4ZAKD

Crystal structure of the mcd1d/db06-1/inktcr ternary complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A Novel Glycolipid Antigen for NKT Cells That Preferentially Induces IFN-gamma Production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zakD02
3L9RB 3FOMB 1V5JA 3HLAA 1DBKL 2FRGP 3VXMD 1S7TA 5AYUH 1LO3L 3L7FB 2C3GA 3IKKA 3U7AA 2J88H 3FMGH 1WTLA 4K3JH 2VXQH 3RX7A 5DDHA 1TQBB 2YZ1A 4DZBA 5JORA 5D7LD 3NCJL 2X1PA 1OQOA 1C5BL 5FAAA 1ZWIB 1AE6L 2FLBT 4ZSOB 3MRDA 4JPIB 3OKEB 1DP0A 2BMKA 4KMLB 5IVXF 5GJSL 3DYOA 2FIKA 3CFEA 2AJ3A 2UZXB 4M5ZL 1DCLA 4Q6IC 4GS7B 2XQYG 5D5MB 4BA8A 2W9DL 4OAWB 1SVCP 3DX6A 4PJHB 3KPTA 3GMQB 4KDVA 3V8OA 1JK8A 1EFXB 2M26A 5E4IA 1ZS8A 2DN7A 4U3XA 3D2UD 1KC5L 1A6TA 2H6PA 2R2EA 5K33A 4D9RD 2FGZA 4MS8C 4E5XB 1KOAA 3W81A 1ED3B 1XR9B 2OK0H 1I1AB 4OLUH 2CMRL 1CFQB 3GSNB 3W2DL 1S7QB 1OPGL 3TYFB 5KAQF 3J7HA 5KW9H 5JUEH 1W0YT 1AHWB 4WO4A 4QTIH 2WP3O 3OHXB 1P84K 4M8QB 4DVBB 2YD9A 2CIKA 1ZHKB 1BBJA 4UINL 2BX5A 5A43C 4ODVH 2VAAA 1XCTB 1XIWD 5HHOB 1OTUC 2QQNL 2FWOB 2PNDA 4MDIB 1ES0B 2BHYA 3IDJB 3LD8B 3QUXA 4LLVB 1S78D 5D1ZB 4KJYA 1A6PA 3QCVH 3KPSB 2XTLA 4E9LA 1MEXH 4OCNC 1MFBH 3PGCA 4JZOA 4IJ3C 1TCRB 3QIBC 1DEEB 3E8UL 5GS0L 4ZDHB 6CGTA 4EN3A 2XRAL 3QHTC 4ODBD 3HC4L 2QADC 3EDJA 4NC1E 4NKDB 3GK8H 2DMKA 3UDWC 4HJJL 3VFNA 1NFDE 5DS8A 4UQ2B 4JJ5A 4NZUH 4HUMB 5DD3L 4X6BB 1HZHL 3B2VL 1G84A 2XKSA 3RNKA 1BHGA 5CGYD 4KV5F 4NYLB 1JNLL 4MA8L 3LB6D 1A4JB 1GSMA 1NBZB 1K4DA 5GGQL 1TCMA 4OUOA 5LXGH 1X5GA 1G6RA 4PGCA 3P73B 4X7FC 1CYGA 1KYOK 3OAYH 1O7VA 4H25A 2XWJA 3D85D 5DA0B 4OGYH 4HMDA 4MJIA 5DC0A 4LLUB 4XWGL 3CFIC 4O2CA 4ZPTA 3EJZC 3NACH 3IFPB 3H7BB 1E4XI 4RGNE 4AT6A 3LIZL 4H88H 4DGYL 3UTTB 2DBLL 3VD3A 1VKXA 2EE9A 4FXGB 4YHMH 2ARJB 3T0EA 3PABB 4ORGA 2YPLD 2ZCLH 3KYKH 4MJ5B 2X4OA 5IVZA 2VDNH 3HNTL 1EBAA 5HYFA 3W0WA 1E4JA 1A22B 3IF1A 3NCEB 4W6XB 5LGKA 2HRLA 1VCAA 1VPOL 1JF6A 2VLJB 2VDLL 4PJBB 2Y36L 3L3KA 5CEXB 2FDBP 4IBLT 2AXGB 3CU7A 4TRPL 2AI0H 2WK2A 3P9LA 3WFBH 5EU4B 4QRQA 1VACB 1C1EH 5LVEA 1ZVHA 4HIHB 3O4LD 4C83A 2VL5B 4P2OB 5IB3B 3ULVC 3UTQA 1VFMA 2LU3A 3MOAH 1KN2L 2JE8A 1FVEB 3I6KA 4OLWL 3CXHK 4K7PY 4FQ2H 1D5ZB 2IQ9L 2ICEB 4XH2B 2I24N 2P5ED 1KJMA 5HHME 2J8UF 4ELKA 3P11H 1CF8H 2QV2A 3RPIA 2ZOKA 3OKLA 4K23L 4WFFE 5BS0E 1R3HA 1EGJH 3QIUC 2HJKB 5CGYC 3LB6C 4LPVA 4Y4KB 4DGVL 2V2XB 5JNYB 4N0CD 4RZCB 3OPZH 2R69L 5CJQL 1A9BA 4J3OC 3G5ZA 5EBWB 2WW8A 3PDDA 4JQIL 1YEIH 2YUWA 1FNGB 1BVKB 4HWEH 1WISA 3BH8A 5E9DB 3AAZB 5J3HD 2G9HB 3C6LD 5C8JA 4PJXF 2IFFL 3N1QC 4YXLL 1R3JA 1HILA 4HWNA 5I73C 1BQUA 4NCC2 3PWLB 1BVLA 4XGZB 5IMOA 3RVTC 3HMWH 4OZ4A 2M2DA 5GGTA 3JV6A 3CGTA 1BZ9B 2FX9H 5CBAA 4NT6A 1F00I 3LQAL 5D7KE 3MV11 3IFLL 4Y2DB 1CDBA 3DXAA 3B5HA 4M61B 5GZOC 5DT1H 3V6ZA 2I9TB 3MLUL 4XX1E 5GJTH 1HNGA 1EZVX 3W39B 3D3VD 2MQ0A 2XPGA 1ZHNA 5L88L 3QUYD 3QAZB 4BZ2H 4Y19E 5J6GB 5E00B 3GMOB 3D0VA 4K3EH 5DF0A 2FJGB 3FT2B 2FL5A 4PJCF 4Y5VC 5FDYA 3VD5A 4LARH 3GM0A 1ONQA 4MX7B 3SCMB 3BRDA 4L3ED 2DQDL 4ODWB 3R0NA 4KVCH 5AYQA 5IVOA 3NN8B 5A2IH 4KPHL 2CJUH 1KCLA 3SDAB 4L9LB 4PJAE 3N1PC 4PBVC 4F7EA 2XA8H 5A16B 3WUWA 1U8PA 4N1EA 4GKSA 1TPXC 1H15B 5GIRB 2D31A 4POZD 3HPLA 4EUPA 1YDPA 4N5ED 1QLEH 1BM3H 2I60L 4EIGB 3HMXL 4X98A 1YZZA 4NM4L 3WNPA 1WCQA 2DKMA 3KWWA 4FFYL 5DHVA 4JM2B 5I1JL 4JY6B 4MNQD 5L0QC 4EKXA 5GRJH 2IALA 4FZEH 4S0TD 5J3HC 5T1DH 4M7LT 5ICZB 3BHBB 4JFQA 4BJLA 2N56A 1RUPH 1WICA 5BV7L 3SHSA 5HDBF 5F7KC 1T6VN 4U4BA 5MI0C 2VDOH 5BRZD 1ZLSH 5C0RH 1EX0A 4NQDB 3MLPA 5DWUH 1I8LA 1ERNA 1V7NH 1FRGL 1FBIL 3GZKA 1NUDA 4FABL 5C70A 3CZFB 3KVQA 4NKIL 3MRGB 3H9SE 4ETQA 1UJTA 1JHKL 5I1DA 5EU6B 4ZAKC 1A4KB 2X4NA 3G6JB 3QUYC 1PG7H 4U6YA 2FHBA 3K3QA 4JR9L 4FMKA 4PJGA 3L95B 3O6KL 3TO4B 3BMVA 1HEZA 2BVQB 5BMFL 3UJTH 5B3NA 4OZHB 1HHIB 4N8VA 3LV3A 5C07E 4GW4A 4NO2A 3ARBB 1G9NH 1JWMB 3PQYA 1YY9D 3U36A 4NNYB 5F7EH 4JFZH 4JRYB 4JZJB 3KJ6L 1CE1L 3OKYA 3REVA 1S9XB 5LBSH 5B38G 3GHBL 1B4RA 2HJFA 5GRXG 2L7JA 4POZC 4XPGL 3WBDA 1J11A 1CR9H 5IVXA 3F62A 4RGOL 2BP3A 2DJSA 3RGVD 3GBNL 3IU3A 4GG8A 4JFXA 3JWOL 2VAJA 4TVPE 1EO5A 1Q94A 3VXUD 2OXGA 2WUBL 5DK2B 5D5ME 4X8JA 5E6IA 8CGTA 3LH2L 4KI1A 4HIJA 4CJ0A 4PJHE 2FR4A 3CH1B 2GJ6A 1JF5A 2HFFB 4ZS7L 2V7NB 2LE9A 4Q6IB 1ZVSA 1ETZA 1W0VA 2GITA 1F11B 5B3JF 5H94B 1PQZB 3MNZA 4BELD 1EAPA 1B0RB 3AFLA 1TJHH 2GSGA 3LEXA 3VXOA 5IB4B 1HHKB 1ZLWH 3OR6A 3S36H 2F53A 1N6VA 1G7MA 4QHMB 4OQ1A 3EOAB 3D18A 3MYZA 5KSUB 4NGHL 3RTQD 4U1GC 1P6AB 1OWWA 5HJ3B 2X1XR 3HCVA 1I1YA 2Y1VA 2A1WL 4XI5D 3NAAH 1K2DB 3MLSL 4LPXA 3FB7A 2DL9A 1VESA 3ZYIA 3G6AA 4KI5E 4JFDA 1ADQL 1RVFH 5I71B 3S3SA 1YY9C 2OZ4A 3A6CH 4LEOA 1YEJL 2YK1L 5T1MB 2V5MA 2R1XA 3QZWG 3G04B 2P45B 1IAKB 5AD0A 3KPSE 2IH1A 4GW1B 3C5ZC 3MRFB 4WW1B 2X09A 2HWZH 4LLMB 1PBYA 4NHCL 3VXMB 3BUTA 2VDMH 1PD6A 3RDTC 1U8NA 4NOFA 2PF6A 3U0WH 1T2QH 3SOBL 2H26B 3OGCA 3V5HB 4NRXA 5KSVB 5I8EB 4GKNB 1JNHB 1NL0L 3U30B 5T5FH 5D7LB 2VH5L 4JCMA 4CL7A 4DAGH 5IGXH 4LRNL 4XCYA 1XGYL 1CD1B 5HGHB 3MNVB 1WZLA 1FNHA 1TNMA 5I1HL 4TUOB 3CVHL 4ODSL 2UYLB 4K55A 2BRRL 4NC2B 4FQJH 3EUUA 1IEBB 