4ZAKD

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD02
4X8JA 4Y5VC 2PNDA 3SGEI 1NMCB 5BRZB 3MOAL 2A6IB 3BPNC 3NPSC 3SN6N 1PSKH 2XNAB 5AYUH 1A64A 3DV6A 3ARGC 4AMKL 3LN5B 4LDEB 4Z7WE 5F1NA 5I17A 5B38A 3MRMB 4MDIA 3MZGB 2IANE 1D5MB 4LCWE 4X7DC 5FOBB 2WBJC 4F7PB 7CGTA 5IBLC 3L95B 1OSPH 1MJ7L 2M2DA 1GCFA 2VRAA 1UVQB 3PWJB 4Y4FC 1JZ6A 2CKNA 4N1EA 5ISZB 4MAYB 3OMZA 4TTDC 3SDYL 2DQCL 3WN5A 2GAZA 2XN9A 1J1OH 2IG2H 4KRLB 1FORL 3FCTA 4G6AD 3PWPB 4HUVA 4U3CA 4HS3A 3PXHA 1T0MB 4LVNB 1GC1C 2H45A 1FL6A 3JV5A 3EO1A 1CGXA 5F89A 3MMEA 4ZSOE 3R8BB 3V0VA 5FF6A 1BAFH 3WFBH 5JHDA 1JNJA 1AKJD 5AZEL 1MCDA 4LRNH 4BZ1H 3L5HA 2F15A 4FZEH 1KT2B 4PJHE 4JFHE 5A3IC 1YMME 5CJOH 5JIKA 2Z31A 5EIIB 2DQFB 5GGVL 3MRJB 1BIIB 5TFSH 3WFHB 3EHBC 4Z95L 1HI6A 2RR3A 3DNKA 4F33B 2DDQL 5AYQA 4XVSL 5DFVD 4U1NB 4UV4H 1QRNB 1XF3A 2YPVL 1JP5A 4NHCL 2WUBL 4CL7A 4OB5H 1UM4H 3H7BA 5E5MB 5T3XL 5J7CC 1T89C 2NLJB 2EDKA 2P7TB 1B0RB 4JFQB 4OZGE 4NJAL 3L3KB 5FKAB 4PTUB 4JQIL 4P46C 1RUKL 1NCCL 3O4LE 1UENA 1DBKH 1AD0B 3BHBB 5FDWA 4NNYB 4PRPD 3S3JA 4PRHB 4JFEB 2EXYD 2XICA 4A6YL 1Z9OA 3ECBB 1QG3A 4X6DB 1I1CA 5DJ8B 2OBGA 1HKLL 1FDLL 4CBPA 2ZUYA 4UTBH 5I1DB 1HSBA 2ZUUA 5KSAB 3RVWC 5T3ZE 3GMNB 1IL1A 4PJIB 3GJFB 3MV7A 4PJBF 1LP9F 3MBEA 3IAPA 2HT4D 4G5ZL 1GGUA 4UIKH 1K3ZA 4ZUUA 1A7OL 2NY2D 2ID5A 2C3WA 2NX5E 2DQUL 3QDMA 2CKBA 5GZOD 4KPHL 5C08A 4IDJL 2P24A 2JELH 43C9A 5HPMB 1T22B 1A21A 5IOPA 3AUVA 4RZCA 5C6WH 4P2QD 1U8OB 4N0RA 3WNOA 5JDSB 3MJ8B 4JR9H 4N0YL 4K3HA 3KS0J 1G6RB 1UADC 5D1ZC 4NQXA 4PJ9D 4Y2DC 3O8XC 2ICEA 2VLMD 5HHVL 5TH2B 4L4TA 4CRPA 5JA8B 1X4ZA 3TJEL 1KLUB 1UM6H 2EECA 5J6GA 3UPCA 2HJLB 3QDAA 1GVIA 4XMKH 4NSKA 4K55A 5DK0B 3V6BR 2BERA 4R3SB 3CX2A 5MP6H 1XR9A 3CXDL 4XPAH 3CPLB 4ZQKA 2GUOB 4PTTA 5I1CH 3DVIA 3QDGD 5CHNB 4YFDB 4NWTL 4N8CL 4RA3A 4UAOC 1LWRA 2J8HA 4JAMA 4PRIE 3KPNB 2XFXB 1RHFA 1VA9A 1PY9A 3ZL4H 4OCNC 1QFUH 5ID1A 1YEFH 4AEHL 4LSTL 5IW3A 4QT5B 3CFBA 3FTGA 5FEBA 5D7KE 4PUBH 4YO0B 1FFOA 3QFDB 4EN3C 5EZIL 1MFNA 2NY6C 5GRXG 2SEBA 5JW5B 1J87A 3RZCD 5CLWA 3VH8G 3U9PL 4NRXA 1BVZA 1XH3B 5FV2A 4L8BB 4BFEA 3QPQC 4QOKB 2YXFA 3DXAE 3ULVF 1NC4D 4PJGF 4OGAD 5BO1L 4WO4A 3VG0L 4NQEA 3SE3A 4PRAB 3MCG1 4EI6A 1P1ZB 1CXFA 4OFDA 4P5MA 1SJEA 4JCLA 5GS0L 1HQ4B 4QXTB 1MPAH 2BSSB 4RDQF 3QFJE 1YUHA 4WUUB 2F54E 1DEEA 2E3VA 3OKYA 1CL7H 4DVRL 3D2UA 2W9EH 3MTRA 1HNGA 3QJHB 1F4YH 1XGYH 3VXNA 4FQQA 3SO3B 3UCRA 2BRRL 4JZNB 3O3DA 4N90E 4ZS6C 3C9NB 4WCYH 4P4KC 1WUNT 1OAUH 1PG7X 5A43C 5ITFB 3B5GA 3F5WB 2FBJL 4GMSH 2EXWC 1NGQH 3KLHD 5GS1A 2XT1B 4PJ7A 3HHRB 5DC0A 1CWVA 2HG5A 5F7NC 1CBVL 5EUOB 1TVHB 2OYPA 3GMRA 3PDDA 5E6IA 3G6JB 5GGTA 2OK0L 3BP5A 1H5BB 3IU4H 4WU7A 4OLZH 4ZAKB 3KYKL 1EFXA 1MWAB 4IS6B 2FIKB 3QG7H 4YQXL 5KVGL 4LKXA 3OHXB 1VPOH 5DJXA 1QR1B 5KBNC 1I1RA 4D3CH 4NFCA 2QEJA 3D9AL 3QPXL 4L8SC 1YDPB 1IGMH 3BPLB 3C60C 2DJUA 2FD6H 4KTEH 4LARH 3I6GA 5F9JB 5J9PA 3T0VA 4EQ2A 4FFWC 5DD5L 1VFBB 1GIGL 5E99H 4PRDA 2P45B 3ILQD 3IRZA 4YDLB 4CUCA 4ZPTA 5D5ME 4ZYKB 3LIZL 1GSMA 3V95A 3GKZA 1EA9C 1DZBA 1CF8H 2DN7A 5L8LB 4P2YA 1FZJB 4PJ8D 3GSOA 1GC1L 2O5ZH 4PJDB 2XRAH 3BYYA 4X9BA 1FYTE 3D3VB 5I74B 5F88A 1FPTL 1N6QL 4K7PX 4NNXA 4P23A 4RDQG 3CXHK 5DZOA 3CK0H 5K93A 4UT7L 1ZEAH 2YK1L 3RWFB 4KQ3L 3HZYB 3P4NB 3FB6A 2Y36L 4YHPA 1CDYA 4CNIA 1NDGA 4GO6B 5JMRA 5IROC 5GHWL 4NQCA 2D0FA 4NQVA 4ZD3L 3X14B 1VKXA 5DK3A 4KRPB 1GGTA 4HLZG 4RAHA 1F2QA 2D7PA 3BWUC 3LRSA 4H1LB 4OZHA 4NC1C 5HYJB 2IQAA 4ODHL 1S5IL 1DBBL 2O26U 4TOYL 5T1LA 4M43L 1MVUB 5DFTA 1GGBL 5F72S 3RWGB 5I30L 5EOTA 2XOTA 4OTXH 3TZVC 3TNMA 3HZMA 1NBYB 1KENL 1S7QA 3S37L 4H5SB 5DMGD 2GSIA 4CVXB 5I19H 1FNGA 4M03A 3T65A 2PW2A 4G7VL 2ADJA 5L2KB 1KACB 1QBMH 4K71C 4NM4H 3RPIA 5IW1B 4ODUB 3RU8L 3M17A 3G9AB 1P4BL 5LJYH 5DS8A 3HPJB 2XTJD 1RZ8A 2BJML 3GK8L 2Z9TA 1MY7A 4ESKA 2I24N 1SEQH 2ESVE 2KL6A 1S9VA 5BJTA 4CAGA 1FIGL 1RUMH 2PETA 1T5XA 4Z7WA 2JCCF 1AGEB 2IANA 1W0VB 2IMNA 1OM3L 4LCWA 2Z91B 3O6MH 4FQHA 4IOIA 4GLRI 5IP4A 4RGND 4IEFB 1DQLH 3DX7B 4L8DB 5D72L 3U4EA 4WI8A 2DQDH 1M7DA 2DWEB 4APQA 1S8DB 5EU5A 4OKVA 3V52L 4BQ8A 4Z7OF 4XWOD 4FTVB 4JG0H 2X42A 3U9UB 1KCRH 2Z8WC 1NFDF 4PY7B 3S98A 1DDHB 1UM5H 2DLFH 4LF3B 4KHXH 5AYUL 3T3PF 5IV2B 4EBQH 1DQQB 1Y18A 3QDJD 4U1IB 3VGEA 4ZSOA 1WVZA 2ZG3A 1BF2A 4X6EB 4WFEE 1NCUA 4Z77A 1H15A 5KAQG 4F58H 3SBWC 4AIXA 1OSPL 1IFHH 3H42H 5BVPH 5IFJA 3FFCB 5IIEB 2CRYA 4HF5H 1PKQB 5L8JB 4PJHA 4YDKH 1P9MC 4R0LC 3P73A 1NUGA 4PJBE 4XPGH 3TM6A 5DHYB 1YMMA 5FGSA 3EDKA 2ZCHH 1J1OL 2IG2L 2Q8AH 3WFCH 4PJCE 1NUNB 5CBAB 1AJ7H 4RCAA 3RWCA 5AZ2H 5DYOB 2M26A 2VLJE 5E6ZA 1GJIA 1CTNA 3RJDA 2V2TB 1YNTA 3BH9B 4M3KB 3V0WH 1RHHB 4XPTH 3W11C 3VFRA 3SDDD 2H6PA 3BWAB 2EDBA 5DDHB 3S3SA 1OHQA 4OZGA 3RJQB 4HIIA 1FGNH 2YWZA 5J4MA 3MPCA 2FR4B 5F3BA 3ETBF 4BZ1L 1MHEB 1G7HB 5IEHA 4IMLB 5CMAA 2ED8A 3O4LA 4MJ6A 4IJ3C 3TN0B 1MEXL 1DUYA 1P5VA 2ICCA 5CJOL 4RRPA 3VA2C 4YH6A 4XC1H 5TFSL 1VGKA 5D7IB 4OKDA 3UYPA 1J8HE 1CDHA 3VXUE 4JY6A 5GGTH 3RTQB 4OF3A 5FGCE 5DC4B 3FB7B 5DHVB 2PYED 4PJ5D 1UT9A 4UV4L 4NO5A 4B5EA 3CLFH 2W0FA 4OB5L 