4ZAKD

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD02
5F3BA 5HD8C 3BPLC 2KUTA 5DJ2B 4GLRI 3UTSB 4YFDB 2ZNWA 4OZHA 5CKAA 3VW3H 4QHUA 1A3LL 3DURA 2QADD 5ICXA 4A6YH 1EEQA 1SEBA 3ARWA 2MMXA 1MLCB 4NQUA 1WZ1L 1HHKA 5CCKH 4QY8B 5AUMA 3EOAA 5DEFA 1CIDA 4YDJB 1FYTB 3CFDB 2NYYD 1MI5B 3WXWL 2AGJL 2W9DL 2AJXL 3O3DB 4YR6B 2AEWA 1NMBH 1NCDH 1P7KB 2W1NA 5DUMH 3TJHC 1XF3A 2XYCA 3WE6B 3ARBA 4FRWA 1FVCA 5E6ZA 4PJCA 1EFXD 2HVJB 4ENEC 2AJUH 4G8GB 1A1NB 1IC1A 3OZ9L 1T89A 2FHCA 4NGHL 5ECJE 5GGTH 1ZKAA 3TO4B 2NY5C 1BJ1H 3JWDC 1NAMA 4DN4L 1JWUB 3P11L 3T2NH 1LP9E 1N59A 15C8H 3FFCA 1MCOL 4GG6E 4F9LA 3TA3A 1OP3H 3DARA 4KKCC 3ME0A 1DBJL 4NT6A 4TSCH 3FO0H 1ERNA 1UT9A 2WQ8A 1NLBH 1NFDE 4YHLH 4O5LH 3ZL4H 5GQBA 1PJ9A 3WO4B 4HBCL 2WP3O 2YEZB 4HIJB 1FIGH 4O00A 2CR3A 4TNVK 3B4NA 3VGFA 2ZG3A 4LNVA 2ZPKH 4H26B 1IEAA 1B6UA 3ZHDA 4ZOCA 4ZO7A 5I17A 3RNKA 3W5MA 3THML 1LILA 2PETA 2LQRA 3FO9A 3MCG1 2NY6C 2FWOA 3S98A 1TQCB 2ZSWA 1F4WL 3L1OH 4QXGL 4PB0H 4HXAL 3OPZL 3P40A 3QFJE 2AV7A 3M8OL 3O9WC 3TBYA 3LV3A 3IETA 1WBXB 3MLRH 5KVFH 5GS2H 2ENSA 1VERA 2X4PA 3NPZB 4NKDA 3VWJB 3GB7A 3RIAK 1IGYB 3OGCB 5DQJA 4L8SB 1CFNB 1QEWB 4QHMA 4Z0BL 1ZAGA 3CFJB 5DJ8A 4X9BA 5IFAL 4DGVL 5CEXB 1JYNA 4ZG1A 2YR3A 3S6CA 5HYJB 1KTRL 3IDMA 1TETH 4Y1AD 5CD3B 4M1GH 2F54A 4LPCA 2J2ZA 1N4XH 2HJFB 4QHKI 3Q5OA 4HULB 3BVNA 5CJ5A 4JO1H 1UXSA 2IG2L 4OCYL 3HR5B 4YHOH 2YD4A 2X2YA 4YO0A 4MQXC 6FABL 3ZSTA 3RIFK 5JNYB 2NY5H 1ZK9A 4Z7OE 1P6FA 1IVLA 2EE2A 5K9KB 1KB5A 5DK2B 2J88L 5DGRA 2PXYC 1T0NA 1ZHKB 1S9VA 5E1AA 3WO3B 5HYFA 1YDPA 3OB0K 1U95A 2V2XA 2HJKB 4JRYA 4YNYB 5C0RL 3VFOA 3BH8B 4Z6AT 2V7NA 3RQ3A 2FR4B 2H6PA 2EEAA 5J12C 2CDEB 4NCDA 4NPYA 4DCQA 3QCUH 4LKXB 2VLLA 5BS0E 4MYWB 2ESVD 3BPOC 3GO1L 1U8KA 2X9XA 1VGKA 4CVZA 5T3XE 4GBXB 5FA3B 5IIEB 5MP6L 4NKDB 3VWJA 4IDLA 3HZYB 2HVKA 4WNQB 5EU6D 4RCAA 1GC1H 2I07A 1FAIL 5I15H 5CBAB 2A6KB 2NY6D 3VRLE 4WENB 1FVEA 2UWEE 2VB5A 4B5EA 2H41A 4KMTH 5KG9B 5I1DB 1MJUH 1I3UA 2Q3AA 4MA1B 5ESAB 1FE8H 1SY6H 3SGDH 5AEAA 4I13B 2G60L 5GJSH 3VGGA 2Q6WA 3LKSA 1TJIH 2VDRL 1HINH 5IB3B 3RL1A 1ZGLA 2CLVA 5F7WC 3FOLB 3MOAH 4JO2H 4PGJA 3B9EA 4H1LB 4PJFE 3UTQB 4D8PA 2WBJC 4HZAA 1AD9A 3NAAH 1NEZB 3VWKC 1NC2B 3PHQB 1LEGA 4QOKA 4PJDF 4CADB 3U7WL 2JELH 2V7NB 3MRQA 5DQ9B 3V4VL 1RUKL 1QOKA 2X5PA 1LDPL 2XNAA 1OAUH 1TJHL 4YHMH 5HGAA 2FHBA 1HXMA 5D1ZA 1NUFA 5J11C 1BECA 1IGML 3FL7A 1QNZL 4CDGC 5E4EC 1HHIA 1YEKH 1FC2D 3MNZB 1RZGB 4LAQL 4YO0B 3BP5A 2IANB 3PWJB 1X5KA 5JOEA 1MEXH 3UEZA 1IARB 4HDIB 4JKWA 4LFHG 2DS4A 4WWKA 5D96C 3UZEA 1CU4L 4TVSa 4LPTA 5FDWB 1AP2B 1H3WM 2VDNH 4MZ3A 3MODH 5GS0H 3AREC 3HI5H 4Z7UB 3U48A 12E8L 4XVUD 3BPCB 3RAJH 3PNWA 4M6ML 1Z0NA 5HGDB 3WIIH 2GTWB 3LN4A 4L8SC 4FHBD 2F53B 4YXKL 1QVOA 3LKOA 3OAYH 3UTZB 1WCQA 1RJLB 3MGAA 5K9OB 3C09B 4G8GA 3QYCA 1P4LA 3FRPA 2FD6H 3PDDA 5GRUL 2R39A 3SCMD 1A6AB 5IJKA 4F7PB 4PJAA 3JV4B 1ZHLB 4AH2B 2H32B 4XPHH 3EFFA 3L5WB 1BWMA 1SYSB 1DUYB 2Z8SA 3IFOB 4ZUWA 1AO7B 5BZDA 1S7QA 1QD0A 4JPKL 2GW5A 2ZKHH 1ZGLB 1Q94B 4XC1H 4NKQB 5EFIB 2UVEA 3FRUB 4P23B 3OKKA 3LB6D 5C92A 1V05A 2HWZH 4HXBH 4XX1E 4X6DA 1DLHB 3O41A 1FG2B 1XCTA 3SKUD 4MXWH 3FOMB 1T89C 4OQ1A 4YDVB 4U31A 5I8KH 5DTFB 1BD2E 4NQSB 3ZE2E 5TE4L 4EVNA 4PRDB 3TYGH 2Z4QA 1W8NA 2HYMA 5BQ7A 1T6VN 4GG6F 1A9BB 3C60B 2VDPL 2DWDA 2VAAA 5CHNA 1MRFL 3K2MC 3CFEA 1G9MH 1I3RB 4OSUL 2IQAB 4HG4K 3I6KA 1IFHL 4YBHA 3D39A 3O3BA 1I3GH 4NZRH 3BZDA 4X6CF 2BHZA 1Q0YL 3TFKC 1CFVH 2BNUB 4E9LA 4M7KL 1MCJA 4RBPH 5C8JA 2IPTH 5MHSE 1VHPA 3V0AC 4M6OL 3KJ6H 2EXYC 4JJHA 3CSBA 3O2DH 4XPFL 5T5FL 3A0OA 4U4BA 3KLDA 4OLYH 3LQAC 3DX8A 3IDUA 4LLWB 5E2TL 3BVNB 3BKYH 4NO3B 3AY4C 1CR9H 1U8HB 5CEZD 5HHQB 2VLJE 4N9GA 4O9HL 3B9KC 5T3XH 1L6ZA 4LSRH 7FABL 3ARZA 4FZ8L 2CUIA 1DBMH 3KPPB 1MHCA 3EFFB 2DQGL 5FA4B 4WI4A 2NXYC 5FYJH 3MV8D 1R6VA 1DN0A 5BOZG 3K8LA 4NN7B 1QFWL 4HIXH 3SGJA 4EIGB 2ICWJ 2NXYB 3JWOL 1MHHA 4Y5VB 3OF6A 4F9LC 3BXNB 2XV6B 3BFOA 2HLFC 2IMMA 1EVTC 5FOJA 1P5UA 2R4SH 3D0VB 3KXFB 3PP3K 1P7HL 1YEJL 4RGND 1YPZB 1EFXB 3CVIH 4HK3J 4KHXL 1HZHL 1QLFB 3FHQA 5FYLD 5IB3A 4I48B 4CMMA 4N90E 3S9DB 1DQTA 3DTXA 1MCIA 2A73A 5IT2L 1D5IL 4NN5B 1WVZA 4L1HA 1SBSH 2X4SA 4CVWA 4ZNCD 1BD2A 2J8UB 5D2LF 4CW1A 1JZ2A 3HA0A 5CZKA 2VZOA 2Z93B 3HC0B 4O2CB 4FTVA 4JFHE 3QEUA 3RP1A 5L9DL 4JFFD 3MLZL 3E6HA 3L3OB 4I3SL 5HHOA 3PWJA 4Y4KC 4H0IA 1S7UA 2DIBA 4BH7A 5ESVA 4NDMA 4P9MH 3ZZ1A 3TZVC 4J3XA 4P2RD 2DJUA 2NR6C 2HN7A 2VDLL 5DHYA 1MUJB 1FAIH 4L5FH 3B5GA 4HC1A 4U6VL 2ADGB 2CIIA 4P2QE 4MVBC 3MRCA 2C7UA 3SDAB 1XGUB 1B9ZA 5CMAA 3C5SB 3GJFK 3DV4A 2GAZB 4OUUB 5AZ2H 2JIXA 4EBQL 4F57H 1BAFL 1F4YH 4HIIB 5I1GH 4X4XA 3KWWA 4CBPA 4QXWA 4WTXA 2A83A 3GSUA 5CEYB 3CFBA 3I75A 3MLYL 3S3PA 3F12B 2HJFA 4P57B 1U8QB 1FNEB 2P8LA 4NIKB 1FORH 1IGMH 1I85A 3S3JA 2GTZB 1DANU 2NW3A 3ZTJH 4GG6B 1OAUL 1TJHH 5ADOH 2G60H 5DJDB 1S7TB 4Q97A 1RZ7L 2FO4A 5DJ0A 3KXFD 2ESVE 5B8CB 3E2HC 3S88H 4K3EH 1ZLVK 1CBVL 3VXME 4ODHL 5DQJB 1GGBL 1PEWA 3F65A 3DETD 3VXRA 2EH8L 2UY7A 2V5SA 3C08L 4LF3A 4BK5A 4Z7VB 5C9KA 3NFSL 1J1OL 1E4KC 2CKBB 4P2QD 3CMGA 