4B5EA 5C9JB 1OAXL 4HKBB 1MAML 4O4YH 2EYSB 4A2MA 5JW4M 1LO3H 1IRAY 3FO9B 3UTTE 1J05A 3D2UB 3QDHA 5DEFA 4NNXB 3RTQC 5BXFA 1HH6A 3NCJH 1IC1A 1C5BH 4MCZA 2YN3A 1AE6H 2FLRT 4PV8A 4XI5C 2ZSWB 4NKOB 3IFOB 3MRPB 3RY5A 1V3MA 1R5VB 2X2YA 4G9FA 3NGBC 2VLJE 1U3HD 2EDBA 4JVUA 4PJBE 1D5MA 1FVCA 4M5ZH 1XF5A 1JZ7A 4HC1L 3S4SA 4PY7B 2VLRD 2W9DH 4N0UA 4DZ8B 4EI5A 3WLBB 3CFBB 3BWAA 4UDUB 2J3SA 4BQ9A 3GMNA 1VSCA 1JTPA 3MLVL 1XIWB 2VYRE 1KC5H 3DGGA 5EPMA 1KB9K 3QRGL 5FK9A 1ZV5A 1MCJA 4F15C 3HI1B 2UY7A 3C60A 4YUEL 5L2KD 3ARWA 4KDTA 1YPZA 2CMRH 3FONA 3P0VL 4EOWH 3W2DH 4ZMAT 1OPGH 4MJ2A 3MCLL 3MJ8B 4M43L 1DE4B 5FCSH 1UC6A 4OJFL 4UINH 1GGIL 2W0FA 1K85A 3GSUA 3TO2A 3KPOB 2BNQA 2V5RA 3LSOB 2Q86A 2QQNH 3VW3L 4OT1L 4HDIA 1PEWA 4LKCB 5T3ZE 3VDCA 4PJXA 3WJLC 3PXHA 4J3XA 1AXSA 3IDIA 4R6UA 2AQ1A 1UWXK 3D85B 1JIBA 3V6OE 3SBWA 4L5FL 1WZKA 2QQKL 1U95B 4RIRA 3FT4A 5C2UB 3NVQA 5DFWH 1I7RA 5SX4H 3E8UH 2HAZA 3DI3B 3PL6D 2XRAH 1GOGA 1JJUA 1KCKA 2MMXA 3HC4H 5F1IA 3FOLB 1U3HC 3FQRA 4HV8A 4HJJH 1FO0L 3C87A 2YPLB 4RSVA 3OJ2C 5DD3H 1FYTD 1HZHH 3B2VH 3W82A 2AQ2A 3NIGF 1JNLH 2AXFB 4MA8H 4YGVA 3KDMA 5GGQH 3GEWB 4EJ1C 1IQDA 3IETA 3SPVB 4OBSA 4LSTL 5ACZA 2H3NB 1MHEB 1ZE3C 5CBEB 2YPKB 4V1DA 3BUYA 3LIZH 4LDLB 4OQTL 4DGYH 2DBLH 3AMLA 5DR5L 3O4LB 4R96A 2V2TA 2APBA 3LQMA 3BVNA 4QHLB 2EXYD 3WKML 4UOW0 1S7VB 4XAKE 3CMGA 4G6FD 1S7SB 5I9QC 3HNTH 2C4FU 2E7MA 3EFDL 2P5EB 4Z7WB 3MGOA 4NFBA 4G80A 2CKBA 4XXDB 3PP3K 5MEPA 2AV7B 3U7WL 1VPOH 5B21A 1WBZB 2VDLH 5BQ7A 5ESQB 3OKKA 3AS0A 4LOUC 1VADA 4IRZL 1UWEL 5FGBA 2Y36H 2VO5A 3TBTA 4IHOB 4F37F 3GB7B 1IGIL 4B41A 2OTPA 3EYUL 4TRPH 1MSPA 4YDLB 3BIKA 1JN6B 1HSBA 3RWCA 2DWDA 1ZT4B 1NGWB 4Y4HD 3PWPE 1UVQB 1M7IA 1WWAX 1C16A 4OLWH 4Q9CA 4ZO9A 5E8OA 2OLDA 3C6LB 2IQ9H 2XTJD 3PL6C 5JPMA 4JKPL 5E1HB 2HN7A 1DLFL 1JTOA 1QO3B 2CRZA 1XGUB 5K9OA 1X5XA 3QUZC 4K23H 3QWRD 5DK0A 4KKLD 5EU6E 3G6JE 1WZ1L 4R0LA 2WZPD 1FDLL 4Z78B 4DGVH 2YKLL 1BQHB 3ZL4L 2FHFA 4F7TA 4HJGB 1LE5B 1R3LA 2R69H 1SJHB 1H3TA 1J10A 3BYYA 3D3VB 4OZHE 1AGFA 4OZFG 1FFPA 3HNSL 2Z31A 4JQIH 4QGYA 3QUYB 2N4IA 1U93A 2ICWA 3V95A 2DI9A 1BZ7B 1I8IB 5IG7A 5E2WL 2IFFH 4JRYE 1R5WA 4NSKA 5EULV 1QHOA 1QSFA 4YXLH 1I7UB 4C56D 5BVJA 3TA3A 3DVNA 2R2BB 4L3EB 1E28A 3BZEA 4N9GA 3OMZA 2DDQL 2F54A 4PJDF 3X13B 1QLRB 2C3HA 1U41A 3LQAH 3KYAA 1F6AB 3IFLH 4PRPE 4LAJH 2Z8WC 4QHNA 3MLUH 3X11A 1TXKA 4KQ4L 4XC1L 3ESVF 5L88H 4MSWA 3HZVA 3DX9B 1HI6A 3EHBC 1U91B 4NN5B 5ABDE 5ETUB 4NUJA 1NBYB 1LQSR 1GZQA 4I48A 4D3CL 2KKQA 4OFKA 4Y4HC 1MHPH 1WAAE 2ED7A 3E3QC 4MNQB 2W65B 2BXYA 2DQDH 3QDJD 2NW3A 2BOBB 2L4OA 1XT5A 2F5AL 2XTJC 1XAUA 3RWEB 4ZNCD 4KHTL 4KPHH 3QWOA 1T89A 5BRZB 4HKJB 1PY4A 4KJWD 5HHVL 5HGBA 1SYSA 4IDLA 1OARL 4XPBL 4CVZA 5H2BA 2I60H 3SGJC 3HMXH 5J12C 4MXVF 1Z0MA 5HGDA 2PR4L 4RMTA 4FFYH 2OTUA 4D0CB 5I1JH 4Y0GA 5DQJA 1Q8MA 3HFML 2W0PA 5KBNC 3T4AA 5BV7H 1JL8A 4LSQL 4M3JA 4EEEA 1C5DA 5EBLB 4K7PL 4GBXA 3QCUL 3VXME 4UUJA 4CGTA 3C5SA 4LFHG 4LKXA 1FRGH 4L8BB 4CVXB 1FBIH 2XA3A 4S2SB 4FABH 1NGZB 4NKIH 3FB5B 5HY9A 3ARRA 2VQUA 5LGHL 1JHKH 5D6DC 4MNGE 3ABZA 4LSRL 3VXRA 2IAMD 5D7LE 5HYEA 4NZTH 1QA9B 5J1AA 5D96C 1D9KC 3G6DL 2FIRT 1BX2A 3BKML 1OW0A 3FTGB 4JR9H 3RGVB 3O6KH 5SWQA 2R23B 1HDMB 3VDBA 5SWZA 5BMFH 3L3GB 1J0JA 3VXUB 2VTFA 2NW2B 4P9HL 4JFPA 2B8OT 4X8XA 1U8LB 3QI9C 5GGUA 4X7SL 2J6EL 4CW1A 4G6KL 3PJSA 3KJ6H 1CE1H 1C7SA 1QEWB 3RL2A 3QNYB 3WFCL 1ZTXL 4KJWC 4R26L 2F5BL 3GHBH 4U6XA 4KWUA 5E94B 4ZUTB 4XPGH 5I1EL 2R4SL 4D9RE 3IJHA 5IM7B 1CLYL 4RGOH 4ZS6D 2HYMA 3GBNH 3CSPA 2OYPA 4DFIA 1U8MA 1K8DB 3JWOH 1I7TA 3RTQB 5E5RB 3S8WA 4YFLI 2R8SH 2EYTA 1QFHA 2WUBH 1QD0A 3LH2H 1MNUH 4HX1B 3BN3B 4W6WB 2NTFB 3NGBB 1ITBB 3BZDA 4WGVB 4H5SB 4UU9A 2FEEL 4RAHA 1CGSL 1QRNA 1TLKA 2FJFA 3DX7B 5CFHA 1U8QB 4P3DB 2CDEB 4J7RA 5CP7A 4I0PD 4FQQB 5E8NB 2VERN 4J1UB 4XCFL 4B0MM 4O02H 4H1LH 5ANMA 4M62L 2A1WH 4F15B 4MD5A 3L5WB 3GFUA 2O5XL 3E6HB 3ZDYE 4LHQB 3MLSH 5IFAL 2D0HA 2X1WL 1MFNA 2RIKA 4WO4C 1A02N 3C8HA 1ADQH 4M3KB 1NFDF 2ZG1A 3CFCL 4LDEB 4HUWB 1ORSB 4NQXA 4MQSB 4WFHD 1IEAA 5B22A 3SE4A 3A0OA 1YEJH 2YK1H 3FQXB 5MEQA 3QISA 3GMPA 3QUXC 4GRWB 2RFXA 1QKZL 5D4QA 4M6OL 4QRSB 5GSVA 1N7ML 5C0EB 4NHCH 4H0GA 1D5IL 1XF4A 5DVMA 3UZVB 2DQUL 3PV7A 4DCQA 3SGKA 3EBAA 4QF1A 1TZHB 4FOMA 2CLVA 4HHAB 3SOBH 3WXWL 4HW6A 4K94C 4UDTB 4X0KB 1NL0H 1KPVB 1U92B 2VH5H 4QCIB 4LRNH 1KLUB 1AY1L 1EAJA 1XGYH 3TN0A 3AXLB 5EA0L 1U3HB 5I1HH 2Q87A 3CVHH 4ODSH 5E08L 1W0WB 2BRRH 2X41A 2VLRB 1OAXH 4K71B 3VFMB 5I16B 2V17L 1C12B 1EEYB 2CO6B 2VIRA 3NFSL 1OGAA 5HGAA 5EU7C 3O4LE 1JGDA 2OR9L 4XAWL 3MTRA 4Y2OA 3FCTB 3OWEA 1LEGA 5J1TC 1G9MC 2VISB 5CCKL 4Z7WE 2WM0A 2FJHA 5L2KB 4PGJA 5DRWB 1REIA 3VWKA 1NMBL 1DBML 1FN4B 2XKNB 1Y0LB 3DXAD 3EYVB 3VRIA 4HC1H 3GUTB 1JWSB 1LNUA 4YE4L 3QJHA 4NHUA 3IU4L 2NX5E 5HI4C 4X7TB 2BY0A 1C08B 3MLVH 3WD5L 4M93C 3QRGH 1MCPH 2LAGB 3T0VA 1UWXH 4QHKI 4TUKL 1N59A 1SJXA 3WV0A 5HYSA 4F9PA 2YBRB 5FYJD 4ZD3H 4YUEH 3BJ91 2HFGL 3IDYC 5TDNA 4BYHA 3MRIB 5IMMA 3LKQA 3L3IA 3MRHB 4DQOL 3P0VH 2PYEA 2MHAA 2HMID 3PL6B 3GSXB 3E2HB 3MCLH 3S96A 1OCWL 3PDGA 4M43H 2YPVL 