1UM4L 3ARTA 1UKSA 4XBPA 5DRWB 3HE7A 3BGFC 4JDVB 3QUYA 1KSRA 4EI5A 3ZKXC 1YYLH 4XNQA 3D48R 1DBKL 1I4FB 4LLMB 1R5VA 2PW1B 5TF1H 2NX5A 1KB5B 4HIHA 3FAWA 1I7RA 2PCPB 2C1OA 3ME0A 4RIRB 5EPMB 3SGDH 5FYLE 4KVNH 1ZOXA 4H20H 4OGXH 5IVNA 4UTBL 3RQ3A 1EXUB 3C5ZB 1MJUH 2ZOLA 3NOIA 4PV9B 5BV7H 3ULVE 2EIZB 1KB9J 5F1KC 1AC0A 2YR3A 4JDZB 4MS8D 4ZDHA 1AGCA 1U8JB 4JQVC 1KYOK 1QFHA 4UIKL 1A1MB 1RPQA 3OKNB 1P7QA 4Z7NE 2D7MA 4P5KB 4X6BA 1C1EH 3DX9A 1BOGB 3K80A 5JZ7D 5FA3B 1BWMA 1WJ3A 2VQUA 3BP6B 5MEPA 3UBXA 1OF2A 4EIZC 1CXHA 4ORZC 4HCRH 2V9QA 1AXSB 1FVDA 2CXKA 4PRIA 2B5IB 4F7EB 4IIQB 3KR3H 3OAYK 1JNLH 4EDXB 2ATKB 3OKDA 1S7RB 5KJRH 4TN9A 4Y4HB 2WLYA 5JLZA 4J3SA 1JWUB 2CRZA 1Q9LA 1OAYH 2YZ8A 1NEUA 4NGHH 2LVEA 2CLVB 4H88H 1UM6L 3DGGA 5FUCC 4HULB 2IPUK 2ZZUT 1U8MB 2OMBA 2NY3B 3MV9B 4XMKL 1GXEA 2D4DA 4Z9KB 2R2EB 3SDCB 3TESA 3WKML 2BP3A 5MP6L 1UJ3A 4GUPA 4XPAL 1Q9OB 4WO4C 4QRTA 2J8UE 3SE3C 1VFAA 3QUKA 3S7GA 5I1CL 5I71B 1G7JB 3GSXB 4RGOH 3CSYA 3TJHD 3STZA 3DXAA 3TCXA 3SGJA 1QEWB 4NZUH 3RFZC 1YEFL 1P69B 5C92A 1DCLA 4ELKB 3EOYG 1FG9C 1H0DA 4PUBL 4G6FB 3OKLB 4FOMA 4P5TA 4NKDB 4AIZB 4DCQA 5B39A 2Y9RT 4KI5F 3QFJA 4WTXA 4M7LT 2F54A 4XVTH 2W92A 3QQNA 1X5HA 3IKCB 2X7LA 4PRPE 4ELME 1V3LA 2MJWA 2I9TB 4LLVB 1AE6H 2AJUH 3RVUC 4ZFOA 1UCBH 3RGVD 3TVMB 5CJBA 5I16A 3OJVC 1WIPA 3G9VA 3C08H 4G7YH 1A14H 3CVIH 5AD0B 5LQBH 2AJVH 1I1FA 3TP4A 5E6IC 2AXHA 2ZOKA 3VWKD 4WVRA 3VDAA 3DECA 4XVUC 3OF6D 3LY6A 4X5XA 5FCUH 5CUSH 1MPAL 4FRWA 2AXGA 4J12A 4JRYB 3W0WB 5F7KC 1ZA3B 3M8OH 1RZKH 1KJ2H 5CBEB 1CL7L 5DJ6A 5DVLA 2NXYB 2W9EL 3O6FC 3VXME 1F4YL 3G5XB 5DRXB 1XGYL 3KLAA 1U3HB 2BNUB 3PHOA 4JRXD 5E56A 4DGIH 1IQWH 4CDHA 4P2QE 4WCYL 4YPGB 5MHSE 1OAUL 4QXGH 4WI4A 2IJ0C 4D9LL 3EYOB 3V7AE 4GMSL 1VSCA 3VCLA 5HHOB 1NGQL 1XMWA 3AXLA 4OD3H 3WEXA 5BV7C 3HCVA 3PDOA 3GMPA 3VGFA 4DW2H 5HPOA 4JFOA 1A4JB 4J3OC 2F5BH 1T1YB 3IU4L 3MNWA 4IDLA 3UTTE 3GSUB 1E27B 2YA0A 2AK4B 2ZSWA 5LWYL 3QG7L 3QDGE 1QLRA 5EOCH 1NGZA 3IXTA 4NO0D 4OCLC 1VPOL 5CSBA 3DROB 4D3CL 3BXNB 5J1AA 1H8OA 3QO1A 4NO2A 1U8LB 1MAMH 1L0YA 5L8KB 4KUCF 1IGML 1FYTA 2FD6L 3V5DA 2BVUA 3FRPG 4KTEL 4LARL 4M48H 1ZVHA 2EYTB 3TIDA 3ROOB 1FRGH 2GJ6E 4LCYB 1J5OH 1NSNH 1OCWH 3KPPA 4Q7DA 1ZT4B 12E8H 2K7QA 2WWMD 3H9HB 3SE4C 1S9YB 2GIYA 3PHQA 3BJLA 4M8QB 4MWFB 4JLRB 2JCCE 5IB3B 4GOSA 4HJ0D 2DM4A 2FSEA 4Y4KD 4XHJD 4PD4K 3STLB 2EE3A 5J89A 1J05A 2R15A 1T7YA 2G2RB 3HC0B 3MGAA 4WWKC 1TCMA 1I1AD 5HYSG 1L7TH 2XRAL 2E5EA 4G9DA 5F7DB 3E0GA 2EC9U 3CK0L 2A1WH 3E8UL 1MQKH 1ZEAL 2EDWA 1QA9B 3HI6H 1IM9B 2VL5A 4JFPA 4JM2B 5KZCB 4GT7A 2CDGB 3OX8A 4HQQL 1NH6A 4IRJD 1AR1D 1NAMA 2HFFA 2R29L 3BZEB 4HJJH 1RAMA 2X05A 1DANU 2IF7A 3V0AC 3EJJX 2LTQC 1S5HA 3B2VL 3UTQA 1M6OA 3VXTA 1KPUA 2BXYA 4MJ5B 1MFAH 4WW2F 2YUZA 1I3VA 3D5OF 3MSPA 1T66C 3P0YH 2ESVA 4UIMB 1BQLH 3L1OH 2OS7A 3BKMH 2YS4A 4RMUA 2BK8A 1CD1B 1JGEB 1HH6B 4XB7A 5CEXB 1UB6A 1N59B 2NY4B 1A7BA 5I19L 3DPBA 1NEZG 3SCMC 1ZWIA 3QAZB 5GS2H 4MNGB 2BNRE 3C09B 3CFEB 1RZKC 1QBML 2W0LA 3R06A 3EUUA 4QLRA 4RMVA 1Y6KR 1P4IH 5E9DE 1K6QH 3FO1B 2GT9A 3MROB 3PJSA 2DQGH 4L29B 1TZHB 2ZUVA 1XGPB 5FFLA 2Q86A 1SEQL 1VACB 2R0KH 3CC5B 4UU9A 4V1DD 5DJ2B 3GUTB 1YMHA 1RUML 2MSPA 1WICA 4I48B 3ESVF 3VH8A 1NCAH 4BK5A 1MCHA 1N0LA 1I1YA 4FQXB 5DJZA 4OZIB 5A1AA 3O6ML 5DJ0B 2N7AA 3O9WA 3IDXH 3DVNB 4ZOEA 3VDCA 1DQLL 1J0HA 1ED3B 1FZOA 2DQDL 1HDMB 5EN2B 5BS0E 2Z93B 1IGYB 3QIBC 3HZVB 4PJBA 4JG0L 3S35X 4U6XB 4WHYH 2VDLH 1KCRL 4PJCA 1UM5L 2DLFL 4U1MB 4KHXL 1LK3H 5KSVA 3EOTL 5B3NA 4EBQL 2VLJA 4JPIB 3JWDH 4P2OC 2DIAA 5LAXB 2BVQB 3AU1A 2BSED 3BZFA 3U30C 3WFZA 3T3MF 4NJ9L 4F58L 1RU9H 4BFBD 4D9RD 4F7CB 1IFHL 3H42L 5BVPL 5IQ7H 4HF5L 1LILA 2QKIB 3HLAB 3NCYS 1B6DA 4RNRB 4XPGL 4ODXB 4MCZB 3OAZK 4M61A 2P49B 2ZCHL 5J6HA 2Q8AL 1U8KB 4LCUB 1G7MB 1OY3B 3KWWB 4LSUH 3WFCL 1TQBC 4NDMB 1J8HA 5HI3C 1AJ7L 3FN0H 3VXUA 2VB5A 5AZ2L 3E1F1 3QUYC 4W6YB 1BVKB 1DN0A 3WLBA 4EI5C 5KSUA 3V0WL 5HI5D 4XPTL 8FABB 1N64H 3RNKA 3S96A 3B43A 2DS4A 4RFOH 1E4JA 3TPUA 1FGNL 1CXEA 1HSAB 4XRCB 2H3NB 2GK0B 5MERB 1TTUA 2VXQH 3H7LA 3U0PA 1S78D 3QB7C 3L7FA 1DQJA 3V7MA 3VFOB 3VXOA 1BX2A 4Q6IA 1CFQA 2XTJE 1OQOA 4XC1L 3FONB 4ONFH 4R26H 5IKCA 1H3UA 4KU1A 1CLZH 1QO3B 1OD7A 3W39A 5C0RH 1N26A 5GGTL 1WTLA 1X5YA 1D6VH 1KIPA 3UTZB 4MNQB 3CLFL 5JIIA 3ULUF 1ZK9A 4QRSB 3ZYIA 1RJLA 3I75B 4L3CA 3OKEB 1S3KH 1YYLL 3T4YB 4NUJA 4LEOA 3EOBB 3NFNA 5D7JB 2BOBB 4MAUL 5TF1L 4KI5E 4C54A 2P5EB 3ARDB 4ZUWA 4Y5XB 5H8DA 1OP5H 1NLDH 5DJCA 2V5RA 4KVNL 4H20L 1DTUA 5K59E 2XWBA 4OGXL 4DTGH 1CYGA 1MJUL 4CGTA 5BV7L 4IRSC 1UJ3C 5I9QC 1BQHB 2Q6WB 4JFYB 2P5WB 1OTSD 5ENWB 3BEWA 2BSTB 4S2SA 5J13C 4TUJB 3GJFK 3VI4E 3SGJC 1C1EL 3NZ8B 1X5IA 2J8UA 1Y0LB 3T1FA 3UZEA 2K1MA 4U05A 2F74B 5CD3B 2F5AH 4ZO9A 3QWQB 1D5BA 4HCRL 4P5TC 4KDVA 5DEZA 3KR3L 1HHJB 1JNLL 5KJRL 2CLRA 5J11C 1HXYB 2G75B 4UTAL 5KS9F 3SGDI 3PIQA 1OAYL 4OLEA 5BRZD 4NGHL 2APBA 3MXVH 4H88L 3GSRB 3P30H 4OLUH 4AT6A 2MQ3A 3NFPA 1EH9A 3PWLA 2NY1D 1H3WM 1EK3A 1JV5B 2ATPB 4U2YA 2BVEA 2G5BB 5IEKA 1EUUA 3M1BB 4PRPA 4F2MA 1BWWA 4ELMA 3Q3GA 3LZFH 