4JRYB 2HFGL 4YNYA 43C9B 1F58L 4NQVB 3F7YB 1NAKL 4X99A 3M8OH 4N5EC 5E5MA 3WLBA 3HN3A 1XF5A 4K3GA 3DYPA 5ICYA 3FT4A 4FABL 3H9YA 1SYSA 5TDNA 4JM2F 1FO0B 1MJUL 1OAKH 1NGWB 5JNYA 4KI5E 4WTZG 4LLMA 5ESVB 2NY0C 4PS4H 3U0TB 4IJ3C 4Z78A 5EZLB 5D93C 3KPSD 1VSCA 2A77L 1RUQL 5ANMB 3MCLH 5CP7A 4GBXD 4MNQD 3MYJB 2DQJL 5LXGL 4WFEE 5CIPH 1LGVA 2C5DC 4XZUB 4UZGA 4OZ4A 5MEOA 1JP5A 1TQBB 1IBGH 4G3YH 1CLZH 5EU5B 3SDAC 1KPVB 3LMJL 5GRJH 1HQRB 1U8MB 2H26A 4XXDA 2CJUH 3UC0H 8FABA 2XQBL 5T5NG 4C83B 3N85H 5BCAA 5FYLL 5HD8D 5HYJE 4XPAH 2OCFD 2DQTH 2H1PH 5K33A 4PY7A 1AGFB 3MRNA 5AZEL 1H15B 4AIOA 3KLHC 3NH7H 3Q3GA 3SKMB 4NRXB 4I4WA 1MY7A 5LBSL 2Z35A 5F1KC 3NCYP 4WI7A 2GUOB 1EX0A 4WWKC 2FJFB 1Z6JT 1RZGA 1EHXA 1VFOA 2LTQB 3S34H 3WFBH 2V7HA 1X44A 1SYVB 3OV6A 5SX5H 3U2SB 3VH8G 1NMBL 1EDQA 2H3NB 4U05A 5IOPB 2EC8A 4ZXBD 4NQTA 3NH7L 3P3YA 3DSNA 4JM4L 3I9GH 2YPLD 1G7PA 2AJVH 1MWAL 1OSPL 3P4LA 1YNLL 2BP3A 4LGPB 1BLNB 4N9GB 5HPMA 3TBWB 3NA4A 1N7MH 1RZIB 1A4JB 4HJ0D 5ERWA 5T1MB 1ND0B 1OM3L 4LRNL 5AZ2L 5J1SC 4XAWH 4J3TA 4HUMB 3MV7E 3V6FA 5D1XB 4U6TA 3B9VA 4I0PA 5FYKD 5MHSD 4MDJB 3QJFA 1PKQE 4IHOA 3TJEL 5BV7B 1MVFA 5MI0C 2I26N 1FZMA 2ICWI 1EUTA 1G9NL 5E2VL 5SX4I 3MRBB 2VKWA 5C6PB 4RQQA 5T5FH 1UM6L 3AY4A 3X3GL 4MX7A 4LSDA 4LSUL 1OW0A 3W81A 1REIA 2ZCKL 1L7TH 2DLIA 2WBWB 4ZOEA 4OV5B 4K3EL 1U91B 1I3GL 2R2CA 1P9MA 5FOBB 1XGQB 2LFGA 5KVGH 1HWGB 5CGMA 2B8OT 1MPAL 3OKNA 2H32H 3RGVA 2ZJSL 5IG7B 2FBJL 5EU4B 4FQQA 1UADC 1HSBA 3MRHA 1I8KB 2MHAA 4G42B 3ARSA 4LRIA 4NPYB 2I60H 5J4MA 1YYLH 1HZHH 4B7IA 4NNYB 1A6AA 1OY3B 3T0EC 5I1GL 3G5XA 2UVFA 2HRPH 5IBLC 1I1RA 2AQ3A 3QDGB 5CIPA 3KPOA 3N1QC 1X9QA 3U9PL 4KRNA 5K9JL 1S7QB 3B8YA 4K7FA 3EIFA 3DVGA 2UUDH 4GRMB 3QUZD 3CCHB 3QCVL 1HK6A 4JO3L 4P2OA 5IROC 4F7TA 2HTLD 4Z7UE 2BSTA 4JLRB 4NO2A 5GS0C 5IVXE 3Q0HA 5E56A 3PWUA 3U7AA 3B2VL 5C07E 2DLFH 4OF7A 2VR5A 1E4XI 1A4JA 4JR9L 3TFKD 5D6DA 3O6FD 5IMLB 5IB4B 3AAZA 2H2SC 5FAAA 3A6BH 4J3SA 3LZFL 3WO4C 5IW3A 3QUZA 3WS6A 4AYFA 3QA3B 1LWRA 2PTTA 3QJFB 4PRAB 1QKZL 3RZCD 2Z8WC 2DLFL 3PIQA 1M7DB 3VXSB 5ALCL 1MRCL 5D70L 4HWEH 3SE9H 3ALWA 4WIQA 4KK8D 2EYSA 3BWAB 2DWEA 4S1RH 4LCWA 4OLVL 3MLXL 5I17B 4NQCB 4OD3H 4JN2A 2OZ4L 1NEZA 3SN6N 4CADA 4NHCL 1CF8L 4XPTH 3UBXI 5C08B 1E0OB 1BQLL 4F9PA 5KAQF 3TA3B 1QFHA 3FN9A 1CL7H 1JHLL 4OAWA 2E27H 4TSAH 5D93B 1GOFA 1Q9KB 2CRZA 4JGUA 1QLEL 3H7BA 3BZ4B 4AEIH 3QEQD 4BUHA 4OCMC 1G6RA 1T04B 5C0CB 4UT9L 2JLLA 1JGEB 4ONGH 1CXLA 1XR8B 4PGDB 4UU9A 5SWZB 3SKJL 1YPZA 1JWMA 3MLWL 4DZBB 5E2UH 3QCTL 4JFDE 3SCMC 3HS0A 2P24B 4ISVB 3UXFA 1T5XB 5EZIH 3FONA 1U9KA 3TBTB 1KJ3H 1F6LL 2BVOA 4I0PD 4MD4A 1MH5A 1E4KA 5IF0B 4FQIL 2BNRD 2XA3A 3MV9D 2VISA 1KPVA 1IAIL 2MNUA 5LGJA 2A6JA 2DQCL 2JJTC 4GMTL 4CU8A 2FEEL 5BS0D 3ZSSA 2Y72A 2IPTL 1CD0A 1S9VB 5K9KA 4G80B 4QCIA 2WWMC 2P4AB 3F62A 4KVCH 4DJMA 1GCFA 4JFFE 5LJYH 3SDDA 4IRSB 5I19H 1Q9OA 3DYMA 2FGZA 3QHFL 4PRIB 4X4YA 2L7UA 4JVPA 2VLLB 4OGZA 2AVGA 3UTSA 4YQXH 1ZLVH 4U1IA 3MJ8A 2CDGA 5KSAA 3IFLH 3HC3H 5DZNA 1U0QA 2G9HB 3OKMB 3ARUA 5IMKB 1WUNT 3SDAA 3WNPA 4LHUG 3VXPA 4LARH 2R69L 5T3ZL 5EZIL 2D7NA 1MJ7H 4AIXA 2ICCA 2EEBA 1SJHA 1T5WA 1ZWIB 3O3EB 4PP2B 2LAGB 4G6KL 1HHGB 1F97A 2CLZB 4NHUB 2OS7A 3DX7B 4WEUD 1A4KA 1SEQL 4WGVB 4YHIB 3QIWD 3BP6A 2YBRB 5D2LB 2A0LC 4QRRE 4LAJH 2DQTL 4L3EA 4Q9QL 4F37F 1FG9C 3PXHA 4N1CA 4WDIA 4YZFE 4BZ2H 4GKZA 4S2SB 2GFBB 2Z31D 4KJYA 2XN9A 2IPKA 4ISVA 4K23L 4QXTA 2R2HA 1QUNA 5EG6C 4X80H 3V7AG 4X5WB 4Z7QE 2N7AA 2ATKB 1JIBA 3SY0B 4TUOB 1OB1A 4NRZA 4IOFD 2C3VA 2H1PL 1JWSB 3IGAA 4XHQA 2R0KL 2NTFB 3X17A 1P5VA 3M07A 2FB4L 5E8EA 1AC0A 2V2WB 4FNLH 4XCFL 2YD1A 5DJCA 4TSBL 2MQ3A 4IRZH 1KULA 4NHUA 4LPXA 4LCIH 4PJCB 5AD0A 4XMPL 1P7QB 3NVQA 4J4PD 4D9QD 5IHUL 5IMLA 3B2UD 4NZTL 3QDGA 4WW2B 5EORH 1NC4A 3W9EA 4NJAH 3FO9B 5EU5A 5CD5C 3GGWA 4Y1AE 1CBVH 1QBMH 5SWQA 2YMXH 3U83A 2A73B 1WIUA 2V5YA 3EW3B 3GMMA 1CFBA 1PG7L 2WV3A 4PJIA 4TTGA 2C4FT 3HZVA 3CCHA 5C0EB 1GZQB 2YA0A 3QUMA 2JIXD 3CMOL 2LTQC 4GMTH 4ZAKA 4UUJA 3O45A 3VCLB 2MJWA 2D7TL 2VXTH 2Q76A 4HUVB 3ZHLA 1G1YA 2I60L 1IAIH 3I6LD 4O02H 1CFTB 4UQ2A 2HAZA 1MFAH 4U7KA 5E5RB 5JQHC 3NIFE 3MV7A 3RWEA 3HLAA 3MFGB 2EYRB 2FX7H 3S97C 5DMYA 4UDTB 1S9WA 1NAML 4JRYE 5I66A 4XX1G 1FE8L 3SJVE 3MRIB 3RY4A 4OZFG 1UXWB 5IROA 2RIKA 3P4MA 2Y6SD 1MLCA 1A7NL 5CFHA 25C8H 2NZIA 5D72H 1BZQK 2WINA 5JMRA 2O5ZH 1ZHBA 2ITDB 3JUYA 4DW2H 2R1XB 5HGBA 3BGMB 5D1XA 3HAEH 5IW6B 4U6HA 4GS7B 3MUGA 4OF0A 4ACPA 5DK0B 3ZE2F 3DVIA 4Y5XA 2FH8A 4ODXA 1TDQA 3F58H 1WTLA 4KTDL 4P5MB 5KS9B 3DGGB 2LVCA 1IGTB 2JKXA 1J88A 1J8HA 5A16A 5LGHL 4MS8D 1DEDA 2BFVL 4ZYKA 1SMOA 2LU7A 3QWRD 3IFPA 2AXGA 1GZQA 1CICA 2YWYA 1INEH 2EICA 4W6XB 3QXTA 1U8LA 5I74B 5K59E 4MJIB 4XBEL 4PRHE 2AI0L 5E7FA 2YPKB 4PGDA 4FG6D 1UA6H 3QXWA 3FTGA 3U1SH 2AJ3B 4MJ5B 3V7MA 4JZOB 3WFBL 4BZ2L 1BGXL 4Z5RA 4NUJA 2J6EA 4UDTA 3JTTB 1DBAH 2YRZA 3O6ML 4GW5B 4XNMB 3KPRA 2HG5B 5D9SA 2VC2H 3M17A 4ZQKA 3MACL 4OM0L 3V4UL 2R0ZH 4PJ9D 3DMMC 3MROA 4KJQC 4X7SH 3NCFB 4YX2L 5J6HB 1JI1A 5E5MB 4W4OC 2BSRA 4KZDH 1FZJB 1WBZA 2OR7A 1QA9A 1UB6A 