4OJFH 3CDFA 3SKNB 3S35H 2EKJA 1GGIH 1FYTB 3OQ3B 3DBXB 2WIMA 3QO0B 5F1KC 4BKLB 3VW3H 4OT1H 1BWMA 5D6CB 3VFOB 2DS4A 4PG2A 1RJLB 3FAXA 2EEAA 4O9HL 4KROD 4L5FH 3MQIA 4BM7A 3MO1B 1NFKA 2NY1D 1MHCB 2FECL 2QQKH 3WL9A 4HQQL 3MV8A 1HSAB 2XV6B 1RZ8A 4XCCL 2Q7YB 2EIDA 1FO0H 1JCKA 2YEZB 4HUUA 4X6DB 3RZCA 4G6FB 4HPYL 1QLFA 3BEWA 3PP3H 2VXTL 3FN9A 1URLA 1UXSA 5IFJA 1G7IA 1KCVL 5ISZA 2W9EL 3P4MB 3QJFA 3VFVB 5CILL 4RQQA 1JE6A 3F12A 2ATKA 3FO2B 5DQ9B 5TDPB 4LSTH 1ORQB 3GGWB 5ID0B 4MNQE 3UYRL 4PRAB 1CT8B 3TBVB 1FVDA 2BNRD 4DGIL 5FA3B 3CPLA 3OR7A 4OQTH 5DI8A 4GW5A 3PGFL 4M9PA 5CIPH 4K8RD 4Y4HB 4XZUB 3T65A 3WKMH 5BRZE 1A1MA 3KHQA 2XQYK 2OSLB 3U0PA 3EFDH 2XTJB 3VFSB 5F89A 5GHWL 2VB5A 3U7WH 2DWEA 5MERB 3NMEA 3QDME 2AJVL 2WWMD 1GGUA 4IRZH 1UWEH 3BXNB 3VD4A 5KN5B 3P77B 1WCBA 4C4KT 1UB5A 1IGIH 4PS4L 3EYUH 4JHBA 3VI3F 5JO5B 4J6RL 3VXNA 5JOPD 3HUJA 3DX8B 5J12B 3SN6N 4PG9B 3B4NA 1ODAA 1N5AA 2NY1C 4YR6A 4GRLA 5INDB 4CNIA 1VFAB 1KNOA 1CZ8L 3RGHA 3RWFB 1QSED 1BF2A 1SEBA 4JKPH 1I8LC 1CFSB 4C56B 1DLFH 2KQMA 2AJUL 3U9PL 3ILQC 4RDQG 1T5WB 5L7XL 2P46B 1CL7L 4PP2A 3PWVB 3HR5B 3EJJX 3IVKA 4C58B 2YD6A 1OTSC 1WZ1H 3F5WB 1FDLH 4JPVL 1BQHG 4UMGA 2YKLH 3ZL4H 5GZND 2AEWA 2P24B 3QULB 3TNMB 1UZ6E 5T1KB 2ZUQB 3T0WA 4BSWB 4M1CC 3HNSH 3NCYP 1KLGB 4XP5L 1SMOA 5D96B 1UQSB 2Z4QA 1VERA 2Z0BA 4Q74A 3UPRB 1FIGL 4K8RC 5E2WH 5TQ2L 1KIQB 5J11B 1FFRA 5I6XC 1H3PL 1S5HA 2GFBB 3QDJB 1P2CA 1INQB 1U8KB 2JELL 5CEZD 5IHZB 2DDQH 3L3DB 5EBMA 4BZ1L 1YN7B 2NY5H 2XWBA 1S7TB 4OF0A 2WWMC 3L7EA 4YZFE 2A9NL 3UPCA 2J12B 3JZ7A 1VGKA 4M4RA 2D7NA 4P2RE 1B9ZA 3A6OA 2UUDK 4KQ4H 2VJXA 4XC1H 1HHGA 2PCPB 1OAZL 5JORB 2ZOLA 5E6IC 3SDXB 4O00A 2AJZA 2D0GA 4CBPA 5HI3D 4D0DB 4D3CH 5D2LE 1BFVL 5FEBA 3ULUE 4TNWK 2BMKB 4DVRL 1BFSA 1NAML 2F5AH 4AENA 1WFNA 1U2CA 5DMGC 1PG7W 4KHTH 3DMMA 3DX6B 2UZIH 4QKXB 2GK2A 5HHVH 1JTTA 2VNCA 1ZS8B 4YBQC 3ZE1E 5GRYA 5HHQA 1OARH 3U46B 1MRCH 3ES6B 4XPBH 1KN4L 2OJEB 2R2EB 2P8LA 1AQDA 3TBYA 1CWVA 1U42A 2VR9A 2EYRA 1U2HA 2PR4H 4XNMB 3OTTA 1BIIA 1NFDA 2IAMB 2NYYC 2OMNA 5CZVL 3CU1A 5FYKE 3HFMH 3JV4A 2IGFL 3CVIL 4KJQD 1MVUB 3OX8B 3WIHL 3UAJC 1BMGA 3HB3D 1T0PB 4GRWE 2GKIA 1HQ4B 4N68A 1WBYB 2VLKD 2IMNA 3WNLA 4Z6AT 1BBJB 4ALAL 4K7PH 2UWEA 3QCUH 3K81A 4I2XB 4XNZC 3NH7L 2ADGA 3MUJA 3R0MA 4YBLC 4MJ6A 5IB5A 3B6SA 5DZOA 2FZ3B 5LGHH 3C60D 2FH6A 4HIIB 1YMHB 4LSRH 1A2YB 2MSPA 3X12A 4AY0A 2ENYA 5F7YC 2NNAA 4PJEB 1T7VA 3BKMH 3G6DH 3PGCB 3EJYD 4NN7C 4JZOB 5DEZA 2FD6L 2FEDD 1EO7A 3IXTA 3RWJB 1CD0A 4XNXL 2V2WA 5TJWK 1A3QA 2LVEA 2I25N 4X7SH 4HUXA 2J6EH 2KZWA 3KJ4B 2UVFA 4WTXA 4G6KH 1FSKC 4HS3A 4YHNA 1FGVL 4QGTA 1K4DB 3N06B 3ULUL 4LHUA 1ZT1B 1ZTXH 5F1NA 4R26H 1VGEL 2F5BH 3WFCH 5L2JA 1ACZA 1BJMA 4H25B 2XWJB 1EEZB 1OT2A 3ILPB 5INCB 4IRJA 2R4SH 3AM8A 4O2CB 1C7TA 4I0PB 1CLYH 4AT6B 5L2KE 5I2IA 4MDJA 5HDQL 3EDKA 3LMJL 3OXRA 4LBEB 4M8VA 5J9PA 1BBDL 1VKXB 5DJ2A 4DUVA 2X89D 4CN6A 3O3DA 5EZLA 1PLGH 4JE4B 5KJRL 2OS7A 3H9HB 5BS0A 4KJQC 2X4OB 2ZSVB 5F88A 5ITFA 2DQCH 2V9RA 5HYJA 3AMKA 5GGSB 2XXMB 3ESUF 3T2QA 1CGSH 1IM9D 3H7LA 4BFBD 4NQVA 2PW2A 5KVDL 5FYKL 1P7KB 3RI5K 5KTEL 3T2OA 4KKNA 3C60C 4JO1L 3IAGC 1EVTC 4KDTC 2E27H 5DQDL 3CSYB 4M62H 4C83B 5SWSE 3UTQB 3EJYC 3HAEH 4F2MB 2O5XH 3FFDB 4Z77A 2ZNWA 4Z7NE 4KRLB 2D9QB 1D3CA 5IEHA 5IFAH 4Y8AA 4OFIA 1TITA 1E4XL 4ELKB 5D1QA 2WBKA 1FYTE 3CFCH 4FG6C 1FFOB 3E6FB 3GMRA 3SGEH 4Y19A 1KCRL 4R7DA 4DN3L 1S7RA 1S8DA 2DKUA 2GJZA 4NO0A 1D5BA 1QKZH 2Y72A 4M6OH 4JFYB 1N7MH 1AFVL 1D5IH 4OF7A 3LKPA 1W72B 1JGUL 3GSVB 3LRHA 4HPOL 2DQUH 2GQHA 2Y4SA 2RJMA 4YLQT 1GYAA 3T1FB 3MRMA 4RWHA 3WXWH 1RJYA 3D25B 4CRPA 4X6DE 2V9QA 4PJAA 4ZTOH 1BVLB 3OF6A 5IMOB 1AY1H 5EO0B 5DEGA 3UJIL 3VE0A 4KKAC 5I8CA 5IBLD 5EA0H 2FATL 3DSFL 3RQ3A 4PJIF 4HAGA 5E08H 3DXAB 3B9KA 5EWIL 3HTLX 2FX7L 3DRTA 2HFEB 1JRHL 2V17H 1I3GL 4Z7VB 1BQSA 1ZHNB 3NFSH 1NBVL 2G2RB 2OR9H 3MBXL 5KG9A 4F7CB 2Y6SD 2JIXA 5DJCB 4OCRL 3RKDC 5FIEA 5CCKH 1T66D 3ZHDA 1W8OA 3F6LA 1KSRA 4PYHA 4Y7MA 4ENEC 1NUGA 2F54D 4N0FA 1CI5A 1NMBH 1DBMH 2ZUWA 4MA3A 3R8BB 2CSPA 3H9SA 1ADQA 2GHWB 5FGBC 1JPFA 1MLBB 4I77L 4NBZB 4X5LA 3ZKQD 4GKSB 4YE4H 4ODHL 5C0NC 5I8KL 4NDMB 2D31B 2E6JA 1A6AA 1YDPB 5EU5A 3IU4H 4JDTL 1YECL 4X98B 3RWHB 3U4EA 3WD5H 4F7MB 3KWWB 1F3DJ 2L7UA 4ELMB 3TFKC 3RL1A 5C07A 2BVUA 2YR3A 4TUKH 2VABB 2CPCA 4UBDD 1KJ3L 4KROB 1F97A 3L7FA 4B53A 2HFGH 1P53A 2NY1B 5FFLA 4RWYL 2EECA 4DQOH 2XZAL 3IT8D 1YN6B 4G8IA 1INDL 5IBLC 4MXQC 4NBXB 4ZSOA 2AVGA 4JPIA 1OCWH 4R0LC 4OCYL 3OKEA 1EA9C 2YPVH 1FP5A 2HTLD 1CXEA 5GQBA 4X80L 4ETQB 2X70A 1I85A 4GAJL 1AIFA 4OSUL 2Z31C 4NZRL 5D5MA 1JUFB 2X4NB 3Q6FB 4OAWA 1DR9A 4PJHA 1WWBX 3T4YB 3GMQA 2JB5L 1EFXA 5C6TL 1HEZB 2NZIA 3ZMRA 4HQQH 3QDJE 2BNRB 1HYRC 3O6FD 4G8EB 2NXZD 2ITCB 3LV3B 3OXSB 5I19L 2X1OA 4LVEA 4ACPA 4XCCH 3X17A 5I6XB 4H0IA 3RU8L 4NKQB 1U9KA 4UNUA 2VXTH 2R1WB 2MWCA 1ED3A 1XR9A 3VXPB 3MXWL 5DJ0A 2W9EH 1I1AA 5CILH 1CFQA 1MJ7H 4YNYB 3GSNA 2YUXA 1S7QA 1YNLL 3CNKA 3SDXE 3TYFA 1X5AA 5IVXB 4C54A 3OHXA 1P4BL 4M8QA 4DVBA 4JFXB 1KIUA 3UYRH 3FQTA 1CBVL 1XCTA 5HHOA 4DGIH 1OOAA 4OF8A 4X8JB 4MDIA 1ES0A 