4ZB8A

Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with oxidized glutathione.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
220
structure length
220
Chain Sequence
MSHGKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLDFQKGEHKAPEYLKVNPNGRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGPYYGQAAWFSVYHPEKVPSAIERYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFLLEGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 82
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zb8A01
1UA5A 4AGSA 5HR1A 4EDYA 3TJBA 5ELAA 1BQ7A 2CVDA 5D73A 4N30A 1NW2A 3A5WA 1PSQA 3GHAA 5DCHA 4IVFA 2GSQA 2HRFA 4IBPA 1K3YA 2X8HA 4OO4A 4NWYA 3F6FA 3HKRA 2CQ9A 5J5NA 1TOFA 3HCZA 1EEMA 3E0UA 5HFGA 1F6MC 2A4VA 4KE3A 3TJKA 3UL3A 4NXIA 1SKRB 3HA9A 5CRGA 4TR4A 1JLVA 3KD0A 3BCKA 1YEXA 5IOWA 4MJAA 1GUMA 3KP8A 2LTKA 3HY2A 1TW9A 2NPBA 4LL4B 3GKXA 4O92A 2GLRA 3FK8A 4ECIA 3L0HA 4GF0A 2B6MA 3UVHA 5DDLA 2QC7A 4V2MA 2GGTA 2C4JA 3KXOA 2XHFA 3L9UA 3C71A 3PGTA 3ZMLA 1I5GA 1LJRA 3H8QA 3K8NA 1G6YA 1T4YA 1M0UA 2JZRA 1M2AA 1EV9A 3F63A 5ECNB 3HZ4A 1GTBA 3KJYA 3LGCA 3PINA 4OFMA 1JFUA 2GQKA 4BVYA 2DBCA 2FCHA 2R2JA 2B5XA 2RIIA 4ZBAA 2R5GA 2MMZA 1F2EA 2VL2C 2FWFA 3TKSE 2AYTA 2OE1A 1XWGA 3F8UA 2H6YA 2XPEA 3GA4A 4JR4A 1XW5A 1WPIA 2PUKC 4F82A 3TJFA 5IOXA 5B7CA 2VLVA 1TU7A 4TRXA 2X64A 1XFLA 3DEXA 1A8LA 5CO3A 3WT1A 2KP1A 3TJGA 1BAYA 1TRVA 2NTOA 2VCQA 4BL7B 2OA7A 1TRSA 1WOUA 4KDXA 2OE0A 2YN1A 3EC3A 1U88A 1Y6EA 3Q18A 4K0NA 1GTUA 2G0FA 2DJJA 2MBSA 3WD6A 2V32A 5F07A 1OC3A 3D4TA 5GSTA 2H74A 2QKEA 4NAXA 4K7IA 4MF7A 4YAPA 1HNBA 5E59A 1FG4A 2MMNA 5AISA 3TKSA 3CSHA 3H93A 1Z7PA 1QXHA 4TR1B 2H1AA 3FRCA 1HD2A 1SD9A 1T1VA 2WZ9A 2C0FA 3EYTA 3PH9A 1JLWA 2PPTA 1B4QA 3TKPA 3LEFA 2L5OA 1GSYA 3GYKA 4TXVA 4P3YB 4HZ4A 4XS6A 1PL2A 1YEPA 3GKKA 1U87A 1U6TA 2V1MA 3L78A 5IQYA 3FR9A 2RUEA 2DJKA 2GTUA 3GX0A 2QGVA 4MZCA 2B7JA 4GQCA 1V9WA 2CZ2A 1R26A 3UBKA 1CQHA 5ECRB 1T00A 2HRKB 4XRAA 4IP1A 3S9FA 4L8EA 1OKDA 2CX3A 3GNJA 4GSTA 1X5DA 6GSUA 1MDKA 1PRXA 3ZRDA 3MSZA 1YF0A 3VFIA 4WETA 1GTIA 3UBLA 1NHOA 1A8YA 1KBNA 2EIQA 2KUCA 2CZ3A 4ML1A 4XS4B 3C7MA 5IO2A 1PX6A 5IMAA 3R3EA 4N10A 2K8VA 3D22A 2H75A 5DCGA 1T4ZA 1WE0A 4FH8A 4ECJA 4ZL7A 3A2VA 6GSSA 5ECPB 2H73A 1GULA 5A4WA 4RI6A 5ECIB 3EE2A 1GWCA 2H71A 5C00A 2YWIA 3IXRA 3TUEA 4WR4A 4POBA 2C3NA 2VD0A 2H70A 4E8EA 4X1UA 5EPFA 3TRPA 2VAFA 4ZXGA 2IFQB 1O8XA 4G0IA 1R5AA 2IN3A 3NOFA 1U3AA 1GLQA 3DGQA 4QQ7A 3D21A 1YQ1A 4IHUA 4HJMA 1J08A 4MH2A 3RHCA 4YAVA 2CX4A 6GSXA 2O8VB 2B5EA 2E0QA 4ZL8A 4MZBA 3WGXA 2FUG2 1K0MA 5AIVA 1WMJA 4EC0A 4LMVA 1XBSA 1A0FA 3UJ1A 2UZ8A 2QSIA 2JZTA 4FQUA 3IK9A 2MMOA 1NHYA 3QPMA 1XVQA 2OBKA 2AAWA 2JL4A 4WBRD 2J23A 4G9HA 4K7NA 5GZZB 1MTCA 4MF5A 13GSA 1DE2A 2B7KA 1A2JA 1GTAA 1TP9A 4HU9A 2R4VA 1PL1A 3LJRA 3ZREA 4BVXB 2DJ3A 3IRAA 4KSOA 3GURA 3W6GA 5G30A 2IL3A 2M46A 1XZOA 2LRTA 4G0KA 1AQVA 3CSIA 6GSTA 2MYGA 1G7OA 2YNXA 1A24A 4TN8A 4JU5A 1XPVA 4RQRA 4XTSA 4F0BA 3CRTA 2LSTA 1XWKA 1ML6A 3KMNA 2ZCTA 5ECOB 1H4OA 5IO0A 4NHZA 4WKWA 2EIOA 4K6XA 5CYYA 3E3EA 1PGTA 2EIRA 1FB6A 5DAKB 5FWGA 2IWTA 3RBTA 4XRDA 3AY8A 2F3MA 5ID2B 5DVBA 2HI7A 1OAZA 3Q6OA 1S3AA 2FWHA 1OE8A 1GSEA 4ZILA 2BTOT 1RW1A 1SU9A 2CVKA 2JSYA 2H66A 3MWHA 2TIRA 1TI3A 5DQYA 1ST9A 2DJ2A 3DKSA 3ZLPA 3D4MA 2LRNA 3FEUA 5ECSA 2B3SA 2OACA 3EINA 4GQFA 4CW9A 2VM2A 3NZNA 1MD4A 5IMVA 3EU4A 2C0EA 1SL0B 3ZL5A 2VD1A 4ZL9A 5EY6A 1E6BA 3BCIA 4K1FA 4V1Ap 5G2ZA 4J56E 1C72A 2ON5A 3CMIA 5A4VA 1XOAA 1SJZA 4V1Ag 1EP8A 1GSDA 1M7TA 5F0GA 1R7HA 2DSAA 1TJDA 3DRNA 5D8IA 4OO5A 2VLTA 1VF2A 1Y25A 4PNFA 3LG6A 4KGIA 4KDYA 2MMAA 5INYA 2HYXA 1OKTA 3NIVA 3IV4A 4GLTA 2NDOA 5D9VA 4ILFA 5FHIA 3GV1A 4TXOA 1A0RP 1E2YA 2YJ7A 1OC9B 1QGVA 2X8CA 3APQA 2GQLA 1PKZA 1AC1A 1N8JA 2LJRA 5F06A 4MCUA 4OD7A 1AQXA 1EWXA 2HXKA 2H30A 1URMA 4HU7A 5H5SA 2PMTA 2YJHA 2C80A 3ZVJA 3D5JA 1YDKA 4YH2A 3FR6A 1TKDB 1F9MA 2NBSA 2VCVA 3M0FA 3FY7A 2HRKA 4DEJA 4KDUA 3KGKA 3H1NA 2K9FA 3J7Yb 2CAIA 1IYIA 4KF9A 4MJCA 3HVXA 4MK3A 2FWEA 3HJPA 3EU3A 4MP4A 4XS4A 4L0UA 4POMA 3VWXA 4TOPA 1SK2A 5D9WA 5F05A 3GFKA 1JZWA 19GSA 1MD3A 1A23A 3W8SA 3IOSA 1SK0A 5CREA 1QFNA 4NHWA 5LD0A 2H0HA 1SL2B 3APSA 2YP6A 2H8LA 4N0ZA 2P5QA 1XWCA 1PA3A 4KCEA 2LKUA 1TTZA 3TB2A 4D73B 3D0ZA 4I97A 3HVSA 4FIWA 5AIXA 5IPHA 3GKNA 2ES7A 2VCTA 4LL1B 3QAVA 2K8SA 1OC8A 5DJLA 4MMMA 3ISOA 2P5RA 4LMWA 2LV3A 3F4RA 5COHA 2B1KA 4HEA2 1TK0B 1B4PA 1GNWA 5ELGA 3QCPA 2YCDA 3RDWA 4F0CA 2PGTA 1ERVA 2KOKA 4ZBBA 5IIZA 3TKSC 2WFCA 3HHVA 3UARA 1K0NA 3I9V2 2O85A 1K3LA 2LEGA 3G7IA 1W4VA 4FYBA 4AJ6A 1B9XC 2CV4A 2HZEB 4JR6A 3LXZA 2XPDA 2Z9SA 1V2AA 3RPNA 4MJBA 1Z7RA 2KLXA 2C3TA 4LA1A 4EO3A 2KP2A 4KUNA 2WGRA 5G5EA 2GVPA 4OFTA 4FO5A 3WYWA 3QAWA 2L57A 1A2MA 1FOVA 5H5RA 1AXDA 3F9UA 3OR5A 4PUAA 2GQMA 1SJ6A 2OJLA 4HS1A 2XBQA 3L9VA 3R2QA 2AV4A 4MZWA 5DJMA 4PUFC 1UC7A 4IELA 2L6DA 1KNGA 4BVXA 1YKCA 1DSBA 4OWYA 5J3RA 4DSRA 2A2SA 1ACVA 2VL2A 2CAQA 4WBJA 1RK4A 3D6IA 3LQ7A 4TVEA 5HR2A 3HD5A 4EXJA 4Z7XA 2EC4A 1FHEA 3I69A 3N5OA 2F8AA 2GSSA 3P7XA 2E2GA 5KEJA 1WWJA 4GWRA 2IIYA 3H79A 4XS1A 1PQNA 3I6AA 4POKA 4I5QA 4G10A 2IMEA 1LBKA 3F6DA 2H19A 3J7Yk 1PD21 2N5FA 3TCOA 3LORA 4ZIJA 2LJAA 2OE3A 4F2IA 5DAKA 1PN9A 4GXZA 3BD2A 5JCWA 1QUWA 1AIUA 3QAGA 5B6NA 3ED3A 5G5FA 5IMFA 3TDGA 3P90A 2CT6A 4CDOA 1THXA 1X0RA 1F3BA 2HRAA 4O7HA 3FYGA 4OCEA 2HSNB 3VPTA 3DWVA 2JZSA 1ZL9A 2HRNA 5JCUA 1WRYA 1GSUA 2JU5A 3PPUA 14GSA 1FAAA 1GSSA 3LXTA 4PXOA 4MABA 3FZAA 3JCML 5AGYA 3DMLA 2VM1A 2GSRA 5BMUA 2I9HA 3G7YA 4QL7A 4IJ3A 3C1RA 2HSYA 1XW9A 2R3XA 2YOIA 3HJMA 5ECMB 3GSSA 4RI7A 3F4SA 1GNEA 1ABAA 2I3YA 1G0TA 4F03A 1VRSD 4KA0A 17GSA 3GIXA 1XCCA 3DD3A 2DJ1A 5J9CA 3IHQA 1OYJA 2HSHA 3LYPA 1OC9A 2PBJA 2ZUPA 3UEMA 4ISDA 2DMMA 2H6XA 4IKHA 4ZB9A 1SENA 4FYCA 2MBTA 2A2RA 1XIYA 3GX8A 10GSA 2X99A 3GL5A 2GT6A 1HNCA 4MJEA 5D9TA 1XXUA 4USSA 2HSMB 1I9DA 4GTUA 3BJ5A 1JZOA 2AUVA 5CP1A 1O7UA 4EF0A 2FA8A 4PNGA 2LJKA 2H1DA 4MDCA 4DSSB 4WR5A 1ZZYA 2YWOA 3V1WA 4JZQA 7GSSA 2AJQB 4KCAA 5CRDA 2N5AA 3KEBA 2K6VA 2OKAA 4GCIA 2PERA 1VF3A 3H4KA 1BX9A 1F3AA 1Z3EA 2RM6A 3HZ8A 3RAZA 2VL3A 4G19A 1A2LA 2GSTA 1B9YC 3QR6A 4NMUA 1XW6A 4PTSA 2JADA 3KH9A 2DC5A 3Q19A 3LWAA 2C3QA 5H5QA 4IS0A 3I43A 2WS2A 2REMA 4TW5A 1ERWA 3F4TA 3ME7A 2VL9A 1J0FA 1B8XA 2PVQA 5JCGA 4ZB8A 3UIWA 8GSSA 4RQXA 4WXTA 5GAPD 1V40A 3QFBC 3DIEA 4MPFA 1K0AA 1J9BA 3GKMA 2YWNA 1K0BA 4O32A 3GTUB 3LSZA 1OVNA 4NPBA 2VOCA 3IC4A 2GZPA 4D73A 4K8MA 2ALBA 4YQVA 3MNGA 5LCZA 1HNAA 4WEYA 1YY7A 3TOTA 5KN1A 4IN0A 1MDJA 4MPGA 3QFAC 3SBCA 2V41A 4TR3A 11GSA 1XOBA 2H0IA 2RLIA 3MDKA 5IM9A 4RUVA 2V2GA 2GZYA 1W89A 1Z6MA 1IYHA 2WCIA 2FLSA 3ZITA 2FNOA 1X9WB 1V58A 5G1LA 2B1LA 4PQIA 2PN8A 1EZKA 5CRWA 2HZEA 4XCSA 2DLXA 5E4WA 4L0WA 2C0GA 2C0DA 4BL7A 3TKRA 1GP1A 4HQZA 4KW6A 2VIMA 5HQPA 2KHPA 3IA1A 4EVMA 5HR0A 5IMZA 4I6XA 3ERWA 20GSA 5KN3A 2DIZA 3EWLA 4KSMA 3C73A 3ME8A 2O87A 3Q74A 3IBHA 1SKSB 4L5LA 2VLUA 4H86A 1O81A 4ZB6A 3F3RA 3IE3A 6GSYA 2X8GA 5EL8A 4N0VA 2P0GA 2WB9A 4TR1A 1DBYA 1EOGA 3VPQA 3LYKA 5B6MA 2GZZA 3ZFBA 5HFKA 3VWUA 3QOUA 4GSSA 2DIYA 2O89A 1H75A 1TK8B 3KZQA 4KB3A 3GL3A 3ZIVA 3A2WA 3GMFA 2ON7A 5B8AA 1GRXA 1EV4A 1S3DA 3U6VA 3EURA 4ULXA 2XBIA 1V57A 1QQ2A 1XWBA 3U5RE 3ZVJD 3FZ9A 4K2DA 4MH3A 3ERGA 4IQAA 3TKQA 3CYNA 1MEKA 3RHBA 4EDZA 4Q5FA 4CHSA 2J9HA 5L71A 2R37A 3G9BA 1GSFA 3F3QA 3TOUA 4EE0A 3CSJA 5JWOB 2BJXA 1ILOA 5D93A 2P31A 2CA8A 1FVJA 2H1GA 4F9ZA 5G1KA 5HFIA 1X9MB 2R6KA 3IAM2 5LNKe 1PX7A 5IPGA 1EP7A 2LNSA 1K0CA 2H76A 3TRXA 5ECKB 1MDIA 3CTFA 1XVWA 1T8EB 1G7EA 2L6CA 5DALB 2YANA 1BG5A 1NM3A 1VGLA 2LQQA 1K0OA 2LNTA 4ID0A 3MAKA 2IMKA 3CTGA 1LU4A 2IMFA 5A5KA 4G0LA 1Z5YE 1G6WA 4BWQA 3P8WA 1WJKA 2WULA 4NV5A 3US3A 4ML6A 2HT9A 3ZMKA 3FW2A 3LFLA 4WF4A 2C8UA 1CQGA 3CBUA 4POLA 2IPAA 4IQ1A 4AJ8A 1QK8A 4J57E 3GN3A 2IFQA 1K3OA 3HDCA 4V2LA 5GSSA 2YZHA 1ZOFA 1ON4A 2HFDA 3L4NA 9GSSA 3O3TA 4IJIA 1GUKA 2H0GA 3VLNA 1B48A 2FWGA 3M1GA 3FZ4A 3ZZXA 2OBIA 3FR3A 4BA7A 3O76A 4AJ7A 4HDEA 2LQOA 5IMCA 1BYEA 3UMAA 1K0DA 1FB0A 4PX1A 5D96A 2I1UA 4PGTA 2V6OA 1M2DA 1OE7A 1V98A 6GSWA 4PQ1A 2FA4A 2HE3A 