2BSSB 4JZNA 5C0AA 3LS4L 3VI4F 3L5IA 4NCC2 4FFZL 1WIOA 4NC1E 1U42A 1RMFL 3MR9A 5GS3A 3NCMA 1HHIB 3IFNH 1A1OB 5D2NA 4L3EB 1QFWH 4LSQL 5IB1B 4QTIL 1ZXQA 2H8PA 5KVEL 1OTUC 5DJ8B 5D2NE 2R1YB 3BP6B 4U1GC 1MF2L 3AVEA 4JANB 1M7XA 5CP7B 1B0GA 1DBML 4LHUA 3OAUL 1Q8MA 1TPXB 5DSCB 1DN0B 4OZFA 2YRPA 1UM4L 3CVHH 4NO5B 3AM8C 5I1KH 1J12A 3IJHB 4MMZC 4HGKC 3MV01 5GZOC 4F9PC 1CR9L 2C3VB 4QRPE 4FXKA 5HHVH 4RFOH 1EZVX 4JFPA 5F44A 3V2AR 5HSFA 3SO5A 2UY6A 4PJBB 4KGLA 2NX5E 1I1YA 2AXFB 5DJ6A 1DL7H 4RZCA 5T1KB 3OAUH 1KC5L 5EBGA 4ZXBA 3GNML 4PYGA 3PWPB 3DLQR 4WHYH 2K7PA 5HHMD 4YHLL 5C0IB 2F5AL 1JNLH 1TVDA 4P23A 5D8JL 5DYOA 3L7FA 1RV6X 4UAOB 3G6DH 1NUDA 1PW3A 4M5ZL 3DURB 1AO7A 5BZDB 3MV8E 1HNFA 4XBPB 4FQHB 4K8RH 4Y7MA 3IDIA 1CGVA 4KRPD 1C5BH 1XGTB 4I0KA 3L3GB 4JN2B 3MLUL 2PYFB 3QIUB 5E7BA 4OKVA 2MTPA 5CEYA 1TZGL 4JHWL 3NCYS 4LEOB 3HHRB 5SWSE 1OP5H 4YXLH 1EHNA 1IEBA 2W65A 4GRWB 4HS3A 4RFNC 4YDLC 1I7UA 2Q6WB 2IAMB 5DHVB 5KSUB 4WFHE 1HOCA 2FD6L 4P4RB 3QIUD 3BKML 4PJHB 3H0TB 1QSVA 3GEWB 5K59F 4FQJH 2NW3B 5AYUH 3HNTL 2BERA 3NABH 4N8VA 2HMID 4TVPH 4DTGL 1QSFA 2CUHA 2Q76B 1ZT4A 4WVRA 3KPSA 2Q86B 4YHKL 3VE0B 1QSZA 3BQUD 5IBLD 1RULH 1AD0B 5D7IA 3V5DA 4EEEA 3C6LA 1JNHB 1MCHA 1BWWA 2XWJA 3DO3A 4IIQC 2P7TA 4AT6A 3C9NA 3FONB 3EYUL 2EIZA 4LLDA 3LMJH 3SKOA 1BFVH 4MLIA 5ICXB 4OCLC 4GLRH 4JZJB 1E6JL 3NABL 3GSQA 1Z9OA 4JFEE 3S37L 3BIKB 5JHLL 1JTTA 3P4NB 4YEEA 3BUYB 2IALB 3OKYA 4D9LL 3NFPB 2ADFH 1KT2A 4LLYB 4MMXC 5FUCE 1A6VL 3WSQH 4UBDC 4NNYA 4QRQA 5EZJB 1UJTA 1MSPA 3E6FB 1JK8B 2EYTB 2KL6A 2P48B 3CZJA 5EO1A 4X7CC 4PG2A 5CZXD 3OKEB 4OZFH 3TM6A 4MNGE 3HR6A 1F58H 2APWA 1XIWC 3J8F7 3CVHA 3RWHB 1HQRA 2H26B 5E8DL 3L5XL 1I8LC 3OL2A 4DN3H 2AK4B 3VE0A 1VA9A 1NFIA 5KOMC 5FB8A 1W72H 1T83C 1J7VR 4KK9D 2IPKB 1YJDC 4YHML 4XMKH 1HNGA 5CUSL 4GRWH 1T7ZA 2AXGB 2FX7L 3T65A 1KNOA 3IDJB 4X7TA 3RVTC 3BIBX 2A6IA 3EYVA 3T2OA 1F11B 1RUKH 1YYLL 3BAEL 2JK5A 3D25B 4YWGH 5KSUA 5L2JA 3O9WA 1SM3L 2BDNL 2DQHH 1I7TA 3RTQD 5HHVL 2Q7NA 4Y5XC 4XWGH 4XHJD 3WXVH 4JFZL 2FYYA 1ZA3A 1I7RB 4UQ3B 3RWIB 3C09C 4YJZL 3VFUB 3CVHL 3JWDL 2VLME 5I71C 3KPRB 4LVEA 1RZIA 3WDJA 3SKNB 1OPGL 1DQLL 1Y0LA 1CICC 4P4KC 3L5XH 3VD7A 2QSVA 3IKCA 4N0YL 5F8RC 4D0DB 2A6DB 2Y36L 1T4KA 3LEXA 1MELA 3O0RL 5JDSA 3IXAA 1XR9B 4JRXD 2J88H 3C5SA 4R2GC 4ZFGL 2I24N 1RJZA 4HFWA 4LSPL 1R3HA 3ULUF 1DCLA 4QYOA 3V0WH 1RK1B 4S1QH 4DFIA 1QLRB 1ROWA 1JPFB 4M8QA 4XWOD 5LGJB 2W0KA 3O2WL 2A0LD 2YD5A 2CPCA 1KEGL 3TIEB 1D5MB 4KV5F 3T65B 1MH5B 1FDLH 5B3NA 1OTTC 2YPLB 4NQSA 1H0DB 2IF7A 3IFNL 1MREL 3SQOH 4JFQB 3TBSA 3GGWB 3R4DA 3UBXA 2IH3B 2FYYB 3G08A 5I6XB 1BX2B 5FGCB 2BY3A 4K23H 3EYUH 2Y5TA 1I9IH 3O6MH 4H25B 5DRZB 2XG5A 3B43A 3MV9E 2MHAB 4G42A 3UYRH 2VNCA 3S3SA 4E0RB 4X4MA 1RFDH 1Y0LB 2ORBH 1J0JA 1OGAD 4PJ8B 4GW4A 4NZDA 1B90A 4Q9QH 1S7WB 5CP3H 1QQDA 1MHEB 3PE9A 3SOBH 4PBVC 4MQ7B 1G7HB 1YUHB 3LQMA 1NCCH 1VPOL 3DETC 4ELME 3K4DA 3G5ZB 3UTPD 2R2EB 4YGVB 5EIVA 3Q1SH 3OWEA 1EO7A 4ERSL 5FECB 1HEZA 4CJ1A 2WWKO 3T3PF 2DQDL 3D39D 1R5WB 1HDMA 4LLUA 4EN3B 1FNGA 4U1KA 1B4JL 3JXAA 1A1NA 1S5HB 5D2LA 4JZOA 4PJ9B 4QRSA 3GSRA 5E6ID 4IEFB 3KGRA 2G75B 4PJAE 2Y25A 2XTLA 1O7VA 3GNMH 4PJHA 3OBAA 3FO0L 1CGYA 4MDIB 2IAMA 5DHVA 2F53A 4JO4H 1LDPH 4X98B 3QSKB 1HHJB 4L3AA 1NAKH 5D7SL 4DVBA 3WXVL 3VXMD 2Z8RA 2PUQT 1UB6B 1KN4H 2ZG2A 5FO7B 1PD6A 4KAQH 4M03A 3WL9A 1BFOA 4FQIH 2CDFA 3SEPA 3G08B 1CD1B 3FMGH 4RFNB 4W4NA 1V5JA 3MBXL 3SE4C 2ADGA 4LSSL 3MO1B 2VLRB 5EU3A 4W6WB 4P5KB 3LN9A 1MF2H 1KXVC 3DROB 4L9LC 1SVCP 5JR1L 2A9NH 3HZYA 2V17H 5L88H 4PJ8A 1RVFH 1TVHA 2R29H 3UPRB 2DLTA 3UTOA 2QHRL 5C07A 4AEIL 4OB5H 4QWWD 1CE6A 2LVEA 5H2BA 1RU9L 4PREB 1C5CL 4PJXE 1OSZA 1KB5L 1XCTB 3X13A 2V2XB 1KIRA 1A3LH 3EOTH 4A6YL 3QO1A 4JG1L 2EDDA 2WIIA 4D9LH 3D39E 2ADJA 2CK0H 2NY3C 4D3CL 4NOBA 1JF6A 3TVMD 1A9BA 1AGCB 3S37H 3TT1H 3DV4B 2Z91A 4ZUVA 2A6IB 5F9DC 4S1RL 4F37K 2V2TB 2AEPH 1OGAE 2AKRB 1DBAL 1IRAY 5CP3A 2XFXA 5F21B 1DQDH 3G9VA 5I1DA 4LF3B 3B83A 4GSDH 2WP3T 3Q48A 4HV8B 4GSDL 2CMRL 3ZE0F 5L9DH 5DYOB 1CD9B 1GGUA 4K3DH 3FQUA 3O3UN 3WFZA 2NY1B 2RCSH 3K0WA 2P5EE 3MNVA 1A64A 2OL3H 1S9WB 4FOMA 4KRLB 5F6IC 5CINH 3QHTC 5E6IA 4AEHL 5FK9B 5B3JE 3VRIA 2XZZA 1NANH 4F33B 1NSNL 1T83A 3EUUA 4K71C 1IM9B 2ZSVB 3PG2A 3MZGB 3NPSC 2R8SL 2GYSA 1RZ8B 2BNQA 3D85A 3ROLB 3EJZD 5L7XL 3P4OA 1MFNA 3H0TA 3JV5A 3BQUA 4OD1L 5E9DD 1EAPA 1QSEA 4LKCB 3LKOB 3I2CL 2PYEB 5DA4A 1TJGH 1VFMA 2FSEB 4MJ5A 5DHVH 1WITA 2EDBA 4IDJL 3DUUA 3MRJB 5GS1B 1J8KA 2FDBP 1BHGA 4N90D 3Q3GB 3VGDA 3QHFH 3V5HB 4I9WD 2IH3A 4EI6A 1FSKB 4PJIE 4KVCL 2OX5A 2BXZA 4AG4L 3VXUA 7FABH 4X6DE 5AYQA 3I6LE 4DKAA 3UMTA 1ADQL 1T21A 5EOCJ 4QLRA 4BSJA 1UCBH 1PY9A 4LIQL 1G9NH 4M8VA 4UNVA 3BW9B 5J6HA 4XP9L 1IM9A 1DLHA 1JVKA 4MQ7A 3LKPA 2XFXB 1E4WH 3OB8A 5TDPA 1WC7B 3QUKB 1IM3A 1RUML 3BH8A 2HH0L 3KPMA 1FPTH 3B8SA 2NY4B 4K07A 4K8RC 4I3RL 5MENE 4Y4KA 4GBXA 3PDOA 5FUZH 3DBXB 1FLTX 4HH9B 2GJZB 4AM0B 5A2FA 1BBDL 4K94H 4Z77A 2XTJC 2R9HC 4RRPA 4WUKH 4IOIB 4M6NH 2FZ3B 5F3BB 2NXZC 3IAPA 4NQDD 4OLXL 1T80A 5IB1A 3QQ3B 1NCAL 3PDGA 