3PGFH 4HIJB 5CZKA 3IDJA 4LLVA 5D1ZA 1XH3B 4P49A 1T89C 4MJ4A 3KPSA 3ET9F 4JJHA 7FABL 1QSEB 5DFVD 1ETZB 2IF7A 1IAII 5GHWH 1TCRA 1DEEA 3FQUA 4WTZA 4ZDHA 2VWEC 3MNZB 3QH3A 2AJVH 1EAPB 2AABL 2HTLC 2GSGB 4NKDA 2VITB 1CXKA 3DHMA 1KIPA 4UQ2A 4LGRB 1G7MB 4KXZI 3T0DA 4X6BA 2EIZB 1EDQA 4MVBD 3UZQA 2ZUTA 2QSVA 2H8PB 4J6RH 1LP9F 2ORBL 4NYLA 4IMLA 1A4JA 4YHLL 1PFCA 1F8TL 2IPTL 3P73A 1I1FB 3SDCD 4P5TD 2Q3ZA 1CZ8H 4I2XE 1JYXA 4GBXC 4LEOB 4HWBH 2AJUH 2D7OA 3U9PH 3UTTA 3RHWK 1FO0A 5L7XH 5DRZB 1A7OL 2ARJA 1CL7H 5AD0B 1TJIL 2IH1B 1EFQA 2V7HA 2ZUVA 2K7QA 4WVRA 4XNZB 4MJ5A 4N9OB 2WBWB 4JPVH 4PJEE 4U31A 3U83A 2EDEA 4HG4K 1NCAL 2UUDH 3O11B 4YBLB 2V6HA 3T0XA 1OW0C 1KGCD 2R15A 2VLJA 3QIWD 4PJBA 4XP5H 5KVMC 5AUMB 3T2PA 5DJXB 3ZDZF 1NCBH 2AXGA 3TZVD 1FIGH 5CSBA 5CIPA 5BO1L 5TQ2H 1ZHBB 1ZSDA 4NKMB 3HPJA 1UZ8B 5BOPA 3JVGA 4HIHA 2JELH 3PF2A 3OAZK 5DFVC 4P2OA 1CIDA 3FQWB 4M00A 1F3DH 5C0BE 4BZ1H 1MPAL 2IPKB 1D5ZA 1ROWA 2OL3L 3V9FA 2DIJA 1I9JH 4TUJB 4XH2A 5J13C 3VD9A 1AXTL 2BOCA 1IAIM 35C8L 1DTUA 5A2FA 1J05B 4U1HB 1PKQB 4MVBC 3V52L 1OAZH 1OP5K 2HJKA 4MCZB 3GNML 5BZDB 1BFVH 2V2XA 3EKCA 5JNYA 3MJ9L 4RZCA 1KB5L 1NAMH 2I07A 1D5MB 4P5TC 3DVIA 1U8JA 4WU5B 2WIIB 3MSPA 3HA0A 4WFHE 1FNGA 1BVKA 2IC2A 4F8QA 3Q0HA 3H6JA 3AAZA 1CXIA 2G9HA 5CUSL 3SGDH 1YA5A 2VLKB 1CCZA 3V6OA 3BP6B 2DQIL 4NRYB 2WWKO 1L9NA 3UTSD 4LCUB 1SMAA 4PFEA 4XGZA 3VFGL 2EE3A 2ZPKL 5I8OL 3DGGB 5EPMB 1KN4H 1BZ9A 1BIHA 1LMKA 2E8ZA 5JLZB 4Y2DA 2J8UB 3QIWC 5E7BA 4M61A 5SX5H 2I9TA 3N9GL 3W39A 4XWOD 1QACA 2IGFH 1TQCB 3CVIH 2C3VB 5FGSA 1G9NC 3GSWB 3QFDB 3WIHH 5E00A 3GMOA 2JJUA 3SE4C 2VXUL 4P48A 4FFVD 4ZO8A 2FJGA 3FT2A 1LO5B 1B3JA 3NIDF 5DA4A 4Z7QF 4ALAH 3SCMA 2C3WA 5DJAB 2W0FB 4ODWA 4Q7DA 3DYPA 4ZFZB 4OCMC 2Y23A 1A14L 3OB0H 3GJFH 1RZJL 2Q20A 3NN8A 4PJXB 1ZMYA 1QFUL 3MV7E 3ZZ1A 1FGNL 1CDJA 3K8MA 3SDAA 4L9LA 5A16A 3IDNB 4XXCA 43C9B 4YDJB 3FT4B 5IV2B 4Y16D 2CDFA 5GIRA 5DUML 3WE6B 2FD6H 1RUAL 1I3RA 2K9UA 1MLCA 3MACL 5F1IB 5LG1A 3BW9B 1A47A 1A1OB 3LN5B 4JY6A 4KUCF 4Z7VE 2AJYL 1FGVH 1L0XA 3MV01 5ICZA 4BH7A 1FZJA 3ULUH 3WMSA 3MRRB 1B2WL 3QEGL 1IM9B 1VGEH 4PJCB 5ACZB 2C3XA 2X9XA 2EDNA 4LLWA 3MV8D 1E4KA 3I85A 5FO8A 1WGOA 4YGAB 5E8DL 1BFTA 5HDQH 3LMJH 1MI5D 3NIFE 1A9EB 1BBDH 4R96B 2YWYA 4AQOA 1DLHA 3RNQB 4XWOC 5KJRH 2J4WL 3RZCD 2R9HD 1QQDA 1XGRB 3UXFA 1TMCB 5EU6A 1A4KA 5HYQB 3G6JA 4JGUA 5I17B 4Y4FD 1ZAGA 3P9WB 2HT3D 3TO4A 3VA6A 4FFVC 2B4CL 4N8PA 1DDHB 4HD9A 4OZHA 1EEQA 4V2BA 1Z3GL 4I13B 3V4PL 4ELME 5KVDH 5FYKH 4YEFA 3MLWH 3RWGB 5E2TL 3ARBA 5KTEH 5FKPB 4NNYA 3BIKB 1NCCL 5H37G 1HSBB 1I9IL 3NFNB 1PEZA 3T3PE 4JRYA 4F9PC 4GXUM 5IW1B 2KUTA 2X40A 2QKIB 4JZJA 4ERSL 1B6DA 2EC9U 4WW2F 2W59A 1YQ2A 4Y16C 1NH6A 2QBWA 3LKNB 4HS6B 5C0AD 2JCCF 5I0DA 2HLAB 2EE2A 2I5YL 3TPKA 1QBLL 3J8F7 4GG6E 5C0CE 4PRPA 1RK0B 2XZQL 1E4XH 5K9OB 2P44B 4PJ8D 2ATPB 2X5PA 5EU3B 3UPAA 5HVFB 3T0BA 4JRWA 2DF3A 5IMLB 4ZPVB 2NY6D 5DK2A 4GAYA 1KCRH 4L4TD 4JY4A 1X9QA 1SY6L 4PG2C 3AVEA 3CH1A 5C3TA 4F7TB 4S10A 1R3LB 2RQ8A 1WAAA 1X5ZA 2VN4A 4OIIL 1AFVH 2HFFA 2V7NA 4RFOL 2BNRE 4Q6IA 1JGUH 2OM5A 1NFIB 1YJDC 4HPOH 4Q0XH 5JW5A 2ICWB 1G1CA 4M6AA 1PQZA 4YDIL 1RULL 2ARWA 1RURL 1U8HB 4Y1AD 3Q1SH 1FLTX 4APQD 3S5LB 1IJ9A 1R5WB 5IB4A 1HHKA 4PGZA 3M8OL 3RZCC 5CD5D 3EOAA 3UJJL 3NCFB 3MRJB 3UJIH 3CFJB 1XGQB 2F54B 1AGEB 5C6PB 4BFGA 4ISVB 4WV1B 2FATH 1WWCA 1K2DA 3VJ6B 5EWIH 2FSEB 1MFAH 4CMMB 2FX7H 1TZIB 2VZ1A 3X11B 4ZFFB 1JRHH 1CK0L 1I3GH 3JTTB 5JOPE 4MSWB 1NBVH 5T1MA 4NUJB 3MBXH 1GZQB 2D2OA 1FAIL 1IAKA 3ZT7A 4WW1A 4OCRH 2E6PA 3VXMA 1HXMA 4G7VL 4X6CF 3DARA 5A3ID 5BJTB 3O4OC 3WUWG 2H26A 3V5HA 5KSVA 3LPGA 4HSQA 4MNGA 4I77H 4CADA 3DLQR 5D7LA 4Z76B 2NY6C 1SBSL 4ODHH 3B83A 5I8KH 2BSED 1CD1A 5HGHA 1X5JA 3MROB 4CVZB 4JDTH 1YECH 4TUOA 4TTDC 1H9VA 4GRLC 5C9JA 5D7SL 3BIAX 2W38A 2YD3A 4LVOB 1KJ3H 3EGSB 4PJ5D 1JBJA 3FO9A 4WEMB 2IEPA 1VA9A 3E0GA 3DMMD 5CEZE 4RWYH 2NR6D 4FQPA 3O6FB 5CD5C 3D2UA 5L8JB 1TDQA 2XZAH 4NNXA 2NXZB 1C5DB 3M1BB 4HGWA 4LCCB 5E2JA 2E7LA 2MKLC 3DO7B 1INDH 4G8FB 2N7BA 4Z0BL 2OQJA 2ZSWA 4OCYH 4NKOA 2D03L 3IFOA 2GT9A 3AB0C 3GM8A 3MRPA 4ZNEE 1MCCA 5C0GB 1JNJA 3TNNA 1BLNB 4X80H 1CFTB 4GAJH 4OSUH 3FL7A 4XVJH 4EQ2A 4NZRH 1VFUA 2MKWA 3LEYL 4Z9KB 3EO9L 4DZ8A 4KV5E 5GGVY 1L0QA 1HHJA 4NQTA 3WIFB 4QRUA 3CFBA 3WLBA 1CS6A 4TSAH 4UDUA 5DFTA 4P4RB 3VFWB 2X4PB 2KQNA 2JB5H 3FRUB 4FFWD 4M6ML 5D2LF 5C6TH 3ULUF 2HTKD 3MR9B 5D1XD 4QO1A 5FHAL 3WIIL 2NY3D 4NO3B 1XIWA 2JJSA 4P2YA 3Q2CA 4JFPB 2EIBA 5I19H 5GGUB 5KSBE 12E8L 5A3IC 1D6VL 3SQOL 3TESA 4RBPH 2RBLA 4RGND 3RU8H 5FUOL 1J12A 3G08B 3KXFE 1GOFA 3LQZA 4HUVB 3L6FA 3HRZB 3MXWH 3ZKND 4CVUA 2ID5A 4W4OA 1PKQE 1A6ZB 1FV1B 1H8NA 4U6XB 5J13B 1YNLH 2DLHA 2IQAB 1L4IA 3O2DH 4WFGD 3BQUD 4PY8I 1P4BH 5GPRA 3FT3B 1DE4A 2AEIT 1TVHB 1RFDL 4YHYC 3ULVL 4BQCA 4DEPB 1CBVH 4X9FA 3KPOA 4LMQI 3LSOA 1J0IA 4PRBA 3TVMD 3CXDL 3DMMC 3SDCB 3UZEA 1YY8B 5GISL 3K1DA 2YD5A 2VLKE 4P5TB 3UP1A 7FABH 1U95A 5LQBL 4LHUD 4RGMC 4WEUD 4M6NH 1MCEA 1Z9MA 4WI2A 4U05A 2AABH 1AD9B 3FOLA 2J8UE 1IT9L 3U79A 4NC1C 3RVUD 5ADPL 2OXHA 1A0QL 5KAQG 2ORBH 2AXFA 2VXVL 