3ZHDA 3CIQA 4OLVL 5HDQH 1K4DA 3GSVB 4QXUL 5E00B 3V6OE 1KCVH 4Z7VE 5B3JE 2IPUG 2YMXH 4KHTH 4GMTH 4RGOL 1F2XK 5GS3A 3CFCH 3P77B 1GAFH 5DVKA 4NZUL 4PJ5E 3DVGB 4YHIA 2A6DA 2XWTB 4IOSD 4MAYD 2HFEA 2GFBB 4YUEH 3PWPD 5C09B 3MLRL 4X6CB 1FL3A 3O2VH 1JPTH 1JHLH 4XVTL 2F58L 5IB5B 1NKOA 1Y6MR 1CGWA 1ORSA 4G42B 4KRMB 1MCBA 2WK2A 1AE6L 2AJUL 1KN2H 3DO3A 1F6FB 3HPLB 3VXMA 4M6OH 4LK4A 2FJFA 4HZAA 1FSKC 1UCBL 1T20B 1GZPA 2WBWB 3Q0HA 4U6HA 3MLWH 4P2QA 4CKVX 3NPZB 3T04D 5LQBL 2AJVL 5D2LB 2UY6A 4PJ9A 4W4OA 3FMGH 5INCB 1K3IA 1KGCD 3RY6A 4I4WB 5FCUL 4KZDH 2CIKA 5CUSL 2ITCA 2OQJA 5FKPA 4MNHB 4D0BB 1HXMA 3M8OL 1RZKL 3BP4A 3CVHA 3L6FB 2Y6SD 3QCUH 2IALB 1DQTA 4DZ8B 3UTTA 3LSOB 3ZE1E 1M05B 2X4UB 2VAJA 1UZ6F 3VRIA 5DHXB 3QEHA 2W07A 4QHMA 3QDGA 1MRFH 4P3DB 2OL3A 1UYWH 4DGIL 1IQWL 1X44A 2C3GA 2FGZA 4GRWF 5DGRA 4XMLH 4Z7UE 2X5PA 1I3RB 3QXTA 2WIMA 4KROD 2BCKB 1NJ9B 4OI7A 3B9KB 1LEIB 2EYRB 4G8FA 3PWNA 4L3AA 2HJKB 2HLFD 4PRHD 3EO0A 4JFED 4ZFGH 5AUMB 3BH8A 2GJ6A 4FQ2H 1F90H 4FFVD 4OD3L 4ZFFA 2BZDA 4E0RB 2FH8A 3CSPA 5GGSY 3IYLW 3BPOC 5TDOB 4DW2L 3D25B 1R5IA 2A74B 1REIA 2F5BL 3KJ4B 4RFNC 3HUJB 4Y8DC 3VFWB 35C8H 4EUPA 2JCCA 5IBUB 4F9LA 2XXMB 3BN3B 5EOCL 1O7SA 4PGEA 4JREB 1TQCC 4XP9L 4MGXA 5DUMH 3S3PA 3MRQA 3MO1B 4CN6A 3QQ9C 4GW4B 2OM5A 1MAML 5LBSH 4CN4A 5MI0C 3EO9H 2AKRB 3IF1B 4M48L 1FRGL 5EOCJ 4XNXH 1DSFH 1J5OL 1OCWL 1R3HB 4JJ5A 5GGQH 1OGTA 1NGYB 4P57A 1XF2B 3WLWD 3E2HC 3R4DA 4G80B 3VFTB 5IVXB 1P5UA 5FYLH 3MGTA 4HBCH 4HUWA 4N68A 4I77H 1N8ZA 1LO4L 1MAKA 4G8GB 2BMKB 3SOBH 3ULVH 2ORBH 5CJ5A 1C12B 1EAPA 4LOUD 4M1CC 4R7NA 4Y0GA 5T3ZL 4LQFH 1L7TL 1A6TA 5GRWA 4WTZA 4QRPB 1QSEB 2GITA 1XCQB 4HIJB 5A2KH 1IILE 2A1WL 2J12B 1NGWB 1MQKL 4RWYH 3HI6L 3UO1H 1M1SA 3MJ7B 2R23B 4CVUA 1KJ3H 1KLGA 1Z3GL 4L3EB 4JFXA 4XH2B 2YN5A 3RWEB 3LD8C 3HRZB 4HJJL 5DRZA 1CZ8H 3OGOE 5SV3A 2BNRA 3BO8B 3LKQA 3LCYA 4XXDA 4JRXE 1CTOA 3VE0B 4RMTA 3T3ME 4OZFA 1X4YA 5DURB 4OQ1A 3RRQA 5E9DA 1XR8A 3F7VA 4HLZH 4JB9H 4AENB 3MNZB 3V5HA 4BKLB 1MFAL 1BZQK 1U8PB 1TLKA 4DN3H 1F11A 3P0YL 5IK3A 3LV3B 3GHBH 2ZP0T 1BQLL 4WWID 1ZGLB 3BKML 1D9KB 1K9TA 4QOKD 3RVTC 3HNTH 4G9FB 1R3LA 4XBGA 4UNTA 4URTB 2VXTH 3T0EB 3GGWA 4R96B 1ZGLP 1GZQA 3GSWA 4GAYA 4TULH 1PW3A 4GBXB 5DSCB 3LKRA 4XMPH 3DYOA 4FQLH 3RUGF 5BQ7B 1G1YA 4WUUD 4MA3A 5BS0A 1P4IL 4PJ8A 4OI8A 1K6QL 4G6MH 3TO2A 1CGVA 3FT4A 2FIRT 2QADB 5CEZD 2JJSC 1F6AB 2GTZB 3F65A 4BK4A 4NC0B 3U4BH 3IAQA 1I7UB 3D39B 3BPCB 5CJXC 3RDTC 5TDNB 2R0KL 5SWSB 2NTSP 1UWEH 2DAVA 3CCHA 1NCAL 4LAQL 1OP9A 3MUY1 5ANMB 4F15B 3VGHA 4PJAF 4LQ1A 2BVYA 4NWUH 2HP4A 3LB6D 3QHZH 1QBLH 4OD2B 3VGGA 3IDXL 4HH8A 5JORB 4KKCC 3TFKC 5KW9H 3BPNB 3NPSB 1JWMB 1FNAA 3KPLB 1FZKB 3ARGB 1W0YT 2J1KA 2V2XB 4XPHH 4UQ2B 4YZFF 3QH3A 3V4UH 2GEEA 3B8SA 3BRFA 2VDLL 1TVBA 1T3FA 4MYWB 3MUJA 1LK3L 3L5WA 4R4FH 1RJYA 3G6AB 2BX5A 3LKOB 5J57B 4PJEE 3ELAT 3FQUB 5EU7E 4YIQA 4Y4FB 5MENB 1HYRC 5EU4A 4ZFOL 1KTDB 2X70B 4O51B 1XF4B 5HDBF 3MRKA 1RU9L 4KQ4H 4Q6IC 1SYSB 1FNEA 2DLGA 5IQ7L 3VFNA 1XIWD 1MUJB 4JO2L 3VXQA 5E94A 1LMKA 2EZ0D 3LEXA 1EEZB 3LS5H 3QWRA 1KEGL 4HH9B 3AREC 4MXVF 3NA9H 2DMCA 3OR7B 1II4E 4LSVH 1BJMA 2VTFA 5HHNA 4LSUL 3ULVC 1T7WA 3TNNB 4M5YH 1DEDA 3FN0L 2D0GA 3CVHH 3HZKA 4LHUB 3WJLA 3OGCB 4WJ5A 4MB3A 2NNAA 5JOFA 4S0TD 2X1QA 1N64L 2OL3H 3D3VD 1LO5A 3T8XA 4RFOL 3MR9B 2EEAA 4KZEH 4D8PB 5DMKB 3E6FA 2OLDA 5CEYA 3S5LB 1N7MH 1UA6H 2VAAB 3JTSA 5DEFA 5ABDE 1TIUA 3FRPA 2GJZA 5GGVY 2CDEB 2PTTB 3ZDZF 2EDLA 3QWOB 4ONFL 4R26L 1CLZL 2X4NB 4JN1H 4YHMH 3PF2A 5C0RL 4V1DE 4KRPD 4Y5YA 3UYOD 2X4QB 2YZ1A 3TV3L 3WKNA 5ADPH 5F7WC 1S7XA 4EZMA 3D69B 1D6VL 3O4OC 4P46B 1RJZB 4OGYL 3V9FA 2IGFH 4HWZA 4JY4B 4OZ4B 5CLTA 4PP2A 3I02B 4EOWH 1BZ7A 3CDCA 1EPFA 3D87B 4OUUA 2EIEA 3S4SA 1IC7H 3KPSB 1A9BA 3NIFF 1S3KL 4RMRA 2YBRA 4MVBD 5JW4N 4GKSB 2I27N 4TUKL 5E08H 3A6OA 1NLDL 3KPRD 5L2KD 1ULVA 2IAMA 3ULSB 2V17H 3KXFB 1TZIB 4YHOH 1ZT7B 5C9JB 3HB3D 5ACLA 3QT2A 4DTGL 1P84K 1OAKL 1LO3H 1LDSA 1GPOH 4PGJA 4U1LA 4U2ZA 3SDDA 1BECA 2B39A 3MJ9A 5D70H 3SKOB 5F96L 3RVVC 4D9RE 1M7IB 5M95B 4GQPH 5SWZB 4YHNA 4YHZL 4LNVA 5JXAH 3DO7B 3DJ9A 3WHXA 4FMKA 3DRTB 4G43B 1CT8B 1BGXH 3TYGL 4AQ1B 3V6OA 1VGEH 1CD9B 4WU5A 5F3HB 5D1ZB 4Z7VA 3X3GH 2OX5A 2F5AL 3CUPB 1A9EA 4M62H 4NYLA 4U7KA 2EE2A 2HT4C 4PJ5A 1NEZA 4PJFE 4FZ8H 4NZTH 2GTWB 4FTVD 5E8PA 1KCLA 5HVWA 3P9LB 2EKSB 1OB1A 3MXVL 2LABA 3P30L 2ZCKH 4OLUL 5BOPA 3ES6B 4J3XA 5FA4A 2R1YA 4BSVB 2ZCLH 2HYMA 3QEQE 4TNWK 1KXTB 4UAOB 5C71A 2AVGA 3OR6A 5E8EB 5DD6A 3FQRA 2DKUA 2Y7QA 3LZFL 4LDLB 4K8RH 3MV8B 5GXBB 4W4OC 1KCVL 4UDUB 4XCEB 2YMXL 4KHTL 1R5WB 4GMTL 4L5FL 3VD4A 5D9SA 3FFCD 3RY6C 3CFCL 3AS3A 4ODSL 1GAFL 3ILPB 1L9NA 3PQYD 4NQUA 3WS6A 4V2BA 3C6SB 4EN3B 4OV5B 1A3RH 2NY6B 3TO4A 4M02A 4AYFA 1GOFA 1KXVC 3DIFB 3EZ8A 4YUEL 3WYRA 1FZMB 4OM0H 3O6LH 1C8PA 5CP7A 1JPFA 3O2VL 4N0CD 4LLWA 4D2NA 4M9PA 1CI5A 1JPTL 4BFIA 4P4RA 1JHLL 1PKOA 5DXWA 3VRLF 3BP7A 3MODH 2OJEB 1KN2L 1S7TA 1AHWA 4ZUVB 3FQXB 1OSZA 4M6OL 1TJIH 1MJ8H 5IMMA 5F97E 5SV4A 4Z7UA 3IU3B 4QYOA 2CJUH 1T04A 5HGDB 3DX8A 3I6LD 4PREA 2NPLX 