4CN4A 4EKXA 1WQVT 2RAMA 2ERJB 1PX4A 5E70A 2Q1EA 3VMPA 2O5YL 4GT7A 2FLBT 4NZUH 1K4CB 3SOBL 4OM0H 4P9HL 1JGUH 1G7QA 3TBTA 2YKLL 4BZ1H 2RFXA 4UTBH 4G9FB 4G6AD 1EXUA 4RMUA 1RJCA 4POZD 4LK4A 3ZDZE 1NGPL 4M7JL 5TH2A 4WI6A 5LCVH 1Z9LA 2FBOJ 1RUAH 1BFOB 3VFOB 4NQEB 1MCNA 2F5BH 4ZAKB 3G6JE 5ACMA 3BZ4A 4ELMA 2AW2A 3ULUL 4G6MH 3DGGA 3FCTB 1J18A 4UT6H 3R06B 4S1SH 3RJQB 1LNUA 1ZA3B 3BZFB 4MS8C 1L6XA 1NBZB 3S4SG 5HYEA 1B2WL 5E9DA 2ILLA 3CU7A 4I9WE 4L3CB 5DD3L 4HS6B 1YEFL 3RDTD 2I9LA 4MAUL 4M61B 5D1QC 4P2RE 4CJ0A 2Q8BL 1F6FB 3LN5B 4YXHH 1CFNA 1JPGB 3MNWA 4OFDA 2HFGH 5EC2A 4JKMA 4G8EA 1OOAA 5T5NF 5CWSA 1Q0XL 1CDUA 4TPRH 4MJ6B 4XNUL 3X3FL 4WHTB 4G8GE 1IC5L 3CUPA 5L2KE 2JF1A 5FM5M 1MCDA 3EGSB 1OTSD 2EH8H 25C8L 1CQYA 3VFNA 5HI5D 1CZ8L 2YUVA 4KC3B 3L95B 1W0VA 5EBMA 5F1NB 1MHHB 1X5JA 4B41A 1A1MA 1BFSA 1MRDH 4L9LA 1FNSL 5ISZB 4ZQKB 1TZIB 3BX7C 4KAQL 1H0DA 3IB4A 4XMLL 4LLYA 3Q6GL 1T03H 4XT1C 2X42A 2FX9H 2R1WB 3BJ91 1NGZA 3GMRA 2NY2B 1KN4L 5I71B 3NIGE 3KS0J 3VG0L 5FUOL 1XF4B 2A74A 4M4PA 4FQ1L 2Q8BH 2HT2D 5GRWA 1V7NL 2OBGA 4PRIE 4L3CA 3BKCL 1KJMB 4AMKL 5HYSG 5IKCB 1ULVA 3BMVA 4ZO6A 1X4XA 3QDJD 5INCA 4L4TA 4P3DB 3VXTB 4XVJL 2WW8A 4CKVX 3M1BB 4KZEH 2DDQL 1DSFL 2B2XH 4J4PC 3FQRA 4R4ND 2C3XA 1G7LB 3VXRE 5SWSD 2VOTA 1T1ZA 4PV9B 3GM0A 4A2MA 2JE8A 3WE6A 1VFAA 1KCSH 5C0FB 1G1CA 3HTLX 4OCYH 3NFNB 2OZ4H 3S34L 4HWZA 5F1SA 4I77H 1U58B 5FA3A 5KTEL 4L8DB 5JQ6H 4KKNA 3IDYC 2R0KH 4GMSL 5DZLA 2HT4C 3TCLA 1MCPH 2E9BA 3MRBA 2J7LA 1EO8L 4MJ4A 4IOFC 4HHAB 1WIPA 3AXLB 4Y2DC 5F97E 1QBAA 1D5XA 5HYSA 3CSPA 1WLHA 4WUUE 2DBLL 3F12A 1LO4L 3R8BB 1CFTA 5JW4R 3WN5A 2IAMD 1A2YB 4FQHA 5EU6B 2ORBL 4S0TD 2EIEA 3BQUC 5CKGA 1F4XL 2GHWB 1U3YA 1CK0L 5AD0B 4PRHD 5HDLA 1MCEA 2YZ1A 5DFWH 3QXDB 4LHUD 3WMSA 1UXWA 4NP4H 5FO8A 4MXQC 3RGVC 4ZFZB 3SKNA 1M1SA 1S9YB 3UJJH 1INDL 5LWYL 3GMMB 5GGRY 3QEGL 4L8CA 1MFDH 1LP9A 4RISH 1ZVSA 4WRLA 4PJ7E 1D6EA 4ZTOL 1IGIH 1NMCC 4JHWH 5LGHH 2AEIT 1WT5A 3SDCA 3O45B 4HBCH 4FABH 3BKJH 1KTKE 4Y16C 1WBXA 1TIUA 2AK1H 1VADB 3CLFH 2B4CH 5B38G 1HH6B 4JRXA 5ACZB 3B6SB 5F9JA 2VQ1A 5C2BL 4G6AC 4YQXL 1JNHA 5D72L 5DFTA 4O4YL 3PQYB 4LOUD 4N8CL 4UDUB 1H8SA 4XP4L 3VFGH 3VJ6B 1FPTL 5CEZE 3MRDB 4FFWD 3IU3A 4L4JA 1KEMH 2XPGA 3GSQB 3BYTA 1AQKH 4OCXL 4XP9H 3VXNA 5HVFB 1IQWH 4PP1D 4JDZA 3KYKL 5D7KD 3VDBA 2GFBA 3MV11 3KR3H 1OCWH 2ZZUT 4BSWA 5L0QB 2D7TH 1AD0A 3V5DB 1T0MB 1FN4B 3DPBA 2BOCB 5LAXB 2IGFH 2FGWL 5A3IC 4KROB 1NQBA 1N8ZA 3LQAL 3PWUB 1WZ1H 5CCKL 1BVKA 2OR9L 5ICZB 3REWB 4K8RD 3OXRB 3IETB 5T33H 4F7EB 3ABZA 3HPLB 3FQNA 4XC3L 3D0VA 3KXFA 3QXAB 5DVKA 1OAXH 1NMAH 3TZVB 3WXWH 3ZTNH 3WKMH 5EWIH 4FQXC 3ZHKA 1MJJB 4ZDHB 3VGEA 4ZFFB 1ZS8B 2CGRL 4ODVL 2BY2A 4L5FL 3ZO0A 3ARXA 5IV2B 5MEPB 1F4YL 5F3HA 4MA8L 4TUKL 1BQLH 4OGAC 3O4LD 5ESAA 1JFQH 4TSAL 2IFFL 4XCFH 4F7MB 4CMHB 4HUVA 4G7VH 5F7DB 3TC9A 4RRPG 3WL9B 3ZKSD 5F1IB 4A6YB 1BQHG 3P9MA 5IHLB 5JXEC 5FGRA 3U1SL 2ARJQ 3WLWD 3RPIA 4R4FH 1VADA 4M93C 1WISA 3FQXB 3UTTD 4EJ1C 5ITBH 2NLJB 3IS0X 4G80A 4QCIB 1CTNA 2M8XA 4X80L 1MCCA 1K8DA 4K2UL 2GQHA 4HF5L 5TPWL 4JPIA 1AO7E 1CD1A 4PPTA 4I3SH 3BGMA 2WINB 1EJ6A 43C9A 2A74B 1LMKA 5D1QA 5FKAB 1XGUA 5EPMA 4XNYH 4NN7C 3BPNB 5KANI 1GPOL 3ZT7A 3I3BA 4PRNB 2VLKE 3PGFL 1RULL 4K7FB 1YECH 4HFUH 3B2VH 5JOFA 3HC4L 3HPLA 3L7FB 3C8DA 3MO1A 3VFUA 3CZFB 2JCCB 3V6FB 5T1LD 3BHBB 4EI5B 3UYOD 2J1KA 2KZWA 3EYOB 4PJFF 1BBJA 5I1LB 1AGEB 3REVB 3QUZC 1KLUA 2VYRE 4QF1B 3D3VA 3BDYH 4RGOH 3VU2A 2ZCHL 3QFDA 2HRPL 2OR8A 3EOTL 3FQRB 4GKNB 4KQ3H 4PV8A 4MLSA 1FAKT 5IJVA 2XKNA 5F1IA 4A6YA 1MFBL 1RZKL 3AREB 4ZAKD 4E41B 4BFIB 4ZSOB 3VG0H 4GAGH 1FNHA 2QHRH 2RR3A 5E2TH 1MFCL 4JFXA 3V52L 3MRGB 2WUCH 1A21A 3QFJB 3QO0A 2Q7YB 2EDYA 4P2OD 5HPOA 5F3HB 3OTTA 1J0ZA 2O93L 3MOAL 4JO2L 1N26A 5KVGL 5I8OH 4UI2A 3BZEA 2YK1H 1D3CA 3FB6A 1J87A 4Y5VA 3W11D 2B5IB 3UYPA 3ZDYF 4PGBA 2HN7B 3EDEA 1AKJD 2D7MA 1HXYB 3TBSB 5EOTA 3BESR 4AL8H 3FZUC 3ILPA 1RSFA 5DD0H 4I2XA 4PD4K 1AQDA 5H94A 3WS3A 4ODSL 4CN1A 1S9KC 5FECA 4TUOA 3G5ZA 2PN5A 3GMLA 1AP2A 2EDHA 3BRGC 1FC1A 3KPQA 1KELH 3IDXH 4Z7OF 4ODWB 4UTAL 1KG0A 5JO5B 2ESVA 4MJ6A 4XAKE 4UT7H 4ERSH 5FDYA 3FQTB 1IEHA 4LRNH 2Q8AL 5B38B 2OMNA 4OFKA 4C83A 3CDGB 4QOKE 2VIRA 4ONGL 4WDIB 2W38A 2NY2D 4BSVB 3HE6D 2G5BB 5BRZA 2YUWA 3L5HA 1YQ2A 4S2SA 3WNOA 1FNFA 4H20H 3L3JA 3ROOA 2PO6C 4IRZL 3MXVL 4YUEH 5DO2D 1J0YA 1V3MA 4FNLL 1MQ8A 3G04B 1F4XH 4BQCA 5IBUG 4J3OC 1LK2B 4H1LG 4XPTL 3ULUC 4XGZA 3BEVB 3S7GA 2X9WA 4JRXB 5D71H 3BIAX 3EO0B 3HNSL 1WWWX 4BH8A 1I7TB 3QISA 5I74C 1FLRH 2CRIA 2FRGP 3OKLB 3ZKXC 5IG7A 5FYLE 4YAQA 3O11B 4FQCH 1HQ4A 1J0KA 1MI5A 5JQ6L 3O41B 2IFGA 4IBLT 1IL1B 5E08H 5DWUL 1U6AL 3VD5A 5D71L 2BOCA 7CGTA 2HRLA 1I1AC 2HKFH 3BW9A 3LY6A 2D03H 4HH9A 5CGTA 1QYGL 3W9EB 1S3KH 5GIRA 4XVUC 3HI5L 4W70A 4JDZB 2XTJE 2CKBH 4PGZA 5DJ0B 1ORSA 3D2UA 4IRJC 1L7IH 4HPOH 3WCYA 4PS4L 2E3VA 5K93A 1ZLUH 3THMH 3T8XA 2BHUA 4X99B 3UAJD 4G8GD 2X1XR 2DM2A 4M3KB 2VXUH 2BVOB 2RFXB 4KVNL 4NYLA 5D1XC 4ENED 2E7LA 2Y06L 1WWAX 4O9HH 3P9LB 5L2JB 3GB7B 3WFEL 4TNWF 3X11B 2JCCF 2OM5A 1P4LB 3HI6L 4F7CA 