4WFFD 4XP6L 1AR1C 4YHLH 1F8TH 4FFWC 4P2QD 3NFPB 3QIWB 2IPTH 4HK0B 3SPVA 1HKFA 1NANI 3TZVB 5CBEA 4JO2L 2YPKA 2OI9C 4J3SA 4UILL 3TIEB 3MRBB 3OAZH 2AJSL 4RGNC 4LLQB 1TIUA 2UZYB 2FCBA 3O4LA 1A7OH 2AGJL 4QHLA 1A5FL 1TJIH 4OBRA 1P5VA 1S7VA 2LAAA 1X3DA 1S7SA 2P8MB 2N1KA 4JFED 1EV2E 1NCAH 4ZYKB 1EMTL 4Z7WA 4DCQB 4XXDA 1OLLA 2AV7A 2IMMA 4HIXL 3X14B 4QF1B 2CLVB 1WBZA 1OP5H 5ESQA 4MWFB 1KJ2L 4U6TA 1JZ2A 4IHOA 4E0RB 3GB7A 3TVMC 4E42B 5ECJE 4OD1L 4LLDA 1JN6A 3OB8A 5EZIL 5BO1H 4L4VE 3U4AA 4JG0L 5D9SB 4LPTA 1CU4L 2YA2A 1ZT4A 2ICWI 2NX5A 3CH8A 4OV5B 3LKRA 4PJCE 5E7FA 3GJEB 3K8LA 2XG5A 1UVQA 5TE7L 1K5NB 1MPAH 4IRJC 5GGRB 3Q5TA 2OL3H 3AM8C 4RA3A 3C6LA 3RVVC 1RUQL 1AXTH 1YNKL 3WFEL 35C8H 3LEVH 5HGAB 3UTSB 4BK5A 1XGUA 1JGDB 3V52H 1IGJB 1LEGB 3UTOA 1I9EA 4OGXL 3FHAA 2E3VA 3GNMH 3QPQD 1BQHA 4NCDA 3MJ9H 4HJGA 4Z7NF 1KB5H 4ONOA 4PBWD 3KS0J 1JGVL 5BV7C 4I3SL 1YYMH 3ETBF 3S4SG 1RZFL 3KPNB 2WBJA 3NCYS 5CZXD 2NY4C 3O6ML 4HWBA 2IH3B 1BZ7A 4YPJA 1OVZA 4DUWA 5CUSH 1I8IA 1I7UA 4WW2A 2DQIH 5HDBE 3W5NA 2QHLA 2R2BA 3VFGH 1P4IL 1LEIA 4G6ML 5LKNA 2ZPKH 5I8OH 2BSSB 4OZFH 4TULH 3X13A 1QLRA 3NTCL 5B4MD 1KENL 1F6AA 1NLBL 2J8OA 3BMWA 2Q8BL 4P99A 4XHJD 4ZXBD 2YA1A 2NZ9C 3N9GH 4Y16B 3L3IB 3H9SD 5D1QC 3VMNA 2O61B 1FL6B 4ODUB 5H8DA 1U91A 2VE6B 5ETUA 1NBYA 2VXUH 5C0FB 3EYQC 3PDOB 1NKRA 4MNQA 2A0LD 4OF6A 2FGWL 2W65A 2BOBA 3JXAA 4M4PA 3RWEA 3ARTA 1T21A 4AEHL 3DRQB 1QFUH 4AH2B 3IJSB 1FGNH 1LK3L 5BRZA 4HKJA 3TBSA 3JWOC 4BQBA 3WL9B 3MV8B 4PJDB 4GLRH 4AYFA 5DUMH 1RUAH 1KUMA 4CDGC 1XZ0A 1MI5B 4IRSA 3QDMA 1QSZA 3MACH 1WC7B 2AK1L 3VWJD 3RZCB 4S1RL 3TH4T 4D0CA 3B9KC 5DC4B 4Y4FB 3WNNA 1HE7A 2C5DC 2AJYH 5HHNB 3RWIB 3U9UB 5MP6L 4RQQB 4OUUB 2CO7B 2CUHA 3BOVA 3F12B 1B2WH 2ATKB 2CD0A 3QEGH 3PWNB 2EEBA 2IFGA 4P9ML 3U2SB 1IBGL 1RV6X 4NJAL 4JQVC 5EBLA 5IK3A 1J87A 3BJLA 4HMEA 2XOTA 4BSJA 3F7PC 5B3JE 3CLFL 5B4MC 3NOIA 5E8DH 1A6WL 2XNAA 4S2SA 4LCYA 1WVZA 3FB5A 3T65B 3MUHL 2J4WH 3TIDB 2MNUA 5C0AB 3EZ8A 1QA9A 2XY2A 5F3BA 2OTWB 2FO4B 3RGVA 1S9WB 5K9KB 3O4OB 2B4CH 4KMQA 1IL1B 4CJ1A 3L3GA 4PJ8B 4OLXL 3PWJB 2A0LC 3V4PH 1Z3GH 1ZHLB 2NW2A 2NY6B 4Z0XB 1U8LA 2DLFL 4L4TB 4L8SA 5E2TH 3FB6A 4P23D 3GJFA 2BVOB 1NCCH 3VXNB 1I9IH 5FM5M 3FO1B 3Q5OA 3RVXD 2YS4A 2O5ZH 5E2UL 4ERSH 1QEWA 1E27B 3QNYA 1TQBC 2V5TA 4ZUTA 1W72H 2VKWA 3QUKA 2I5YH 4Y1AB 1QBLH 4APQB 5IM7A 3QXTA 2XZQH 1LILA 1K8DA 3WS3A 3UBXB 1IM3A 4LCIL 4P2RA 5E24E 4PP2B 1I85C 1OSPL 3WLWC 4HX1A 3WJJA 4GS7C 3ECBB 3AB0B 1SY6H 2NTFA 4EBQL 5D2LA 4UV4L 1MWAH 3QQ9D 4G5ZH 4NN6B 4U1LB 4OIIH 2W92A 4H5SA 4RFOH 3ROOB 2VUYA 5HDLA 3KS0H 5C3LD 2VLMD 3PE9A 4LSDA 1YEEL 2JJWA 3DX7A 1U8QA 2CDEA 2Z4QB 4QOKD 4YDIH 1RULH 4FQQA 1BVZA 1HHHB 5E8NA 4J1UA 1G7QB 3M8OH 1S5HB 1F2XK 4S1QL 3UJJH 2KZ1B 3HE6A 3T8XB 4UV7L 2H32H 3QXUA 4EDWH 2EKSB 3L5WA 1I1AC 4KK5C 1A7RL 3N85L 4J3TA 3KYOB 4RNRB 1V3LA 3E6HA 4G3YL 4P5MB 3AS2A 3CLEL 3AC0A 1VGKB 4X7CC 3RVWD 5KS9F 3QUML 2DQTL 3MYJB 4LSPL 2ZUYA 1CK0H 4KI5C 4HUWA 1ORSA 4Q9RL 5JQ6L 4PPTA 4R4ND 1LVEA 1NC2D 2YUZA 2B5IB 2RR3A 1FAIH 4CN4A 1ZKAA 2CK2A 4YHYB 5D1ZC 4U0QB 3Q48A 3QFJD 2CRIA 1EO8L 4HCRL 4G7VH 4DWHA 4PJ5B 1C8PA 1DANT 3WNOA 5HD8C 3DMMB 2EC9T 1YEHL 4HHAA 3VI4E 4WIQA 5JPNB 4P4KA 3SKMB 3IDGB 4UDTA 4X0KA 2VRAA 1KPVA 4RGMB 1SBSH 1J8HD 1KLUA 1KGCE 3AXLA 4YIQB 3KAAA 3QQ9C 5E70A 2A9ML 5C09D 1BZQK 1W0WA 5F7DA 1NFDB 4C59B 2VLRA 5D7SH 5EZOL 3B9DA 3VFMA 1ULVA 3BYTA 5I16A 1C12A 1EEYA 5D1XB 2W07A 3O2WL 3RUGF 2NY3B 2FO1A 1EK3A 2BZDA 3FCTA 2PW1B 3BIBX 5FYJU 2VQ1B 1MOEA 2YXFA 2VISA 2D03H 3BD4A 4RGNB 3ARXA 5L2KA 4ZFOL 2AV1A 4ONHB 2BDNH 5DRWA 3GKZA 2XKNA 3EYVA 4PTUB 3V4VL 3MZTA 1JWSA 1EPFA 3V2AR 3EO9H 1J7VR 5FUCE 4A6YH 3BQUB 3RY6A 4Q2ZB 3N0PB 3BGFB 3IXTB 4M6MH 5FV2A 1OAUL 1DL7L 4YHZL 5FHAH 3DETD 5I1AB 1HXYB 4RISL 3TYGL 5GS1B 3BT2L 4OI7A 3JVGC 4YX2L 1GGTA 5JDJA 4MMZC 2WV3A 1QZ1A 3TVMB 1YMME 4P2OC 1UM5L 12E8H 2AKRB 1D6VH 5JIHA 1WZMA 3SQOH 2YBRA 3MODL 5FUOH 3UTSE 3MRIA 4W70A 4LHUB 2DQFA 2B7DT 1G7HB 3MRHA 4UQ3B 3SDAD 2Q76B 1QNZL 5FECB 4XAKD 4TSBL 4K9EL 3PL6A 3GSXA 4PUBL 3I02B 4RRPG 3DECA 3OXRB 1RFDH 3ULVH 2K7PA 4ONGL 3VG0L 3ALWA 3B3IA 1FYTA 3DBXA 5CJXC 5EZLB 1MFDL 4WTWA 1JYVA 3QO0A 4BKLA 4I1NB 3VFOA 4P2QB 3C9NB 1RJLA 1KCSL 5F88B 3CXDH 3DIFA 4X6FB 5GISH 5BV7B 1DBBL 4BH8B 2CQVA 1MHCA 1WIPA 5LQBH 1HSAA 1I75A 1BAFL 4QRRE 1HYSD 3PWPD 3D9AL 4QHKJ 2Q7YA 5JA8B 3PWUA 1DBJL 4HAFA 1IT9H 4X6DA 5EC1A 4Y2DC 5ADPH 4JFEB 1IGFL 4XB7A 1O7SA 1A0QH 3P4MA 3MOQA 2VXVH 4XP6H 4FQHA 2IBZX 3QAZC 4N8CH 1YEGL 3FO2A 3RX5A 1I8KB 5DQ9A 5TDPA 3S9DB 1ORQA 2VZTA 3F65A 3ZDXE 5ID0A 5CWSB 4JCLA 4JN2B 4JO2H 1LD9B 1CT8A 4PRAA 4UILH 3SCMC 1A21A 1I1RA 3B9AA 5FA3A 2AJSH 5DMYA 5CP3A 1J1OL 2HJLA 4Q9QL 5EUOF 2NY5C 4HBCL 2AGJH 2GY5A 5SX4I 4FQLL 2HT4D 2OSLA 3SDAC 4L9LC 4K3HA 4I4WA 4PJDE 3UBXI 5GSRB 3VFSA 4XXCC 1NEZB 4HIXH 3O2DA 1MI5E 3FQNB 5A2LH 5MERA 5JW4Q 1RJYB 1KJ2H 3BXNA 1V7ML 3P77A 5KN5A 2ARJQ 4XBEL 4PRPD 4M48L 5GGVL 4BUGA 4ZUUB 4XPAL 4OD1H 1F4WL 5DEGB 1MRDL 5EZIH 5JO5A 5I8CB 4JG0H 1CU4H 3DX8A 3ARED 3FB8B 1AJ7L 2X4SB 5INDA 3O6LL 4JFHD 3GKWL 5TE7H 1HYSC 2DQEL 4CU8A 3RWFA 