEHB 1YY8B 5EZOH 3F7PC 2E7MA 1FAIH 5GJSH 5SWSA 2WBJB 4Z7OE 1E27A 5D6CA 5C0RH 4RMUA 4U2YA 2VISB 4ZXBA 4FQJL 1B4RA 3W81A 1MCHA 3VFWB 5IWLC 3RWJB 1LHZA 5KS9F 4NKMA 4G3YL 3STZA 3EIFA 4JLRA 4W68A 5CP7B 1BVLB 1ZTXL 3BKCH 4N68A 5HI3D 4JM2A 1EEYB 1JUFB 1UXWB 5D1ZB 5EZLB 3ESUF 1FBIL 4NJ9H 1QO3A 2M2DA 3TVMA 2R23A 5JW4Q 1J8HD 4WY7H 2ILLA 3C08H 2VR5A 5ACMA 3JWDC 2VAAA 2Z31B 2DWDA 5FYKE 1ND0B 3LKQB 4UU9B 3QO1B 3X17A 3VXUA 1GGIL 4HWEL 5JOEA 1JZ5A 2NY6C 2VB5A 1J0HA 1D7FA 4MD5B 1MI5B 4OT1H 3LHPL 3UBXA 3LDBB 4WTWA 4MVBD 4EVNA 4PTUB 3VXMB 2VDKL 2ZCLH 2A83A 1MI5E 1BD2B 1QACA 2FEDD 4RX4D 5C7XL 2CXKA 2D0GA 4WWKA 1WQVT 1HHJA 2F8XC 1AFVL 4K55A 4KKCC 4YEEA 3HE7A 1OL0A 3WO4C 2NLJA 1IAIH 3MXVL 4X8JA 4P5TC 5E8OA 5JW3H 5KS9A 4M7JH 5F44A 2PW1B 1EO5A 5DLML 3D0LB 4Z0XA 4X5WB 5E8NA 1Q0XH 4FQ1H 5EBLA 1HSAA 2W0KA 4NN6B 3TP4A 2QADC 4X7TA 4EI5B 1I9JH 3B3IA 5TJWK 1WTLA 5I15L 5E1HB 2R0WL 1NBZB 2VLLA 2AJYL 5KZCD 2Z4QA 4DGVH 3M07A 1UWXH 1EGJL 4LCIH 4E5XA 2ITDA 1EJOL 3D0VB 1E6JH 3ARGC 5IFJA 5IJKA 5HYJD 4WHCA 4X6DA 4GLRI 1SMAA 3G5VA 1CFTB 2APBA 1M71B 4Z7OF 4NYLA 4S0SD 3PWPD 3EYQC 1X5IA 1CTOA 1FZJA 2VDML 2XZAL 3HCVB 1GHFL 2F15A 5ESQB 4FHBD 1JYVA 2YEZB 5IB5A 1U8NA 1HHIB 2CSPA 3IFPB 4MD4B 1I1RA 1WCBA 1MHHB 1OGTB 3OZ9L 1P4IL 2ATKB 3VFUB 4IS6B 5J6GB 3ARBA 3FO9A 3U0PB 3BEVA 1Z3GL 3FN9A 4BFBD 4U1IB 1WZ1L 2OL3L 1PLGH 3RDTD 4MJ6A 3MBXL 1IM3B 1DP0A 4YWGL 3GI9H 4N8CH 3LKPB 5ANME 3PGFH 1KJVB 3SKNA 2RCSH 3GNMH 1W0VB 3DUHA 4CBPA 4GSDH 4ZUVB 4YPJA 4CMMB 1G9NH 3DUUB 4X7SL 3P40A 3O3BB 3AVEA 1BLNB 1KF9B 2Q8BL 3PP4H 4GG8A 4PJCE 1N26A 5HYSG 5EPMA 1YECH 3OF6A 3BWAA 4WHTB 3FRUB 3T0BA 2GY7B 3BKJH 5EU6A 5FYJL 2FCBA 2ERJB 3PWLB 4TVPH 4OM0H 1TNNA 3LZFL 1U8OA 3NTCL 4GMSH 2H1PH 3CVHB 1C5CL 2V9RA 3VW3H 4X6EB 1OTTD 5CD3A 3OJVC 1ONQB 4PRIB 3KR3L 3QUXC 4LGSB 2ADGB 4E42B 4M3KB 4TQEL 4KMQA 5LXGH 4PRIE 2HVKB 4Z7VF 4HZAA 3BZDA 2F54B 2V9QA 4C56D 1Z9MA 4PY7A 2F54E 3WUWA 4YHOH 2YHGA 3HAEA 3V7MA 4RWYL 3G5XB 2Z0BA 2EECA 1ES0B 4MQTB 1VESA 1HHHA 2LAAA 2R1YB 4FXGA 3EHBD 3FZUC 4IOIB 4M7LH 3GUTB 3MRMB 5J1AB 2X4UA 1S9VA 5GGQL 2C1OA 4PJEF 4PBWD 5FKPA 3L3HA 2CO7B 1DVFB 3MRHA 4K7PL 5DD6B 3AFLA 1A22B 4WUUA 5IM7B 4F9PA 4Z76B 2J8UB 4YHKL 3U9UA 1N0XL 1UB5B 3MV7A 1CU4H 2DJSA 5JR1L 1U95B 4OJFL 2J8UE 1BJ1H 2J8HA 3F58H 5IGXH 1YJDL 4PJHB 3MRPA 