5IMDA 2HSMA 1SYRA 4HJ2A 22GSA 5DBQA 2I81A 2H72A 3SWLA 5B8BA 2MZCA 2TRXA 2FGXA 3VURA 4KNDA 4I2UA 4DSSA 4FYUA 1NSWA 5KN2A 3VI7A 2PVOC 3IPZA 4TR0A 1GL8A 1GUHA 5ABRA 4HZ2A 4YQMA 1JZRA 1O8WA 3G7JA 3A3TA 4HUAA 3DVXA 4PQHA 4TXOB 3EMPA 4HOJA 2L59A 4PURA 3ZTLA 1HYUA 3DYRA 3HJOA 2I4AA 2N5BA 3FKFA 1HQOA 3QMXA 5ECQB 3KP9A 2BMXA 5KN0A 12GSA 3IDVA 1X5CA 16GSA 5F8BA 5CNWA 3C1SA 4Q5RA 1Q98A 3GTUA 4BWSA 2VCXA 2WRTA 2YZUA 1M9BA 1M99A 1TDIA 1ZYQB 2D2ZA 5ID2A 4EKZA 2IJYA 4N11A 3KH7A 1BJXA 3GRXA 1JHBA 1DE1A 4ECCA 5ECLB 4JRRA 3QDNA 2M80A 5G31A 1JZDA 1FVKA 3FHKA 1ZGNA 4X43A 1QMVA 4OMVA 1YJ6A 1BEDA 4MF6A 1PKWA 5J4UA 1Q4JA 2DJ0A 3HVVA 1TI1A 2H6ZA 2E7PA 1M2BA 3WT2A 1O85A 1USBA 2GDRA 4ZBDA 3TGZA 3CXGA 5CAXA 1X5EA 1ZCPA 2FD3A 4HI7A 2AHEA 4G2EA 1ZMAA 4YQUA 5C04A 1YKAA 2O7KA 2VCZA 2PU9C 3IK7A 2AB6A 1KTEA 3DXBA 4TKYA 3O6TA 3EMXA 3L9SA 1SJIA 2YWMA 1SK1A 2ZNMA 3M9JA 3UOMA 1AQWA 1EEJA 2WDUA 4BVYB 2JSZA 2V6KA 2HLSA 3RPPA 4WF5A 3VK9A 3KCMA 3VWVA 1TXXA 3M8NA 5AN1A 4J2FA 3W8JA 3HXSA 3IR4A 2M72A 4V2NA 1VF1A 4DSQA 3UVTA 3WGDA 3ERFA 1DUGA 1EOHA 1UN2A 3KTBA 4OFNA 1TRUA 1EGRA 5JWQB 3QD9A 1AW9A 4L5OA 2YPMA 2YV9A 3VI5A 4MA9A 2LUSA 3GSTA 3TRQA 1R4WA 5CRHA 18GSA 1THOA 3N9JA 2IMIA 3KTLA 1SYXA 1SKWB 1GH2A 1T3BA 3KM6A 4IP6A 5J9BA 4IW9A 2VO4A 3DVWA 5HR3A 2B5YA 3A2XA 1Z6NA 2YV7A 4OCFA 5ENUA 5FT3A 5JWRB 2FY6A 1TK5B 2OADA 3C8EA 3IAS2 4IGJA 4O5RA 1YF1A 4AF2A 4DVCA 4K0GA 4Q5QA 1SD8A 1N2AA 3ZFLA 1RQMA 3M3MA 2GT5A 5ECHB 1TU8A 2VUPA 2IMDA 5DALA 4GRFA 3PR8A 2F51A 3KMOA 4KX4A 4I8BA 6GSVA 2E2MA 2RM5A 1VF4A 3VWWA 1FO5A 1Z9HA 2HZFA 5A4UA 5GAND 5J41A 2L5LA 1ERTA 1U3IA 4LLRA 3APOA 2PWJA 3CRUA 2TRCP 2F9SA 2RUFA 2LS5A 1FW1A 4ECBA 2JACA 2L4CA 5DQSA 4KH7A 2LRCA 3F0IA 1UVZA 2HQTA 3UAPA 2HNLA 2DMLA 4EUYA 2WJUA 1WIKA 4JEDA 1O6JA 1KEBA 4K7OA 4JE1A 1SL1B 1PMTA 5EVOA 3FZ5A 4JBBA 1YZXA 3GUSA 2L4QA 5D9XA 2C1YA 1ERUA 2NVLA 4I2TA 1TRWA 1XWAA 4QL9A 4Q5NA 4ACSA 4XIHA 4E8HA 3P2AA 4X0XA 2XC2A 1X9SB 1S3CA 3EVIA 4MLYA 1M9AA 2CVBA 2G2QA 3IC8A 2H1BA 2K18A 2FHEA 1WP0A 3GH9A 3BOAA 4XHMA 3E9JB 1O73A 3M9KA 2F8FA 3ZYWA 4KAEA 3HYPA 4EL1A 1GLPA 1EGOA 2H01A 1AUCA 2VCWA 1AAZA 4NV2A 3KIJA 3WGEA 4K9ZA 3BBYA 3TJJA 3ZIJA 1T7PB 4HQSA 1GSQA 2GS3A 1F37A 4BPYA 1R5PA 1ZYEA 3GH6A 4GSNA
chains in the Genus database with same CATH superfamily
1UA5A 4AGSA 5HR1A 4EDYA 3TJBA 5ELAA 1BQ7A 2CVDA 5D73A 4N30A 1NW2A 3A5WA 1PSQA 3GHAA 5DCHA 4IVFA 2GSQA 1SVLA 2HRFA 4IBPA 1K3YA 1ZYPA 2X8HA 4OO4A 4NWYA 3F6FA 3HKRA 2CQ9A 5J5NA 1TOFA 3HCZA 1EEMA 3E0UA 4ICYA 1F6MC 5HFGA 2A4VA 4KE3A 3TJKA 3UL3A 4NXIA 1SKRB 3HA9A 2HSNA 5CRGA 4TR4A 5A34B 1JLVA 3KD0A 3BCKA 1YEXA 5IOWA 4MJAA 5KOXA 1GUMA 3KP8A 2LTKA 3HY2A 1TW9A 2NPBA 4LL4B 3GKXA 4O92A 2GLRA 3FK8A 4ECIA 3L0HA 3RGBC 4GF0A 2B6MA 3UVHA 1N25A 5DDLA 2QC7A 2WVYA 4V2MA 2GGTA 2C4JA 3KXOA 2XHFA 3L9UA 3C71A 3PGTA 3ZMLA 1I5GA 1LJRA 3H8QA 3K8NA 1G6YA 1T4YA 1M0UA 2JZRA 1M2AA 1EV9A 3F63A 2EFCA 5ECNB 3HZ4A 1GTBA 3KJYA 3CWGA 3LGCA 3PINA 4OFMA 1JFUA 2GQKA 4BVYA 2DBCA 5A5HA 2FCHA 2R2JA 2B5XA 2RIIA 4ZBAA 2R5GA 2MMZA 1F2EA 2VL2C 2FWFA 3TKSE 2AYTA 2OE1A 4N3ZA 1XWGA 3F8UA 2H6YA 2XPEA 3GA4A 4JR4A 1XW5A 1WPIA 2PUKC 4F82A 3TJFA 5IOXA 5B7CA 2VLVA 1TU7A 4TRXA 2X64A 1XFLA 3DEXA 1A8LA 5CO3A 3WT1A 2KP1A 3TJGA 1BAYA 1TRVA 2NTOA 2VCQA 4BL7B 2OA7A 1TRSA 1WOUA 4KDXA 2OE0A 2YN1A 3EC3A 4O5UA 1U88A 1Y6EA 3Q18A 4K0NA 1PFOA 1GTUA 2G0FA 2DJJA 2MBSA 3WD6A 2V32A 5F07A 1OC3A 3IHGA 3D4TA 5GSTA 2H74A 2QKEA 4NAXA 4K7IA 4MF7A 4YAPA 1HNBA 5E59A 5J4VA 1FG4A 2MMNA 5AISA 3TKSA 3CSHA 3H93A 1Z7PA 1ZYNA 1QXHA 4TR1B 2H1AA 3FRCA 1HD2A 1SD9A 1T1VA 2WZ9A 2C0FA 3EYTA 3PH9A 1JLWA 2PPTA 1B4QA 2R0GA 3TKPA 3LEFA 2L5OA 1GSYA 3GYKA 4TXVA 4P3YB 4HZ4A 4XS6A 1PL2A 1YEPA 3GKKA 1U87A 1U6TA 2V1MA 3L78A 5IQYA 3FR9A 2RUEA 3HVNA 1FOHA 2DJKA 2GTUA 3GX0A 4AKIA 2QGVA 4MZCA 2B7JA 4GQCA 1V9WA 2CZ2A 1R26A 3UBKA 1CQHA 5ECRB 1T00A 2HRKB 4XRAA 4IP1A 3S9FA 1YEWC 4L8EA 1OKDA 2CX3A 3GNJA 4GSTA 1X5DA 6GSUA 1MDKA 1PRXA 3ZRDA 3MSZA 1YF0A 3VFIA 4WETA 1GTIA 3UBLA 1NHOA 1A8YA 1KBNA 2EIQA 2KUCA 2CZ3A 4ML1A 4XS4B 3C7MA 5IO2A 1PX6A 5IMAA 3R3EA 4N10A 2K8VA 3D22A 2H75A 5DCGA 1T4ZA 1WE0A 4FH8A 4ECJA 4ZL7A 3A2VA 6GSSA 5ECPB 2H73A 1GULA 5A4WA 4RI6A 1M3JA 5ECIB 3EE2A 1GWCA 2H71A 5C00A 2YWIA 3IXRA 3TUEA 4WR4A 4POBA 2C3NA 2VD0A 2H70A 4E8EA 4X1UA 5EPFA 3TRPA 5A1NB 2VAFA 4ZXGA 2IFQB 1O8XA 4G0IA 1R5AA 2IN3A 3NOFA 1U3AA 1GLQA 3DGQA 4QQ7A 3D21A 1YQ1A 4IHUA 4HJMA 1J08A 4MH2A 3RHCA 4YAVA 2CX4A 6GSXA 2O8VB 2B5EA 2E0QA 4ZL8A 4MZBA 3WGXA 2FUG2 1K0MA 5AIVA 1WMJA 4EC0A 2H1LA 4LMVA 1XBSA 1A0FA 3UJ1A 2UZ8A 2QSIA 2JZTA 4FQUA 3IK9A 2MMOA 1NHYA 3QPMA 5J4YA 1XVQA 2OBKA 2AAWA 2JL4A 4WBRD 2J23A 4G9HA 4K7NA 5GZZB 1MTCA 4MF5A 13GSA 1DE2A 2B7KA 1A2JA 1GTAA 1TP9A 4HU9A 2R4VA 1PL1A 3LJRA 3ZREA 4BVXB 2DJ3A 3IRAA 4AKHA 5A34A 4KSOA 3GURA 3W6GA 5G30A 2IL3A 2M46A 1XZOA 2LRTA 4G0KA 1AQVA 3CSIA 6GSTA 2MYGA 1G7OA 2YNXA 1A24A 4TN8A 4JU5A 1XPVA 4RQRA 4XTSA 4F0BA 3CRTA 2LSTA 1XWKA 1ML6A 3KMNA 2ZCTA 5ECOB 1H4OA 4G01A 5IO0A 4NHZA 4WKWA 2EIOA 4K6XA 5CYYA 3E3EA 1PGTA 2EIRA 1FB6A 5DAKB 5FWGA 4X4JA 2IWTA 3RBTA 4XRDA 3AY8A 2F3MA 5ID2B 5DVBA 2HI7A 1OAZA 3Q6OA 1S3AA 2FWHA 1OE8A 1GSEA 4ZILA 2BTOT 1RW1A 1SU9A 2CVKA 2JSYA 2H66A 3MWHA 2TIRA 1TI3A 5DQYA 1ST9A 2DJ2A 3DKSA 3ZLPA 3D4MA 2LRNA 3FEUA 5ECSA 2B3SA 2OACA 3EINA 4GQFA 4CW9A 2VM2A 3NZNA 1MD4A 5IMVA 3EU4A 2C0EA 1SL0B 3ZL5A 2VD1A 5BMUB 4ZL9A 5EY6A 1E6BA 3BCIA 2WVXB 4K1FA 4V1Ap 5G2ZA 4J56E 1C72A 2ON5A 3CMIA 5A4VA 1XOAA 1SJZA 4V1Ag 1EP8A 1GSDA 1M7TA 5F0GA 1R7HA 2DSAA 1TJDA 3DRNA 5D8IA 4OO5A 2VLTA 1VF2A 1Y25A 4PNFA 3LG6A 4KGIA 4KDYA 2MMAA 5INYA 2HYXA 1OKTA 3NIVA 3IV4A 4GLTA 2NDOA 5D9VA 4ILFA 5FHIA 3GV1A 4TXOA 1A0RP 1E2YA 2YJ7A 1OC9B 1Y1UA 1QGVA 2X8CA 3APQA 2GQLA 1PKZA 4PHZC 1AC1A 1N8JA 2LJRA 5F06A 4MCUA 4OD7A 1AQXA 1EWXA 2HXKA 3A5IA 2H30A 1URMA 4HU7A 5H5SA 2PMTA 2YJHA 2C80A 3ZVJA 3D5JA 1YDKA 4YH2A 3FR6A 1TKDB 1F9MA 2NBSA 2VCVA 3M0FA 3FY7A 2R0PA 2HRKA 4DEJA 2O36A 4KDUA 3KGKA 3H1NA 2K9FA 3J7Yb 2CAIA 1IYIA 2WW1A 4KF9A 4MJCA 3HVXA 4HSCX 4MK3A 2FWEA 2UV8G 3HJPA 3EU3A 4MP4A 4XS4A 4L0UA 4AI6A 4POMA 3VWXA 4TOPA 1SK2A 5D9WA 5F05A 3GFKA 1JZWA 19GSA 4YKFA 1MD3A 1A23A 3W8SA 3IOSA 1SK0A 5CREA 1QFNA 4NHWA 5LD0A 2H0HA 1SL2B 3APSA 2YP6A 2H8LA 4N0ZA 5KOWA 2P5QA 1XWCA 1PA3A 4KCEA 2LKUA 1TTZA 3TB2A 4D73B 3D0ZA 4I97A 3HVSA 4AKGA 5AIXA 4FIWA 5IPHA 3GKNA 2ES7A 2VCTA 4LL1B 3QAVA 5A1NA 2K8SA 1OC8A 5DJLA 4MMMA 3ISOA 2P5RA 4LMWA 2LV3A 3F4RA 5COHA 2B1KA 4HEA2 1TK0B 1B4PA 1GNWA 2QA1A 5ELGA 3QCPA 2YCDA 3RDWA 4F0CA 2PGTA 1ERVA 2KOKA 4ZBBA 5IIZA 1TXUA 3LW9A 3TKSC 2WFCA 3HHVA 3UARA 1K0NA 3I9V2 2O85A 1K3LA 1S3RA 2LEGA 3G7IA 1W4VA 4FYBA 4AJ6A 1B9XC 2CV4A 2HZEB 4JR6A 3LXZA 2XPDA 2Z9SA 1V2AA 3RPNA 4MJBA 1Z7RA 4MNNA 2KLXA 2C3TA 4LA1A 4EO3A 2KP2A 4KUNA 2WGRA 5G5EA 2GVPA 4OFTA 4FO5A 3WYWA 3QAWA 2L57A 1A2MA 1FOVA 5H5RA 1AXDA 3F9UA 3OR5A 4PUAA 2GQMA 1SJ6A 2OJLA 4HS1A 2XBQA 3L9VA 3R2QA 2AV4A 4MZWA 5DJMA 4PUFC 1UC7A 4IELA 2L6DA 1KNGA 4BVXA 1YKCA 1DSBA 4OWYA 5J3RA 4DSRA 2A2SA 1ACVA 2VL2A 2CAQA 4WBJA 1RK4A 2DKIA 3D6IA 3EPTA 3LQ7A 4CY6A 4TVEA 2A2PA 5HR2A 3HD5A 4EXJA 4Z7XA 2EC4A 1FHEA 3I69A 3N5OA 2F8AA 2GSSA 3P7XA 2E2GA 5KEJA 1WWJA 4GWRA 2IIYA 3H79A 4XS1A 1PQNA 3I6AA 4POKA 4I5QA 4G10A 2IMEA 1LBKA 3F6DA 2H19A 3J7Yk 1PD21 2N5FA 3TCOA 3LORA 4ZIJA 2LJAA 2OE3A 4F2IA 5DAKA 1PN9A 4GXZA 3BD2A 5JCWA 1QUWA 5BRTA 1AIUA 3QAGA 5B6NA 3ED3A 5G5FA 5IMFA 3TDGA 3P90A 2CT6A 4CDOA 1THXA 1X0RA 1F3BA 2HRAA 4O7HA 3FYGA 4OCEA 2HSNB 3VPTA 3DWVA 2JZSA 1ZL9A 1PN0A 2HRNA 5JCUA 1WRYA 1GSUA 2JU5A 3PPUA 14GSA 1FAAA 1GSSA 2DKHA 3LXTA 4PXOA 4MABA 3FZAA 3JCML 5AGYA 3DMLA 2VM1A 2GSRA 5BMUA 2I9HA 3G7YA 4QL7A 4IJ3A 3C1RA 2HSYA 1XW9A 2R3XA 3CQFA 2YOIA 3HJMA 5ECMB 3GSSA 4RI7A 4EIPA 3F4SA 1GNEA 1ABAA 1SVMA 2I3YA 1G0TA 4F03A 1VRSD 4QMKA 1SVOA 4KA0A 17GSA 3GIXA 1XCCA 3DD3A 2DJ1A 5J9CA 3IHQA 1OYJA 4PI2C 2HSHA 3LYPA 1OC9A 2PBJA 2ZUPA 3FMWA 3UEMA 4ISDA 2DMMA 2H6XA 4IKHA 4ZB9A 1SENA 4FYCA 2MBTA 2A2RA 1XIYA 3GX8A 10GSA 2X99A 4K5SA 3GL5A 2GT6A 1HNCA 4MJEA 5D9TA 1XXUA 4USSA 2HSMB 1I9DA 4GTUA 3BJ5A 