1U8OB 1RUQH 3ZKXC 5CGTA 3STBA 1NGQL 4C56A 1YNKH 4RMSA 5FB8B 5EIIB 1OSZB 3WFEH 5CJOL 3CDYA 1T5WA 3O3BA 4OIBA 4H1LB 4N5UA 3HR5A 5C0AE 2AS5M 1JI1A 4BFEA 1WV7T 4OGXH 3F5WA 3OG6B 4H0HB 4ZXBB 3V0WL 4MXVE 4GG6F 1OB1B 1JGVH 1OHQA 2P24A 2Z91B 2Z8VC 4I3SH 2I9LB 5T1KA 3TNMA 3TO4C 4BSWA 2CKNA 3H9SB 4XCEA 4PP1D 5IUSA 5C08D 3ZSTA 1UQSA 3O6MH 4LVHB 4IOIB 3UPRA 3ARBC 1WUNT 2MCPL 1A6AB 5EU5B 3H0TA 5J56B 2HT4C 5F7WC 1T80A 2GFBA 1P4IH 3QDJA 3RP1A 4G6MH 3U4EB 1U8KA 4ORZC 5IHZA 1OTTD 2GI7A 3L3DA 5IW3A 1YC8A 4DN4H 3NTCH 1ACYL 1KENH 3V7AG 4Y1AE 1NLBH 1YN7A 4YK4C 5DHYB 3MREB 4IOSD 4OI9A 2IG2L 1L6XA 1UGNA 5D7IF 4FFZL 4TSCL 1IVLA 2PCPA 3S37X 1W2KT 1J86A 4G8IB 1WITA 3SDXA 4D0DA 3VWJB 5MEND 1RIHL 4EDXB 1DQJB 3CVHB 4WNQA 2AEPL 3GHEL 2FGWH 2X70B 2PO6D 2NY0D 4WWKD 3VGDA 1AIFB 3KPLB 4NZDA 1AQKL 1MFEL 2ADIA 3JV0A 4OLYL 4JO3L 4AEHH 1P9MA 5DMJB 1LK3H 2W0LA 4XC3L 3BD3A 3D69A 3V0VB 4BUHA 2R39A 1RD6A 3U46A 3ES6A 1UACL 2OJEA 1F13A 4L8CA 4LCWE 1Z9LA 2AK1H 3VDAA 3T0EE 4GAFB 4S1RH 1X4XA 4XNMA 2IAMA 4U1KA 4PP1C 3ULVF 1U0QA 5DJ0B 2LTQC 2FBOJ 5I71C 4Y5XB 1AXIB 1T03L 4LL9A 1MVUA 1VFOA 3OX8A 1DQTA 5F7FA 3VXTB 3H2WA 1XF2B 4P9MH 1FPTL 5DK3A 1IBGH 1HQ4A 3M17B 4NJAH 1OTTC 1WBYA 4H8WC 4P23B 4DW2L 1II4E 4I2XA 3FQTB 3CLFH 4PJ5E 1JP5A 3D1MC 1T83A 1A6WH 4OFPA 5GRVL 1B0GB 4LK4A 3LOWA 4HXAL 3PG2A 2FZ3A 1MUJB 5IQ9B 4HIIA 1UA6L 1YMHA 3K46A 1A2YA 1U3YA 3U30C 3O9WA 4PJEA 1DUZB 1OL0A 1IGYA 1FCGA 3FQUB 5FA4B 2APXA 4WY7L 3QH3B 5HVGB 3RWJA 4OLXH 1N8ZA 3CDCA 4MA7L 5I30L 1KIPB 1FC1A 2PO6C 1GGYA 2NY0C 4WWKC 4P57B 5IIEB 2DLFH 3WHE1 4MZ3A 4YFLF 5T5NF 4IMLB 4Z5RB 4G6JL 5E2UH 3G5YB 1NUFA 1ZT1A 5JIIA 1LO4L 5GRVK 1EEZA 2RGSA 3MLZL 3ILPA 5INCA 4QOKB 5C0BA 3INUL 4HKXB 5F1SA 2E7LC 4I0PA 5FKAA 3UBXG 5KSBF 5IB1B 3WNKA 4LBEA 2EXWD 1FO0B 1ZGLA 3P2TA 3HC0A 1G6RL 4LCIH 1T7ZA 2AW2A 2Z35A 1I3VA 3QEQD 3VRLF 4F8TA 3ARZA 2Z92A 2V7HB 3H9HA 4N0YL 1OSPH 1XF1A 1G0YR 1QPXA 3RIFF 2ZSVA 4WFGE 3SY0A 4UV4H 5J57B 4WHYG 1WQVT 5F44A 3OV6A 5GGSA 2WQ8A 3W11D 4PD4K 3ARFD 3C2AL 1YEEH 4DKEL 1XIWC 2JJSC 2DL2A 1NC2B 1P7KA 1UYWL 4X5WB 4ODXB 4X4ME 4U1SB 4L9DA 5CIPB 1S78C 1IAMA 5JDSA 1ZSDB 3QFJB 2CUMA 3HPJB 3OKOA 4A2LA 4S1QH 4OTXL 3CSYA 4ZFGL 4R4BB 4UV7H 4W4OC 5D7JD 1A7RH 4DKFL 4F2MA 3N85H 2YD7A 4YQXL 3FFDA 4AQ1B 1L0YA 4G3YH 3CLEH 2BOCB 3QUMH 4QHUB 2DQTH 4RDQF 1J8HB 2YSSB 4LSPH 1B4JL 4Q9RH 1FFOA 5LGJA 2OBGA 4BK4A 3E6FA 1IAOB 4MAYD 4P2QE 5C09B 3BAEL 1NBQA 4IIQB 4HZAA 3BPOC 1KELL 1EO8H 4JFYA 2NX5D 4HCRH 2I07B 1Q9WA 3DWTA 1W72A 1U8JB 3GSVA 3D87B 1T1ZB 1MRFL 4WRLA 3ARSA 3SKOA 4AM0B 3T1FA 1WIOA 1YEHH 4IS6B 3D25A 3MV7A 1OF2B 2BVEA 3GMMB 4LASL 4JFEE 3GO1L 3E1F1 4Z8FL 5EO0A 4J4PD 4R8WL 3OBAA 1L7IL 4OZGF 1CQKA 1MWAA 4ESKA 2A9MH 3LS5L 4OZIE 5DSCB 1Y18B 1F5WA 4HWZB 3W11C 2DB8A 3WDHA 1N6QL 3PIQA 1UWGL 5EZOH 2HFEA 1NPUA 2PN5A 5E1AB 4Z7VA 1A8JH 4U0RB 2WBJD 3O2WH 2GSIB 4JGJA 2G2RA 1FNFA 2CH8A 1CGVA 5DJYB 4F7CA 2FH8A 5GS3A 1QFOA 4JVWA 5DJCA 4M7ZB 3GRWL 4U1MB 6FABL 1IKNC 4NQCD 2DMCA 1JMZA 1CLOL 1JZ4A 4YDVA 4XRCA 3KPPB 5IOPB 3V4VH 1CTNA 5IBTL 1MLBA 3VGFA 1OAKL 5FYJL 2CDFB 4NDMA 1IKFL 3D48R 2P1YA 5CJBA 2GTWA 4YDLC 1OAUH 1DL7H 1I3RB 4N0CC 4PJIB 4YHZH 1MLCB 3RWHA 3TYGH 4RISH 1Q0XL 4F7MA 4YX2H 3MA7A 1JHTB 4ELMA 1XGPA 4F58L 1S9KC 4QXUH 2HKFL 4MAUL 1UM5H 1ZT7B 2VABA 3MODH 1BF8A 1CLZL 4OLEA 3OKNB 3C6LC 2GJ6E 4LHUG 4BH7B 1FZJB 4MHHI 2AXHA 3K4AA 2LU4A 4ZG1A 1TNNA 3NBNA 1JI2A 5ADOL 1S5IL 4LIQL 1QNZH 1E4WL 2IADB 3PWPB 1YN6A 4FQ1L 3IDMA 4TSBH 4K9EH 3NZ8A 4QY8B 4PUBH 3ZKXB 1N3NB 4LLWB 4V2CB 1ZLVK 1QFWH 1I8MA 4JHWL 5FO8B 5C0CA 1MCBA 3QEUB 4IRSD 1HKLL 4WGWB 4ONGH 3VG0H 3QDMD 3CC5B 1DLHB 1MJ8L 4JQXA 3TH2T 1MFDH 1P84J 3WUZA 5DTFB 1QQDB 4QTHB 2GW5A 2A73B 3VI3E 1OY3B 1JUFA 3Q6FA 1KCSH 1TJGL 2WBJC 2BY2A 3DNKA 5ID1B 3BPNB 3T4YA 1DBBH 3B2UD 4WW2C 3IKCB 2BNRA 3JWDC 5IJVB 4G8EA 1BAFH 3V6BR 1GGBL 3H3BC 2ITCA 1CGWA 3OXSA 3DI2B 4UIMA 3D9AH 1T22A 1CIUA 5FM4A 1DBJH 4ZO6A 1ZA3B 4K07A 4J2XA 2R1WA 4X4XB 1IGFH 4HK3J 3VXPA 3QHZL 4Z7UF 4CN1A 2C1PA 4YNYA 5JTWA 4A6YA 5F6HI 4YK4B 2WQRA 1AD0A 5FHBL 4N5EC 1YEGH 4NN5C 3ARGD 5KVEH 4PRPB 2QJDA 4XX1G 4U1IB 3F8UB 1MELA 5IBUB 4LSUL 4JREB 1KYOJ 4GAYB 1J1OH 3AREB 2X9YA 4X6EB 4Q9QH 2ADFL 3KG5A 4HBCH 4JY4B 1XH3A 3KLHD 4FQLH 1UFUA 5D93B 3HG1E 2YN5A 4HFWB 2JTDA 3QB7C 3X3GL 3QXWA 4ONFL 1QSEA 5JW5B 3GMLB 3CDGB 3FAWA 4U33A 2KH2B 1OP3H 4IRSC 1DFBL 2ERJC 1V7MH 2VITA 4XBEH 1VEOA 1ZLUH 3WNMA 2AERT 4M48H 5GGVH 4XPAH 4P2RD 1F4WH 1UCBL 2EIZA 1MRDH 4JHAL 4NQED 2H8PA 4QRTB 1PYWB 1KJVA 3S35X 3PP4L 1AJ7H 3B2UC 4FS0A 1QVOA 1PDKA 1IZJA 3O6LH 1I1FA 5E8PB 3NCCB 3ULUD 5C08B 2O5YL 2LTQB 3RRQA 5B39A 3GKWH 2DQEH 2F8OA 4N0UE 3MRKB 2DM7A 2BHUA 3KPRD 4MB5A 3MLTB 3TT3L 1NGQH 3MRQB 4M1GL 2Z93B 3TCXA 5J06A 1X44A 3CXHJ 3GIVA 5DRZA 2CDGB 4PJ7E 4E41E 1RAMA 3QNZB 4RFEB 3HAEB 4NWTL 1PJ9A 1EHLL 1HXMB 3DVGA 2OZ4L 4X9BA 3HE6D 3O11A 4KTDL 3SE9L 2PYFB 1RU9L 3V0WH 4PR5B 4ZNEA 5C0JA 4NIKB 3RGVC 5JA9A 4K2UL 2QQLL 4JKMA 1H5BB 5AUMA 1Z5LB 4MNGB 5DJXA 4CADB 2DRUA 4PGBB 1LP9B 5FYKD 4UTBL 5MENB 4L8SC 2MCPH 3BSZL 2BFVL 1ZHBA 4LF3B 1L7TL 2X42A 4NKMA 2PTUA 3KLHC 