1WSST 1IAMA 1PEWA 3FMGL 4MA7H 3IS0X 3CDFA 5H35B 4F9LC 4WW2A 1RK1B 4KZDL 5EG6C 3BIKB 2P8MB 1EV2E 4XCNA 2BNQD 5BZWA 3QCUL 3RBGA 5HHQB 5GSVB 1CK0H 5ACMA 3QUXC 4P4KB 2C7UA 2R2BA 4GG6B 1IC5H 2ZSVA 3JSSA 1MRFL 4YPJA 3UTSB 3VG9C 1UYWL 5C1MB 4MSWA 2AGJH 5FOJA 4XMLL 1HHHA 4X98B 2PYFB 4BUGA 1MIEH 4RBPK 5BRZE 1J0IA 3H0TB 4ZFGL 4KMLB 1OT2A 1V8HA 2X6MA 4FQ2L 1F90L 4KK9D 4XGZB 1I7ZA 3WUWB 1CLYH 2AJ3A 1B9ZA 2EYSB 2VLRD 4I5BB 4KV5E 2NXZC 3C5ZD 2R69H 4J1UB 3DARA 1HN1A 4POZD 35C8L 5EU3B 3AY4C 3MRPB 4X4XB 2FL5B 4C56B 1DQDH 4L8SB 5M94B 4O5LH 3C60B 2R8SH 4Y2OA 5CP3H 5D4QA 3V5KA 3CU7A 1G7LB 5DUML 1HHKA 1NBQA 3T77A 4CDGC 2OR7A 4K7FB 5JW4Q 5ISZE 5LBSL 3O45B 5CIPA 3EO9L 2JF1A 2WANA 1GHFH 1XGTB 5C0CB 2JB5H 3H6JA 1JWSA 4H26A 3PWPE 3QEUA 1HKFA 3OF6A 4XNXL 5DJYA 1DSFL 4IBLT 2DWDA 2CXGA 1K8IA 5GGQL 2J6EA 1QFOA 3QZWG 3RAJH 1S7SA 5MEOA 3G5YA 5I66A 1ZHKB 2DTSA 3CFJA 1FV1A 1SM3L 5IUSA 1BFSA 3GSNB 1UXSB 5FYLL 3JV6A 4WNQB 4KKBD 4HBCL 1R3KA 2R4SH 3MRGA 4I77L 3MV9D 4JRXA 5L0QC 4IOFD 2X89D 2VIRA 3SDCD 3SOBL 4GRLC 4K8RC 3ULVL 2ORBL 4LQFL 1B88A 3CAFA 4NT6A 2FBOJ 1WWAX 4JZOA 3KYOA 4ALAH 1HOCA 2H8PA 2HN7B 4XPFH 4YZFE 4DJMA 2VDRH 4JGMA 2AJZB 5I1HL 4RWYL 1U3ZA 1S7VA 3UO1L 5JOPE 1AKJB 4NO3A 4RX4D 1KJ3L 2X4RB 1NLBH 3HI1B 1QRNE 2OTUA 1CFSA 3ISWA 4X4ZA 1YEHH 5FUZH 4Y1AB 1E6OH 5DT1H 1G0YR 4X6FA 2DKMA 3E6HA 5I6XB 1LD9B 4G6FD 3QRFM 3QO0A 4FXGB 2A2QT 3FB8B 4NO0A 4O4YH 4K3GA 1PLGH 5HDBE 4X0KA 2XZCH 2R2HA 4ZUSA 3MJ9H 4JB9L 1Z5LB 5GSRA 4OFPA 5K9KA 5J56B 1HCFX 4PRHE 4JFEE 3ZKND 1MAJA 4DN3L 4E42A 1RFDH 1IM3B 4CW1B 4X6DE 1NCWH 3TVMD 2YSSA 3HNTL 3LKPA 1KF9B 4RISH 4K71B 1R3JA 3RL1A 1BZ9B 1QBBA 3RVXD 1EAJA 4H1LG 2VXTL 4MB4A 5GGUB 1ZS8A 5ID0B 4KKAC 2AK1H 4TULL 5HY9A 3U2SB 1IGFH 4UNVA 4WUKH 4N5EC 4XMPL 1QQDA 1J7VR 1Q0XH 2ICWA 4C58B 3EW3B 4PJIE 4FQLL 4C57C 5DK2B 1CQKA 4OAWB 1C08B 3W0WD 2PF6A 1I1AA 3UZVB 2XKNA 4G6ML 1AGBA 1IZJA 5ILTH 2NXYD 3U4BL 5HD8C 3MUHL 5HGAB 3PE9A 5C3TA 4X80H 1UWEL 4GXUM 2XZAL 4JKMA 4MQ7A 1I8KA 3ZDZE 1BQSA 3C6LC 4PJEA 5DI8B 1BEYH 1JN6A 5D93C 5IF0B 2VZVA 4TRPH 1T03H 2Y72A 4NWUL 5D2NC 3QHZL 1QBLL 3BW9A 1HQRA 2NY2B 5HHOD 3S6CA 4WGWB 3EGSA 5KW9L 2I5YL 2IH3A 2VO5A 4Y8AA 4UBDD 4JQXA 1D5ZA 3WJLC 2YD3A 4NKOB 4XPHL 1GGCH 3IFLH 4HGWB 3V4UL 2AK4D 1AO7E 1U95B 3F12A 3OTTA 1X7QA 2VZSA 4RMSA 1E4XH 4UV7H 5BZDA 1DBMH 2FECI 4R4FL 4LPCA 4NQDD 1M7XA 2D9QB 2VISB 3C87A 2VR9A 1PYWA 1XF5B 2H9GB 3PL6D 4NPYB 5T5FL 1AD9B 1A1NB 5EBWB 4R0LB 4R7DA 1HYSD 4KI5C 3IDMB 2DM3A 2HT2C 3IVKB 4ETQA 5CGMA 5C3LD 2IADB 4Y5YC 4LKCA 1NQBA 1PJ9A 3LS5L 4X5WB 5I18H 2VUOA 2VITA 3NA9L 1I8IA 1B4RA 2YPKA 1YEKH 5HI4D 3EOAB 4LSVL 2MHAB 2LAAA 4NCDA 4PGZA 3REVA 5IB4B 2DQIH 3GMOB 2VLKB 4V1DA 1G9MC 1U41A 2P44B 3CVHL 2C4FU 5AWNH 1WZ1H 1KTKE 4CVZB 3VD5A 4DVBA 3PGCA 3MJGX 4J3TA 3QCTH 1YA5A 1T1XB 5I8EB 2FX7H 3OG6B 3BE1H 4YNYB 2OL3L 1U6AH 4PRNB 3LPGA 4K3EH 4O02H 3RZCB 3AB0B 2VZOA 3SKUD 3TBTA 3AFLA 4NP4H 4KZEL 2FJHB 4A2MA 4M7LH 5EZOH 1IM9D 2IAMC 4JM2D 3QXAB 4WUUE 1N7ML 5C0DA 1IAIM 1UA6L 5DUBB 3G08B 2DM2A 3LDBC 3P9MA 2W65B 4AY0A 2O5XH 4LRIA 4U7SA 5CEZE 1NC4B 2HRPH 3S34H 1JPSH 1ND0B 3V6ZA 1CFVL 1EGJA 1D6EB 1FP5A 3MFGB 4JN1L 1CQYA 1FN4B 4IRZL 4Z76B 5JPNB 1WEJH 2H32A 3HTLX 5ADPL 2P24B 3U83A 1J0ZA 4HC1A 2G9HA 3P4MB 5KSBB 3ZKXB 1PG7W 2ZNXA 3T4AA 2IGFL 3H9SB 5C0BD 1JHKL 3L7EB 4EOWL 3QQ4A 3EDEA 4FFYH 1MIMH 5J1TC 1AXIB 3V6OC 4LLDA 4KXZH 1IC7L 5C8JA 4IM8A 4Z78A 5I1KH 3DX6A 2ICEB 5CIPH 5EUOE 4ZMAT 3G6JE 4NQTA 3M07A 3MLUL 3IDNA 3Q48A 4MMZC 3O3BA 3RKPA 4GH7B 5E08L 3CZFB 2J6EH 3SDAA 4DOHB 2V17L 4YHOL 4ZQKB 1KCSL 3IDJB 3RIFF 1NCNA 1AC6A 3V4PH 4PJFA 1NDMA 3BKYH 1LO3L 5E2WH 1VFOA 5FO7B 1GPOL 2APFA 4NN7B 5EC2A 5FYKD 5LGJB 3IS1X 5D70L 3N06B 2G5RA 5JW4R 1K4CA 4U1JB 3EYFB 3QNZB 5C2UB 2WW8A 4HUMB 5JXAL 1JGUH 3QEQA 1CN4A 1IBGH 1IGTB 5E95B 4YR6A 1VGEL 1T2JA 1N4XH 4U1SA 3TO4C 4JY5H 3X3GL 4DZBA 3QXVA 1JPGA 1LDPH 1Q94A 1Z0NA 5GJSH 5GRVK 5FUOH 1IEAB 1BMGA 3REWB 3FO2B 5BMFL 2HT3D 4FZ8L 4NZTL 1SY6A 2P47B 4PJDE 4QF1B 3FZUC 4ENED 3D3VE 2PR4L 1FFPA 2ZCKL 4ZPVA 1CFNB 2ERJC 1U8IA 4JN2A 4XCFH 2VLLB 1A2YB 1BFOB 5E1AB 4EVNB 1MFEH 4I0CC 5GGRB 4I0PC 1G7QB 3OAYH 1CG9B 2FCBA 3QNXA 4K8RL 2IH1B 3OBAA 4NKMA 1CGUA 4PV8B 2DOCA 5HYJE 4WW2C 1I9RH 4X4YA 2EE6A 5ESQA 2MFNA 4WV1A 3O11B 3ULUH 1A3RL 1A22B 3IB4A 5D6CB 3PNWA 4JVUA 2HA1A 3UDWC 3DVFA 3RWHB 4OM0L 1UH3A 3O6LL 2R9HD 2PO6A 4QNPF 1MHCB 5IW6A 3FRUA 1JZ3A 3EJZC 2JB6A 5FDYA 3MNVA 4W70A 2Y23A 5ACZA 1LQSR 2NZ9D 1N3NB 3MODL 4YGVA 4ODWB 4NRZB 3NA4A 2C3VB 4GG8A 1TJIL 1ZV5A 5L2KE 4LPTA 3C2AH 1N5AA 3SKMA 4CADA 1INQB 4GAJH 5GRJH 2YKLL 1X4XA 1IEBA 4LLYB 1EFXB 1YY9C 4LKXB 4R4BB 1QR4A 4HZLB 5BRZA 1EHNA 4MA7L 2A6IA 3F7YB 1ZMYA 5H37G 3HG1B 2XNAA 4UMGA 3GSQB 3O6FB 4NN6B 2B1AH 4KJPD 3DRQB 5KOVC 4YBQD 2APVA 3LN5A 2I07B 2CIIB 4N9OB 3MRMA 5J9PB 1D5MA 1CK0L 1P6FA 5FOBA 2QQLL 1PZ5B 5HYQB 4F7PA 3BI9X 3L95A 4PR5B 1UVQA 3JBG7 1SBBA 2FRGP 3PWJA 1G7IB 2AGJL 1EVUA 1KULA 1XCTB 2NYYC 5D7JD 5BV7B 5ISZA 4MAYA 4FTVE 3S36H 1MIEL 2P5ED 3ARDD 4FXKB 4OFKA 2EDYA 3PWPA 1T0MA 1HILB 1R24B 4RGNB 5HDLA 5IJVB 