1JZOA 2AUVA 5CP1A 1O7UA 4EF0A 2FA8A 4PNGA 2LJKA 2H1DA 4MDCA 4DSSB 4WR5A 1ZZYA 2YWOA 4CY8A 3V1WA 1XG8A 4JZQA 7GSSA 2AJQB 4KCAA 5CRDA 2N5AA 3KEBA 2K6VA 2OKAA 4GCIA 2PERA 1VF3A 3H4KA 1BX9A 1F3AA 1Z3EA 2RM6A 3HZ8A 3RAZA 2VL3A 4G19A 1A2LA 2GSTA 1B9YC 3QR6A 4NMUA 1XW6A 4PTSA 2JADA 3KH9A 2DC5A 4Z2TA 3Q19A 3LWAA 2C3QA 5H5QA 4IS0A 3I43A 2WS2A 2REMA 4TW5A 1ERWA 3F4TA 3CHXC 3ME7A 2VL9A 1J0FA 1B8XA 2PVQA 5JCGA 1BF5A 4ZB8A 3UIWA 8GSSA 4RQXA 4WXTA 5GAPD 1V40A 3QFBC 3DIEA 4MPFA 1K0AA 1J9BA 4K2XA 3GKMA 2YWNA 1K0BA 4O32A 3GTUB 3LSZA 1OVNA 4NPBA 2VOCA 3IC4A 2GZPA 4D73A 4EIQA 4K8MA 2ALBA 4YQVA 3MNGA 5LCZA 1HNAA 4WEYA 1YY7A 3TOTA 5KN1A 4IN0A 4W66A 1MDJA 4MPGA 3QFAC 3SBCA 2V41A 4TR3A 11GSA 1XOBA 2H0IA 2RLIA 3MDKA 5IM9A 3RFRC 4RUVA 2V2GA 2GZYA 1W89A 1Z6MA 1IYHA 2WCIA 3MYDA 2FLSA 3ZITA 2FNOA 1X9WB 1V58A 5G1LA 2B1LA 2X4AA 4PQIA 2PN8A 1EZKA 5CRWA 5J40A 2HZEA 5J47A 4XCSA 2DLXA 5E4WA 4L0WA 2C0GA 2C0DA 2WW2A 4BL7A 3TKRA 1GP1A 4HQZA 4KW6A 2VIMA 5HQPA 2KHPA 3IA1A 4EVMA 5HR0A 5IMZA 4I6XA 3ERWA 20GSA 5KN3A 2DIZA 3EWLA 4KSMA 3C73A 3ME8A 2O87A 3Q74A 3IBHA 1SKSB 4L5LA 2VLUA 4H86A 1O81A 4ZB6A 3F3RA 3IE3A 6GSYA 2X8GA 4GDFA 5EL8A 4N0VA 2P0GA 2WB9A 4TR1A 1DBYA 1EOGA 3VPQA 3LYKA 5B6MA 2GZZA 3ZFBA 5HFKA 3VWUA 3QOUA 4GSSA 2DIYA 2O89A 1H75A 1M3IA 1TK8B 3KZQA 2OT3A 4KB3A 3GL3A 3ZIVA 3A2WA 3GMFA 2ON7A 5B8AA 1GRXA 1EV4A 1S3DA 3U6VA 3TU3B 3EURA 4ULXA 2XBIA 1V57A 1QQ2A 2WVZA 1XWBA 3U5RE 3ZVJD 3FZ9A 4K2DA 4MH3A 3ERGA 4IQAA 4AKXB 3TKQA 3CYNA 1MEKA 3RHBA 4EDZA 4Q5FA 4CHSA 2J9HA 5L71A 2R37A 3G9BA 1GSFA 3F3QA 3TOUA 4EE0A 3CSJA 5JWOB 2BJXA 1ILOA 5D93A 2P31A 2CA8A 1FVJA 2H1GA 4F9ZA 5G1KA 5HFIA 1X9MB 2R6KA 3IAM2 5LNKe 1PX7A 5IPGA 1EP7A 2LNSA 1K0CA 2H76A 3TRXA 5ECKB 1MDIA 3CTFA 1XVWA 1T8EB 1G7EA 2L6CA 5DALB 2YANA 1BG5A 1NM3A 1VGLA 2O3EA 2LQQA 1K0OA 2LNTA 4ID0A 3MAKA 2IMKA 3CTGA 2EFDA 1LU4A 2IMFA 5A5KA 4G0LA 1Z5YE 1G6WA 4BWQA 3P8WA 1WJKA 2WULA 4NV5A 3US3A 4ML6A 2HT9A 3ZMKA 3FW2A 3LFLA 4WF4A 2C8UA 1CQGA 3CBUA 4POLA 2IPAA 4IQ1A 4AJ8A 1QK8A 4J57E 3GN3A 2IFQA 1K3OA 3HDCA 4V2LA 5GSSA 2YZHA 1ZOFA 1ON4A 2HFDA 3L4NA 9GSSA 3O3TA 4IJIA 1GUKA 2H0GA 3VLNA 1B48A 2FWGA 3M1GA 3FZ4A 3ZZXA 2OBIA 3FR3A 2A4HA 4BA7A 3O76A 4AJ7A 4HDEA 2LQOA 5IMCA 1BYEA 3UMAA 1K0DA 1FB0A 4PX1A 5D96A 2I1UA 4PGTA 2V6OA 2QA2A 1M2DA 1OE7A 1V98A 6GSWA 4PQ1A 2FA4A 2HE3A 5IMDA 2HSMA 1SYRA 3HMJG 4HJ2A 22GSA 5DBQA 2I81A 4PI0C 2H72A 3SWLA 4BIKA 5B8BA 2MZCA 2TRXA 2FGXA 3VURA 4KNDA 4I2UA 4DSSA 4FYUA 1NSWA 5KN2A 3VI7A 2PVOC 3IPZA 4TR0A 1GL8A 1GUHA 5ABRA 4HZ2A 4YQMA 1JZRA 2WZSA 1O8WA 3G7JA 3A3TA 4HUAA 3DVXA 4PQHA 4TXOB 3EMPA 4HOJA 2L59A 2EFEA 4PURA 3ZTLA 1HYUA 3DYRA 2EFHA 3HJOA 2I4AA 2N5BA 3FKFA 1HQOA 3QMXA 5ECQB 3KP9A 2BMXA 5KN0A 12GSA 3IDVA 1X5CA 16GSA 5F8BA 5CNWA 3C1SA 4Q5RA 1Q98A 3GTUA 4BWSA 1I1IP 2VCXA 2WRTA 2YZUA 1M9BA 1M99A 1TDIA 1ZYQB 2D2ZA 5ID2A 4EKZA 2IJYA 4N11A 3KH7A 1BJXA 3GRXA 1JHBA 1DE1A 4ECCA 5ECLB 4JRRA 3QDNA 2M80A 5G31A 1JZDA 1FVKA 3FHKA 1ZGNA 4X43A 4Z2UA 1QMVA 4OMVA 1YJ6A 1BEDA 4MF6A 1PKWA 4ZB7A 5J4UA 1Q4JA 2DJ0A 3HVVA 1TI1A 2H6ZA 2E7PA 1M2BA 2WVXA 3WT2A 1O85A 1USBA 2GDRA 4ZBDA 3TGZA 3CXGA 5CAXA 1X5EA 1ZCPA 2FD3A 4HI7A 2AHEA 4G2EA 1ZMAA 4YQUA 5C04A 1YKAA 2R0CA 2O7KA 2VCZA 2PU9C 3IK7A 2AB6A 1KTEA 3DXBA 4TKYA 3O6TA 3EMXA 3L9SA 1SJIA 2YWMA 1SK1A 2ZNMA 1BG1A 3M9JA 3UOMA 1AQWA 1EEJA 2WDUA 4BVYB 2JSZA 2V6KA 5A5HB 2HLSA 3RPPA 4WF5A 3VK9A 3KCMA 3VWVA 2VKZG 1TXXA 3M8NA 5AN1A 4J2FA 3W8JA 3HXSA 3IR4A 4K5RA 2M72A 4V2NA 1VF1A 4DSQA 3UVTA 3WGDA 3ERFA 1DUGA 1EOHA 1UN2A 3KTBA 4OFNA 1TRUA 1EGRA 5JWQB 3QD9A 1AW9A 4L5OA 2YPMA 2YV9A 3VI5A 4MA9A 2LUSA 3GSTA 3TRQA 1R4WA 5CRHA 2WW3A 18GSA 1THOA 3N9JA 4O5QA 2IMIA 3KTLA 1SYXA 1SKWB 1GH2A 1T3BA 3KM6A 4IP6A 5J9BA 4IW9A 2VO4A 3DVWA 5HR3A 2B5YA 4E68A 3A2XA 1Z6NA 2YV7A 4OCFA 5ENUA 5FT3A 5JWRB 2FY6A 1TK5B 4FXYP 2OADA 3C8EA 3IAS2 4IGJA 4O5RA 1YF1A 4AF2A 4DVCA 4K0GA 2O5VA 4Q5QA 1SD8A 1N2AA 3ZFLA 1RQMA 3M3MA 2GT5A 5ECHB 1TU8A 2VUPA 2IMDA 5DALA 4GRFA 3PR8A 2F51A 3KMOA 4KX4A 4I8BA 6GSVA 2E2MA 2RM5A 1VF4A 3VWWA 1FO5A 1Z9HA 2HZFA 5A4UA 5GAND 5J41A 2L5LA 1ERTA 1U3IA 4LLRA 3APOA 2PWJA 3CRUA 2TRCP 2F9SA 2RUFA 2LS5A 1FW1A 4ECBA 2JACA 2L4CA 5DQSA 4KH7A 2LRCA 3F0IA 2X49A 4YKGA 1UVZA 2HQTA 2WW0A 3UAPA 2HNLA 2DMLA 4EUYA 2WJUA 1WIKA 4JEDA 1O6JA 1KEBA 4K7OA 4JE1A 1S4BP 1SL1B 1PMTA 5EVOA 3FZ5A 4JBBA 1YZXA 3GUSA 2L4QA 5D9XA 2C1YA 1ERUA 2NVLA 4I2TA 1TRWA 1XWAA 4QL9A 4Q5NA 4ACSA 4XIHA 4E8HA 3P2AA 4X0XA 4Z2RA 3MIXA 2XC2A 1X9SB 1S3CA 3EVIA 4MLYA 1M9AA 2CVBA 2G2QA 3IC8A 2H1BA 2K18A 2FHEA 1WP0A 3GH9A 3BOAA 4XHMA 3E9JB 1O73A 3M9KA 2F8FA 3ZYWA 4A5PA 4KAEA 1YVLA 3HYPA 4EL1A 1GLPA 1EGOA 2H01A 1AUCA 2VCWA 1AAZA 4NV2A 3KIJA 3WGEA 4K9ZA 3BBYA 3TJJA 3ZIJA 1T7PB 4HQSA 1GSQA 2GS3A 1F37A 4BPYA 1R5PA 1ZYEA 3GH6A 4GSNA
chains in the Genus database with same CATH topology
1UA5A 4AGSA 5HR1A 4EDYA 3TJBA 5ELAA 1BQ7A 2CVDA 5D73A 4N30A 1NW2A 3A5WA 1PSQA 3GHAA 5DCHA 4IVFA 2GSQA 1SVLA 2HRFA 4IBPA 1K3YA 1ZYPA 2X8HA 4OO4A 4NWYA 3F6FA 3HKRA 2CQ9A 5J5NA 1TOFA 3HCZA 1EEMA 3E0UA 4ICYA 1F6MC 5HFGA 2A4VA 4KE3A 3TJKA 3UL3A 4NXIA 1SKRB 3HA9A 2HSNA 5CRGA 4TR4A 5A34B 1JLVA 3KD0A 3BCKA 1YEXA 5IOWA 4MJAA 5KOXA 1GUMA 3KP8A 2LTKA 3HY2A 1TW9A 2NPBA 4LL4B 3GKXA 4O92A 2GLRA 3FK8A 4ECIA 3L0HA 4GF0A 2B6MA 3UVHA 1N25A 5DDLA 2QC7A 4V2MA 2GGTA 2C4JA 3KXOA 2XHFA 3L9UA 3C71A 3PGTA 3ZMLA 1I5GA 1LJRA 3H8QA 3K8NA 1G6YA 1T4YA 1M0UA 2JZRA 1M2AA 1EV9A 3F63A 2EFCA 5ECNB 3HZ4A 1GTBA 3KJYA 3CWGA 3LGCA 3PINA 4OFMA 1JFUA 2GQKA 4BVYA 2DBCA 5A5HA 2FCHA 2R2JA 2B5XA 2RIIA 4ZBAA 2R5GA 2MMZA 1F2EA 2VL2C 2FWFA 3TKSE 2AYTA 2OE1A 4N3ZA 1XWGA 3F8UA 2H6YA 2XPEA 3GA4A 4JR4A 1XW5A 1WPIA 2PUKC 4F82A 3TJFA 5IOXA 5B7CA 2VLVA 1TU7A 4TRXA 2X64A 1XFLA 3DEXA 1A8LA 5CO3A 3WT1A 2KP1A 3TJGA 1BAYA 1TRVA 2NTOA 2VCQA 4BL7B 2OA7A 1TRSA 1WOUA 4KDXA 2OE0A 2YN1A 3EC3A 4O5UA 1U88A 1Y6EA 3Q18A 4K0NA 1GTUA 2G0FA 2DJJA 2MBSA 3WD6A 2V32A 5F07A 1OC3A 3IHGA 3D4TA 5GSTA 2H74A 2QKEA 4NAXA 4K7IA 4MF7A 4YAPA 1HNBA 5E59A 5J4VA 1FG4A 2MMNA 5AISA 3TKSA 3CSHA 3H93A 1Z7PA 1ZYNA 1QXHA 4TR1B 2H1AA 3FRCA 1HD2A 1SD9A 1T1VA 2WZ9A 2C0FA 3EYTA 3PH9A 1JLWA 2PPTA 1B4QA 2R0GA 3TKPA 3LEFA 2L5OA 1GSYA 3GYKA 4TXVA 4P3YB 4HZ4A 4XS6A 1PL2A 1YEPA 3GKKA 1U87A 1U6TA 2V1MA 3L78A 5IQYA 3FR9A 2RUEA 1FOHA 2DJKA 2GTUA 3GX0A 4AKIA 2QGVA 4MZCA 2B7JA 4GQCA 1V9WA 2CZ2A 1R26A 3UBKA 1CQHA 5ECRB 1T00A 2HRKB 4XRAA 4IP1A 3S9FA 4L8EA 1OKDA 2CX3A 3GNJA 4GSTA 1X5DA 6GSUA 1MDKA 1PRXA 3ZRDA 3MSZA 1YF0A 3VFIA 4WETA 1GTIA 3UBLA 1NHOA 1A8YA 1KBNA 2EIQA 2KUCA 2CZ3A 4ML1A 4XS4B 3C7MA 5IO2A 1PX6A 5IMAA 3R3EA 4N10A 2K8VA 3D22A 2H75A 5DCGA 1T4ZA 1WE0A 4FH8A 4ECJA 4ZL7A 3A2VA 6GSSA 5ECPB 2H73A 1GULA 5A4WA 4RI6A 5ECIB 3EE2A 1GWCA 2H71A 5C00A 2YWIA 3IXRA 3TUEA 4WR4A 4POBA 2C3NA 2VD0A 2H70A 4E8EA 4X1UA 5EPFA 3TRPA 5A1NB 2VAFA 4ZXGA 2IFQB 1O8XA 4G0IA 1R5AA 2IN3A 3NOFA 1U3AA 1GLQA 3DGQA 4QQ7A 3D21A 1YQ1A 4IHUA 4HJMA 1J08A 4MH2A 3RHCA 4YAVA 2CX4A 6GSXA 2O8VB 2B5EA 2E0QA 4ZL8A 4MZBA 3WGXA 2FUG2 1K0MA 5AIVA 1WMJA 4EC0A 2H1LA 4LMVA 1XBSA 1A0FA 3UJ1A 2UZ8A 2QSIA 2JZTA 4FQUA 3IK9A 2MMOA 1NHYA 3QPMA 5J4YA 1XVQA 2OBKA 2AAWA 2JL4A 4WBRD 2J23A 4G9HA 4K7NA 5GZZB 1MTCA 4MF5A 13GSA 1DE2A 2B7KA 1A2JA 1GTAA 1TP9A 4HU9A 2R4VA 1PL1A 3LJRA 3ZREA 4BVXB 2DJ3A 3IRAA 4AKHA 5A34A 4KSOA 3GURA 3W6GA 5G30A 2IL3A 2M46A 1XZOA 2LRTA 4G0KA 1AQVA 3CSIA 6GSTA 2MYGA 1G7OA 2YNXA 1A24A 4TN8A 4JU5A 1XPVA 4RQRA 4XTSA 4F0BA 3CRTA 2LSTA 1XWKA 1ML6A 3KMNA 2ZCTA 5ECOB 1H4OA 4G01A 5IO0A 4NHZA 4WKWA 2EIOA 4K6XA 5CYYA 3E3EA 1PGTA 2EIRA 1FB6A 5DAKB 5FWGA 4X4JA 2IWTA 3RBTA 4XRDA 3AY8A 2F3MA 5ID2B 5DVBA 2HI7A 1OAZA 3Q6OA 1S3AA 2FWHA 1OE8A 1GSEA 4ZILA 2BTOT 1RW1A 1SU9A 2CVKA 2JSYA 2H66A 3MWHA 2TIRA 1TI3A 5DQYA 1ST9A 2DJ2A 3DKSA 3ZLPA 3D4MA 2LRNA 3FEUA 5ECSA 2B3SA 2OACA 3EINA 4GQFA 4CW9A 2VM2A 3NZNA 1MD4A 5IMVA 3EU4A 2C0EA 1SL0B 3ZL5A 2VD1A 5BMUB 4ZL9A 5EY6A 1E6BA 3BCIA 4K1FA 4V1Ap 5G2ZA 4J56E 1C72A 2ON5A 3CMIA 5A4VA 1XOAA 1SJZA 4V1Ag 1EP8A 1GSDA 1M7TA 5F0GA 1R7HA 2DSAA 1TJDA 3DRNA 5D8IA 4OO5A 2VLTA 1VF2A 1Y25A 4PNFA 3LG6A 