4JDTH 5J1AB 2YD7A 3MV9A 3CNKA 5EZLA 4JJ5B 3HPJB 1NLBL 2VXSH 4GAYB 3QJHA 2R2HB 3V4VH 2BMKB 4JFZH 5I73C 1TQCC 5ISZE 2P46B 3QQ4A 2A9NL 2IBZX 4JQIL 4FMKA 1TENA 2EC9T 2X10A 2WWMD 3NCBB 1KIQB 1ZSDB 2Y5EA 2VL5A 1AE6L 3CGTA 4XZUA 2IALA 4KK6C 4KDWA 1CFSA 2A6DA 5HTSA 2YWZA 3O8XB 1BJMA 2C1OA 3R8QA 4PUBL 3QT2A 4XP5L 1P2CA 2XTJD 4IRSC 4OLWL 5DXWA 3MREB 4UV4L 3W2DL 2WUCL 4ZUSA 2ZUQB 4L9DA 3R1GL 4EDWL 4UNUA 4NM4H 1NBZA 4MQTB 4ODTH 1BZ7B 5CEXA 3OJMB 3L6FA 4LBEA 1XGRB 5J3HC 2FECL 2FEDD 3JZ7A 1IL1A 2CRYA 5F7MC 3BIKA 4MQSB 3MYJA 5D7IF 35C8H 3QAZB 4PTUA 5DMGD 4F58L 4MXWL 1W0WA 3QDMD 1RQ5A 4G6FB 4GFTB 4XCEA 3GBLA 3QUYC 4JAMB 1HEZB 1VENA 4GJTB 1K5NA 4FXLA 5DMIH 1UVQB 1KELL 3IDXL 4UT6L 1QLEH 5TDOA 1E6JH 4GRLB 2NMSA 5EOCL 5DJXB 1CXFA 1BD2B 1H3PH 4NBZB 1Q1JL 3FAXA 5IQ7L 2GSGB 4W81A 4NBYB 2IWGA 3VFWA 1BZ9A 2QQLL 2ADFL 5E8PB 1I1YB 4HG4J 5LCVL 3OF6D 2VLMD 3V4PH 5ACZA 2OL3A 4G7YH 4G43A 4LCYB 1I9EA 2VQTA 4OCSL 1HSAA 3UCRA 1T0PB 2W9EL 2EDNA 3I84A 2WM0A 3MV8A 3OJDA 3ARBB 4JRYD 1QBLH 4NZUL 5HGAB 1F90L 3C6LD 1XEDA 3MJ9A 1YEIH 3QXVA 4QGTA 2XZCL 3F7VB 1FNLA 3LAFA 4J3VA 4NWUL 1JGEA 5DD1H 4OTXL 1JWUA 1MLBB 4NNPL 3IDIB 4PFEA 1XF1A 3MGTB 3RVWD 2VTFA 1HSBB 3MRHB 1R3LA 1X5FA 5TQ0L 4X4XB 3QHZL 1M4KA 1KYOJ 3MLUH 2BSED 5AG9A 4Z8FH 1G7JA 3VWJD 3DIFA 3PL6B 1IQDA 5TDPB 3EZ8A 1BMGA 4KXZH 3LKRB 3WFCH 3HZVB 1PKQB 3EHBD 2WLZA 2X89D 3CFEB 4FZ8H 5KVMC 5E8NB 5HYQB 4F7MA 3PWVA 4DKDC 1CLOL 1JJUA 5JDSB 4MX7B 5T3XL 2ICWA 1K4CA 4PJIF 4YAQB 1JNNL 3L7EA 5CGYC 3HB3D 1JNLL 4WW1A 2X41A 5E8PA 3BKYL 1MJ7L 3NBNA 1C5BL 3EO0A 4M8QB 4OLEA 2ZCKH 3T0AA 3UTSD 3AUVA 3VFMA 4HWZB 2FZ3A 3E6HB 1QBBA 1U8JB 3L3OA 1EAJA 2VZUA 4ORZC 2E8YA 1CDIA 3ARFA 4NQDA 1JZ5A 3ARFD 5IB4A 2EKJA 1OD7A 1V7MH 2FIKB 2V9QA 4EUPA 1TVBA 4JREB 4YFEA 1JBJA 1V7ML 5DJYA 5KSVA 4KQ4L 5D2NC 5DRNB 1AGBA 1WTGT 4OGYH 2XZQH 4ZPTA 4M5YL 5HGDA 4IIQA 3NACH 1JYXA 2WANA 1T22A 4Q6IA 2XWBB 4ALAL 4Y4FB 1OQXA 2VQUA 4JFEA 1HILA 4PJ5A 4LGRB 3D69A 2FATL 2HLAB 4NQCA 4M7LH 5D1QB 4PJFA 4JFHD 1YMHB 1FBIL 5KJRH 4YDLB 5IMMA 4U1NB 4LVOC 1ETZA 3U0WH 3R06A 1SMAA 3H9ZA 1WK0A 4OGAD 3T0VA 2VAAB 4NO5A 2X4PB 5CHNB 3SKJH 2DKSA 2R9HD 3UTSE 3MACH 3V4UH 3UJJL 5ISZA 1S7TA 4HXBL 3VGHA 4K7PL 4UINL 4YPJA 1IGJA 1RI8A 1EFQA 3ZKQD 1FH5L 5DURD 1F45A 1MAJA 2W9LA 2BNRB 1A7RH 3VFTB 3O8XC 3CX5K 3SDXA 1YN6A 3SGEI 1B0RA 1IC4H 1ZTXL 4WHTA 3DO7B 3MGOB 4R90L 4XP1H 4ZO8A 5A3ID 3OKKB 3AREA 5J3HD 3MBED 3GBMH 2AS5M 4ZSOA 5KN5A 3MJ8B 5KSAB 3V79C 3FT4B 3V8OA 2YC1A 4UB0H 2R0ZL 1MREH 3BOVA 2XQYG 1CG9A 1IM3B 3QUKA 4MNHB 5D6CB 4QRPD 2BFVH 5MERA 3MRKB 2E7LC 2P8PB 5DMIL 2DQFB 4C56B 4WJ5B 4XBGB 1T0MA 3RWCB 2V9TA 5CBAA 5J6GA 2GJJA 4JM2C 5B8CA 1XF2A 4R6UA 4TTDD 1OF2A 4YZFF 4KTDH 5AYUL 4ZFGH 4QRUA 1BIIB 3HI1B 3CDFA 1JL8A 3FFDB 4OD2A 2JB6B 2QKIB 3C60C 4RIRB 4KK8C 3CH8A 4QTHA 5BV7L 2XNAB 4N0YH 5IUSA 1UB5B 2NY0D 1J0IA 4O2EB 3B5HA 5E95B 1QFUL 2NY4C 4OV5A 4MJIA 2CK0L 1LE9B 1OAZH 1NCNA 5GGRB 2RBLA 1F3JA 3HE7B 3MUZ1 3BDXA 4H1LA 5HVGB 3UTQA 4D8PB 4O5LL 2LAAA 3E8UH 4JGJA 1QRND 1G7QB 3ZL4L 4BH8B 5TDOB 1V7NH 1WGOA 2N56A 3W0WD 3U4EB 5T1LB 1DFBL 3UAJC 4HPYL 5C3LD 1X6NA 4CUCA 4P23C 5IFHH 5F7DA 2BVQB 5C9JA 1P69B 1C16A 1PZ5A 3BN3B 4YDIL 3CH1A 3T1FA 4XCNA 1IKFH 4JFFB 5JR1H 3SE8H 4MXQD 2E7CA 3BE1L 5FV2A 1XR9A 1T0NB 4XWOC 3WKNA 4WV1A 2EO9A 3LQZB 3PDOB 2PNDA 4EDXA 4NZRL 1XGYL 5JHDB 2QQLH 3DVFA 1RY7B 2EE3A 4QNPF 4HUXB 1QFUH 3Q6FB 4OUOA 2J4WL 1AH1A 2JJWA 1YNKL 1LO5B 4WI3A 3GKWH 2R2EA 4YGVA 1FIEA 3UTTB 1YZZA 4RA3A 4HK0A 4MWFA 2Z8VC 3BWUC 3GRWH 3PV6B 2XRAL 1F42A 2VXSL 2AK4A 5E1HB 1UM4H 1ED3A 4DGIL 2DTSA 1F2XK 1GC1L 2VZ3A 3AC0A 3VGAC 3AAZB 4OZIE 5ELIA 4LQFH 3MRJA 1BP3B 5D7JD 1NC4D 3SJVA 1A14L 1OQOA 3OJVC 3UTZA 5F9JB 3AU1B 5DC4B 2AJSH 5HHXL 5FFLA 1EXUB 3EYVB 4Z5RB 3MA7A 1NANI 4QGYA 3FB6B 5F6IB 5CJXA 1VCAA 5CWSB 1MWAH 4RISL 1L7IL 1MOEA 4AENB 1N7ML 3S8WA 4OM1L 1RMFH 2Q7YA 3ULUH 4WU5B 4Y8DC 3IAQA 4CU6A 2PXYD 4LMQI 3RVTD 5IK3A 1H3TA 1VFUA 1A6UL 5GS2D 2DF3A 4XCYA 1LK3L 1IMHC 4JVWA 1J8HE 3ULVL 1UZ6E 3IDYB 5FHAL 1FFPB 1YEIL 4RX4A 4QRTA 4U0QB 2I07B 4X4YB 3U4EA 5F9OH 1J1XL 4Z0BH 3LRSB 1SEBB 4QO1A 5SV3A 3UZVB 2YUXA 2EDOA 2H9GB 4ZD3H 1ZVYA 2GAZA 3TH3T 5HDBF 4MB4A 3DHMA 3V4PL 3VMNA 4C59B 1UWXH 4OFVA 1U8QA 2L7JA 2IADB 4XPBH 4AQ1B 5I1AA 1M05B 1KXTB 3N1GC 3G6JF 5EU4A 1YMMB 4MCYA 4HXAH 4M9PA 2NNAB 5IF0A 5I66B 5EA0L 3IFLL 1F02I 4OLUH 5BW7A 1B88A 1QFOA 2C9AA 4XGZB 1OTSC 1FZMB 5DF0A 1DLFH 3ZDZF 4AJ0A 3V6BR 2R4RL 4P2RB 1I3RA 3EDDA 3NACL 3T3ME 4D9QE 5ACLA 4NKOA 4JPVH 5DJDA 4L9LB 2DQGH 3O6KH 5C09E 2AQ2A 4GKOA 2R1XA 1MWAB 2WBKA 1BQHA 4B0MM 4J6RL 5HDQL 5FEBA 1OPGH 3HAEB 5IEHA 3BKCH 1KENH 3ARGC 1FL3B 1K4DB 2OL3B 5IVZB 4HHAA 2QQKH 4GOSA 4LSPH 1KB9K 4HJJH 3PL6D 2XY2A 3BH9B 3GHBL 5HYIA 3K4ZA 5JW4N 4XXCA 4M93B 5LGKA 5LKNA 3GMPA 4PY8I 1VB9A 2X40A 3L3KB 5DI8A 4N0FB 5C0DA 1Q94A 2Y4SA 4C4KO 1IJ9A 1DFBH 3F8UB 3FRUA 4NWTH 1UQSA 4NNXA 3TYGL 3FFDA 3E3QC 3GMOB 5TE6L 2UYLA 2YPVL 4HLZH 3KPLA 5CAYB 5M94B 2F74A 4GAJL 3RVXC 4N5ED 1IKFL 4KUCD 2P44B 2WMPA 1W2KT 4ODUA 4G8EB 1FO0H 3OQ3B 4KUCF 1ONQB 2ZUTA 3CSYB 