1CLYL 5HVHC 2R69L 3VXPB 5A16B 1IKFH 2FJGB 1LE5B 1JNHB 1FC1A 4K9EH 4O5LL 2WNGA 2P5WD 2Y4SA 3FFCE 2R8SL 4AL8H 3NABH 1PKQE 1KT2A 1C7SA 2E7BA 1VKXB 1P7HL 2QJDA 1L9MA 3ZO0A 4BH7B 3E3QE 3QDJB 3F6LA 3L3OA 4M1DH 5EIIA 2DQFA 2JB5L 2IWGA 4GW5B 3WFHA 1JGDB 4P2RB 1TJGH 4E41B 4J3VA 4WFFD 4UQ3B 4F33A 4Z0XB 3O6KH 3WO4C 2A6KB 3RAJL 4U1NA 4Z7QF 1QRNA 1WFTA 1ZHNB 3ARFC 1O7VA 4WWKB 5E5MA 4KK6C 3WHE1 2NLJA 2H32H 2P7TA 1BM3H 1B0RA 4JFQA 1VB9A 4L9LB 4TYUA 4HC1H 2R4SL 3UC0H 4Y7MA 3L3KA 2W1NA 5FKAA 4PTUA 3Q5TA 5IVZB 3ET9F 2X4TB 4JVPA 2IBBA 4R97C 1EO7A 1AD0A 3BHBA 1TZGH 4NNYA 1ZLSH 1G9ML 3RPIB 3I6LE 4RAUB 4PRHA 4JFEA 4ALAL 3BFOA 2OXHA 4XPFL 5D7IE 3ECBA 1A3LL 2IFGA 4X6DA 2VDRL 1N5YL 5DJ8A 3ULUC 3KYNB 5EBGA 2ILLA 4XHJC 5I1DA 2LTQB 5FK9B 1F4WH 1F8TH 5FUZL 1E6OL 5DT1L 5KSAA 4X7TB 1AI1H 5C09D 3GMNA 4PJIA 3GJFA 4O4YL 1PLGL 3ZDYF 3RHWK 4I2XB 4GRWH 3K2MC 3RWJB 2CDFB 3MJ9L 2PYEB 2AV7B 5HPMA 1T22A 1RFDL 5T1KB 3SCMB 4NHUB 1NCWL 4AM0B 3HR6A 1GRWA 1GL4B 4RISL 1KJ2B 1U8OA 2DBJA 3CXHJ 5JDSA 3MJ8A 3NAAH 5T3XD 1WFOA 1G6RA 4O9HH 3KHQA 1HCVA 5TH2A 2AK1L 4XXCA 2PKDA 1IGFL 1KLUA 4WUKL 1Q0XL 2LE9A 2HJLA 1H15B 1F4HA 1OTUD 1SY6H 3X13B 1BD2D 1QYGL 5DK0A 2EICA 1S7UB 4LLQB 5DQDH 4S11A 4R3SA 3PWVB 5HJ3B 3CPLA 3NIGF 1MLBB 3VWJD 5DD0H 2GUOA 1AO7A 1Q0YH 3WJJC 1RZGB 4PJ7F 4J4PD 5CHNA 3OXRB 4X80L 4I18C 4IMKA 2XFXA 2E7MA 1BEYL 1FNSH 4WIQA 5B4MD 3B9KD 1Z9MA 4TRPL 1T03L 4QT5A 3QIBB 2HVJB 1HHIB 4YO0A 5IBTH 2HLAB 3QFDA 1E4KA 5IFHH 3VFPB 5J1SC 3MV9E 4QHUB 2XXCB 1MCLA 1DE4B 3DSFH 4HMEA 4K9EC 5JW5A 4Y89A 1GGCL 3IFLL 4P2OB 1YN7B 3FO0H 2A73B 3VFVB 2UWEB 5CS7A 2AEWA 3SPVB 3WCYA 3AMKA 2E7HA 1XH3A 2IMMA 2XACC 4YEEA 3WIIH 1E4XL 4L8BA 4UV7L 2FEEL 4XB8A 1DBML 4A2LA 4ZFZB 5MEQB 4MJID 1JGVH 1P1ZA 5JUEL 4LRIC 3GBLA 4PGDB 1HQ4A 5L2JB 4QXTA 4LMQE 1YQ2A 5CJQL 1EVTC 2BSSA 1TQBB 4XAKD 4WUUA 1DLHB 1QFWI 4NUGH 3OL2A 3MRLB 5I18L 3ARVA 5CZVH 2FYYB 4OIAA 5KANG 3QJHA 3X17A 2DQIL 3LN4B 4PLJC 4QO1A 2WUCL 4JZNA 5AWNL 1WZ1L 2FHBA 2N1KA 1P53A 2E6PA 4G8GD 4LHJB 5E7FA 3C9NA 3QCTL 2QLVB 5DO2C 2FX7L 3BE1L 3F5WA 1U6AL 4QRPD 1UGNA 3HMXA 1AP2B 3VFUB 4O02L 2VE6B 3OAZH 1FCCA 4OZHF 1WITA 2ZNWA 1LNUB 3SDAC 1X5AA 3MLTB 4M7LL 5EZOL 4JRYE 1TTGA 1TVHA 1TTFA 2FX8H 5EUOA 5C0ND 3W0WE 5CFHA 3BQUC 3RGVB 3G6JA 5F8RC 2UUDK 1H5BA 3D0VB 2O5XL 4L4JA 2HRPL 3S34L 1JPSL 4ZAKA 4Y19D 4R2GC 1MWAA 4IS6A 2FIKA 4JO3H 2E7LC 1GGIH 1WEJL 5GGVH 3VWKB 1QR1A 3HAEH 2DDQH 5ECJE 1KIRB 4TVSa 4YEFA 3GMLB 1A7NH 1YDPA 2X2YA 5GS0D 4JHZA 5HHOE 4FFYL 1MIML 1MLCB 1CVSC 5F9JA 2LVCA 1B2WH 32C2B 3HRPA 1D9KD 5I1KL 1VFBA 1KEMH 4G9FD 3C5SB 2X4SB 4D0DB 1EBAA 2AK4E 2CGRH 4GBXD 2D7QA 3EYVB 4ZYKA 4IRSB 2J6EL 1UJ3B 5I9QB 4JKWA 4Z7WF 3BD3A 3TA3D 1FZJA 3V4PL 3BKYL 1HKLH 1FDLH 2QADD 5E2WL 5J13B 3STZB 3KLDA 3D3VA 5DEGB 2HKHH 4XZUB 1QHPA 3D39D 3RI5K 3B5HA 3RWFA 2EE9A 3JVGC 3HZYA 4PBVC 3P4NA 2PXYC 3FB5B 4WHDA 4N1CA 3VFMB 4U6VH 3NH7H 1IBGL 2O5YH 4WV1C 1A7OH 5J11B 4KXZI 3CD4A 3X14A 4JY5L 1OT1A 1U91A 5J8OA 3BN9C 3K74B 2J88L 1LDPL 1OPGH 3PABB 1K2DB 4H1LA 5HYJA 5GJSL 5FUOL 2PO6C 3HC3H 1ADQH 4X5LA 3Q2CA 3ARGD 1MVUA 2NY7H 3RWGA 3T2NH 3ALXA 4HWBH 3GEWB 1JYNA 3OAUH 4PS4H 5IBLD 3O2WH 3FO9B 3KPOB 4XCFL 4I3SL 4KJYB 1IC4H 1NBYA 4PJHF 4Y4KB 3UYRH 5EBLB 4JGJA 5I2IB 1MFEL 4Y4FD 5MEND 2HTLC 3FQWB 4H5SA 1CXKA 4XNZB 5E4EC 1KYOJ 5DJAA 1CR9H 4XP6H 4TTDD 3I2CH 1NMCC 4M6NH 5L2KA 3DUSB 3EFDL 5IW1A 1I9RL 4ODUA 1WQVT 4ZO7A 3WNNA 4WFHD 4F7TB 5HGGS 3HPJA 3ULUL 4C4KO 2HMIC 4OZGF 2GW5A 4IRJB 5GPRA 2IEPA 2BHZA 1UZ8B 3MCLH 1FSKB 4PBXA 1SBSH 2AP2A 4K3DH 1AGEA 2X41A 2YEZB 4KK5C 1W0VA 1YEDB 43CAB 2Z91A 3DGCR 5A3ID 4MNGE 3DX7A 4YDVB 5F71A 3DMMC 4L8DA 3V8CA 4KH2A 4GAJL 3EHBD 2DWEA 1S8DA 5D7LB 2K9UA 1Z2KA 1URLA 5IJKC 4FTVA 5IB2B 3ABZA 1A7PH 3U9UA 3VG0H 1FFNB 1DDHA 4FQPA 2ITDB 1GOGA 1MCPL 4FQIH 4LF3A 3GB7B 2B1AL 3JXAA 3ZTNL 1DQQA 2YD2A 3WIFB 2F53B 4F9PA 1UEYA 1V3KA 4U1IA 3MYJB 4P46D 1PQZB 1T1WB 4X6EA 5SX4H 3HR5B 4OZIE 1H3TA 4MD4B 4JHWH 4Z5RB 3FFCA 5IIEA 5C0AB 3SEPA 1PKQA 1NFKA 2VNCA 2YPLD 2R39A 4MA1B 5DHYA 2KH2B 3S36L 3QISA 4OIBA 2VXSH 2R2CA 5CBAA 5FECB 3RVWD 1KIQB 5DYOA 3KXFD 5I1LB 4N0UB 2V2TA 2FGWH 4OFIA 1KPVB 3BH9A 3RHWF 1RHHA 3SJVB 1IKFL 1WV7T 1OW0A 3BWAA 5DDHA 4K9EL 4M7KH 1T21B 3GIZL 3QXDB 2FR4A 2EDJA 5E5RB 2N56A 3NABL 4AL8L 5SWZD 1MHEA 4X7SL 2YD4A 1OTTC 3AS2A 4IMLA 1A3QA 1RIVH 1WTGT 1ZSDB 1LE9B 3HMXH 3TN0A 1PVHA 3B9AA 4OV6F 4NZRH 4KDTA 1DL7L 3QPXH 1J88A 5D1ZD 4CU8A 4LFHD 4Y2DD 5D7IA 5KSAC 1TJGL 3O8XD 1KJMB 1JJUA 1U8HB 2GY5A 5E8NB 3RTQA 5EZJB 3L3JB 3O6KL 1T6WA 2JIXD 3FB7A 3VMNA 5DHVA 5A2JH 5EU6B 2RBLA 1EGJL 3Q1SH 1FVEB 1MJJB 1BM3L 1X9QA 3NCJH 5DRWA 1CU4H 2KKQA 1JUFB 1UB6B 2WINB 4HC1L 4JDVA 1MHHB 2WZPD 1U42A 1F3JB 3LQZB 3LKNB 4AH2B 1IGIH 1M71B 1T2QL 2VABB 5JMOC 1I4FA 4LLMA 2PW1A 1TZGL 4KTYA 1KB5A 1FE8H 1QTYT 1NKRA 2PCPA 3MV8D 5IVOA 4RIRA 1QFWM 5EPMA 1YEIH 4F80A 1T7ZA 5EOQH 1J10A 2YXMA 1C5BH 3HNSL 2AEIT 5TPWH 3VFSB 1EFQA 4UT7H 1EXUA 3C5ZA 4HFWB 4MNQE 4EN3D 4KQ3H 4PV9A 3BX7C 1F4WL 1F8TL 3FT2B 2X9YA 2NY6D 2EIZA 3DURB 5J12B 1AI1L 4JDZA 3QJFB 3WDJA 2IQ9H 3EAKA 