4KGIA 4KDYA 2MMAA 5INYA 2HYXA 1OKTA 3NIVA 3IV4A 4GLTA 2NDOA 5D9VA 4ILFA 5FHIA 3GV1A 4TXOA 1A0RP 1E2YA 2YJ7A 1OC9B 1Y1UA 1QGVA 2X8CA 3APQA 2GQLA 1PKZA 1AC1A 1N8JA 2LJRA 5F06A 4MCUA 4OD7A 1AQXA 1EWXA 2HXKA 3A5IA 2H30A 1URMA 4HU7A 5H5SA 2PMTA 2YJHA 2C80A 3ZVJA 3D5JA 1YDKA 4YH2A 3FR6A 1TKDB 1F9MA 2NBSA 2VCVA 3M0FA 3FY7A 2R0PA 2HRKA 4DEJA 4KDUA 3KGKA 3H1NA 2K9FA 3J7Yb 2CAIA 1IYIA 4KF9A 4MJCA 3HVXA 4MK3A 2FWEA 2UV8G 3HJPA 3EU3A 4MP4A 4XS4A 4L0UA 4AI6A 4POMA 3VWXA 4TOPA 1SK2A 5D9WA 5F05A 3GFKA 1JZWA 19GSA 4YKFA 1MD3A 1A23A 3W8SA 3IOSA 1SK0A 5CREA 1QFNA 4NHWA 5LD0A 2H0HA 1SL2B 3APSA 2YP6A 2H8LA 4N0ZA 5KOWA 2P5QA 1XWCA 1PA3A 4KCEA 2LKUA 1TTZA 3TB2A 4D73B 3D0ZA 4I97A 3HVSA 4AKGA 5AIXA 4FIWA 5IPHA 3GKNA 2ES7A 2VCTA 4LL1B 3QAVA 5A1NA 2K8SA 1OC8A 5DJLA 4MMMA 3ISOA 2P5RA 4LMWA 2LV3A 3F4RA 5COHA 2B1KA 4HEA2 1TK0B 1B4PA 1GNWA 2QA1A 5ELGA 3QCPA 2YCDA 3RDWA 4F0CA 2PGTA 1ERVA 2KOKA 4ZBBA 5IIZA 1TXUA 3LW9A 3TKSC 2WFCA 3HHVA 3UARA 1K0NA 3I9V2 2O85A 1K3LA 2LEGA 3G7IA 1W4VA 4FYBA 4AJ6A 1B9XC 2CV4A 2HZEB 4JR6A 3LXZA 2XPDA 2Z9SA 1V2AA 3RPNA 4MJBA 1Z7RA 4MNNA 2KLXA 2C3TA 4LA1A 4EO3A 2KP2A 4KUNA 2WGRA 5G5EA 2GVPA 4OFTA 4FO5A 3WYWA 3QAWA 2L57A 1A2MA 1FOVA 5H5RA 1AXDA 3F9UA 3OR5A 4PUAA 2GQMA 1SJ6A 2OJLA 4HS1A 2XBQA 3L9VA 3R2QA 2AV4A 4MZWA 5DJMA 4PUFC 1UC7A 4IELA 2L6DA 1KNGA 4BVXA 1YKCA 1DSBA 4OWYA 5J3RA 4DSRA 2A2SA 1ACVA 2VL2A 2CAQA 4WBJA 1RK4A 2DKIA 3D6IA 3EPTA 3LQ7A 4CY6A 4TVEA 2A2PA 5HR2A 3HD5A 4EXJA 4Z7XA 2EC4A 1FHEA 3I69A 3N5OA 2F8AA 2GSSA 3P7XA 2E2GA 5KEJA 1WWJA 4GWRA 2IIYA 3H79A 4XS1A 1PQNA 3I6AA 4POKA 4I5QA 4G10A 2IMEA 1LBKA 3F6DA 2H19A 3J7Yk 1PD21 2N5FA 3TCOA 3LORA 4ZIJA 2LJAA 2OE3A 4F2IA 5DAKA 1PN9A 4GXZA 3BD2A 5JCWA 1QUWA 5BRTA 1AIUA 3QAGA 5B6NA 3ED3A 5G5FA 5IMFA 3TDGA 3P90A 2CT6A 4CDOA 1THXA 1X0RA 1F3BA 2HRAA 4O7HA 3FYGA 4OCEA 2HSNB 3VPTA 3DWVA 2JZSA 1ZL9A 1PN0A 2HRNA 5JCUA 1WRYA 1GSUA 2JU5A 3PPUA 14GSA 1FAAA 1GSSA 2DKHA 3LXTA 4PXOA 4MABA 3FZAA 3JCML 5AGYA 3DMLA 2VM1A 2GSRA 5BMUA 2I9HA 3G7YA 4QL7A 4IJ3A 3C1RA 2HSYA 1XW9A 2R3XA 2YOIA 3HJMA 5ECMB 3GSSA 4RI7A 4EIPA 3F4SA 1GNEA 1ABAA 1SVMA 2I3YA 1G0TA 4F03A 1VRSD 4QMKA 1SVOA 4KA0A 17GSA 3GIXA 1XCCA 3DD3A 2DJ1A 5J9CA 3IHQA 1OYJA 2HSHA 3LYPA 1OC9A 2PBJA 2ZUPA 3FMWA 3UEMA 4ISDA 2DMMA 2H6XA 4IKHA 4ZB9A 1SENA 4FYCA 2MBTA 2A2RA 1XIYA 3GX8A 10GSA 2X99A 4K5SA 3GL5A 2GT6A 1HNCA 4MJEA 5D9TA 1XXUA 4USSA 2HSMB 1I9DA 4GTUA 3BJ5A 1JZOA 2AUVA 5CP1A 1O7UA 4EF0A 2FA8A 4PNGA 2LJKA 2H1DA 4MDCA 4DSSB 4WR5A 1ZZYA 2YWOA 4CY8A 3V1WA 4JZQA 7GSSA 2AJQB 4KCAA 5CRDA 2N5AA 3KEBA 2K6VA 2OKAA 4GCIA 2PERA 1VF3A 3H4KA 1BX9A 1F3AA 1Z3EA 2RM6A 3HZ8A 3RAZA 2VL3A 4G19A 1A2LA 2GSTA 1B9YC 3QR6A 4NMUA 1XW6A 4PTSA 2JADA 3KH9A 2DC5A 4Z2TA 3Q19A 3LWAA 2C3QA 5H5QA 4IS0A 3I43A 2WS2A 2REMA 4TW5A 1ERWA 3F4TA 3ME7A 2VL9A 1J0FA 1B8XA 2PVQA 5JCGA 1BF5A 4ZB8A 3UIWA 8GSSA 4RQXA 4WXTA 5GAPD 1V40A 3QFBC 3DIEA 4MPFA 1K0AA 1J9BA 4K2XA 3GKMA 2YWNA 1K0BA 4O32A 3GTUB 3LSZA 1OVNA 4NPBA 2VOCA 3IC4A 2GZPA 4D73A 4EIQA 4K8MA 2ALBA 4YQVA 3MNGA 5LCZA 1HNAA 4WEYA 1YY7A 3TOTA 5KN1A 4IN0A 4W66A 1MDJA 4MPGA 3QFAC 3SBCA 2V41A 4TR3A 11GSA 1XOBA 2H0IA 2RLIA 3MDKA 5IM9A 4RUVA 2V2GA 2GZYA 1W89A 1Z6MA 1IYHA 2WCIA 3MYDA 2FLSA 3ZITA 2FNOA 1X9WB 1V58A 5G1LA 2B1LA 2X4AA 4PQIA 2PN8A 1EZKA 5CRWA 5J40A 2HZEA 5J47A 4XCSA 2DLXA 5E4WA 4L0WA 2C0GA 2C0DA 4BL7A 3TKRA 1GP1A 4HQZA 4KW6A 2VIMA 5HQPA 2KHPA 3IA1A 4EVMA 5HR0A 5IMZA 4I6XA 3ERWA 20GSA 5KN3A 2DIZA 3EWLA 4KSMA 3C73A 3ME8A 2O87A 3Q74A 3IBHA 1SKSB 4L5LA 2VLUA 4H86A 1O81A 4ZB6A 3F3RA 3IE3A 6GSYA 2X8GA 4GDFA 5EL8A 4N0VA 2P0GA 2WB9A 4TR1A 1DBYA 1EOGA 3VPQA 3LYKA 5B6MA 2GZZA 3ZFBA 5HFKA 3VWUA 3QOUA 4GSSA 2DIYA 2O89A 1H75A 1TK8B 3KZQA 2OT3A 4KB3A 3GL3A 3ZIVA 3A2WA 3GMFA 2ON7A 5B8AA 1GRXA 1EV4A 1S3DA 3U6VA 3TU3B 3EURA 4ULXA 2XBIA 1V57A 1QQ2A 1XWBA 3U5RE 3ZVJD 3FZ9A 4K2DA 4MH3A 3ERGA 4IQAA 4AKXB 3TKQA 3CYNA 1MEKA 3RHBA 4EDZA 4Q5FA 4CHSA 2J9HA 5L71A 2R37A 3G9BA 1GSFA 3F3QA 3TOUA 4EE0A 3CSJA 5JWOB 2BJXA 1ILOA 5D93A 2P31A 2CA8A 1FVJA 2H1GA 4F9ZA 5G1KA 5HFIA 1X9MB 2R6KA 3IAM2 5LNKe 1PX7A 5IPGA 1EP7A 2LNSA 1K0CA 2H76A 3TRXA 5ECKB 1MDIA 3CTFA 1XVWA 1T8EB 1G7EA 2L6CA 5DALB 2YANA 1BG5A 1NM3A 1VGLA 2LQQA 1K0OA 2LNTA 4ID0A 3MAKA 2IMKA 3CTGA 2EFDA 1LU4A 2IMFA 5A5KA 4G0LA 1Z5YE 1G6WA 4BWQA 3P8WA 1WJKA 2WULA 4NV5A 3US3A 4ML6A 2HT9A 3ZMKA 3FW2A 3LFLA 4WF4A 2C8UA 1CQGA 3CBUA 4POLA 2IPAA 4IQ1A 4AJ8A 1QK8A 4J57E 3GN3A 2IFQA 1K3OA 3HDCA 4V2LA 5GSSA 2YZHA 1ZOFA 1ON4A 2HFDA 3L4NA 9GSSA 3O3TA 4IJIA 1GUKA 2H0GA 3VLNA 1B48A 2FWGA 3M1GA 3FZ4A 3ZZXA 2OBIA 3FR3A 2A4HA 4BA7A 3O76A 4AJ7A 4HDEA 2LQOA 5IMCA 1BYEA 3UMAA 1K0DA 1FB0A 4PX1A 5D96A 2I1UA 4PGTA 2V6OA 2QA2A 1M2DA 1OE7A 1V98A 6GSWA 4PQ1A 2FA4A 2HE3A 5IMDA 2HSMA 1SYRA 3HMJG 4HJ2A 22GSA 5DBQA 2I81A 2H72A 3SWLA 5B8BA 2MZCA 2TRXA 2FGXA 3VURA 4KNDA 4I2UA 4DSSA 4FYUA 1NSWA 5KN2A 3VI7A 2PVOC 3IPZA 4TR0A 1GL8A 1GUHA 5ABRA 4HZ2A 4YQMA 1JZRA 1O8WA 3G7JA 3A3TA 4HUAA 3DVXA 4PQHA 4TXOB 3EMPA 4HOJA 2L59A 2EFEA 4PURA 3ZTLA 1HYUA 3DYRA 2EFHA 3HJOA 2I4AA 2N5BA 3FKFA 1HQOA 3QMXA 5ECQB 3KP9A 2BMXA 5KN0A 12GSA 3IDVA 1X5CA 16GSA 5F8BA 5CNWA 3C1SA 4Q5RA 1Q98A 3GTUA 4BWSA 2VCXA 2WRTA 2YZUA 1M9BA 1M99A 1TDIA 1ZYQB 2D2ZA 5ID2A 4EKZA 2IJYA 4N11A 3KH7A 1BJXA 3GRXA 1JHBA 1DE1A 4ECCA 5ECLB 4JRRA 3QDNA 2M80A 5G31A 1JZDA 1FVKA 3FHKA 1ZGNA 4X43A 4Z2UA 1QMVA 4OMVA 1YJ6A 1BEDA 4MF6A 1PKWA 4ZB7A 5J4UA 1Q4JA 2DJ0A 3HVVA 1TI1A 2H6ZA 2E7PA 1M2BA 3WT2A 1O85A 1USBA 2GDRA 4ZBDA 3TGZA 3CXGA 5CAXA 1X5EA 1ZCPA 2FD3A 4HI7A 2AHEA 4G2EA 1ZMAA 4YQUA 5C04A 1YKAA 2R0CA 2O7KA 2VCZA 2PU9C 3IK7A 2AB6A 1KTEA 3DXBA 4TKYA 3O6TA 3EMXA 3L9SA 1SJIA 2YWMA 1SK1A 2ZNMA 1BG1A 3M9JA 3UOMA 1AQWA 1EEJA 2WDUA 4BVYB 2JSZA 2V6KA 5A5HB 2HLSA 3RPPA 4WF5A 3VK9A 3KCMA 3VWVA 2VKZG 1TXXA 3M8NA 5AN1A 4J2FA 3W8JA 3HXSA 3IR4A 4K5RA 2M72A 4V2NA 1VF1A 4DSQA 3UVTA 3WGDA 3ERFA 1DUGA 1EOHA 1UN2A 3KTBA 4OFNA 1TRUA 1EGRA 5JWQB 3QD9A 1AW9A 4L5OA 2YPMA 2YV9A 3VI5A 4MA9A 2LUSA 3GSTA 3TRQA 1R4WA 5CRHA 18GSA 1THOA 3N9JA 4O5QA 2IMIA 3KTLA 1SYXA 1SKWB 1GH2A 1T3BA 3KM6A 4IP6A 5J9BA 4IW9A 2VO4A 3DVWA 5HR3A 2B5YA 4E68A 3A2XA 1Z6NA 2YV7A 4OCFA 5ENUA 5FT3A 5JWRB 2FY6A 1TK5B 2OADA 3C8EA 3IAS2 4IGJA 4O5RA 1YF1A 4AF2A 4DVCA 4K0GA 2O5VA 4Q5QA 1SD8A 1N2AA 3ZFLA 1RQMA 3M3MA 2GT5A 5ECHB 1TU8A 2VUPA 2IMDA 5DALA 4GRFA 3PR8A 2F51A 3KMOA 4KX4A 4I8BA 6GSVA 2E2MA 2RM5A 1VF4A 3VWWA 1FO5A 1Z9HA 2HZFA 5A4UA 5GAND 5J41A 2L5LA 1ERTA 1U3IA 4LLRA 3APOA 2PWJA 3CRUA 2TRCP 2F9SA 2RUFA 2LS5A 1FW1A 4ECBA 2JACA 2L4CA 5DQSA 4KH7A 2LRCA 3F0IA 2X49A 4YKGA 1UVZA 2HQTA 3UAPA 2HNLA 2DMLA 4EUYA 2WJUA 1WIKA 4JEDA 1O6JA 1KEBA 4K7OA 4JE1A 1SL1B 1PMTA 5EVOA 3FZ5A 4JBBA 1YZXA 3GUSA 2L4QA 5D9XA 2C1YA 1ERUA 2NVLA 4I2TA 1TRWA 1XWAA 4QL9A 4Q5NA 4ACSA 4XIHA 4E8HA 3P2AA 4X0XA 4Z2RA 3MIXA 2XC2A 1X9SB 1S3CA 3EVIA 4MLYA 1M9AA 2CVBA 2G2QA 3IC8A 2H1BA 2K18A 2FHEA 1WP0A 3GH9A 3BOAA 4XHMA 3E9JB 1O73A 3M9KA 2F8FA 3ZYWA 4A5PA 4KAEA 1YVLA 3HYPA 4EL1A 1GLPA 1EGOA 2H01A 1AUCA 2VCWA 1AAZA 4NV2A 3KIJA 3WGEA 4K9ZA 3BBYA 3TJJA 3ZIJA 1T7PB 4HQSA 1GSQA 2GS3A 1F37A 4BPYA 1R5PA 1ZYEA 3GH6A 4GSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UA5 A;  4AGS A;  5HR1 A;  4EDY A;  3TJB A;  5ELA A;  1BQ7 A;  2CVD A;  5D73 A;  4N30 A;  1NW2 A;  3A5W A;  1PSQ A;  3GHA A;  5DCH A;  4IVF A;  2GSQ A;  2HRF A;  4IBP A;  1K3Y A;  2X8H A;  4OO4 A;  4NWY A;  3F6F A;  3HKR A;  2CQ9 A;  5J5N A;  1TOF A;  3HCZ A;  1EEM A;  3E0U A;  5HFG A;  1F6M C;  2A4V A;  4KE3 A;  3TJK A;  3UL3 A;  4NXI A;  1SKR B;  3HA9 A;  5CRG A;  4TR4 A;  1JLV A;  3KD0 A;  3BCK A;  1YEX A;  5IOW A;  4MJA A;  1GUM A;  3KP8 A;  2LTK A;  3HY2 A;  1TW9 A;  2NPB A;  4LL4 B;  3GKX A;  4O92 A;  2GLR A;  3FK8 A;  4ECI A;  3L0H A;  4GF0 A;  2B6M A;  3UVH A;  5DDL A;  2QC7 A;  4V2M A;  2GGT A;  2C4J A;  3KXO A;  2XHF A;  3L9U A;  3C71 A;  3PGT A;  3ZML A;  1I5G A;  1LJR A;  3H8Q A;  3K8N A;  1G6Y A;  1T4Y A;  1M0U A;  2JZR A;  1M2A A;  1EV9 A;  3F63 A;  5ECN B;  3HZ4 A;  1GTB A;  3KJY A;  3LGC A;  3PIN A;  4OFM A;  1JFU