3MXVH 5C0CD 1ZLUK 3QPQC 3ZKND 3BJLA 4TNVF 3OKDB 4JQXA 1JE6A 3HC0A 4O2CA 5E0QA 4Z7UF 3GSRB 4MA7H 4I4WB 2PCPA 4L1DA 1HH9B 3MLVH 4OBSA 2E27L 4FFZH 3WSQL 1EVUA 2CMRH 4KJYB 3HRZA 3MR9B 1RZJL 4UTAH 1QLFA 4ELMF 4FMFA 4X5LA 3H3PL 5DC0A 3NOIA 1X5HA 4L29B 5CINL 5GZOD 4G6ML 4V1DA 3BZEB 2GEEA 2ZKHL 3RVUC 1V3KA 2GSIB 5GXBB 3BP7B 2VDLH 1DZBA 3CUPB 4ONHA 2F58L 4JM2A 3I50H 3MBEC 1QQDB 4PJ8C 5IQ9A 4FP8L 3ULUD 2GT9B 3UDWA 3ZE1E 1MCFA 1MQKL 3MJ9L 3EDKA 2E7HA 1XZ0B 2WWKT 3KPLB 3C60A 4RBPK 3C6SA 3PWPD 5HHMB 1F2QA 2CH8A 3ALPA 1T5WB 1R5VA 3KYAA 5C7XL 3SQBA 5ITBL 4DCQB 1DTUA 2XA8L 1M7IB 4YDIH 1JPSH 2GCYB 3TBVA 1KJ2H 2M1KA 3ARBC 3I6KB 3O2VH 3V0VA 5KW9L 2DD8L 2IQ9H 3TZVD 3BP4B 4KXZI 4O51B 1RZKC 3T09A 2B0SL 5DQDL 3S36H 3TESA 3ZE0E 1RURL 3CFKA 4PRPD 2I9TB 1KB5H 3GSNB 4OCWL 3FMGL 4ZUVB 3TO4A 3KPNA 4XI5C 1CN4A 1X5LA 1YN7B 5C8JB 1RVFL 4YDKL 2HVJA 4XCYB 1T7VA 1FZOB 3SDXB 3VFRA 3S5LA 1F4AA 3VXOB 1DQQA 2Y7QA 4KKAC 1TTFA 4X6FA 2YD8A 4Z18A 3DSFL 3DMMB 1HHGA 4LVNC 4X6CE 3W11C 4LCYA 5D5ME 1FZKA 4FQLL 2X6MA 3QDAA 3NFNA 5B8CC 3DNKA 1MLBA 4M43L 5ETUA 3VFPA 3RGVD 3W0WB 3PWLA 1AXTL 4AIZB 2KPNA 4OIIH 4E5XB 3EJYC 3REWA 4BH7B 2IBGA 4WJ5A 4XXDB 3RWDB 4X5XB 1OW0C 1AHWA 4JRWA 3DBXA 3MV8B 4RNRA 2AQ1A 2R2BB 3MPCA 4OI8A 1MJJA 3WNMA 5A2IH 3E1F1 2YMXL 1IC4L 1P9MC 3HB3C 4HLJA 1M71A 1I7ZB 3GSOA 1CT8A 2J8UE 2WSKA 2X4QB 5HI4C 2D7QA 5E5UB 4MA7L 1Z0MA 5JPNB 3MRPA 3P0VH 5I1AB 5EO0B 5HHNB 3HG1B 4M48L 4HZLA 1U8MA 1E6OL 1UG9A 3L5JA 3ULVE 3BKJL 3KVQA 1XFPA 2XY1A 1PFCA 3TVMC 4CVUA 3VCLA 1NL0L 1YPZF 3GSNL 1IGYA 1FV1B 2OSLB 2CQVA 1C16B 1JHTA 1NL0H 4PY7B 2V5MA 4H8WH 3UZQA 3HE7D 4NN6C 1U8OB 4LSQH 1EAPB 1QSEB 1FZKB 4AEHH 4JZJC 4BFIA 5C0BB 3VXQB 3VFVB 3DI3B 4P46C 4NYLB 1WFOA 4Q9RH 1CGXA 4G8IB 1CL7L 5EC1B 2VXQH 3VI3F 3GIZH 2D0GA 3BSZH 5D7SH 3VFSB 3SY0A 1DVFC 1URLA 2VZVA 5BVJB 5JIKA 3KJ4B 5F7EL 2M26A 1MQKH 2DYPA 2CKBA 3N1MC 3UC0L 5IOPA 1R3JB 4HUXA 3Q6FA 3EAKA 3QULA 4YX2H 1UKTA 3IXAB 1N0XH 4X9IA 1K2DB 2FL5A 3ARYA 3V7AE 2FX8L 4FQ2H 3B2UC 4NQCE 3UJTL 1I9RH 3QUYB 2F9BT 1JK8A 2EYTA 5HI3C 5FIEA 5KSVB 2CR6A 1NGWA 3LH2H 4ZMAT 4MNQB 3LPWA 3VGBA 4LHJB 1NGQH 5F7UA 4P49A 3W39B 2DOCA 3DRTA 4JN1L 2CRMA 3G9AB 1WAAF 2A6JB 4JCMA 3U6RB 3WIIL 2DMKA 3ZKXB 4UQ3A 3GMNA 3OPZH 5GS0L 2ATPB 3DX7A 4J3UA 4HUUA 3K4AA 1AD9B 2B1HH 5K9QG 1PX3A 2BOBB 3VWKB 3PP4H 2NTSP 4FS0A 3FTGB 1D5ZA 3QDJA 4YK4C 3B9DA 1S7XB 3DUSA 3G5XB 1IILE 4MNGA 5F70A 4RA0C 1UKSA 1J1OH 2ZP0T 1CDGA 4HUWA 3BT2H 1F3DH 5C0FA 1KSRA 3QDJE 3QI9C 1U8IA 3ETBF 3O3AA 4TOYL 4IOIA 4OLWH 4GRMA 2HKHL 1N6UA 4F15B 1AR1C 5JUEH 3TCLB 4R8WH 2XXCB 3SCMA 3STZB 3VXRD 4JREC 1O5DT 2BJML 2FNBA 2JTDA 1I8MB 3RWCA 5J9PB 1IKNA 1KG0B 4G9DA 4KU1A 2BJMH 4PJ9C 4GBXC 4HWBH 3OR7B 1JCKA 2EZ0D 2Y1VA 1NDMB 3C5ZD 5F9WB 5HGBB 1HKFA 1OL0A 4U1SA 2GCYA 1KT2B 4Y2DA 5HHOE 5J12B 3V6OA 5FYJD 4J2XA 4PLKD 1J9CT 3QXUA 3O2DA 1OVZA 1QFWM 5DRXB 3UO1H 3C6SB 5D7IE 2BY0A 1KCSL 3LRSA 4XRCA 3X3GH 2XKSA 2MSPA 4GW4B 3FFCE 4N0RA 1NGYB 1Q1JH 4LHUB 1NH6A 2AV7B 4HH8A 2G75A 3TJEH 1P1ZA 4K9EL 3NIDE 2WBJA 3SDYL 4BZYA 1YNKH 2EXWC 1J05A 2R23B 3PL6C 4G5ZH 4JM2D 2OXGA 3MBEA 5HYJA 4QHKJ 5HJ3B 1GGIL 3U9UB 3V5HA 1QVOB 4WTWA 1HHJA 4I48A 4CMMB 3IXTA 3PIQB 4JFDA 5E2WL 4WW2F 1G6RL 3JWDH 4E5XA 4P3CH 3LN5A 3PABA 5DMJB 2BVQA 2VQ1B 1HXYA 3HPJA 1Z5LA 5TGBA 4R2GD 1S8DA 3I02A 3RUGE 2K7QA 4NUGL 3QQNA 4F8QA 2QSQA 4XMLH 1MUJA 4YBLC 5H94B 1ZE3C 4UOW0 4X5XA 3U82B 3WS3B 6FABH 1PYWA 4XP5H 4XCNB 3FCTA 2YSSA 4TULL 1FH5H 3ROLA 1SQ2N 4U1MB 5D7LE 5DRXA 3GI8L 4M6NL 5C0JB 5I18L 4M00A 4K55A 2J6EH 2CLVB 4XHJC 2CSPA 5BS0B 2NY7H 5FYJL 1HHKB 1R3KA 5D7LA 4M02A 2PO6D 4OZGA 4DOHE 3MLRL 4N0FA 4XNUH 3T77A 3X3FH 4JDVA 1KB9J 3PHQA 4I77L 3UJIH 1A6ZA 2R4SL 1I8IB 3GKZA 5INDB 3P73A 3TP4A 3IT8D 3O3DA 4HD9A 4NJ9H 3RWGA 3T2QA 1DVFD 3IAGC 5IJKC 2VXVL 3DX8B 5CILL 1UYWH 3LEYH 1A47A 1NFDF 2DQJH 1R5IB 4XVSL 4HC1H 3SE3A 3VA2C 1EPFA 4NSKA 4OLYL 1PY4A 2COQA 3O6KL 5FUZL 5J89A 3HCVA 4BELD 3QEHA 5KSBF 2EYRA 4JKPL 4PB9H 4HJGB 1O7SA 4LU5L 5E8OB 3VFWB 4ODSH 1QTYT 1B0RB 3DO7A 1EMTL 1UC6A 3GM8A 4DVRL 4OLUL 4EUPH 2FX8H 3QO1B 3QH3B 3KG5A 5ESQB 1A0QH 3OHXB 1F8TL 3QWOA 1CG9B 1JN6B 4XH2A 4R90H 1AFVL 1IAIM 5IVXB 4GQ9H 3D9AL 5GSVA 1DQJA 2DYPD 1DL7L 4IS6A 5C08D 3S37X 5MEQA 3GUTB 4Y1AA 4P99A 1G84A 4L29A 4TSCL 3S35X 5JXEA 3WLBB 5GS0D 5GIRB 3SGJC 5CLTA 1KXQE 4ZAKC 1AY1L 1WBYA 2ZUWA 2AV1B 5FKPB 4KMLB 4M6OH 3UPRA 2AK1L 4GG8B 3FO1B 4OIBA 2PTUA 3QCTH 4PJDA 1JTOA 2Z92A 4HQQH 5CGYD 5JIHA 3KNBB 3CZFA 4H8WL 4NRXA 4D0BB 3ULVH 4KPHH 4RAVB 4ESKA 3OZ9H 3MJ7B 2CIKB 4YK4B 4GW1B 3MOBH 4PJGB 1UJ3C 1MCLA 4JZJA 4HIEB 3A6OA 4U1MA 4L4VD 1UFUA 3LN4B 3K3QA 3FN0L 4X7DC 3EO9L 1BBDH 3QP3A 1H9VA 4K94L 4XC1L 5GPRA 4XNMA 4POYA 5EBWB 1AI1L 1R3IL 4RX4D 3CC5A 3LV3B 4JM4H 4JFYA 5CBEB 2EXYD 3GI8H 2PF6A 4NKIH 3QR2A 4WW2C 3VJ6A 1HKLL 3H7LA 2VC2L 4PRPA 5EZOH 5ID1A 4Z7WE 1BLNA 3OX8B 4OGXL 1FYTE 3WN5C 3MLXH 1PVHA 2BOBA 4MJIE 5IMOA 3X14A 5GGUB 1AHWC 4OZHE 4LVHB 1P6AB 1LO0L 4QXTB 5HDBE 1S7UB 1HHHA 3CDYA 4X8XA 1DQDL 1VKXB 1RIUH 1H3UA 2AJYH 3LKPB 5JDJA 2D31B 3AS1A 2D9CA 2NYYC 