3ILQC 1MRCH 3D39D 2VXUH 3QFJB 4U1HB 1RIHH 4PJHE 4J3VA 2F5AL 5EU7C 2FIKA 3C9NB 2LTQB 1KLUB 4OCYH 5EDXA 4Z7NF 3I84A 3QFJE 6FABH 4Z7VA 5KVGH 5CEYB 1JV5A 3QEGH 2VDRH 4HT1H 4S11A 1KB9J 2D03L 3ALWA 4OQTA 4LSRH 3AM8A 5F7WC 2ZNXA 2BY2A 2ZWLT 1LE5A 4J4PC 3KLDA 4NWTL 3LPWA 3FT3A 1RJZB 2XZCL 3FB7B 5DJ0A 2O61A 3H9HB 3T1FA 4QT5B 3ZHKA 2VOTA 1GZPB 1MFBH 4YHPA 5L2JB 4LLMA 3WDHA 5DFVC 5FK9B 3QISA 3RI5K 2FATL 4Y16B 3QHTC 3L3KB 4V1DB 4CU7A 4PJEA 4Y0GA 3WIHL 1AGDA 1C16B 2CKBB 5F1IA 1QR1A 4MA1C 4V1DE 4WENB 3O3AA 4Y1AA 3BQUD 2AXGA 1JRHL 5A1AA 1MFNA 1DQML 1LDPL 1BFVH 1ZVSB 5LGHL 1WFTA 2YXFA 4PGEB 1E4XL 3DYOA 1FGNL 5DJ8A 5TE6H 4OLWL 3VGBA 1I8LA 3QWOA 5TPWH 1NGQH 5FM4A 4F37K 4Z9KB 1LMKA 4F7CB 4ZFOL 4GBXA 1YEDB 2VZ1A 3WHXB 1D9KB 3QI9D 1Y18A 3VJ6B 4BFEA 3D69B 4XVTL 5A40E 4TTDC 5E2WH 2GW5A 1G84A 1QUNA 4N8VG 5GISH 2CJUL 3BKYL 1E28A 3CVIH 3S88L 3NABH 1JGDA 4AG4H 5CIPH 4UDUA 1Z6JT 4LCCC 1GZQB 4NQCD 4G80B 4NBYB 4F8QA 4G7YL 4N0YL 2OJEA 2XRAL 4JQXC 5B8CC 2OR9H 4U1SB 2W0FB 4PS4L 1U2HA 1D6EB 3N1QC 2J8UF 3FB8B 2HKFL 1JPSL 1FE8H 5E8DL 3EYFA 3KPRB 4Q9QL 2OSLA 5CFHA 4NO0B 4ZODA 5IMOB 4Y4FA 3ULUF 1SYSA 1VGKB 3KPRE 5EO9B 4E42A 4MSWB 5I18L 4ZPTA 5F7MC 1UB6B 5E5UB 5E08L 3AS3A 5BV7B 4ERSH 2F58H 4UTAH 2YPKB 2MHAA 4UMGA 5AYUH 4JFOB 1ADQL 4QWWD 1XGQB 3HC0A 2EE3A 1NGWB 4RMSA 1V3LA 3CAFA 3BH8B 1KTLB 1MVUB 4JRXD 2A2QT 4OV5A 2AV7A 2CLZA 2PYFA 5T1KA 4DCQB 5K9KB 2GY5A 2A77L 2YXMA 4PB0H 4UB0H 3RIAF 2ZOKA 5JORB 2HVJB 3HG1B 4RZCA 1F4HA 1B4JH 1H0DB 3HB3C 3IT8D 3Q5OA 1DVFA 3DVGB 4PJBF 3TYFB 3U36A 3DI2B 5E24E 1HKLH 3HG1E 1DL7L 2GSGA 5ENWB 4DFIA 3M1BB 2EDOA 3SJVD 4I5BB 4NRYB 4K2UL 5TF0A 2MSPA 2YPVH 2CUHA 1A6WH 2AJZA 1D5XB 4HUNB 1FCGA 4QTHA 2B5IC 1FC1A 1F3DJ 1YEIL 3HE6C 3PDOB 2GUOB 1P84J 2FWOA 3T0ED 3MV9B 5I9QB 5D96B 3MV9E 1W0YT 3DVNA 5C0AD 4LPWA 4NUGL 3RWEA 4U0RB 4XBEL 3DOSA 2OX5A 1CDJA 3FB6A 2EXYC 5DRNA 4LPTA 1RK0B 2JJSA 4E0RB 3EYOB 2XTJB 1FLTX 4OFDA 3TESA 2W1NA 4KKAC 2PTUA 4Y5VA 4KK6D 4YX2L 3QIWD 2XTJE 4PJBA 4NQUA 4Q97A 4QCIA 3T2QA 1U8MA 1U8PB 5LBSL 5I73C 5D7KE 1JIBA 3I6KA 4I0PB 1VFBB 4XP6H 2R0LH 1NCBH 2ZZUT 2PO6C 5AWNL 5E2VL 1PY4A 3RWDB 5HYFA 1Y0LA 3AAZA 1WK0A 4KK8C 4PJIB 1TJIH 4PJIE 2NY4B 4Q0XL 4H1LG 4J1UB 1PFCA 1AGCB 3UZVB 4BH8A 4UQ3B 2AXHA 3GI8L 3I6GB 1DANT 1E4WL 5GJTH 5AD0B 2EH8L 3V4VL 1ZT1B 2OJZH