A;  2GQK A;  4BVY A;  2DBC A;  2FCH A;  2R2J A;  2B5X A;  2RII A;  4ZBA A;  2R5G A;  2MMZ A;  1F2E A;  2VL2 C;  2FWF A;  3TKS E;  2AYT A;  2OE1 A;  1XWG A;  3F8U A;  2H6Y A;  2XPE A;  3GA4 A;  4JR4 A;  1XW5 A;  1WPI A;  2PUK C;  4F82 A;  3TJF A;  5IOX A;  5B7C A;  2VLV A;  1TU7 A;  4TRX A;  2X64 A;  1XFL A;  3DEX A;  1A8L A;  5CO3 A;  3WT1 A;  2KP1 A;  3TJG A;  1BAY A;  1TRV A;  2NTO A;  2VCQ A;  4BL7 B;  2OA7 A;  1TRS A;  1WOU A;  4KDX A;  2OE0 A;  2YN1 A;  3EC3 A;  1U88 A;  1Y6E A;  3Q18 A;  4K0N A;  1GTU A;  2G0F A;  2DJJ A;  2MBS A;  3WD6 A;  2V32 A;  5F07 A;  1OC3 A;  3D4T A;  5GST A;  2H74 A;  2QKE A;  4NAX A;  4K7I A;  4MF7 A;  4YAP A;  1HNB A;  5E59 A;  1FG4 A;  2MMN A;  5AIS A;  3TKS A;  3CSH A;  3H93 A;  1Z7P A;  1QXH A;  4TR1 B;  2H1A A;  3FRC A;  1HD2 A;  1SD9 A;  1T1V A;  2WZ9 A;  2C0F A;  3EYT A;  3PH9 A;  1JLW A;  2PPT A;  1B4Q A;  3TKP A;  3LEF A;  2L5O A;  1GSY A;  3GYK A;  4TXV A;  4P3Y B;  4HZ4 A;  4XS6 A;  1PL2 A;  1YEP A;  3GKK A;  1U87 A;  1U6T A;  2V1M A;  3L78 A;  5IQY A;  3FR9 A;  2RUE A;  2DJK A;  2GTU A;  3GX0 A;  2QGV A;  4MZC A;  2B7J A;  4GQC A;  1V9W A;  2CZ2 A;  1R26 A;  3UBK A;  1CQH A;  5ECR B;  1T00 A;  2HRK B;  4XRA A;  4IP1 A;  3S9F A;  4L8E A;  1OKD A;  2CX3 A;  3GNJ A;  4GST A;  1X5D A;  6GSU A;  1MDK A;  1PRX A;  3ZRD A;  3MSZ A;  1YF0 A;  3VFI A;  4WET A;  1GTI A;  3UBL A;  1NHO A;  1A8Y A;  1KBN A;  2EIQ A;  2KUC A;  2CZ3 A;  4ML1 A;  4XS4 B;  3C7M A;  5IO2 A;  1PX6 A;  5IMA A;  3R3E A;  4N10 A;  2K8V A;  3D22 A;  2H75 A;  5DCG A;  1T4Z A;  1WE0 A;  4FH8 A;  4ECJ A;  4ZL7 A;  3A2V A;  6GSS A;  5ECP B;  2H73 A;  1GUL A;  5A4W A;  4RI6 A;  5ECI B;  3EE2 A;  1GWC A;  2H71 A;  5C00 A;  2YWI A;  3IXR A;  3TUE A;  4WR4 A;  4POB A;  2C3N A;  2VD0 A;  2H70 A;  4E8E A;  4X1U A;  5EPF A;  3TRP A;  2VAF A;  4ZXG A;  2IFQ B;  1O8X A;  4G0I A;  1R5A A;  2IN3 A;  3NOF A;  1U3A A;  1GLQ A;  3DGQ A;  4QQ7 A;  3D21 A;  1YQ1 A;  4IHU A;  4HJM A;  1J08 A;  4MH2 A;  3RHC A;  4YAV A;  2CX4 A;  6GSX A;  2O8V B;  2B5E A;  2E0Q A;  4ZL8 A;  4MZB A;  3WGX A;  2FUG 2;  1K0M A;  5AIV A;  1WMJ A;  4EC0 A;  4LMV A;  1XBS A;  1A0F A;  3UJ1 A;  2UZ8 A;  2QSI A;  2JZT A;  4FQU A;  3IK9 A;  2MMO A;  1NHY A;  3QPM A;  1XVQ A;  2OBK A;  2AAW A;  2JL4 A;  4WBR D;  2J23 A;  4G9H A;  4K7N A;  5GZZ B;  1MTC A;  4MF5 A;  13GS A;  1DE2 A;  2B7K A;  1A2J A;  1GTA A;  1TP9 A;  4HU9 A;  2R4V A;  1PL1 A;  3LJR A;  3ZRE A;  4BVX B;  2DJ3 A;  3IRA A;  4KSO A;  3GUR A;  3W6G A;  5G30 A;  2IL3 A;  2M46 A;  1XZO A;  2LRT A;  4G0K A;  1AQV A;  3CSI A;  6GST A;  2MYG A;  1G7O A;  2YNX A;  1A24 A;  4TN8 A;  4JU5 A;  1XPV A;  4RQR A;  4XTS A;  4F0B A;  3CRT A;  2LST A;  1XWK A;  1ML6 A;  3KMN A;  2ZCT A;  5ECO B;  1H4O A;  5IO0 A;  4NHZ A;  4WKW A;  2EIO A;  4K6X A;  5CYY A;  3E3E A;  1PGT A;  2EIR A;  1FB6 A;  5DAK B;  5FWG A;  2IWT A;  3RBT A;  4XRD A;  3AY8 A;  2F3M A;  5ID2 B;  5DVB A;  2HI7 A;  1OAZ A;  3Q6O A;  1S3A A;  2FWH A;  1OE8 A;  1GSE A;  4ZIL A;  2BTO T;  1RW1 A;  1SU9 A;  2CVK A;  2JSY A;  2H66 A;  3MWH A;  2TIR A;  1TI3 A;  5DQY A;  1ST9 A;  2DJ2 A;  3DKS A;  3ZLP A;  3D4M A;  2LRN A;  3FEU A;  5ECS A;  2B3S A;  2OAC A;  3EIN A;  4GQF A;  4CW9 A;  2VM2 A;  3NZN A;  1MD4 A;  5IMV A;  3EU4 A;  2C0E A;  1SL0 B;  3ZL5 A;  2VD1 A;  4ZL9 A;  5EY6 A;  1E6B A;  3BCI A;  4K1F A;  4V1A p;  5G2Z A;  4J56 E;  1C72 A;  2ON5 A;  3CMI A;  5A4V A;  1XOA A;  1SJZ A;  4V1A g;  1EP8 A;  1GSD A;  1M7T A;  5F0G A;  1R7H A;  2DSA A;  1TJD A;  3DRN A;  5D8I A;  4OO5 A;  2VLT A;  1VF2 A;  1Y25 A;  4PNF A;  3LG6 A;  4KGI A;  4KDY A;  2MMA A;  5INY A;  2HYX A;  1OKT A;  3NIV A;  3IV4 A;  4GLT A;  2NDO A;  5D9V A;  4ILF A;  5FHI A;  3GV1 A;  4TXO A;  1A0R P;  1E2Y A;  2YJ7 A;  1OC9 B;  1QGV A;  2X8C A;  3APQ A;  2GQL A;  1PKZ A;  1AC1 A;  1N8J A;  2LJR A;  5F06 A;  4MCU A;  4OD7 A;  1AQX A;  1EWX A;  2HXK A;  2H30 A;  1URM A;  4HU7 A;  5H5S A;  2PMT A;  2YJH A;  2C80 A;  3ZVJ A;  3D5J A;  1YDK A;  4YH2 A;  3FR6 A;  1TKD B;  1F9M A;  2NBS A;  2VCV A;  3M0F A;  3FY7 A;  2HRK A;  4DEJ A;  4KDU A;  3KGK A;  3H1N A;  2K9F A;  3J7Y b;  2CAI A;  1IYI A;  4KF9 A;  4MJC A;  3HVX A;  4MK3 A;  2FWE A;  3HJP A;  3EU3 A;  4MP4 A;  4XS4 A;  4L0U A;  4POM A;  3VWX A;  4TOP A;  1SK2 A;  5D9W A;  5F05 A;  3GFK A;  1JZW A;  19GS A;  1MD3 A;  1A23 A;  3W8S A;  3IOS A;  1SK0 A;  5CRE A;  1QFN A;  4NHW A;  5LD0 A;  2H0H A;  1SL2 B;  3APS A;  2YP6 A;  2H8L A;  4N0Z A;  2P5Q A;  1XWC A;  1PA3 A;  4KCE A;  2LKU A;  1TTZ A;  3TB2 A;  4D73 B;  3D0Z A;  4I97 A;  3HVS A;  4FIW A;  5AIX A;  5IPH A;  3GKN A;  2ES7 A;  2VCT A;  4LL1 B;  3QAV A;  2K8S A;  1OC8 A;  5DJL A;  4MMM A;  3ISO A;  2P5R A;  4LMW A;  2LV3 A;  3F4R A;  5COH A;  2B1K A;  4HEA 2;  1TK0 B;  1B4P A;  1GNW A;  5ELG A;  3QCP A;  2YCD A;  3RDW A;  4F0C A;  2PGT A;  1ERV A;  2KOK A;  4ZBB A;  5IIZ A;  3TKS C;  2WFC A;  3HHV A;  3UAR A;  1K0N A;  3I9V 2;  2O85 A;  1K3L A;  2LEG A;  3G7I A;  1W4V A;  4FYB A;  4AJ6 A;  1B9X C;  2CV4 A;  2HZE B;  4JR6 A;  3LXZ A;  2XPD A;  2Z9S A;  1V2A A;  3RPN A;  4MJB A;  1Z7R A;  2KLX A;  2C3T A;  4LA1 A;  4EO3 A;  2KP2 A;  4KUN A;  2WGR A;  5G5E A;  2GVP A;  4OFT A;  4FO5 A;  3WYW A;  3QAW A;  2L57 A;  1A2M A;  1FOV A;  5H5R A;  1AXD A;  3F9U A;  3OR5 A;  4PUA A;  2GQM A;  1SJ6 A;  2OJL A;  4HS1 A;  2XBQ A;  3L9V A;  3R2Q A;  2AV4 A;  4MZW A;  5DJM A;  4PUF C;  1UC7 A;  4IEL A;  2L6D A;  1KNG A;  4BVX A;  1YKC A;  1DSB A;  4OWY A;  5J3R A;  4DSR A;  2A2S A;  1ACV A;  2VL2 A;  2CAQ A;  4WBJ A;  1RK4 A;  3D6I A;  3LQ7 A;  4TVE A;  5HR2 A;  3HD5 A;  4EXJ A;  4Z7X A;  2EC4 A;  1FHE A;  3I69 A;  3N5O A;  2F8A A;  2GSS A;  3P7X A;  2E2G A;  5KEJ A;  1WWJ A;  4GWR A;  2IIY A;  3H79 A;  4XS1 A;  1PQN A;  3I6A A;  4POK A;  4I5Q A;  4G10 A;  2IME A;  1LBK A;  3F6D A;  2H19 A;  3J7Y k;  1PD2 1;  2N5F A;  3TCO A;  3LOR A;  4ZIJ A;  2LJA A;  2OE3 A;  4F2I A;  5DAK A;  1PN9 A;  4GXZ A;  3BD2 A;  5JCW A;  1QUW A;  1AIU A;  3QAG A;  5B6N A;  3ED3 A;  5G5F A;  5IMF A;  3TDG A;  3P90 A;  2CT6 A;  4CDO A;  1THX A;  1X0R A;  1F3B A;  2HRA A;  4O7H A;  3FYG A;  4OCE A;  2HSN B;  3VPT A;  3DWV A;  2JZS A;  1ZL9 A;  2HRN A;  5JCU A;  1WRY A;  1GSU A;  2JU5 A;  3PPU A;  14GS A;  1FAA A;  1GSS A;  3LXT A;  4PXO A;  4MAB A;  3FZA A;  3JCM L;  5AGY A;  3DML A;  2VM1 A;  2GSR A;  5BMU A;  2I9H A;  3G7Y A;  4QL7 A;  4IJ3 A;  3C1R A;  2HSY A;  1XW9 A;  2R3X A;  2YOI A;  3HJM A;  5ECM B;  3GSS A;  4RI7 A;  3F4S A;  1GNE A;  1ABA A;  2I3Y A;  1G0T A;  4F03 A;  1VRS D;  4KA0 A;  17GS A;  3GIX A;  1XCC A;  3DD3 A;  2DJ1 A;  5J9C A;  3IHQ A;  1OYJ A;  2HSH A;  3LYP A;  1OC9 A;  2PBJ A;  2ZUP A;  3UEM A;  4ISD A;  2DMM A;  2H6X A;  4IKH A;  4ZB9 A;  1SEN A;  4FYC A;  2MBT A;  2A2R A;  1XIY A;  3GX8 A;  10GS A;  2X99 A;  3GL5 A;  2GT6 A;  1HNC A;  4MJE A;  5D9T A;  1XXU A;  4USS A;  2HSM B;  1I9D A;  4GTU A;  3BJ5 A;  1JZO A;  2AUV A;  5CP1 A;  1O7U A;  4EF0 A;  2FA8 A;  4PNG A;  2LJK A;  2H1D A;  4MDC A;  4DSS B;  4WR5 A;  1ZZY A;  2YWO A;  3V1W A;  4JZQ A;  7GSS A;  2AJQ B;  4KCA A;  5CRD A;  2N5A A;  3KEB A;  2K6V A;  2OKA A;  4GCI A;  2PER A;  1VF3 A;  3H4K A;  1BX9 A;  1F3A A;  1Z3E A;  2RM6 A;  3HZ8 A;  3RAZ A;  2VL3 A;  4G19 A;  1A2L A;  2GST A;  1B9Y C;  3QR6 A;  4NMU A;  1XW6 A;  4PTS A;  2JAD A;  3KH9 A;  2DC5 A;  3Q19 A;  3LWA A;  2C3Q A;  5H5Q A;  4IS0 A;  3I43 A;  2WS2 A;  2REM A;  4TW5 A;  1ERW A;  3F4T A;  3ME7 A;  2VL9 A;  1J0F A;  1B8X A;  2PVQ A;  5JCG A;  4ZB8 A;  3UIW A;  8GSS A;  4RQX A;  4WXT A;  5GAP D;  1V40 A;  3QFB C;  3DIE A;  4MPF A;  1K0A A;  1J9B A;  3GKM A;  2YWN A;  1K0B A;  4O32 A;  3GTU B;  3LSZ A;  1OVN A;  4NPB A;  2VOC A;  3IC4 A;  2GZP A;  4D73 A;  4K8M A;  2ALB A;  4YQV A;  3MNG A;  5LCZ A;  1HNA A;  4WEY A;  1YY7 A;  3TOT A;  5KN1 A;  4IN0 A;  1MDJ A;  4MPG A;  3QFA C;  3SBC