1CQKA 4RSVA 5SX5K 5HHPA 4EUPB 3HC4H 5LAXA 3QQ9C 4J8RB 5D5MA 3EO1B 3D0LA 3ARQA 3GMQA 1EK3A 3F5WB 3ELAT 4X6BA 4XNYL 1NKRA 4BA8A 3DSFH 4RMSA 2UZIH 4U2YA 1WT5C 2EDEA 3TVMA 3N9GH 3BYYA 5LXGH 3OSKA 2C1OB 5T1DL 1P84J 1TLKA 3BKMH 1N6QL 1CU4H 1Z9SA 3DX6A 4FQJL 3TT1L 4OQTA 4Z8FL 1H8OA 5IFHL 1HCVA 5DFVD 4P46A 3ZTNL 3DUUB 3FN3A 5DEZA 4LLQA 2VH5H 5I1HL 1XF3B 1KGCE 1KN2L 5SX4H 4WWKD 3GSWB 1R24A 1BD2D 4NNPH 2VDNL 4Z7VA 4AMKH 4MAYD 3JBG7 3FOLA 3U0PA 4G9FA 1Q9OB 4PRIA 2DD8H 2ZOKA 4KKLD 4UUJB 3BRFA 1WAAE 1IKNC 1MEXL 2WAHA 2X1QA 3TWCH 4OF5A 5IHBA 3CFIC 3PHOA 5C09A 3U9UA 1RIVL 3QCVH 3S4SA 5JW3H 2R23A 1J05B 5D8JH 5D1ZD 4P5TD 4GAJH 2NZ9D 1JPFA 2FO1A 1XGTA 1DP0A 4M5YH 1RPQA 1EHLL 3IVKA 4QOKD 4RGNB 3RWFA 4DKFH 4NRYA 5C0GB 5I1EL 4LOUC 3C2SA 3FQUB 1ZHBB 2ITDA 1J86A 4JKLA 3OKLA 1YY8A 4P0DA 3BT2L 4J1UB 4R7DA 3N50A 3EYFA 1EZVY 2VLJB 3IKCB 4OV6F 1SVZA 5L2KA 4GQPH 3P73B 5M7QA 4FQXA 1DQML 1ETZB 2V2WA 1ZT7B 1N2RB 4OZGE 5CJQL 3QIBD 2QLVB 2W60A 2ATPA 5I15L 1FYHB 1MPAH 3RZCC 4JPIB 4JY4B 4I5BA 1MCQA 4RAUB 5C0AE 3FB5A 3RX7A 1GGIH 3QI9A 3HG1E 2F54E 5BVPL 3D18A 2ITCA 3Q1SL 3U30C 3QIBB 4L8DA 3ECBB 2KQMA 3T04D 4IJ3B 4X6FB 4NZTH 5EORL 3ULVF 1NCCL 1VPOH 3KYMA 3RFZC 2UV3A 2PR4L 5D96B 1AI1H 1R3IH 5EBMB 5F1NA 2AJ3A 5H8DA 5CD3A 5J0BA 3NZ8A 1FP5A 3QEHB 1G9MC 4U0RB 2CIIB 2N1KA 1HQ4B 3PQYA 3T0WA 3QNZA 2D03L 4G9FE 4KFZC 4XPGH 1J5OL 4LPUA 2VZ1A 3ARGD 3MBXH 2VLKD 4APQA 5E08L 4YBLB 3M17B 2FGWH 5IJVB 3FOMA 4PJXA 3C2AL 4O02L 3EHBC 2MCPH 3WD5L 5CZVL 3GHBH 3I85A 1OLLA 1UM5H 1IGCH 3S96B 1YEEL 5H35B 4QRSB 4K3DL 1WBZB 2BC4A 5E1AB 1HILB 4PJ5B 2ZUVA 3TNNA 1RZ8A 2BNQB 5EFIA 1FN4A 1D6EB 2AV1A 2Y6SC 5CJOL 3CSYA 2QQKL 4JFEB 5EO0A 3NZHL 3WFEH 5GRUH 2YOCA 1UB5A 3VXUE 3CLEH 3F7RA 3QPXH 2PO6A 1K3ZA 4C56E 4JGMA 5DEFB 4KMQA 1A6TB 1MCKA 4LPVA 4BKLB 5A16B 3OX8A 3MRQB 4MQXD 3RHWK 1OWWA 5FYLH 3TYFB 3AFLA 4G6KH 1FGNL 3JVGA 2EDQA 3VRJA 1A14H 4NT6B 2B4CL 2MKLC 5GRJL 4QKXB 2C4FU 2AKRA 5BOPA 5IEKB 4NO0D 3INUH 3O11A 5HGHA 4NQDE 1NAMB 2OSLA 5EUKB 4JHAH 5KS9E 5DQ9A 1U8HA 2FWOB 4PRPB 2PXYB 5ID1B 4XNZC 5GGSB 4XVJH 1RJZB 1G0YR 3QZWA 4HFWB 4JHBA 3MRKA 4X6CA 1I7UB 5FHAH 1TTGA 3ZYJA 3ZE1F 5HI5C 3O6LH 4MNHA 5D6CA 1UJ3A 4PUBH 2BSTB 4JLRA 4NO2B 2JELL 5FA4A 3MFFB 5D4QA 1SHMA 3VXUD 1U93A 4CNIA 1DDHB 1FO0A 2X9YA 4S10A 3EYQC 4LCCB 2XZCH 5IESL 4IOSD 5H37H 3T4YA 4TNWK 3K81A 3M1BA 4YWGL 4ETQA 4V2BA 4YH6A 1INQB 2FEEI 3DHJA 5KS9F 1CE6B 3WN5B 2EDKA 1FVDA 4TYUA 4EI5A 3IDNA 2GUOA 1QHPA 2QJDA 4XMKL 5I6XC 4M62L 3WDIA 4Y4HB 4NSKB 5D1QD 2R0WL 4L4TE 1XH3B 2J5LC 4G5ZL 4GRLD 3P0GB 1YEDA 1K6QL 5E99L 3ULVD 2H3NA 4P4KA 4RFEB 1U58A 1NMCB 5IGXH 4WY7H 4U1JB 5E8EB 5T1DH 1V3LA 5BZWB 3OHXA 3SGEH 4S1SL 4GKZB 5IGXL 1B0WA 1U95B 4R4BA 1I8IA 4S0SD 4WFED 4F7PA 1OAYL 3QDMB 3GO1H 3PWNB 5ERWB 1M6OB 1Z3GL 3FB7B 4M4RA 4ELKB 1F4HA 1I9JH 4RWYH 4YDJA 5E9DE 4L3EE 1PDKA 3ARFB 1XMWA 2ZOKB 5EOQL 4RMRA 5EUOE 1DN2A 4LKCA 2ARJB 3LIZL 2ENYA 4JN1H 1ZT1B 4WFFD 3U30B 3E3QE 1WCBA 4JFOA 5D2NB 3MV9B 3C60D 1NPUA 1UCTA 3OJ2C 4PJIB 4LPWA 4MZ2A 5FXCH 1N8ZB 4IRJA 3RRQA 4DGYH 4X6DB 3H3BC 4XNXH 1XGRA 3BAEH 3NFPA 4GAGL 1KJMA 5IKCA 1CE1H 3PV6A 1ND0A 1IAKA 4RDQF 3TT3L 3TBWA 3ET9F 3RZWA 4WW2A 2NXZD 1QRNA 4QRPB 2E5EA 3ESVF 3U9PH 3JWOH 1T21B 4ZODA 3F7PC 5J1TC 4Z95H 4U1LB 3RL1B 4CVXB 4WV1B 3BUTA 3ECBA 1IZJA 5FGSA 1I8KA 5FB8B 1TQBC 3LHPH 4RNRB 2QBWA 1YMME 5I8EA 1TMCB 4NO0A 4KJPD 4OKDA 3FO1A 2GTZA 3H8NA 1NGXA 5C0BA 1LO2L 3JSSA 5GGSY 1KN2H 3DV6A 2BMKA 2A1WL 5JPNA 1HHHB 1B3JA 3BH9A 3RBGA 2NY3B 1XIWB 3N06B 4HCRA 3PABB 3V95A 5GRXG 3O8XD 5CJBA 3L9RA 5C3TA 3WFDL 4D9RE 4HX1B 4IRSA 4IM8A 4H5SB 3U79A 4S1DD 4OCRL 5ALCH 5EPMB 5KVDH 4JCLA 4LFHD 4U1HB 5T3XD 3OAZK 2NY2C 4PREA 1S7SA 3RX8A 4XCCL 1UWEL 3BPNC 4X9FA 4Y4KD 4J6RH 4LVNB 1TVHB 1N6VA 1MHCB 3E2HB 2F5BL 4PG9B 4F80A 1D7FA 3ARDA 2DB8A 1L4IA 4YEFA 3IJSB 3AS2A 3GJFH 2VKXA 1BF2A 4Z7WA 4RFOL 2IAND 1OP9A 2VXQL 2XXMB 1RK1A 2VLRE 5E2VH 1S78D 5F6HJ 1KJ3L 2HFTA 4BFBD 1J1PL 3H3PH 1A6ZB 2AJVL 4KI5F 4CW1B 1PKOA 3TBVB 5FYKU 4BQ6A 5A2KH 5I8CB 4TQEL 4M1CC 4MD5A 1CFVL 4WHCA 4LCWB 1FL5A 4HMCA 4Y19A 1D5ZB 4DN3L 1JPST 2XWTA 4PJAF 1CYGA 1DUYA 3IFOA 2H2SD 3LS4H 4GS7C 5C70A 1PAMA 3QEGH 3P77A 2QSTA 1YN6B 1QSFE 3GHEH 4YDKH 4NCC1 3HAEA 5IEHB 4XB8A 1FO0L 4U2ZA 4JM2B 4PJ5D 2HFEB 1NBQA 4XAKD 3JV0A 1A3RL 5DJ2A 1SJEB 4TUJB 3MRFB 3KYKH 4LLQB 3MRDA 5IESH 3QG7H 1N5YH 1MAML 1CD8A 1UZ8A 1MCWM 5IVOA 3QEQE 3N1FC 3R0MA 4LP5A 2YXMA 4Q6IC 4ZS6D 2ZUYA 4Y5YC 1JPSL 4NDMB 1YY9D 2XKNB 2P42B 5INCB 2ADIB 2BSSA 4OQTL 4PB9L 4Q9CA 5DVNA 1UEMA 5DC9B 2HT4D 4HCRL 2ZOLA 4P9HC 2WQRA 3MRCB 1BM3H 3NTCH 3H7BB 1U3HC 5F8QC 1A5FH 1G7LA 3BHBA 1WBYB 5F96L 1NGYA 1EO5A 1T2JA 4PTTB 1IBGL 1BF8A 4GAYA 2NX5A 4FQQB 1C12B 3X14B 5IMOB 2OJZL 3OKNB 4KI5C 1A9EB 3LD8C 2DQUH 3B3IA 3WUWB 4C55A 3JV6A 1U8NA 43CAA 3TCXA 5GSRA 1U91A 5E2JA 1TNNA 2DDQH 3KHQA 2Y07L 3K46A 1EGJH 4JFXB 1MFBH 3QDMA 4JFQA 4JFYB 5HHPB 4N0UA 5K9JH 4DVBB 1C5DB 1D5XB 5ANME 5K9QI 3W0WA 4PJGF 4LDOB 4OCNC 2O5XH 4LASH 4X0KA 2JJVA 2NW2A 4FQ1H 2B1AH 5DDHA 2DN7A 4X7SL 1JF1A 1K8IA 4HWBA 1ZANL 4LP4A 5GGUA 