1YQVL 1UZ8A 3RBSA 2VLME 2PO6B 2NY0B 4WWKB 2IBZY 3RIAK 4JGMA 3FQWA 1CTOA 2EDYA 4QOKE 3LKOB 1A3LL 3ARVA 1ACYH 1DBKH 2EIEA 2IPKA 4HK3N 5DZNA 4I9WD 3RZWA 5KSBA 4TUJA 2ZG2A 1FNEB 4TTGA 4MGXA 4FFZH 4TSCH 1CGUA 4U1HA 1PKQA 4P4KD 3N50A 4ODTL 4HGWB 2JB6A 3MLXL 1NMAL 2OQJB 1RIHH 3WJJC 5BZDA 2GT9B 1N6UA 2AEPH 1FJ1B 1UG9A 3GHEH 5GJSH 3ULUC 4UIKL 1KPUB 2P43B 7CGTA 3TNNB 2I26N 4FQCL 1BOYA 3LY6A 3QCTL 4MB3A 2CGRL 1QBBA 4WU5A 2WIIA 4U6HB 15C8L 1MFEH 1AQKH 2EDWA 4JHZA 4OLYH 3IJYB 4IDJL 4JO3H 1HHJB 5FV1L 4QRUB 2XN9D 3QFJE 3QA3A 2VLKA 5K93A 3BP6A 1GJIA 4NRYA 1UT9A 4LCUA 4MHHG 4HLJA 4V1DE 2OR7A 3HE6C 1UACH 3BX7C 2D3VA 3JUZA 5JLZA 3CZJA 4QT5B 2J8UA 3PV6A 3LQZB 3VI4F 3L6FB 3B9EA 4H20L 1J8HE 5IR1B 2DQGL 1Z6JT 1NLDL 1BOGB 3RWDB 2W1NA 5JHLL 2C3VA 3PHOA 5JOFB 1C5CL 4WU7B 1RY7B 3GSWA 5C09E 3QFDA 1F6LL 2A83B 3WKNA 2VZUA 1LO5A 4U49A 1OP9A 1R0AL 1GC1L 4DK6A 4DW2H 5DJAA 4MD4B 4ZFZA 4NCC1 3QDAA 1RHHA 1GGCL 4GKOA 4RAVB 4ZUWB 4PRBB 4HXAH 5EZJB 3BPOB 3UX9B 4P4KC 1EIBA 3IDNA 43C9A 4TNVF 4YDJA 5IV2A 5L6YL 4WTZG 5SWSD 2F58L 3WE6A 1ZGLP 5GS0H 2QLVB 4WY7H 5TE4L 3HZYB 2X89A 1CXLA 4K3JL 4MA7H 3QEQB 3T77B 1A7QL 5I30H 1X6LA 3BW9A 2G5RA 1A1OA 3ZLQC 1AH1A 1VDGA 3ARQA 3LN5A 2ADJA 2VDPL 4K71C 3MV9D 1OGTB 3EYOB 3DHJA 4G6JH 2YD2A 3O3EB 5JW4R 1TZGL 3MRRA 2DQJL 1IM9A 1LO4H 4PJCA 1OAYL 3ARFB 4PRNB 1WWWX 1HQRB 2X4TB 2IJ0C 4XWGH 1I3UA 2Y9RT 1LEKB 1UENA 3NA9L 1QSFE 5F7UA 1G6RH 4IOFD 1A9EA 4O2EA 5HGGS 2B1HL 3TC9A 3RNQA 5CMAB 5D7JB 4N0YH 1XGRA 3RJQB 4ZOBA 5HYQA 5I17A 1IQWL 1IMHC 1XFPA 2LABA 1ZVYA 3RY6C 4PJIE 3FKUS 1X5HA 1DDHA 4JFOB 4R3SB 2VZOA 4XVUD 4U3CA 3BI9X 2A74A 1FNSL 3C2AH 3ZO0A 4OFVA 4DKEH 2XIDA 1IC4L 3RWGA 4MAYB 3CIQA 5DVNA 1UYWH 2DLEA 5FKPA 4LLDB 1NAKL 2CKBL 4FQXD 3NFNA 4LPCA 5IW1A 5F72S 2QKIA 2NX5B 3LKRB 4OTXH 4ZFGH 3LPFA 4UAOB 1KN2H 3LKNA 4HS6A 4DKFH 4YQXH 43CAB 5F7HA 1GH7A 2J5LB 2HLAA 4GAGL 1HNFA 3E2HC 3HI5L 1KEML 5CS7A 1OM3L 5IEKB 3NABL 5H37H 2HP4A 1RK0A 1H3GA 3V6FB 3T0AA 3MJGX 1B4JH 1MEXL 2ATPA 5EU3A 4OKVA 2FYYB 1LDSA 1VHPA 5IMLA 4ZPVA 1CN4A 5DVKA 3BAEH 3QYCA 4HIEA 3JBG7 1BFOB 2WNGA 1KELH 5CJQH 5FUZL 1P1ZB 4X5XA 1NFIA 3IRZA 3ZDXF 5I1LA 3W5MA 1MRFH 2WBJB 4L29B 4ZTPL 3VMOA 3MPCA 2AK4D 4XCNB 1U8HA 1ND0B 5IQ7L 3S5LA 2EXYC 4WW2B 4LASH 1H3XA 5EO9B 1XEDA 1WFOA 4OCLC 4Z8FH 1MQKL 1LEIB 3MRJA 4NQCB 4XMPL 3CFJA 2JCCB 1XGQA 4FNLL 3TT1L 2LU7A 1AGEA 4R8WH 1L7IH 4ISVA 4WV1A 5I75B 3ZYOA 3LS5H 2R56L 3VJ6A 3SGEI 3CUPA 1JV5A 2FSEA 1N6QH 4CMMA 1UWGH 4RX4A 1TZIA 4ZFFA 3BH9B 5T1KD 4LVNB 4GQPH 1MCNA 3JTTA 4U1JB 3BDYL 3VXQB 3ARDD 3QQNA 3C8KB 4JFHE 2R0ZL 3GRWH 1EXUB 3BKYL 6FABH 4PJ9A 4KRMB 2GTZB 2AI0L 3OAYK 1CLOH 1H3WM 2W91A 1T21B 3FFCE 1DQDL 3MC0A 5BJTA 3QUMA 1ZLVH 2HVKA 3TBSB 5IBTH 4DK3A 4I5BB 4RFNB 3UMTA 1OAKH 1A7PL 4Z76A 4KKLC 1EGJA 1M71B 1IKFH 5CD3B 4F3FB 2VL4A 1XZ0B 4IRSB 3MROA 4PTTB 5JHDD 2ERJB 3QDMB 4ZUVB 4NM4H 1Q0XH 1AP2B 2ITDA 1NAMB 5C08E 4F58H 2HKFH 4MAUH 1JZ3A 1DVFD 1NCDL 2X6MA 1K3ZA 3EGSA 4EUPH 1CLZH 1KB9J 1GRWA 5JIKA 3WXVL 1J88A 2PETA 2ED9A 4HLZH 3O6FA 5DHVH 5ADOH 4LIQH 1E4WH 5MEOA 4FQ1H 3M1BA 4HGMA 4LCCA 5IK3B 1WBXA 4X6CB 5TE6L 1MQ8A 3DO7A 4G8FA 1GZPB 4KKCD 4M7JL 4JHWH 1UJ3B 2XNAB 4WUUD 5C0GA 1HKLH 2D0FA 2EH8L 4LCYB 1BLNA 4PLOB 3BP4A 1CFTA 1CICA 1MJ8H 2ZUQC 3VFPA 1LP9E 1TJGH 5F3BB 5MENE 3WIFA 3ARGB 4P4RA 3VFWA 2X4PA 3FRUA 3ARUA 3MR9A 5J11C 4KC3B 2E6QA 2BSRB 4NO3A 5ALCL 1GGBH 2JKXA 3MRNA 4L8SB 5E6ZA 3FB6B 3GJFB 1L9MA 2HLFD 5EUKB 1EZVY 2OCFD 3G08A 4HUVA 3TH3T 3GSQB 3HRZA 3QHZH 3H9ZA 1IGCL 1A6ZA 1FV1A 2R0LL 3IAQA 1J8KA 4WENB 1O0VA 3QUKB 3FN0L 2IQAA 3O9WD 1QP1A 1MAJA 4X9GA 4QYOB 5DD6A 3FT3A 3NA4A 4RRPA 5IBUG 3WS3B 2VXSL 1TVHA 2XA8L 5KVGL 3UO1L 1IM3B 3BEVA 4P2RB 1HINL 4LSUH 3ZDZE 4NQEB 4N90D 3EO1B 5K9QI 1FCCA 2X7LB 4N0RA 2ADFH 4RMVA 1BM3L 4XP1L 4GRMA 3HC3L 5FCUL 5D2LB 3KPQB 3SDCA 1XGTB 1YY8A 1P9MC 1DJSA 3W9EA 1JYWA 4P5TA 1NC4A 4ZS7H 3X3GH 1Z2KA 4ONFH 5ALBL 3KPRB 4KKCC 1Y6KR 1AGCB 4XHQA 1TTGA 5TF1L 1A1NA 3FO0L 5C0BD 4QNPF 1DFBH 2X4RB 2QQQA 1AD9A 3KNBB 2GCYB 3QPXL 2H9GB 2PXYD 4AEEA 1JWUB 1PY9A 2IAMC 3B5GA 1F90L 4NGHH 3U7YL 1UCBH 3HE6B 2DLIA 4JHAH 2DD8L 2DAVA 3P0YL 3TJEL 3F7QA 1A64A 3PP4H 3QXVA 3NFPA 3QIWA 4KH2A 4HK0A 2DJ4A 2EDRA 4QLRA 3QEHB 1S7XB 2EDDA 2O5YH 4HUKB 5EIQA 3BZ4B 3TZVA 2AJXL 5B8CB 1OD9A 1FZKB 5J4MA 3TT3H 3TIEA 3MRBA 4M1GH 2HLFC 1T83C 3MBEA 4LLQA 4X4YB 1YUHB 3BISA 3QQ3B 3MNWB 3REWB 1NGXB 4EI6A 3LDBB 2P8MA 4NPYB 4NWTH 4TPRL 1EHLH 5HI5D 4PRHD 2OZ4H 1VEMA 1G9NL 2JJTA 3A67L 4ZYKA 3O9WC 1MIEL 4KTDH 3SE9H 3SDDD 1RU9H 3X14A 4ZS6C 3KR3L 3SJVD 4K2UH 3BE1L 2QQLH 4LFHD 4MWFA 4P4KB 1FZMA 3QEQE 3DOSA 3OG4B 1WTGT 4P46A 4E0RA 1YYLL 1BD2D 5DVLA 4E42A 4OFYD 1IC5L 1JF1B 2BFVH 3BSZH 1L7TH 3KJ4C 5FXCH 1YQVH 5D9SA 1JHLL 3TP4A 5E6YA 4D8PB 3LN4A 1T7WA 5KSAD 4OV5A 3NIDE 5HYIA 4Z7QE 1TTFA 5ILTL 5F7DB 4YO0B 3GJEA 1E6JL 1A3LH 1K5NA 1MAMH 5LCVL 3H9YA 2XQBL 5GGRA 4LDOB 2Q6WA 2XN9B 3R06A 4JANB 4I0PC 4I18C 4KHXL 1LK2A 1NEUA 2E7CA 5FM5O 4C57C 1AKJD 3UTSA 4FN0A 2EO1A 3MV7D 4ODTH 1IGJA 1UB6B 5F9AC 5LJYH 5HPOA 3GSOB 3MLXH 1NMAH 1KF9B 4TOYL 3ME0A 2CRMA 3V0AC 2AV1B 2HT2D 