A;  2V41 A;  4TR3 A;  11GS A;  1XOB A;  2H0I A;  2RLI A;  3MDK A;  5IM9 A;  4RUV A;  2V2G A;  2GZY A;  1W89 A;  1Z6M A;  1IYH A;  2WCI A;  2FLS A;  3ZIT A;  2FNO A;  1X9W B;  1V58 A;  5G1L A;  2B1L A;  4PQI A;  2PN8 A;  1EZK A;  5CRW A;  2HZE A;  4XCS A;  2DLX A;  5E4W A;  4L0W A;  2C0G A;  2C0D A;  4BL7 A;  3TKR A;  1GP1 A;  4HQZ A;  4KW6 A;  2VIM A;  5HQP A;  2KHP A;  3IA1 A;  4EVM A;  5HR0 A;  5IMZ A;  4I6X A;  3ERW A;  20GS A;  5KN3 A;  2DIZ A;  3EWL A;  4KSM A;  3C73 A;  3ME8 A;  2O87 A;  3Q74 A;  3IBH A;  1SKS B;  4L5L A;  2VLU A;  4H86 A;  1O81 A;  4ZB6 A;  3F3R A;  3IE3 A;  6GSY A;  2X8G A;  5EL8 A;  4N0V A;  2P0G A;  2WB9 A;  4TR1 A;  1DBY A;  1EOG A;  3VPQ A;  3LYK A;  5B6M A;  2GZZ A;  3ZFB A;  5HFK A;  3VWU A;  3QOU A;  4GSS A;  2DIY A;  2O89 A;  1H75 A;  1TK8 B;  3KZQ A;  4KB3 A;  3GL3 A;  3ZIV A;  3A2W A;  3GMF A;  2ON7 A;  5B8A A;  1GRX A;  1EV4 A;  1S3D A;  3U6V A;  3EUR A;  4ULX A;  2XBI A;  1V57 A;  1QQ2 A;  1XWB A;  3U5R E;  3ZVJ D;  3FZ9 A;  4K2D A;  4MH3 A;  3ERG A;  4IQA A;  3TKQ A;  3CYN A;  1MEK A;  3RHB A;  4EDZ A;  4Q5F A;  4CHS A;  2J9H A;  5L71 A;  2R37 A;  3G9B A;  1GSF A;  3F3Q A;  3TOU A;  4EE0 A;  3CSJ A;  5JWO B;  2BJX A;  1ILO A;  5D93 A;  2P31 A;  2CA8 A;  1FVJ A;  2H1G A;  4F9Z A;  5G1K A;  5HFI A;  1X9M B;  2R6K A;  3IAM 2;  5LNK e;  1PX7 A;  5IPG A;  1EP7 A;  2LNS A;  1K0C A;  2H76 A;  3TRX A;  5ECK B;  1MDI A;  3CTF A;  1XVW A;  1T8E B;  1G7E A;  2L6C A;  5DAL B;  2YAN A;  1BG5 A;  1NM3 A;  1VGL A;  2LQQ A;  1K0O A;  2LNT A;  4ID0 A;  3MAK A;  2IMK A;  3CTG A;  1LU4 A;  2IMF A;  5A5K A;  4G0L A;  1Z5Y E;  1G6W A;  4BWQ A;  3P8W A;  1WJK A;  2WUL A;  4NV5 A;  3US3 A;  4ML6 A;  2HT9 A;  3ZMK A;  3FW2 A;  3LFL A;  4WF4 A;  2C8U A;  1CQG A;  3CBU A;  4POL A;  2IPA A;  4IQ1 A;  4AJ8 A;  1QK8 A;  4J57 E;  3GN3 A;  2IFQ A;  1K3O A;  3HDC A;  4V2L A;  5GSS A;  2YZH A;  1ZOF A;  1ON4 A;  2HFD A;  3L4N A;  9GSS A;  3O3T A;  4IJI A;  1GUK A;  2H0G A;  3VLN A;  1B48 A;  2FWG A;  3M1G A;  3FZ4 A;  3ZZX A;  2OBI A;  3FR3 A;  4BA7 A;  3O76 A;  4AJ7 A;  4HDE A;  2LQO A;  5IMC A;  1BYE A;  3UMA A;  1K0D A;  1FB0 A;  4PX1 A;  5D96 A;  2I1U A;  4PGT A;  2V6O A;  1M2D A;  1OE7 A;  1V98 A;  6GSW A;  4PQ1 A;  2FA4 A;  2HE3 A;  5IMD A;  2HSM A;  1SYR A;  4HJ2 A;  22GS A;  5DBQ A;  2I81 A;  2H72 A;  3SWL A;  5B8B A;  2MZC A;  2TRX A;  2FGX A;  3VUR A;  4KND A;  4I2U A;  4DSS A;  4FYU A;  1NSW A;  5KN2 A;  3VI7 A;  2PVO C;  3IPZ A;  4TR0 A;  1GL8 A;  1GUH A;  5ABR A;  4HZ2 A;  4YQM A;  1JZR A;  1O8W A;  3G7J A;  3A3T A;  4HUA A;  3DVX A;  4PQH A;  4TXO B;  3EMP A;  4HOJ A;  2L59 A;  4PUR A;  3ZTL A;  1HYU A;  3DYR A;  3HJO A;  2I4A A;  2N5B A;  3FKF A;  1HQO A;  3QMX A;  5ECQ B;  3KP9 A;  2BMX A;  5KN0 A;  12GS A;  3IDV A;  1X5C A;  16GS A;  5F8B A;  5CNW A;  3C1S A;  4Q5R A;  1Q98 A;  3GTU A;  4BWS A;  2VCX A;  2WRT A;  2YZU A;  1M9B A;  1M99 A;  1TDI A;  1ZYQ B;  2D2Z A;  5ID2 A;  4EKZ A;  2IJY A;  4N11 A;  3KH7 A;  1BJX A;  3GRX A;  1JHB A;  1DE1 A;  4ECC A;  5ECL B;  4JRR A;  3QDN A;  2M80 A;  5G31 A;  1JZD A;  1FVK A;  3FHK A;  1ZGN A;  4X43 A;  1QMV A;  4OMV A;  1YJ6 A;  1BED A;  4MF6 A;  1PKW A;  5J4U A;  1Q4J A;  2DJ0 A;  3HVV A;  1TI1 A;  2H6Z A;  2E7P A;  1M2B A;  3WT2 A;  1O85 A;  1USB A;  2GDR A;  4ZBD A;  3TGZ A;  3CXG A;  5CAX A;  1X5E A;  1ZCP A;  2FD3 A;  4HI7 A;  2AHE A;  4G2E A;  1ZMA A;  4YQU A;  5C04 A;  1YKA A;  2O7K A;  2VCZ A;  2PU9 C;  3IK7 A;  2AB6 A;  1KTE A;  3DXB A;  4TKY A;  3O6T A;  3EMX A;  3L9S A;  1SJI A;  2YWM A;  1SK1 A;  2ZNM A;  3M9J A;  3UOM A;  1AQW A;  1EEJ A;  2WDU A;  4BVY B;  2JSZ A;  2V6K A;  2HLS A;  3RPP A;  4WF5 A;  3VK9 A;  3KCM A;  3VWV A;  1TXX A;  3M8N A;  5AN1 A;  4J2F A;  3W8J A;  3HXS A;  3IR4 A;  2M72 A;  4V2N A;  1VF1 A;  4DSQ A;  3UVT A;  3WGD A;  3ERF A;  1DUG A;  1EOH A;  1UN2 A;  3KTB A;  4OFN A;  1TRU A;  1EGR A;  5JWQ B;  3QD9 A;  1AW9 A;  4L5O A;  2YPM A;  2YV9 A;  3VI5 A;  4MA9 A;  2LUS A;  3GST A;  3TRQ A;  1R4W A;  5CRH A;  18GS A;  1THO A;  3N9J A;  2IMI A;  3KTL A;  1SYX A;  1SKW B;  1GH2 A;  1T3B A;  3KM6 A;  4IP6 A;  5J9B A;  4IW9 A;  2VO4 A;  3DVW A;  5HR3 A;  2B5Y A;  3A2X A;  1Z6N A;  2YV7 A;  4OCF A;  5ENU A;  5FT3 A;  5JWR B;  2FY6 A;  1TK5 B;  2OAD A;  3C8E A;  3IAS 2;  4IGJ A;  4O5R A;  1YF1 A;  4AF2 A;  4DVC A;  4K0G A;  4Q5Q A;  1SD8 A;  1N2A A;  3ZFL A;  1RQM A;  3M3M A;  2GT5 A;  5ECH B;  1TU8 A;  2VUP A;  2IMD A;  5DAL A;  4GRF A;  3PR8 A;  2F51 A;  3KMO A;  4KX4 A;  4I8B A;  6GSV A;  2E2M A;  2RM5 A;  1VF4 A;  3VWW A;  1FO5 A;  1Z9H A;  2HZF A;  5A4U A;  5GAN D;  5J41 A;  2L5L A;  1ERT A;  1U3I A;  4LLR A;  3APO A;  2PWJ A;  3CRU A;  2TRC P;  2F9S A;  2RUF A;  2LS5 A;  1FW1 A;  4ECB A;  2JAC A;  2L4C A;  5DQS A;  4KH7 A;  2LRC A;  3F0I A;  1UVZ A;  2HQT A;  3UAP A;  2HNL A;  2DML A;  4EUY A;  2WJU A;  1WIK A;  4JED A;  1O6J A;  1KEB A;  4K7O A;  4JE1 A;  1SL1 B;  1PMT A;  5EVO A;  3FZ5 A;  4JBB A;  1YZX A;  3GUS A;  2L4Q A;  5D9X A;  2C1Y A;  1ERU A;  2NVL A;  4I2T A;  1TRW A;  1XWA A;  4QL9 A;  4Q5N A;  4ACS A;  4XIH A;  4E8H A;  3P2A A;  4X0X A;  2XC2 A;  1X9S B;  1S3C A;  3EVI A;  4MLY A;  1M9A A;  2CVB A;  2G2Q A;  3IC8 A;  2H1B A;  2K18 A;  2FHE A;  1WP0 A;  3GH9 A;  3BOA A;  4XHM A;  3E9J B;  1O73 A;  3M9K A;  2F8F A;  3ZYW A;  4KAE A;  3HYP A;  4EL1 A;  1GLP A;  1EGO A;  2H01 A;  1AUC A;  2VCW A;  1AAZ A;  4NV2 A;  3KIJ A;  3WGE A;  4K9Z A;  3BBY A;  3TJJ A;  3ZIJ A;  1T7P B;  4HQS A;  1GSQ A;  2GS3 A;  1F37 A;  4BPY A;  1R5P A;  1ZYE A;  3GH6 A;  4GSN A; 
#chains in the Genus database with same CATH topology
 1UA5 A;  4AGS A;  5HR1 A;  4EDY A;  3TJB A;  5ELA A;  1BQ7 A;  2CVD A;  5D73 A;  4N30 A;  1NW2 A;  3A5W A;  1PSQ A;  3GHA A;  5DCH A;  4IVF A;  2GSQ A;  1SVL A;  2HRF A;  4IBP A;  1K3Y A;  1ZYP A;  2X8H A;  4OO4 A;  4NWY A;  3F6F A;  3HKR A;  2CQ9 A;  5J5N A;  1TOF A;  3HCZ A;  1EEM A;  3E0U A;  4ICY A;  1F6M C;  5HFG A;  2A4V A;  4KE3 A;  3TJK A;  3UL3 A;  4NXI A;  1SKR B;  3HA9 A;  2HSN A;  5CRG A;  4TR4 A;  5A34 B;  1JLV A;  3KD0 A;  3BCK A;  1YEX A;  5IOW A;  4MJA A;  5KOX A;  1GUM A;  3KP8 A;  2LTK A;  3HY2 A;  1TW9 A;  2NPB A;  4LL4 B;  3GKX A;  4O92 A;  2GLR A;  3FK8 A;  4ECI A;  3L0H A;  3RGB C;  4GF0 A;  2B6M A;  3UVH A;  1N25 A;  5DDL A;  2QC7 A;  2WVY A;  4V2M A;  2GGT A;  2C4J A;  3KXO A;  2XHF A;  3L9U A;  3C71 A;  3PGT A;  3ZML A;  1I5G A;  1LJR A;  3H8Q A;  3K8N A;  1G6Y A;  1T4Y A;  1M0U A;  2JZR A;  1M2A A;  1EV9 A;  3F63 A;  2EFC A;  5ECN B;  3HZ4 A;  1GTB A;  3KJY A;  3CWG A;  3LGC A;  3PIN A;  4OFM A;  1JFU A;  2GQK A;  4BVY A;  2DBC A;  5A5H A;  2FCH A;  2R2J A;  2B5X A;  2RII A;  4ZBA A;  2R5G A;  2MMZ A;  1F2E A;  2VL2 C;  2FWF A;  3TKS E;  2AYT A;  2OE1 A;  4N3Z A;  1XWG A;  3F8U A;  2H6Y A;  2XPE A;  3GA4 A;  4JR4 A;  1XW5 A;  1WPI A;  2PUK C;  4F82 A;  3TJF A;  5IOX A;  5B7C A;  2VLV A;  1TU7 A;  4TRX A;  2X64 A;  1XFL A;  3DEX A;  1A8L A;  5CO3 A;  3WT1 A;  2KP1 A;  3TJG A;  1BAY A;  1TRV A;  2NTO A;  2VCQ A;  4BL7 B;  2OA7 A;  1TRS A;  1WOU A;  4KDX A;  2OE0 A;  2YN1 A;  3EC3 A;  4O5U A;  1U88 A;  1Y6E A;  3Q18 A;  4K0N A;  1PFO A;  1GTU A;  2G0F A;  2DJJ A;  2MBS A;  3WD6 A;  2V32 A;  5F07 A;  1OC3 A;  3IHG A;  3D4T A;  5GST A;  2H74 A;  2QKE A;  4NAX A;  4K7I A;  4MF7 A;  4YAP A;  1HNB A;  5E59 A;  5J4V A;  1FG4 A;  2MMN A;  5AIS A;  3TKS A;  3CSH A;  3H93 A;  1Z7P A;  1ZYN A;  1QXH A;  4TR1 B;  2H1A A;  3FRC A;  1HD2 A;  1SD9 A;  1T1V A;  2WZ9 A;  2C0F A;  3EYT A;  3PH9 A;  1JLW A;  2PPT A;  1B4Q A;  2R0G A;  3TKP A;  3LEF A;  2L5O A;  1GSY A;  3GYK A;  4TXV A;  4P3Y B;  4HZ4 A;  4XS6 A;  1PL2 A;  1YEP A;  3GKK A;  1U87 A;  1U6T A;  2V1M A;  3L78 A;  5IQY A;  3FR9 A;  2RUE A;  3HVN A;  1FOH A;  2DJK A;  2GTU A;  3GX0 A;  4AKI A;  2QGV A;  4MZC A;  2B7J A;  4GQC A;  1V9W A;  2CZ2 A;  1R26 A;  