2R2BA 3NZ8B 5C2UB 2VAJA 5F89B 5CJXC 1P4BH 2VABA 5DR5L 2ZJSH 2AABH 3O9WD 4NO3A 3OGOE 1F00I 3MUGB 4GMSH 5D7JC 3QUYD 3DXAA 2YPLE 2FEDC 5IMKA 4GXUM 1CICB 4OZGB 4TOYH 5MEND 4N8PA 4L4TD 3VA6A 5A2LH 4PIRF 3PHSA 5IB5A 1SJHB 4YHPA 4ZUTA 5FGCE 1O0VA 1QPPA 3GSNA 4HF5H 5TPWH 2CUMA 4GKSB 2DRUA 3KPSE 4D0CB 3L3IB 3CFKB 3STLA 3GZKA 2I9TA 3ZT5A 5IHUH 4KV5E 5C2BH 1A22B 5BJTA 3QUXD 1FFQA 5L8KB 2AJZB 2VE6B 5MERB 4LSTH 4ZO9A 2E6JA 2P8PA 2G2RB 1SY6L 3DVNA 3KLAA 2FB4H 2VSCA 5GGVY 1RJLA 2P43B 4JB9L 4N0CD 3FQXA 1G7IB 2Z91B 3IU4L 1T1XB 1JGVL 5F7FA 3S36X 3L5WA 2EXWD 4KJQD 3DMMA 4L4VA 3D2UD 4OB5L 4MDIA 3UJTH 1PLGH 4AH2A 1S9XB 3L3HB 2P47B 3U4BH 1WSST 3MGOA 1IE5A 4JVUA 3VRJB 2IBBA 1GIGL 2F15A 2VABB 3TH2T 2H9GA 1ZTXH 3K7UA 5B39G 4HIHA 1X5IA 2I5YL 4R97C 5DEGB 3ZMRA 5F7EH 1VGKB 3TJHD 2OR9H 4CVZB 2XN9D 3SE8L 3EOAB 4LIQE 2OI9C 5LVEA 4X0KB 5HY9B 4PRDA 1CXEA 4NQEE 1UM5L 3E6FA 4C58B 3C5ZC 2VLRA 5EU3B 4C56A 5JW3L 5C0CA 4DGVH 1OCWL 4LCUA 2ZSVA 4H0HB 2XICA 4JFED 2BCKB 1NC4B 1OTTD 2BVPB 1YNTA 4HJJL 2P5WB 3INUL 1RFDL 1NCAH 3RWHA 2QADC 4PJFB 5LQBL 1N4XL 1RZFH 4LDLB 3N85L 3ARVA 1QRNE 1UWGH 1YEGH 2GI7A 1JZ4A 2P1YA 2PYEA 3C87A 5ISZD 4P48A 3CU1A 4XP4H 3SDCD 4M48H 1KPRB 1J11A 1SEQH 2EE9A 2VZSA 1NKOA 4LBEB 1FHGA 5KVFL 1HH9A 1PQZB 3TA3C 4WI2A 1XF5B 4MAYC 1SJEA 4TUJA 3JTSA 3LEVL 1VDGA 3VXQA 3F7YA 5JLZB 4KZEL 2JK5B 3D25A 4LQFL 2B20A 4KHTH 1UGNA 1BPVA 5DFVC 3P77B 3CC5B 2RHEA 4I1NB 3RU8L 4PJXB 1KFAL 2ZNXA 1JUFA 5KSBE 5HDOA 2ARWA 4DAGL 1QP1A 4PRNA 4UOJA 1V3JA 3SPVB 2XZAH 2H45A 3VXPB 1W72A 4I8DA 3C08H 4P9HH 1CXHA 3VDAA 3NCCB 2YBRA 4XNQA 3WFHA 4Z7VE 3OKDA 2VDOL 2AEQL 4WUUD 1LO0H 1SJXA 1N5YL 2BNQD 3B9AA 1NCBL 5FO8B 1MRDL 1BVZA 1IGTA 3NIDF 4KK5C 4Q2ZB 3DOSA 4WO4A 4QRTB 3K1DA 3O3EA 3D85B 2ADJB 1J0HA 3AM8A 5JOPD 2DAVA 1NUGA 4EUPG 4FTVB 5D5MF 3GSWA 3HE6A 2X4UB 1X4ZA 4OI7A 1U2CA 1QPXA 3IU4H 5FM4A 4OZHF 3W39A 3ILQD 4DUVA 3BDYL 4PYHA 1Y6KR 5JPMA 2Q20A 1ZMYA 3L9RB 3D87B 4H5SA 5C0CE 2HJLA 4TQEH 5EUKA 4C57C 4UV7L 5GHWL 3CX5J 4BK4A 4Z7NF 4NRYB 2NXYD 5C0GA 5IEKA 1YECL 1XR8A 4HKJA 1FG2A 4EN3D 3LKRA 3WIHH 2A38A 3CFDA 3EYSL 3HUJA 1ACYL 4G8FA 1ZHKA 1JZ3A 2G5RA 4Q0XH 1OGTA 4Z7VF 4MDJA 3VI4E 3QIWB 3CVHB 4Q2ZA 2XACC 3DRQA 1YYMH 4OUUA 2FSEA 3MODL 1FFOB 3O6FB 5INDA 2HFFB 4OQTH 3VWJC 1SBSL 2AJZA 2VLJD 5FO9B 3RY6A 5IMMB 4MSWA 5CMAB 3EOYG 1FCGA 5HPMB 1YMMD 3QIUC 3F6IA 2H8PB 2DLEA 3A6BL 4U33A 4UDUA 4B53A 4ZUTB 2Z9TA 4TN9A 5AWNH 2R1WA 3O9WB 1N59B 3IJSA 3G6AA 3D3VD 3HS0B 3NIFF 1I1CA 4GRWF 4PRID 3LPFA 3RDTA 3U36A 3VXNB 1FNAA 4HIEA 2CGRH 3VFNB 2DQUL 1MHPH 4Y5YA 4GXUN 4KK5D 4KUZL 3FB7A 2H2PC 3HUJB 1Z5LB 1YYML 3UDWC 3RKDC 5T33L 3V6OE 3HMXL 4KY1L 1B4RA 1TZGH 3RVVC 3WYRA 3S35H 5ILTL 3O4OC 4QRRA 2APTA 4U7MA 4TRPH 3PQYE 3TGXA 2VITA 5EIQA 4J7RA 5DJYB 3GSXA 1EBPA 2UZYB 4Y2OA 3HMWL 4LSVH 4MA3B 5C07D 1N5AA 4ODXB 4UV7H 4HEME 2BVUA 3CX2A 4U1GB 3G5YA 3EFDL 3KJ6L 4P3CL 3HG1A 4OBRA 1AO7D 1F8TH 4ODUB 5DLML 4LL9A 3TO4C 3RNKB 1T4KB 3LEXB 12E8H 5EBWA 5HY9A 4RIRA 1G9ML 4OGXH 4L8BB 4YPGA 1JFQL 1H3PL 3TIEA 5FGBC 1VEPA 4LLDB 3RKPA 5KN5B 4QRPA 4OIAA 4EOWH 1TFHA 3L3DB 1KLUB 1F3JB 3HE7A 3HR5A 1YNTB 2L0DA 5ID0A 5E8NA 3VXMA 5HYQA 3RL2B 2DQDH 3UBXB 3KYOA 1ZT4B 1I4FA 4R96A 3ARED 2F53D 2X4OA 4KK6D 2YPLA 3T77B 3UO1L 1L0XA 2LABA 3MX0A 5IBTL 5JW4Q 4GW5A 3WIHA 1HYRC 1ZHNB 3LKNA 1NC2D 3P0YL 1DQJB 2H2PD 4NQED 2VITB 4Y1AB 3BRDA 1JN6A 3LHPL 5TJWK 1G9EA 5I18H 3ISWA 2DI9A 4OZHB 3QPQD 3ZKNC 4LKXA 1LE9A 4Z95L 3MRLA 4WTZA 2VZTA 4UU9B 2X05A 3VXSE 2Z31A 4YHYB 4HIIA 1AE6H 2NPLX 1QR1B 4XPHL 4OLVH 5DUBA 3GIVB 2Z4QB 3MC0A 4AZ8A 4JQIH 1GHFH 2EZ0C 4IIQB 2W07A 4MCYB 3IF1A 5DD6A 4NQCD 2VDKH 1FL5B 3IDJA 4X7TB 1AXIB 3IKKA 3T2PA 1HDMB 4PTUB 3BDBA 4URTB 1GYAA 5EC2B 5AAWA 4GRLC 3VWKD 4UQ2B 3LSOB 2ESVB 2BHYA 3KYOB 5JZ7C 4FFVD 3L95A 2Q8AH 4Q74A 3VXMB 4PJ9A 4YGAB 1SJVA 4XNZB 2IAMC 1UWGL 1YEGL 1LEGB 3C8KA 4IHOB 5DVMA 5IB2B 5CSGA 4YHPB 2O61B 1LO2H 2OYPA 1QO3A 5CSZA 1CLOH 4L8BA 3D85D 4KKBC 4U3XA 3TNMB 3MLTA 4EI6B 5DSCA 3MMEB 2VL4A 4OLZH 1DVFA 4JFDB 3CXHK 1YNLH 2QSCH 1RUPH 4ZUUB 5KSAD 3OXSB 5DD0L 4HKBB 5HJ3A 1CFQA 1J1XH 3VG9B 3SE4A 4NJ9L 5IM7B 2D7PA 3TZVA 1G7MB 1J10A 4HDIA 5D7LD 4Z78B 1GOGA 5H37G 1LK3H 3V9FA 3AROA 4ODTL 2X70A 4XWGL 3O2VL 1U3HB 4OFIA 3CD4A 1NCDL 2A2QT 4Z7UA 2EKSA 2VDQL 4R4NC 1JMXA 3U7WH 3BPCA 2GK2A 3MGTA 5HI3D 5KZCB 2EH7H 5F9OL 5JHDD 3MLYH 3HE6C 5D1ZB 1OGTB 1YMHA 4OKVB 3WJJA 5AZEH 2P5WA 2G9HA 3OKMA 2E7BA 5EDXA 3B5TA 5DK0A 1FNSH 3LS5H 1T1YB 3BP5B 5L8LB 1A6UH 4PJBF 4RAHA 3PGDA 1OAZL 4YHNA 5EH1A 4Y5VC 5CD5D 1GGCH 2DJSA 3DUHA 1HOCB 1BIIA 1TPXC 3HG1D 3U4BL 4WUUB 4LSTL 4G6FD 4DK6A 1C7TA 5DD6B 1GIGH 1JTPA 1E6OH 5J8OA 4D94A 1OB1B 1CGWA 1OD9A 4NRZB 1JHLH 3C8HA 1KLFA 1X4YA 2AJSL 5HHXH 2YPKA 1TCRA 4O58L 1XGPA 1BX2A 5I1IH 1QRKA 3UTPE 3WIFB 3S5LB 2W59A 2F19L 4O58H 5C1MB 5I1IL 3H9SE 1N0LA 4CN6A 5GGQL 1C1EL 3QXDA 5T1LA 2CKNA 3STZA 1P4IH 4WCYH 1JF1B 5E6IC 4G43B 2X7LA 1CDHA 2EDFA 3RWFB 4LCWD 3K74B 2AP2A 3ZT6A 5E99H 2ICEA 4KKBD 3D3VB 4ZTPH 1MCOH 2J4WH 1I9RL 4NQXB 3VGAB 4R7NA 2FX9L 1BQHB 3WFHB 1N2RA 2J8UF 4ZFZA 4WHYG