4UIKH 2VUOA 2DIAA 3EFFB 4FQCH 3QCTH 3IFNL 2CGRH 2DICA 2C7UA 15C8H 5KANI 2F15A 3KPNA 3MRCB 4U7SA 3SKJL 1FFQA 1BP3B 2BJML 4IDJH 1AGBA 2IH3A 2Y7QA 4S1DD 2YRLA 2L0DA 5TQ0L 2QSCL 2GAZA 2ESVD 2WINB 2BSSA 2BXZA 3AY4C 2D7QA 1AC0A 4KRPD 3HE7A 3DUUB 4JAMA 3MFFA 1YNTB 3U1SL 2YZ8A 3QZWB 4H20H 4Y16A 5DYOB 2DQGH 2DQFB 4U7KA 5SWSB 1NLDH 4YHIA 1JPGB 1FL6A 3VGEA 2O61A 4ODUA 1ZLWK 5JHLH 1ZA6B 1C5CH 1KIRB 4MYWB 3P4LA 2VE6A 4MNHA 5C0FA 5KSAC 4MS8D 3ALXA 4OZIF 3PDOA 2P49B 1MHHA 1R0AH 1GC1H 3B3IB 2ZZUT 2C1OB 2HG5A 3MV9B 2WP3T 1RZKC 1GGCH 4G43B 3VCLA 4F37K 2CIIB 1UXWB 4PJGF 3SKUD 2VR4A 3DRQA 4AH2A 3IJSA 3DIFB 4PLJD 1FZOB 3B8YA 1FL5B 4WI4A 3QXDB 3SO3B 5L6YH 4PJDA 4NQCE 5H35B 3TBWB 2P8PB 2JCCE 4UNVA 2F58H 3H3KA 4O4YL 1OTUD 3I2CL 5DGRA 2RCSL 1MI5A 5TE4H 4CMHC 1P6FA 4W6YB 2HT2C 3D0LB 1YEKL 3PWUB 1WC7A 1S7WA 1A7QH 5EC1B 2CR3A 2E9IA 5C0CD 1DUYA 1T6WA 1YJDL 2VDPH 4Y4FA 4X99B 1FE8L 4P5KB 5HHNA 3RWIA 3QIBD 4S1DC 3U9UA 4JB9L 4OUUA 4FQHB 4Y5YC 5J1SC 4P2CG 5K9QG 1TZGH 2QADD 2DQJH 3WHXA 3PWNA 1OAYH 2CXGA 4GSDL 4MLIA 1S7UA 5HPMB 3U2SA 3BN9D 4JDVA 5BZWB 3EYFA 1T0NB 4XVTL 4BSVB 4KRPC 4FQXB 5LAXB 3BRGC 1HOCA 4FTVE 3NA9H 4JRXD 5DR5H 2HJLB 1AGDB 2YWZA 3OJMB 2B1HH 2QTEA 3TIDA 5C0AA 4I4WB 2HMIC 2K1MA 1N64L 3EJZD 4FXKB 5FYLE 1IQWH 2BVPB 2OTWA 2AXJA 2FO4A 1S9WA 5K9KA 1SEQL 1IL1A 4UTAL 4PJ8A 1X7QB 2RB8A 3NPSC 3PWJA 1FNSH 4JEGB 1ZHLA 4Z0XA 4CU6A 1IC4H 4EOWL 4F9LA 4L4TA 4PJFE 1NAKH 2CKBH 2BVOA 4PGEB 3RIAF 1JFQL 3FO1A 4KROC 4PLJC 1JNNL 1DN0B 1WT5A 1R6VA 1E27A 3DVFA 5F6IB 5T1LA 2BC4A 4R7NB 4G9DB 3HR6A 4X6CE 4XVSL 2VN7A 3DROB 3PNWB 2AK4B 4O58L 4GAGH 1HK6A 4Y1AA 1H8OA 3HI5H 4APQA 1KEMH 3VH8B 1OM3H 1NANH 4D9QD 3NABH 3EZJB 1RZIA 3UBXA 3UTPE 3O3BB 2X9WA 3ULVD 3MLYL 1BEYL 4JQXC 1MH5B 4M02A 3ECBA 2CLRB 2D7PA 5DD0L 1QR4A 5D2NE 4U1LA 5FUZH 3X3FL 3BN9C 5EORL 1RI8A 3R8QA 3ROOA 2VMFA 4XCEB 5DJDB 3I6GB 5EFIB 3QIUD 4ZTPH 3ARDB 3S7GA 1CGTA 1CD9B 4HFUL 5IQ7H 3PHQB 2VOTA 1HHHA 1I4FB 3H0TB 2AAVA 4PREA 1G7QA 4GFTB 1MQKH 4L3AA 2UWEE 3BP7A 5IF0A 3T8XA 4XMPH 1JPSL 1W8NA 4FNLH 5ERWA 1M6OA 3TT1H 2EKSA 3BGMB 3K80A 3KYOA 4RNRA 2R56H 3DV6A 4LCWA 4P5MA 5HTSA 1R3IL 4J23A 4YBHA 4MLSA 3VXSE 2EDKA 3MYJA 3RVTD 5AAMA 2EEDA 4NQEE 3HKFA 4C4KO 5F1OB 1CXFA 3BDYH 5JHDB 5KANG 5FYLL 5AZEL 3S37L 3NCBB 1KXQE 4WNQB 2R0ZH 5GZOD 3D39D 3BKYH 1DVFB 2R0WL 4MB4A 3KPRE 2GK0B 4WHDA 4PJ5A 2OL3B 2ADIB 3KLDA 1HCFX 1P4LB 1DQDH 3S34L 1NQBA 5JPNA 1HH9B 3SKMA 2DMBA 2P5WD 3IDGA 5CJ8A 2FB4L 4PJ7F 3CFDB 3KXFD 4PRIE 1A7PH 3D69B 5JQHC 4P59L 8FABB 3G5VA 5AEAA 4WUUB 3I75B 1GL4B 4YIQA 1JRHI 5GZNC 1F6FB 4L8CB 1X6NA 1KB5B 1U58A 5HVWA 1A7BA 5KS9B 4U1KB 5MHSE 1X5YA 1YPZF 2DTSA 3N1GC 1Q9KB 4KK8D 2YD4A 1KCUL 4PV9B 1NCDH 2SEBB 3WXVH 3DTXB 3L5XL 5D1XA 5HYJE 1JGLL 4HKZB 4LSQH 2VLLA 4MCYB 5E4EB 5C86A 1Q9OB 2PW1A 5TE6H 4OZFB 2VQ1A 5E5UB 4GOSA 4I9WE 4Q97A 4M7JH 5CEYB 4JKKA 2W60B 1P7QD 1T0MA 1RUKL 4ONHA 2EH8H 3FRPA 4OCWL 1IE5A 4PTUA 5IHBA 3S97C 3UC0L 3O9WB 1IGYB 5JXEA 3BQUA 5K9JL 3THML 5I76B 1D7FA 5ESAA 4Q2ZA 5HI3C 5K59F 5EC2B 1N8ZB 5I1AA 1UH4A 1HXYA 2IAND 5GS1A 3GRWA 3Q3GB 5ALCH 4P9HH 3TVMA 4ZAKD 4MQ7B 2X10A 3WO4C 1CVRA 5L8KB 2AKRA 4X4MA 2XN9E 5J8OA 3RUGB 1T2JA 4EIZC 2XYCA 3DURA 4FHBD 1MHPL 2YC1B 4M5YL 1IGCH 4AIZB 1G7HA 3P4NA 2R0LH 4UQ3A 5A1AA 2Q76A 5FECA 5I1EH 5C0BB 2Z8SA 4XTRD 3FN0H 3I02A 1XCQB 4WUKL 4YFDB 5FKAB 3WEXA 5IMKB 2A6IB 4I18B 3ELAT 5AWNL 2ZP0T 2WANA 3HMXA 2PXYB 2VXSH 5KVGH 1ZGLB 3UO1H 3HC0B 4AG4L 1EH9A 2Z35B 1HINH 5GRUL 4NZJA 4KK8C 2Z92B 5CHNB 3MCKB 1CDIA 4P2QA 4XP1H 3C9NA 2JLLA 2VQTA 3HC3H 4D0BB 5FCUH 3SY0B 4X6FA 4BQ6A 1I7ZB 3HB3C 4L4VD 3DUHA 4BH8A 5I18L 1R5IB 5CSGA 4FP8L 4K7FB 5ALBH 2C4XA 2AP2A 2NY2D 5TF1H 4F80A 1S9VB 3FO0H 5JDSB 4QRPD 3QPXH 1G7PB 2A2QT 4XCFH 5TH2B 3OKOB 3U7YH 1F90H 4JFEA 2A6JB 4PRHB 3GSRB 4KY1L 1JZ8A 2VDRL 2DD8H 3SDDB 3P0YH 3TJEH 3GBML 1TQCC 2X1QA 3SJVB 2FEDC 25C8L 2EC8A 3CSBA 4OZIA 1I8KA 1XR8B 2BHZA 1P5UA 4JG1L 5CWSA 1BD2B 4JN2A 2AJXH 4NZTL 1LD9A 1DN2A 3MV9E 5LGJB 3PGDB 4A6YL 4EZMA 4YAQB 4Y88A 5KSAB 1FFNB 3QDGD 5D8JL 5FOBA 5EH1A 4TPRH 1Q9WB 4XTRC 5GSRA 5L8LB 3A67H 1MIEH 3G5XB 1NEZA 3I3EA 2OJZL 3SKOB 1U8IB 2XY1A 3FQNA 3KR3H 2GEEA 1Z0NA 1AKJB 1PW3A 3HZKB 1D5XB 3BE1H 3L3OB 2BVTA 3MV7B 1K3IA 1B0WA 3C5ZD 5CKAA 2A77L 1Q1JL 5C0IB 5DJ6B 1YYLH 1DQML 4ZUUA 1IC5H 4ZSOE 4CMHB 5BVPL 5DC9B 3RDTD 1JHLH 5DO2D 1MWAB 4LNRB 3FB8A 4IMKC 2X4SA 1IZKA 3WFZA 5ILTH 3EDFA 3V8CA 2R8SL 3PIQB 2F8VA 3L1OL 4HF5L 1E6JH 2NY2C 5LCVH 2EZ0D 1MNUL 2XQBH 1U8OA 3H8NA 1FL3B 3QHFL 2W9LA 4Y5YB 5EUOB 3LRSB 4KHXH 5FB8A 5EIIA 1OSZA 3ZYZA 2ESVB 3HS0B 4XAWH 4JQVA 3BKCL 5EOCL 3K1KC 4H1LA 1FG2A 5TGBB 3MGTB 4KRPB 2H32B 1MCOL 1OAQL 2XICA 1PX3A 3LAFA 4TOYH 1IARB 4ZXBA 3JV5A 4YDVB 1BWWA 1OB1A 2Z91A 4XRCB 2I9LA 3OKMA 3IFNH 4O02L 2DYPD 4XBGB 1NCUA 4WI9A 3SKJH 2BJMH 4RX4D 1LDPL 4D94A 3I9GL 5F7LB 4IOIA 2GTWB 4LGPB 5TQ0H 2E9BA 2YOCA 4AEFA 3NPSB 1M05B 4GUPB 2QSCH 4HUNB 1X5KA 3MA7B 3ISWA 1D6EB 1XGPB 5HHOE 2O26U 3LZFL 2AK4E 5DMIL 3U48A 1WFUA 3MGAA 4PJ9D 1N0XL 4WHCA 5DHYA 4CDHA 1HIML 3MREA 4HS8L 3U1SH 2ZCKL 1CDYA 2ZNXA 2APTA 1PSKL 1F4HA 2BK8A