3UBK A;  1CQH A;  5ECR B;  1T00 A;  2HRK B;  4XRA A;  4IP1 A;  3S9F A;  1YEW C;  4L8E A;  1OKD A;  2CX3 A;  3GNJ A;  4GST A;  1X5D A;  6GSU A;  1MDK A;  1PRX A;  3ZRD A;  3MSZ A;  1YF0 A;  3VFI A;  4WET A;  1GTI A;  3UBL A;  1NHO A;  1A8Y A;  1KBN A;  2EIQ A;  2KUC A;  2CZ3 A;  4ML1 A;  4XS4 B;  3C7M A;  5IO2 A;  1PX6 A;  5IMA A;  3R3E A;  4N10 A;  2K8V A;  3D22 A;  2H75 A;  5DCG A;  1T4Z A;  1WE0 A;  4FH8 A;  4ECJ A;  4ZL7 A;  3A2V A;  6GSS A;  5ECP B;  2H73 A;  1GUL A;  5A4W A;  4RI6 A;  1M3J A;  5ECI B;  3EE2 A;  1GWC A;  2H71 A;  5C00 A;  2YWI A;  3IXR A;  3TUE A;  4WR4 A;  4POB A;  2C3N A;  2VD0 A;  2H70 A;  4E8E A;  4X1U A;  5EPF A;  3TRP A;  5A1N B;  2VAF A;  4ZXG A;  2IFQ B;  1O8X A;  4G0I A;  1R5A A;  2IN3 A;  3NOF A;  1U3A A;  1GLQ A;  3DGQ A;  4QQ7 A;  3D21 A;  1YQ1 A;  4IHU A;  4HJM A;  1J08 A;  4MH2 A;  3RHC A;  4YAV A;  2CX4 A;  6GSX A;  2O8V B;  2B5E A;  2E0Q A;  4ZL8 A;  4MZB A;  3WGX A;  2FUG 2;  1K0M A;  5AIV A;  1WMJ A;  4EC0 A;  2H1L A;  4LMV A;  1XBS A;  1A0F A;  3UJ1 A;  2UZ8 A;  2QSI A;  2JZT A;  4FQU A;  3IK9 A;  2MMO A;  1NHY A;  3QPM A;  5J4Y A;  1XVQ A;  2OBK A;  2AAW A;  2JL4 A;  4WBR D;  2J23 A;  4G9H A;  4K7N A;  5GZZ B;  1MTC A;  4MF5 A;  13GS A;  1DE2 A;  2B7K A;  1A2J A;  1GTA A;  1TP9 A;  4HU9 A;  2R4V A;  1PL1 A;  3LJR A;  3ZRE A;  4BVX B;  2DJ3 A;  3IRA A;  4AKH A;  5A34 A;  4KSO A;  3GUR A;  3W6G A;  5G30 A;  2IL3 A;  2M46 A;  1XZO A;  2LRT A;  4G0K A;  1AQV A;  3CSI A;  6GST A;  2MYG A;  1G7O A;  2YNX A;  1A24 A;  4TN8 A;  4JU5 A;  1XPV A;  4RQR A;  4XTS A;  4F0B A;  3CRT A;  2LST A;  1XWK A;  1ML6 A;  3KMN A;  2ZCT A;  5ECO B;  1H4O A;  4G01 A;  5IO0 A;  4NHZ A;  4WKW A;  2EIO A;  4K6X A;  5CYY A;  3E3E A;  1PGT A;  2EIR A;  1FB6 A;  5DAK B;  5FWG A;  4X4J A;  2IWT A;  3RBT A;  4XRD A;  3AY8 A;  2F3M A;  5ID2 B;  5DVB A;  2HI7 A;  1OAZ A;  3Q6O A;  1S3A A;  2FWH A;  1OE8 A;  1GSE A;  4ZIL A;  2BTO T;  1RW1 A;  1SU9 A;  2CVK A;  2JSY A;  2H66 A;  3MWH A;  2TIR A;  1TI3 A;  5DQY A;  1ST9 A;  2DJ2 A;  3DKS A;  3ZLP A;  3D4M A;  2LRN A;  3FEU A;  5ECS A;  2B3S A;  2OAC A;  3EIN A;  4GQF A;  4CW9 A;  2VM2 A;  3NZN A;  1MD4 A;  5IMV A;  3EU4 A;  2C0E A;  1SL0 B;  3ZL5 A;  2VD1 A;  5BMU B;  4ZL9 A;  5EY6 A;  1E6B A;  3BCI A;  2WVX B;  4K1F A;  4V1A p;  5G2Z A;  4J56 E;  1C72 A;  2ON5 A;  3CMI A;  5A4V A;  1XOA A;  1SJZ A;  4V1A g;  1EP8 A;  1GSD A;  1M7T A;  5F0G A;  1R7H A;  2DSA A;  1TJD A;  3DRN A;  5D8I A;  4OO5 A;  2VLT A;  1VF2 A;  1Y25 A;  4PNF A;  3LG6 A;  4KGI A;  4KDY A;  2MMA A;  5INY A;  2HYX A;  1OKT A;  3NIV A;  3IV4 A;  4GLT A;  2NDO A;  5D9V A;  4ILF A;  5FHI A;  3GV1 A;  4TXO A;  1A0R P;  1E2Y A;  2YJ7 A;  1OC9 B;  1Y1U A;  1QGV A;  2X8C A;  3APQ A;  2GQL A;  1PKZ A;  4PHZ C;  1AC1 A;  1N8J A;  2LJR A;  5F06 A;  4MCU A;  4OD7 A;  1AQX A;  1EWX A;  2HXK A;  3A5I A;  2H30 A;  1URM A;  4HU7 A;  5H5S A;  2PMT A;  2YJH A;  2C80 A;  3ZVJ A;  3D5J A;  1YDK A;  4YH2 A;  3FR6 A;  1TKD B;  1F9M A;  2NBS A;  2VCV A;  3M0F A;  3FY7 A;  2R0P A;  2HRK A;  4DEJ A;  2O36 A;  4KDU A;  3KGK A;  3H1N A;  2K9F A;  3J7Y b;  2CAI A;  1IYI A;  2WW1 A;  4KF9 A;  4MJC A;  3HVX A;  4HSC X;  4MK3 A;  2FWE A;  2UV8 G;  3HJP A;  3EU3 A;  4MP4 A;  4XS4 A;  4L0U A;  4AI6 A;  4POM A;  3VWX A;  4TOP A;  1SK2 A;  5D9W A;  5F05 A;  3GFK A;  1JZW A;  19GS A;  4YKF A;  1MD3 A;  1A23 A;  3W8S A;  3IOS A;  1SK0 A;  5CRE A;  1QFN A;  4NHW A;  5LD0 A;  2H0H A;  1SL2 B;  3APS A;  2YP6 A;  2H8L A;  4N0Z A;  5KOW A;  2P5Q A;  1XWC A;  1PA3 A;  4KCE A;  2LKU A;  1TTZ A;  3TB2 A;  4D73 B;  3D0Z A;  4I97 A;  3HVS A;  4AKG A;  5AIX A;  4FIW A;  5IPH A;  3GKN A;  2ES7 A;  2VCT A;  4LL1 B;  3QAV A;  5A1N A;  2K8S A;  1OC8 A;  5DJL A;  4MMM A;  3ISO A;  2P5R A;  4LMW A;  2LV3 A;  3F4R A;  5COH A;  2B1K A;  4HEA 2;  1TK0 B;  1B4P A;  1GNW A;  2QA1 A;  5ELG A;  3QCP A;  2YCD A;  3RDW A;  4F0C A;  2PGT A;  1ERV A;  2KOK A;  4ZBB A;  5IIZ A;  1TXU A;  3LW9 A;  3TKS C;  2WFC A;  3HHV A;  3UAR A;  1K0N A;  3I9V 2;  2O85 A;  1K3L A;  1S3R A;  2LEG A;  3G7I A;  1W4V A;  4FYB A;  4AJ6 A;  1B9X C;  2CV4 A;  2HZE B;  4JR6 A;  3LXZ A;  2XPD A;  2Z9S A;  1V2A A;  3RPN A;  4MJB A;  1Z7R A;  4MNN A;  2KLX A;  2C3T A;  4LA1 A;  4EO3 A;  2KP2 A;  4KUN A;  2WGR A;  5G5E A;  2GVP A;  4OFT A;  4FO5 A;  3WYW A;  3QAW A;  2L57 A;  1A2M A;  1FOV A;  5H5R A;  1AXD A;  3F9U A;  3OR5 A;  4PUA A;  2GQM A;  1SJ6 A;  2OJL A;  4HS1 A;  2XBQ A;  3L9V A;  3R2Q A;  2AV4 A;  4MZW A;  5DJM A;  4PUF C;  1UC7 A;  4IEL A;  2L6D A;  1KNG A;  4BVX A;  1YKC A;  1DSB A;  4OWY A;  5J3R A;  4DSR A;  2A2S A;  1ACV A;  2VL2 A;  2CAQ A;  4WBJ A;  1RK4 A;  2DKI A;  3D6I A;  3EPT A;  3LQ7 A;  4CY6 A;  4TVE A;  2A2P A;  5HR2 A;  3HD5 A;  4EXJ A;  4Z7X A;  2EC4 A;  1FHE A;  3I69 A;  3N5O A;  2F8A A;  2GSS A;  3P7X A;  2E2G A;  5KEJ A;  1WWJ A;  4GWR A;  2IIY A;  3H79 A;  4XS1 A;  1PQN A;  3I6A A;  4POK A;  4I5Q A;  4G10 A;  2IME A;  1LBK A;  3F6D A;  2H19 A;  3J7Y k;  1PD2 1;  2N5F A;  3TCO A;  3LOR A;  4ZIJ A;  2LJA A;  2OE3 A;  4F2I A;  5DAK A;  1PN9 A;  4GXZ A;  3BD2 A;  5JCW A;  1QUW A;  5BRT A;  1AIU A;  3QAG A;  5B6N A;  3ED3 A;  5G5F A;  5IMF A;  3TDG A;  3P90 A;  2CT6 A;  4CDO A;  1THX A;  1X0R A;  1F3B A;  2HRA A;  4O7H A;  3FYG A;  4OCE A;  2HSN B;  3VPT A;  3DWV A;  2JZS A;  1ZL9 A;  1PN0 A;  2HRN A;  5JCU A;  1WRY A;  1GSU A;  2JU5 A;  3PPU A;  14GS A;  1FAA A;  1GSS A;  2DKH A;  3LXT A;  4PXO A;  4MAB A;  3FZA A;  3JCM L;  5AGY A;  3DML A;  2VM1 A;  2GSR A;  5BMU A;  2I9H A;  3G7Y A;  4QL7 A;  4IJ3 A;  3C1R A;  2HSY A;  1XW9 A;  2R3X A;  3CQF A;  2YOI A;  3HJM A;  5ECM B;  3GSS A;  4RI7 A;  4EIP A;  3F4S A;  1GNE A;  1ABA A;  1SVM A;  2I3Y A;  1G0T A;  4F03 A;  1VRS D;  4QMK A;  1SVO A;  4KA0 A;  17GS A;  3GIX A;  1XCC A;  3DD3 A;  2DJ1 A;  5J9C A;  3IHQ A;  1OYJ A;  4PI2 C;  2HSH A;  3LYP A;  1OC9 A;  2PBJ A;  2ZUP A;  3FMW A;  3UEM A;  4ISD A;  2DMM A;  2H6X A;  4IKH A;  4ZB9 A;  1SEN A;  4FYC A;  2MBT A;  2A2R A;  1XIY A;  3GX8 A;  10GS A;  2X99 A;  4K5S A;  3GL5 A;  2GT6 A;  1HNC A;  4MJE A;  5D9T A;  1XXU A;  4USS A;  2HSM B;  1I9D A;  4GTU A;  3BJ5 A;  1JZO A;  2AUV A;  5CP1 A;  1O7U A;  4EF0 A;  2FA8 A;  4PNG A;  2LJK A;  2H1D A;  4MDC A;  4DSS B;  4WR5 A;  1ZZY A;  2YWO A;  4CY8 A;  3V1W A;  1XG8 A;  4JZQ A;  7GSS A;  2AJQ B;  4KCA A;  5CRD A;  2N5A A;  3KEB A;  2K6V A;  2OKA A;  4GCI A;  2PER A;  1VF3 A;  3H4K A;  1BX9 A;  1F3A A;  1Z3E A;  2RM6 A;  3HZ8 A;  3RAZ A;  2VL3 A;  4G19 A;  1A2L A;  2GST A;  1B9Y C;  3QR6 A;  4NMU A;  1XW6 A;  4PTS A;  2JAD A;  3KH9 A;  2DC5 A;  4Z2T A;  3Q19 A;  3LWA A;  2C3Q A;  5H5Q A;  4IS0 A;  3I43 A;  2WS2 A;  2REM A;  4TW5 A;  1ERW A;  3F4T A;  3CHX C;  3ME7 A;  2VL9 A;  1J0F A;  1B8X A;  2PVQ A;  5JCG A;  1BF5 A;  4ZB8 A;  3UIW A;  8GSS A;  4RQX A;  4WXT A;  5GAP D;  1V40 A;  3QFB C;  3DIE A;  4MPF A;  1K0A A;  1J9B A;  4K2X A;  3GKM A;  2YWN A;  1K0B A;  4O32 A;  3GTU B;  3LSZ A;  1OVN A;  4NPB A;  2VOC A;  3IC4 A;  2GZP A;  4D73 A;  4EIQ A;  4K8M A;  2ALB A;  4YQV A;  3MNG A;  5LCZ A;  1HNA A;  4WEY A;  1YY7 A;  3TOT A;  5KN1 A;  4IN0 A;  4W66 A;  1MDJ A;  4MPG A;  3QFA C;  3SBC A;  2V41 A;  4TR3 A;  11GS A;  1XOB A;  2H0I A;  2RLI A;  3MDK A;  5IM9 A;  3RFR C;  4RUV A;  2V2G A;  2GZY A;  1W89 A;  1Z6M A;  1IYH A;  2WCI A;  3MYD A;  2FLS A;  3ZIT A;  2FNO A;  1X9W B;  1V58 A;  5G1L A;  2B1L A;  2X4A A;  4PQI A;  2PN8 A;  1EZK A;  5CRW A;  5J40 A;  2HZE A;  5J47 A;  4XCS A;  2DLX A;  5E4W A;  4L0W A;  2C0G A;  2C0D A;  2WW2 A;  4BL7 A;  3TKR A;  1GP1 A;  4HQZ A;  4KW6 A;  2VIM A;  5HQP A;  2KHP A;  3IA1 A;  4EVM A;  5HR0 A;  5IMZ A;  4I6X A;  3ERW A;  20GS A;  5KN3 A;  2DIZ A;  3EWL A;  4KSM A;  3C73 A;  3ME8 A;  2O87 A;  3Q74 A;  3IBH A;  1SKS B;  4L5L A;  2VLU A;  4H86 A;  1O81 A;  4ZB6 A;  3F3R A;  3IE3 A;  6GSY A;  