2XA8L 4ZD3H 1U8JA 1NFIB 2ZUSA 3OKNA 3QPQD 4P5KA 4IMKC 1BOGA 4PD4J 4MHHI 3TCLB 1KLFA 2P5EE 2BOCB 2VDNH 3BKCL 5FA3A 4HGKC 3BP6A 1LP9B 4HUUB 5JTWA 3HC4H 3VMOA 1AIFB 1AXSA 4F7EA 4IIQA 4ZS7H 4EDXA 2ATKA 5C86A 3NAAL 1S7RA 4Y4HA 3MRIB 3LVEA 1JWUA 4AJ0A 4LAJH 4R6UA 3D18B 4H1LH 2CLVA 1OAQH 5HYIA 1ZVSA 1JF1B 2P5WE 1U8MA 3MV9A 3GO1H 2X89A 4I3RH 2R2EA 3RDTB 3RWIB 1SY6L 3SDCA 4LNRB 2FEDC 2XTLA 1U8NB 4JCMA 4G3YL 5E2VH 1IKNC 1Q9WB 4ZS6D 5F6HJ 2C3HA 3BD4A 5DD0L 4P4KD 1Q0YL 3EYUH 4GW1B 3A0OA 1SEBB 1G7JA 1IARB 3GSXA 4RFEB 4QRQB 5ETUB 3UTSD 2EXWD 2EDFA 3W9DB 5JXEC 3LQMA 2Q76B 4RX4A 1QEWA 3MLXH 1FNSL 4WGVB 5IMLA 3BZDA 3TIEB 4ELKA 5D5MF 4ZOBA 5E03A 4TNVF 5IBTL 1R3IH 3OKLA 4AIZA 4NKDA 2ARJQ 5IFHL 3K4AA 1W72H 3BEVB 3T0AA 1A6PA 1ORQB 1UEMA 3SO3C 3S96B 3VD3A 3ZZ1A 3DUUB 2P46B 3DSFL 3IKCA 1OGAB 3QBTB 3VDBA 3FO0L 5EZLB 2I9TA 4LLVA 5D1XC 2XY1A 1YEGH 3V52H 1XT5A 1FJ1B 4C56D 3U0PB 3C60D 3L7FB 1TPXB 3WHE0 3WIIL 1BX2B 1JI2A 3TVMA 1AQDB 2QSCH 5AD0A 2NY1B 5DD3H 4LCCC 5LG1A 4S1SL 1JGVL 5C0GB 1H5BC 1NAKH 4RA0C 5TE6H 5C0CD 4ZAKC 5C09E 3AREB 4X6CE 3CJJA 5IHBA 4JRYA 3P40A 3W0WA 4PJGB 1ZA3A 4NUGL 5CBEA 5C7XH 1ZAGA 5CZVL 2FWOA 3CFKB 4JFDE 5ESAB 4NUJB 4ZXBC 2R1XB 3G5XA 1EIBA 2QSQA 5DRXA 1U3HA 2BNUA 4L4VB 5KOMC 3WFDH 4YE4H 3RWDB 1DVFC 4ZUWB 1H8NA 4PLOB 1Y6NR 2ICES 4YPGA 4JKKA 5IMKA 5T33H 1FO0B 5T3XE 5D2LE 2MMXA 3EYOA 3B6SB 2VJXA 4YDLC 3ZE2E 3SY0B 5TE7H 3GIVA 4RWHA 2FX8L 4MZ2A 4ODBD 2QQKH 4N0FB 3KYMB 1A4JA 4LHUG 1T1YA 4TVPH 3BAEL 4MA8H 3IGAB 3O4OB 4Y1AD 1E27A 2AK4A 2X9WA 1MEXH 1PBYA 3UP1A 4JO3L 5EA0H 1VEPA 1GGIL 1AFVH 3DROA 3BXNA 1U8LA 1HEZB 4RSVA 3LRGA 1A7NL 3S5LG 1DFBH 4DEPC 4JGUA 3N1PC 2EYTA 2X1WL 5DLMH 3ROOA 3SDXB 1B2WL 1P7KB 4LCYA 1EEQA 2DKSA 5C2BL 2MCPH 1KTRL 3NCYP 3RKDC 1KEML 4GXVH 5SWQB 1ZT4A 3UAJD 1C5CH 1MCOH 5T5NG 3NFPB 3H9HA 3V6FB 1S9YA 3HUJE 4M8QA 3ZTJG 5HBBA 2H2SC 2QV2A 4KROB 4MWFA 4JLRA 1LEKB 3MUZ1 5IB3A 2CGRL 4UILH 4U7MA 3QIUC 5HHXH 2FNBA 4OCYH 3STLA 2CO6B 3HC0A 4MD5B 4BZYA 2G2RA 3ZKMD 5EO0B 1H3VA 2HAZA 5DVMA 4BUHA 2BVPB 4P48A 2UVFA 2HKHL 5F7DA 1TCRB 1LGVA 4N9GB 1AGDB 9CGTA 1QA9A 3L3IB 1IM9A 2XG5A 4XAKE 4JM2A 1EHXA 4U6YB 5EUKB 2CDGA 3FN9A 4X9GA 4U6VL 5IVXE 3NH7L 3QG6B 2O5YL 3JV0A 3BZEA 1JZ2A 3ARBB 4PJCF 3FOMB 1T2XA 2F8OA 1FL5B 2K7PA 4MXQC 2ED7A 2QHLA 1OPGL 3IFPB 1CIUA 4H0GA 1OARH 4G8GE 1G9EA 5GRYA 2BHUA 3HC3L 1ADQL 4WI7A 4Q9CA 1QPXA 2Z4QB 2NY7L 3T1WA 4MJ5A 1QSEE 3T2NL 5EBMB 1RY7B 3AROA 2DLHA 4J8RB 4HWBL 1WZLA 4LPVA 5JNYB 3OAUL 1I8LA 4HKZB 4PS4L 3ZKQD 2XKUA 3O2WL 2MNUA 4KI1A 4RAVB 3UYRL 1IC4L 1JGEA 3KNBB 4LDOB 1HH6A 1KFAH 5CEXA 4L3EE 3D6GA 1N59A 5HDOA 4PG9B 4GSDH 1CR9L 4XP6L 3WKMH 1FNFA 3I2CL 1YNKH 4MNGA 3CFEA 5TDPB 2R0LH 4M6NL 3VMPA 5KVEH 3TLRA 5LGKA 2XG4A 1U3JA 2KDGA 3RX5A 1G6RL 1K8DB 3PG2A 2CLZB 4EKXA 1LEGB 2OL3B 2N4IA 3FO1A 3LEYH 5LCVH 3MROA 4L29A 1TZHA 3ESUF 1X5GA 3W11D 1XGPA 3G5VB 1VACA 3CC5A 5DJ2A 3GUTA 2VLKD 4I48A 5ERWB 4G9FE 3MCLL 3X12A 2JJTA 1SBSL 4K3DL 2OI9C 4JHAL 3ZHLA 2AI0H 1Q9KB 4XX1G 4FQXA 3T0EE 4O00A 4X7FC 4OZIA 1CICC 3RL2B 1JRHH 2FLRT 4HKJB 3OKKB 1ED3A 4JKPH 5C0JB 2W0PA 3WXVH 5I1AB 2EDNA 2GQHA 1HDMA 1QSFB 3ARPA 4GRMB 5EN2A 2OP4H 2Z93A 1IGYA 4Y88A 3HZVA 1T83C 4U6XA 5CINH 1CFBA 3MZTA 2DI8A 2P43B 1A7PL 4ERSH 3D39E 1UACH 4UI2A 3O3EB 4U1MA 1OW0C 1WZKA 1MF2H 2YD8A 3QDMD 3QUXB 4FQIL 4GKNB 4PYHA 5SWSE 4OQTA 3CSGA 2Y25A 4Z7NF 5H2BB 5H37H 3VG9B 5LAXA 2BVQA 5ANME 2I60H 2JK5B 3H9SD 2H1PL 4PLKC 4LBEB 1W8NA 3TN0C 5FGBA 2V7HB 1NFDB 2R0ZH 4KDTC 4F7CA 5C0EB 4K2UH 4FP8L 1EZVY 4JHWL 2QKIA 2R1WB 3HLAA 3RTQC 3QSKB 4RNRA 4ODXA 4MCZA 2NXZB 1TNNA 5ALBH 1U8KA 1G6VK 1QPPA 4LCUA 1G7MA 2VXSL 4D9LH 3KWWA 2X1OA 2OTPA 4ONHB 3V4VH 4K7PH 4NDMA 3ZDXE 3VGBA 2XWJB 1BVKA 2FGWL 1PAMA 2V2WB 2X4PB 4C59B 3B5TA 5D1QA 5MENE 8FABA 2J8UF 3F58L 4OCWH 4F37K 1JHTA 3K1KC 4M7KL 5DVOA 1F58H 1HSAA 4XRCA 1INDL 5LWYH 4RBPH 2Z35B 1Q1JH 2L4OA 2GK0A 1F3DH 5SX4I 3OB0K 5MERA 4FMFA 4POUB 1RIVL 4WFHE 3SE9H 3VFOA 1TETH 3HMXL 3BJ91 2L7JA 4NZRL 1ONQB 3FONA 1XR8B 2DJSA 1HHGB 3PWUB 1QO3A 1S9KC 1ZKAA 2VWEC 2UVEA 1GGYA 5ESVB 1P2CB 3FT3B 5EC1B 3QIWC 5L0QB 3UTZA 4ELMF 1XIWB 3M45A 4MNQA 3Q1SL 3MLPA 4GRLB 4QRSA 4M7ZC 3QXUA 1XGRB 3CH1B 3NCJL 1CU4L 2FO1A 3IXAB 3I75A 2WWKT 3HE6C 4MX7B 4DGVH 3MRNB 3OKEA 2DMBA 3PHSA 4NN5B 2V5YA 3T4YA 1IGIL 4XP5H 4B7LA 5D7JA 3B3IB 3EOBA 5CZXC 4IIQC 2BOBA 5CAYB 1WISA 3LS4H 1FE8L 2DI7A 2P5EA 1A47A 4Y4HC 5BS0B 4Y5XA 4YLQT 3TBWB 1YEIL 3D2UD 1P4LB 5EOQL 2NY3C 3IJSA 1C5BL 1CGSH 5TPWL 1RZJH 3E8UH 2QSVA 4L1DA 1BQHA 4HQQH 4RQQB 5TGBB 1MH5B 2Q6WA 4JFYA 2R29H 2P5WA 3SGKA 2IQ9L 2BRQA 2KZWA 3RVUD 3KPSE 3BVNB 5KAQF 5ENWA 5I71C 1F00I 2BSTA 5EIQA 1J12A 4TUJA 3FOLB 4QRRB 1H3PH 3NZ8A 5C70A 2NMSA 5BOZG 2VDNL 3B2VH 4JRWA 1Y0LA 5E6ID 1DR9A 1BHGA 2F74A 5CD3A 3HC4L 3KXFE 5IWLA 4XVUD 4ZS7L 3VXRB 5K9OB 1HHJA 4FQ1H 1EFXD 4M5ZH 5I76B 3NN8B 1HXYA 2G75A 5FYJE 2MTPA 2CKBH 4NIKB 3L5WB 1BFTA 2HVKB 1DLFL 1Z0MA 2E8YA 3ARZA 1OAQL 3GSRA 3OG4B 2GSGB 3MLZL 3HG1D 3O6FD 3GO1L 1RZFH 5SWZE 4I3RL 2DJ4A 4RMQA 1JV5A 2ATPA 5E2UH 3KPRB 1BBJB 2G5BA 4Q9BA 1MI5B 5CWSB 3C6LB 3M1BA 5E2VL 2Q87A 5D93B 5E00A 3GSVA 4M6AA 3EYUL 4WFGE 5E94B 3MREB 5D2NB 3MA7B 5B8CB 2J4WH 3OKMB 3P77A 3BZ4B 3MLXL 3P0GB 4L1HA 3DVGA 2XWTA 1EMTH 3SE8H 1EJ6A 3HFMH 1JZ8A 2GFBA 4FS0A 1R3IL 5C09A 1W72L 4X6CA 5I1JH 4HJGB 2HTKC 3WN5C 2RIKA 5HSFA 2VN7A 1U3HC 3BGAA 1TENA 4ZUTB 4QHNB 4YDJB 5IB5A 3GM8A 4YK4B 3TBSB 2DL9A 4G42A 1A4KB 4XNMB 1LVEA 5AEAA 4JFDA 1YEGL 3HPLA 3MV8E 1XGUB 3TBYA 1T20A 2XY2A 4XX1E 5LKNA 2QSCL 3QUMB 1A02N 3EOTH 3MRCB 5DD3L 4QY8B 5D2LA 2DYPB 2AXFB 3V2AR 4HBQA 1NAKL 3BRDA 5TE6L 4LL9A 5INCA 2APTA 5EO1B 4DGYL 4I4WA 3D85B 4P2RD 4E41D 4HWZB 4NJ9H 2Z31C 3V7AG 4MNHA 4D0BA 1NCBH 3NACL 3WL9B 1VENA 3L6FA 4DZ8A 2IALA 3UJIH 3PQYB 4WWKD 5C7XL 5HYSB 3LSOA 3B2UC 1M05A 2D7TH 2X4UA 2Z8RA 1A7QH 4BYHA 3ZT7A 3RIAK 5DVNA 3NGBB 3BESR 4P3DA 3WFDL 2UYLB 3GJEB 4YE4L 5IG7B 1J11A 1I3RA 2BC4B 2EDRA 5T33L 4KGLA 2BCKA 1NJ9A 3B9KA 1A6WH 4S10A 1LEIA 2EYRA 3N0PB 2HJKA 4D94A 5JPMB 1RZJC 5AUMA 5HHMB 2GY7B 3S36X 5HI4C 4E0RA 5TE7L 3FKUS 5TDOA 1J1XH 2QQKL 2YD1A 3D25A 2A74A 5JW3L 4TVPL 4MA8L 3HUJA 3VFWA 2DQTH 5C07B 1SMAA 3PV6B 4GG6E 5EA0L 3ARUA 3UTSE 3EBAA 3LQAH 1AFVL 2V7NB 2K3TA 3MO1A 4EUPG 4QEGA 4GW4A 4JM2C 3K3QA 2BNQB 3MBEC 5HYFA 1DFBL 4U31A 3VD9A 3IF1A 2JKXA 5DLML 3KJ6H 3U4AA 5T1KD 3SCMD 1R3HA 2MCPL 5DQJB 4GXVL 4QWWC 1NGYA 3GI8H 1XF2A 5HGHB 1C5CL 1MCOL 4G80A 5EULV 3VFTA 5IVXA 1BPVA 1UWGH 1YNLH 4MAUH 3JV4B 4C56E 2X9XA 1D5XB 4UILL 3KGRA 5HHXL 1MCFA 4OCYL 4G8GA 2BMKA 1O5DT 2Y07H 1C12A 2VLRB 5JO5B 4G6JH 4OLYH 1QSEA 1XCQA 5C0CE 2NY4C 4HIJA 3CFDB 4JFHD 3TPKA 3D1MC 3QAZC 3C09C 4QGYA 1NGWA 1H8SA 3I6KB 2A0LC 3MJ7A 4HKBB 2R23A 3T0XA 4WTZG 3NBNA 4XP1H 4L3EA 4PG2A 4XH2A 4BH8B 4WHCA 3RWEA 3HRZA 3QIBD 4U1GB 4EIGB 2XPGB 3BO8A 4MCYB 2GK2A 6FABH 3VE0A 1OARL 5AAMA 1IAKB 2ERJB 2A6JB 1U93B 4AENA 5EFIB 1BVLB 3MNZA 2JJTC 4K3JH 4P2OD 3PGFL 5T1MB 4BKLA 3TBVB 2OSLB 2OR8A 4ACPA 1IJ9A 1U8PA 4FQXC 1ZGLM 3ARQA 4I0PB 4OZFG 1P84J 3O4LD 1OLLA 4UTAH 1ZGLA 3CLEH 3LV3A 3DX8B 1D9KA 5H94B 1CDBA 1S7WB 4X7CC 4G9FA 1JMXA 4LSRH 1KFAL 4B53A 4K23L 3T0EA 4R96A 1WWBX 4GSDL 4Y1AE 2HT3C 5CZKA 1YNKL 2I26N 4GBXA 4KDWA 5DSCA 2R0LL 3Q6GH 2CO7B 3U7YH 5IHUH 5KVEL 4OLVH 4QXUH 2VSDA 1OP3K 4MDJB 3EFFA 5BQ7A 5CGYC 3ZT5A 4M93B 5KG9B 2AV1A 2O93L 2O61B 1H9VA 1SMOA 3LEYL 3FQTB 1ZLVK 2XZQL 1TJHH 1F6AA 3QUYD 4HK0B 2GTZA 5EORH 5LCVL 1I8MB 1I7UA 3D39A 4XC3L 1U92A 1UWXK 5EDXA 1C16B 4F37F 5SWSA 3QNYB 2NX5D 4HIEB 2YC1B 2ADFH 1JBJA 3MLRH 3AC0A 5E70A 3SKJH 3S88L 5ANMA 4NC2B 2AI0L 4X4ME 1ACYH 4QTHB 3ORJA 1CDGA 1IGJB 5INDB 2F58H 2ADIB 4OD2A 5TQ2H 5JORA 1JRHL 3WE6B 5C0IB 2AQ2A 2ZUXA 4JKPL 2YUVA 5K59F 1JWMA 3WXVL 3WDHA 3KPLA 3UXFA 2OP4L 1FZKA 5GS1C 3ARGA 1SJHB 2V2XA 4AEEA 4UQ2A 3LQAC 2DMKA 2E6JA 5D1QC 5CINL 3EYSH 1UKQA 4ERSL 1UACL 3TC9A 1MF2L 2H26B 3H3KA 3G6AA 3LKOA 3VI4F 5C0FB 1EUTA 3FQUA 1JWSB 2I60L 4Y4FA 5MENA 3PP3K 2JJWA 4DKEH 1V7MH 3IDYC 5I1GH 5GS2D 3IT8D 3JTTB 1KTDA 2X70A 4O51A 1XF4A 4XI5C 3KDMB 1SYSA 2R0ZL 2I9LB 4NM8H 2FDBP 4K2UL 2PTUA 4HW6A 1MUJA 4Y16B 4KJPC 2FH6A 3C8KB 4YBQC 3GDBA 4R4ND 5HVHB 5F7FA 1JRHI 4HH9A 2E9IA 2VZ3A 5ALBL 4S1RH 4U49A 3OR7A 4JO1H 3V4VL 4IRSD 4K7PL 3TNNA 2VLME 1RUPH 2DLIA 4LHUA 1A1OB 1SJXA 3OGCA 5J3HC 8CGTA 4PB9H 3VGAB 4JZOB 2MQCA 4NBXB 4MQXC 4XPBH 3AM8A 4YFLF 1N0XH 4OCWL 2X1PA 4Z7VF 5B3JF 3VJ6B 5KN5B 4PP1C 2X4OB 1F58L 3DETC 5I75C 4Y5XC 3STBA 4D8PA 5DMKA 1Q1JL 5D5MA 3WBDA 3S5LA 2VAAA 4P23C 3X3FL 1ETZB 4P5TD 3SE9L 1CL7I 4XP9H 1TETL 4NQDB 1IAOB 4RGMC 4JPVH 2CDEA 2ZG1A 3R8QA 2PTTA 2H2PC 3PL6B 3ARFB 3QWOA 2P4AB 1E4WH 2X4NA 4W81A 1T89A 2VLKE 2X4QA 1YY8B 1MFBL 2GYSA 3SGKC 4YDIH 1F3DJ 5I1EH 3D69A 1S9WA 4P46A 1A6VH 1RJZA 1T80A 2ZG2A 5IB1B 4JY4A 4OZ4A 2BSRB 5E1HB 3I02A 3I85A 4BJLA 4N90D 2DIJA 4OF0A 1FVCB 2UZXB 3ARSA 4DGVL 3KPSA 1ZTXH 4HG4K 4XP5L 1LO4H 3RNQB 1QVOB 2DLEA 2WIIB 3LS4L 3S4SG 4GKSA 3QUZB 5T3ZH 4KVCL 4IHOB 1G84A 3OKOB 3ULSA 3KXFA 5DTFB 1TZIA 4E5XB 5C9JA 1CGSL 2IPKB 1RZJL 2NW3B 5GIRB 5KSBE 1JMZA 4NCC2 1I75A 3ZE1F 3H9SE 1UQSB 1Z3GH 3SKOA 3HI5H 3IDGA 1M7IA 2A83B 3GMMB 4Z7UF 4HWEH 3DO7A 4GAGH 3U36B 1H3PL 5ICXB 3DRTA 1CT8A 4BELD 4UB0H 2XQYK 5F3HA 1AR2A 5D1ZA 4G6KL 5C0BB 5IHZB 3W5NA 4Z18A 3B9DA 4DOHE 3CUPA 4QCIB 3GMQB 4HHAB 4FQ1L 1MNUH 4M5ZL 5D7LD 4S1QH 2CKBL 2GTWA 5JA9A 1QHOA 4HAFA 3AS1A 3P9LA 4APQC 1WFUA 1HZHH 2AS5M 1RZFL 3ES6A 1FNLA 1XF1A 1EEYB 1FYTD 3MLYL 3RIAF 5E2UL 5I0ZA 2F53D 2VDOH 4BSVA 3K8LA 4I18B 5FGRA 1A6AB 5L6YH 3WIHA 5E8EA 5KS9B 4DK6A 3ZSTA 5GRZA 2B8OT 1NCTA 2F19H 3MV8A 4UDUA 1KELH 4XCEA 1R5WA 4ZODA 2J4WL 5CSZB 3CDGB 1FG2B 4M6MH 5C0AD 5FUCE 1Z6JT 4PJXB 3ILPA 2GCYB 1OTUC 3T0BA 3C6SA 4EN3A 5GGSB 1EMTL 3U1SL 4OV5A 3SE8L 4LAQH 2X10A 3HFML 4YJZL 3DIFA 5FM4A 1FZMA 3CMOH 5I1JL 3DTXB 2WWKO 4Q0XH 3PP4H 4WRLA 4LU5H 3DV4B 1X5JA 3VU2A 2Q1EA 3FQNB 4JFFB 2BHYA 4Q2ZB 3SJVD 1WWWX 4H0HB 2VQ1B 3L3HB 4OFYD 2OJEA 3QI9A 4B0MM 1RMFL 1B0GB 2OXGA 3IU3A 5GISH 3EIFA 1BREA 4HXBH 2F8VA 3ZYOA 5HGDA 1ES0B 4YHKH 1JTPA 1JF5A 2YUWA 3OJDB 1BFVH 2NR6C 4GJTB 5H35A 2D7NA 4OJFL 1RK1A 2P8MA 4U0RB 1NCBL 1RZ7H 5ELIA 4DQOL 5EU6D 2ESVD 1OQXA 4JO2H 3UJIL 4QGTA 4QTIH 5HHQA 5GSVA 1SHMA 2D7TL 4P4KA 3NCBB 4M1CD 5FYJU 5IT2H 4OQTL 5I8CB 2C4XA 1KEGH 4GG6A 1A7QL 2DL2A 3UTSA 4N8PA 2D9CA 1ZHBB 3C8HA 4GKOA 4OSUH 5E7BA 5HVGB 4HV8B 3HE7C 4LGRB 2C1PB 4X98A 4F7MB 2PYFA 1A6WL 3BQUB 1WIOA 3H0TA 4LPWA 3HG1E 1CD0A 3EDFA 1RVFH 3D0LB 4XGZA 4XTRC 3WUWA 4GRWB 1PZUB 1XGQB 2EYSA 4I5BA 3EJYC 1J1XL 2NW2B 2DQHH 1MCRA 2XA3A 4J1UA 4UINH 1U8QB 5IESH 2DQTL 4PLNC 4N8VB 5EU3A 3MRPA 4X4XA 2FL5A 4C56A 4L8SA 2E8ZA 1NC2B 3C60A 2ZKHH 4YXHL 3LQAL 2KPNA 4P99A 5JR1L 1G7LA 3CNKA 4OLXH 2W91A 3QQ3B 3TV3H 3QRGH 4K7FA 3RVTD 1JIBA 3MLVH 3O45A 1Q94B 3WUZA 4PG2C 4OGYH 1CFTB 4MD0B 1FHGA 1XGTA 3ROLB 5C0CA 2UUDH 3C5JB 4BQCA 2KQMA 3KJ6L 4RGNE 3GI8L 2IPTL 5I8OH 1ZHKA 4GLRH 1UWGL 3U82B 3GSNA 1MCIA 2VLJD 1YNLL 5E6YA 4B41A 1KIUA 1YN6B 4WNQA 5E8OA 1EERB 1RZIB 1S9XB 4ODVH 4UNUA 3ZTJH 1SJVA 3OB8A 5FO8B 3KLSA 4TUKH 4PJEF 4KFZC 1EX0A 3RDTD 2Y07L 3V8OA 3VI3E 5J06A 5DMJB 2Y5TB 5CJ8A 1MFCH 4P0DA 1MCJA 4MQTB 2PXYB 4G6JL 3QDJE 4OLYL 1QLFB 5JIPA 3T0EC 1OAKH 2V9RA 1WBYB 5T1DH 1U3YA 5K9QI 2V5TA 2HN7A 4P2RE 1CIDA 1X5KA 4E41E 5IROA 15C8H 3U48A 2AJZA 5F96H 3RX7A 4KKCD 3TFKD 1AKJA 4XP1L 5F6IC 3HI1A 4HMDA 1J8HD 4YHZH 3VXUD 1BJ8A 4Y1AA 5ADOH 1LD9A 4FXGA 2AEPH 3FB8A 2VOTA 3TYGH 6FABL 2Z92B 1G1CA 1KJVB 1QUNA 1WC7B 5FYJH 2FZ3B 5EWIL 1G0DA 1Z5LA 4K3JL 1NAMH 1OGAD 4GQ9H 5FO9B 5E24E 4Z0BH 2ARJB 5E4EB 4CW1A 1IM3A 1RJCA 3CLEL 5DQ9B 2LFGA 4I8DA 1TVDA 4LSRL 1BZ9A 4X4MA 5FYLD 5GRVL 5GGUA 5ID0A 3U2SA 1OOAA 3Q6GL 3ARED 5J0BA 1HNFA 1KCUH 3U7YL 5IHUL 3S37X 5DK2A 3F7QA 3ULVD 4OAWA 1C08A 3ALPA 4HFUL 4I2XE 4L5FH 3DLQR 1M4KA 4ODSH 4ETYA 2D31B 1ZLUK 5EORL 1TJHL 2PYEE 1NMAH 1LO0H 2EDXA 5HGAA 3RUGB 2XIDA 4L4VD 1QSVA 4M8VA 3WIHH 3MRFB 2ADFL 5DI8A 3DMMB 3SKJL 5IF0A 3WMSA 1ACYL 4FN0A 2W0KA 1BJ1H 4NRYB 2CR6A 4LVOC 1U58B 5TQ2L 2Q3ZA 2P8LB 2PTVA 3HAEB 3W9EB 1NMBH 1MRCH 3ZSSA 5I73C 4NKOA 4PJAB 4HGWA 5L9DH 3L9RB 1BLNB 2LU7A 3AM8C 4O58H 3EYSL 1RUQH 1U95A 1NBZB 3KPQB 2J2ZA 3SBWA 1KC5H 3L3OB 5E2JA 3U6RB 3H9YA 3MUGB 2ZJSH 2VISA 1XF5A 2H9GA 1CS6A 4NPYA 1BD2B 1A5FH 1B4JH 1V7ML 3MRHB 4DKEL 5I1GL 1AD9A 1A1NA 5EBWA 2MQ0A 1P9MA 4I1NB 4R0LA 2VN4A 3IDMA 5F7MC 1EO8H 4NM8L 4WW1B 3VWJB 1MCEA 4A6YB 3IVKA 3TYFB 1B3JA 1UB5B 2IADA 4P9HH 3WSQH 4PJFF 4K94H 4I3GA 4X5WA 5ALCH 4CMMB 3RZWA 2AJXH 4BQBA 1HWGB 2UWEE 4S1RL 4OBRA 3EOAA 2MHAA 4UOW1 4JO1L 5IB4A 3UTPD 3GMOA 2VLKA 4J2XA 1RUPL 3RVVD 4CVZA 4PB9L 1KPRB 2J5LB 3EYQD 4PGCB 1HWHB 2HFGH 2VXVH 1T1XA 4XPBL 5I8EA 4YAQB 1T1ZB 1N0XL 4YNYA 4PRNA 1VCAA 3P4OB 2YWYA 3RZCA 3CGTA 4FG6C 4WY7L 3MOQA 4PB0H 2VDKH 4WTWA 4X99B 4HS8H 2FJHA 3QXAA 5DUBA 3G08A 3MXWH 3IDUA 2W65A 5BXFB 1NC4A 4JPVL 1WBXB 4KK8C 4MJIB 1ND0A 3ARBD 1D6EA 1E4WL 1FN4A 4Z76A 5JPNA 3NVQA 4G8IB 1KG0B 4YDIL 5I1EL 3VXMD 3DOSA 1A6VL 4XCYB 3P4MA 5GZNC 4WI5A 5KSBA 4NOFA 1FYHB 3H9SA 2HKFH 1ERNA 3L7EA 4DUWA 2GJJA 1SM3H 5MHSD 1HH9B 2CUHA 3MJ6A 1NANH 1ZTXL 1F42A 4UT6L 2Q8BH 4F57H 4CMHC 4HS6B 3H9ZA 3CZFA 1I3GL 3OXSB 2HRLA 1BP3B 3UTTD 3MRBB 4KKLC 1BIHA 3IDJA 5IR1B 1AO7B 1JYVA 3GSNH 1ZA6B 4GS7C 5I1HH 4JQVA 5IQ9B 5FO7A 1BQUA 2ADGB 4D0CB 5LGJA 1NL0H 4WEUD 3HI5L 5D96C 4U1JA 5ICYB 3EYFA 3PV7A 4HWEL 1Q72H 3NFSH 4NQSB 4Y19B 2A9MH 3QNZA 5FM5M 4MQSB 4GAGL 2GJ6D 5F1IB 2OJZH 1MCSA 5CKGA 1IGTA 1ZHLB 3GBML 3S35L 4UB0L 3VRJB 4BSWB 1AH1A 4JO4H 4KV5F 1ZLWK 4OF8A 3O9WC 1QSFD 1MNUL 1IEAA 4AQOA 4ZNEE 3FFDA 3FO2A 4PGBB 3REWA 3F6IA 4C83B 4S1QL 4QF1A 1JK8B 2L7UA 2NZIA 2MPAH 4N5UA 2P8PB 2DBLH 2XQYG 3BT2H 1EBPA 1HZHL 4HX1A 3QUXD 2B2XH 3QI9C 1CFNA 2BVOB 3RGHA 2VLLA 1A2YA 1UXWB 1BFOA 2VDOL 5E1AA 4EVNA 1N6UA 1Q38A 5KVDH 4B50A 5L6YL 3VXSB 4KJWC 5GGRA 1G7QA 4XAWH 3TA3B 4R8WL 5IM7B 1CG9A 2W60B 3GI9H 4P9HC 4KC3B 4HUKB 2OTWB 3UROR 2F19L 2IH1A 4K94C 1KELL 2J7LA 5C6TH 4F3FB 1UH2A 2NY0B 1G7PB 2AJSH 4PV8A 1K5NB 4M6ML 1YZZA 3VD7A 3KAAA 2XZAH 1FH5H 1F45A 1CDUA 3O11A 3QEGH 2NXZD 4JFZH 5A2FA 5D6CA 4OCXH 3P0VH 2EEDA 4JPWH 1WAAE 3RWHA 5D1XB 5IMOB 4Y5VB 3CMOL 1L7IH 4Q0XL 3O3UN 3PP4L 1MHCA 4LU5L 4P49A 2I5YH 4LASH 4L8CB 1OAZH 3UBXI 4ZOCA 4ZNCD 1N3NA 2VL4A 4LCCB 1QLEL 4ODWA 4NRZA 2FATH 3QA3B 4O2CB 1RD6A 3MBXH 3T0DA 2C3VA 4WDIB 1L6ZA 4ONGH 2WBKA 4QRUB 1INQA 3Q5OA 1WBZA 3JWOH 5GISL 4LLYA 1I7TB 2WBJB 1N2RB 2BNRD 3G5ZB 3T2PA 2B20A 4HXBL 1F02I 3QZWB 4YBLC 4R4BA 3SDXF 4HZLA 4YHKL 3X11B 1BFVL 3F7YA 5E9DD 5T5FH 3UJTL 2CK0H 3ZT6A 3IETB 3HG1A 3GSQA 3O6FA 4ZXBB 3DRQA 3U46B 3I50H 4P59H 2I07A 1WT5A 3DBXA 2CIIA 1RZ7L 1WZMA 3SKNB 2X1XR 2EDTA 1DVFB 4QTIL 4GRLD 4K8RD 1PZ5A 5HYQA 5IT2L 4M4RA 3N1FC 2W9LA 1T4KB 4PR5A 4X6DF 2BDNH 3BUYB 3FHQA 4OSUL 1G7IA 2I25N 3DHJA 1XCTA 1FGVH 5D7LE 4R90H 4ORGB 5HHPB 5JQHC 1KTLB 2FO4B 4FXKA 5BS0D 4PJIF 5F1SA 1RVFL 1HILA 1R24A 5IJVA 2YD6A 2F53E 4HDIB 4G6AC 2DQHL 2UY7A 3I3BA 3VXPA 4UINL 5JIHA 5IESL 5A16A 3MOBH 2FJGA 1LE5A 4HKXB 1JNHA 4U3XA 4HCRA 4MXWL 4DEPB 2ZKHL 1CFVH 2GI7A 2HJFB 5C0AE 2CD0A 3W2DH 4PRBB 4IRZH 4OLXL 4QRRD 1U91B 3QRGL 4NCC1 3MLVL 4BH7A 3QDJA 4EUPH 1AXTH 1XZ0B 2DLTA 3SE4A 4GW5A 1JHKH 1JGDA 4P2RA 4E41A 2EIDA 5I6XC 4UQ3A 4KKAD 2QR0B 4Z0XA 3QIUB 2FB4H 4N0UE 4N5ED 2A6KA 5I8OL