2X8G A;  4GDF A;  5EL8 A;  4N0V A;  2P0G A;  2WB9 A;  4TR1 A;  1DBY A;  1EOG A;  3VPQ A;  3LYK A;  5B6M A;  2GZZ A;  3ZFB A;  5HFK A;  3VWU A;  3QOU A;  4GSS A;  2DIY A;  2O89 A;  1H75 A;  1M3I A;  1TK8 B;  3KZQ A;  2OT3 A;  4KB3 A;  3GL3 A;  3ZIV A;  3A2W A;  3GMF A;  2ON7 A;  5B8A A;  1GRX A;  1EV4 A;  1S3D A;  3U6V A;  3TU3 B;  3EUR A;  4ULX A;  2XBI A;  1V57 A;  1QQ2 A;  2WVZ A;  1XWB A;  3U5R E;  3ZVJ D;  3FZ9 A;  4K2D A;  4MH3 A;  3ERG A;  4IQA A;  4AKX B;  3TKQ A;  3CYN A;  1MEK A;  3RHB A;  4EDZ A;  4Q5F A;  4CHS A;  2J9H A;  5L71 A;  2R37 A;  3G9B A;  1GSF A;  3F3Q A;  3TOU A;  4EE0 A;  3CSJ A;  5JWO B;  2BJX A;  1ILO A;  5D93 A;  2P31 A;  2CA8 A;  1FVJ A;  2H1G A;  4F9Z A;  5G1K A;  5HFI A;  1X9M B;  2R6K A;  3IAM 2;  5LNK e;  1PX7 A;  5IPG A;  1EP7 A;  2LNS A;  1K0C A;  2H76 A;  3TRX A;  5ECK B;  1MDI A;  3CTF A;  1XVW A;  1T8E B;  1G7E A;  2L6C A;  5DAL B;  2YAN A;  1BG5 A;  1NM3 A;  1VGL A;  2O3E A;  2LQQ A;  1K0O A;  2LNT A;  4ID0 A;  3MAK A;  2IMK A;  3CTG A;  2EFD A;  1LU4 A;  2IMF A;  5A5K A;  4G0L A;  1Z5Y E;  1G6W A;  4BWQ A;  3P8W A;  1WJK A;  2WUL A;  4NV5 A;  3US3 A;  4ML6 A;  2HT9 A;  3ZMK A;  3FW2 A;  3LFL A;  4WF4 A;  2C8U A;  1CQG A;  3CBU A;  4POL A;  2IPA A;  4IQ1 A;  4AJ8 A;  1QK8 A;  4J57 E;  3GN3 A;  2IFQ A;  1K3O A;  3HDC A;  4V2L A;  5GSS A;  2YZH A;  1ZOF A;  1ON4 A;  2HFD A;  3L4N A;  9GSS A;  3O3T A;  4IJI A;  1GUK A;  2H0G A;  3VLN A;  1B48 A;  2FWG A;  3M1G A;  3FZ4 A;  3ZZX A;  2OBI A;  3FR3 A;  2A4H A;  4BA7 A;  3O76 A;  4AJ7 A;  4HDE A;  2LQO A;  5IMC A;  1BYE A;  3UMA A;  1K0D A;  1FB0 A;  4PX1 A;  5D96 A;  2I1U A;  4PGT A;  2V6O A;  2QA2 A;  1M2D A;  1OE7 A;  1V98 A;  6GSW A;  4PQ1 A;  2FA4 A;  2HE3 A;  5IMD A;  2HSM A;  1SYR A;  3HMJ G;  4HJ2 A;  22GS A;  5DBQ A;  2I81 A;  4PI0 C;  2H72 A;  3SWL A;  4BIK A;  5B8B A;  2MZC A;  2TRX A;  2FGX A;  3VUR A;  4KND A;  4I2U A;  4DSS A;  4FYU A;  1NSW A;  5KN2 A;  3VI7 A;  2PVO C;  3IPZ A;  4TR0 A;  1GL8 A;  1GUH A;  5ABR A;  4HZ2 A;  4YQM A;  1JZR A;  2WZS A;  1O8W A;  3G7J A;  3A3T A;  4HUA A;  3DVX A;  4PQH A;  4TXO B;  3EMP A;  4HOJ A;  2L59 A;  2EFE A;  4PUR A;  3ZTL A;  1HYU A;  3DYR A;  2EFH A;  3HJO A;  2I4A A;  2N5B A;  3FKF A;  1HQO A;  3QMX A;  5ECQ B;  3KP9 A;  2BMX A;  5KN0 A;  12GS A;  3IDV A;  1X5C A;  16GS A;  5F8B A;  5CNW A;  3C1S A;  4Q5R A;  1Q98 A;  3GTU A;  4BWS A;  1I1I P;  2VCX A;  2WRT A;  2YZU A;  1M9B A;  1M99 A;  1TDI A;  1ZYQ B;  2D2Z A;  5ID2 A;  4EKZ A;  2IJY A;  4N11 A;  3KH7 A;  1BJX A;  3GRX A;  1JHB A;  1DE1 A;  4ECC A;  5ECL B;  4JRR A;  3QDN A;  2M80 A;  5G31 A;  1JZD A;  1FVK A;  3FHK A;  1ZGN A;  4X43 A;  4Z2U A;  1QMV A;  4OMV A;  1YJ6 A;  1BED A;  4MF6 A;  1PKW A;  4ZB7 A;  5J4U A;  1Q4J A;  2DJ0 A;  3HVV A;  1TI1 A;  2H6Z A;  2E7P A;  1M2B A;  2WVX A;  3WT2 A;  1O85 A;  1USB A;  2GDR A;  4ZBD A;  3TGZ A;  3CXG A;  5CAX A;  1X5E A;  1ZCP A;  2FD3 A;  4HI7 A;  2AHE A;  4G2E A;  1ZMA A;  4YQU A;  5C04 A;  1YKA A;  2R0C A;  2O7K A;  2VCZ A;  2PU9 C;  3IK7 A;  2AB6 A;  1KTE A;  3DXB A;  4TKY A;  3O6T A;  3EMX A;  3L9S A;  1SJI A;  2YWM A;  1SK1 A;  2ZNM A;  1BG1 A;  3M9J A;  3UOM A;  1AQW A;  1EEJ A;  2WDU A;  4BVY B;  2JSZ A;  2V6K A;  5A5H B;  2HLS A;  3RPP A;  4WF5 A;  3VK9 A;  3KCM A;  3VWV A;  2VKZ G;  1TXX A;  3M8N A;  5AN1 A;  4J2F A;  3W8J A;  3HXS A;  3IR4 A;  4K5R A;  2M72 A;  4V2N A;  1VF1 A;  4DSQ A;  3UVT A;  3WGD A;  3ERF A;  1DUG A;  1EOH A;  1UN2 A;  3KTB A;  4OFN A;  1TRU A;  1EGR A;  5JWQ B;  3QD9 A;  1AW9 A;  4L5O A;  2YPM A;  2YV9 A;  3VI5 A;  4MA9 A;  2LUS A;  3GST A;  3TRQ A;  1R4W A;  5CRH A;  2WW3 A;  18GS A;  1THO A;  3N9J A;  4O5Q A;  2IMI A;  3KTL A;  1SYX A;  1SKW B;  1GH2 A;  1T3B A;  3KM6 A;  4IP6 A;  5J9B A;  4IW9 A;  2VO4 A;  3DVW A;  5HR3 A;  2B5Y A;  4E68 A;  3A2X A;  1Z6N A;  2YV7 A;  4OCF A;  5ENU A;  5FT3 A;  5JWR B;  2FY6 A;  1TK5 B;  4FXY P;  2OAD A;  3C8E A;  3IAS 2;  4IGJ A;  4O5R A;  1YF1 A;  4AF2 A;  4DVC A;  4K0G A;  2O5V A;  4Q5Q A;  1SD8 A;  1N2A A;  3ZFL A;  1RQM A;  3M3M A;  2GT5 A;  5ECH B;  1TU8 A;  2VUP A;  2IMD A;  5DAL A;  4GRF A;  3PR8 A;  2F51 A;  3KMO A;  4KX4 A;  4I8B A;  6GSV A;  2E2M A;  2RM5 A;  1VF4 A;  3VWW A;  1FO5 A;  1Z9H A;  2HZF A;  5A4U A;  5GAN D;  5J41 A;  2L5L A;  1ERT A;  1U3I A;  4LLR A;  3APO A;  2PWJ A;  3CRU A;  2TRC P;  2F9S A;  2RUF A;  2LS5 A;  1FW1 A;  4ECB A;  2JAC A;  2L4C A;  5DQS A;  4KH7 A;  2LRC A;  3F0I A;  2X49 A;  4YKG A;  1UVZ A;  2HQT A;  2WW0 A;  3UAP A;  2HNL A;  2DML A;  4EUY A;  2WJU A;  1WIK A;  4JED A;  1O6J A;  1KEB A;  4K7O A;  4JE1 A;  1S4B P;  1SL1 B;  1PMT A;  5EVO A;  3FZ5 A;  4JBB A;  1YZX A;  3GUS A;  2L4Q A;  5D9X A;  2C1Y A;  1ERU A;  2NVL A;  4I2T A;  1TRW A;  1XWA A;  4QL9 A;  4Q5N A;  4ACS A;  4XIH A;  4E8H A;  3P2A A;  4X0X A;  4Z2R A;  3MIX A;  2XC2 A;  1X9S B;  1S3C A;  3EVI A;  4MLY A;  1M9A A;  2CVB A;  2G2Q A;  3IC8 A;  2H1B A;  2K18 A;  2FHE A;  1WP0 A;  3GH9 A;  3BOA A;  4XHM A;  3E9J B;  1O73 A;  3M9K A;  2F8F A;  3ZYW A;  4A5P A;  4KAE A;  1YVL A;  3HYP A;  4EL1 A;  1GLP A;  1EGO A;  2H01 A;  1AUC A;  2VCW A;  1AAZ A;  4NV2 A;  3KIJ A;  3WGE A;  4K9Z A;  3BBY A;  3TJJ A;  3ZIJ A;  1T7P B;  4HQS A;  1GSQ A;  2GS3 A;  1F37 A;  4BPY A;  1R5P A;  1ZYE A;  3GH6 A;  4GSN A; 
#chains in the Genus database with same CATH homology
 1UA5 A;  4AGS A;  5HR1 A;  4EDY A;  3TJB A;  5ELA A;  1BQ7 A;  2CVD A;  5D73 A;  4N30 A;  1NW2 A;  3A5W A;  1PSQ A;  3GHA A;  5DCH A;  4IVF A;  2GSQ A;  1SVL A;  2HRF A;  4IBP A;  1K3Y A;  1ZYP A;  2X8H A;  4OO4 A;  4NWY A;  3F6F A;  3HKR A;  2CQ9 A;  5J5N A;  1TOF A;  3HCZ A;  1EEM A;  3E0U A;  4ICY A;  1F6M C;  5HFG A;  2A4V A;  4KE3 A;  3TJK A;  3UL3 A;  4NXI A;  1SKR B;  3HA9 A;  2HSN A;  5CRG A;  4TR4 A;  5A34 B;  1JLV A;  3KD0 A;  3BCK A;  1YEX A;  5IOW A;  4MJA A;  5KOX A;  1GUM A;  3KP8 A;  2LTK A;  3HY2 A;  1TW9 A;  2NPB A;  4LL4 B;  3GKX A;  4O92 A;  2GLR A;  3FK8 A;  4ECI A;  3L0H A;  4GF0 A;  2B6M A;  3UVH A;  1N25 A;  5DDL A;  2QC7 A;  4V2M A;  2GGT A;  2C4J A;  3KXO A;  2XHF A;  3L9U A;  3C71 A;  3PGT A;  3ZML A;  1I5G A;  1LJR A;  3H8Q A;  3K8N A;  1G6Y A;  1T4Y A;  1M0U A;  2JZR A;  1M2A A;  1EV9 A;  3F63 A;  2EFC A;  5ECN B;  3HZ4 A;  1GTB A;  3KJY A;  3CWG A;  3LGC A;  3PIN A;  4OFM A;  1JFU A;  2GQK A;  4BVY A;  2DBC A;  5A5H A;  2FCH A;  2R2J A;  2B5X A;  2RII A;  4ZBA A;  2R5G A;  2MMZ A;  1F2E A;  2VL2 C;  2FWF A;  3TKS E;  2AYT A;  2OE1 A;  4N3Z A;  1XWG A;  3F8U A;  2H6Y A;  2XPE A;  3GA4 A;  4JR4 A;  1XW5 A;  1WPI A;  2PUK C;  4F82 A;  3TJF A;  5IOX A;  5B7C A;  2VLV A;  1TU7 A;  4TRX A;  2X64 A;  1XFL A;  3DEX A;  1A8L A;  5CO3 A;  3WT1 A;  2KP1 A;  3TJG A;  1BAY A;  1TRV A;  2NTO A;  2VCQ A;  4BL7 B;  2OA7 A;  1TRS A;  1WOU A;  4KDX A;  2OE0 A;  2YN1 A;  3EC3 A;  4O5U A;  1U88 A;  1Y6E A;  3Q18 A;  4K0N A;  1GTU A;  2G0F A;  2DJJ A;  2MBS A;  3WD6 A;  2V32 A;  5F07 A;  1OC3 A;  3IHG A;  3D4T A;  5GST A;  2H74 A;  2QKE A;  4NAX A;  4K7I A;  4MF7 A;  4YAP A;  1HNB A;  5E59 A;  5J4V A;  1FG4 A;  2MMN A;  5AIS A;  3TKS A;  3CSH A;  3H93 A;  1Z7P A;  1ZYN A;  1QXH A;  4TR1 B;  2H1A A;  3FRC A;  1HD2 A;  1SD9 A;  1T1V A;  2WZ9 A;  2C0F A;  3EYT A;  3PH9 A;  1JLW A;  2PPT A;  1B4Q A;  2R0G A;  3TKP A;  3LEF A;  2L5O A;  1GSY A;  3GYK A;  4TXV A;  4P3Y B;  4HZ4 A;  4XS6 A;  1PL2 A;  1YEP A;  3GKK A;  1U87 A;  1U6T A;  2V1M A;  3L78 A;  5IQY A;  3FR9 A;  2RUE A;  1FOH A;  2DJK A;  2GTU A;  3GX0 A;  4AKI A;  2QGV A;  4MZC A;  2B7J A;  4GQC A;  1V9W A;  2CZ2 A;  1R26 A;  3UBK A;  1CQH A;  5ECR B;  1T00 A;  2HRK B;  4XRA A;  4IP1 A;  3S9F A;  4L8E A;  1OKD A;  2CX3 A;  3GNJ A;  4GST A;  1X5D A;  6GSU A;  1MDK A;  1PRX A;  3ZRD A;  3MSZ A;  1YF0 A;  3VFI A;  4WET A;  1GTI A;  3UBL A;  1NHO A;  1A8Y A;  1KBN A;  2EIQ A;  2KUC A;  2CZ3 A;  4ML1 A;  4XS4 B;  3C7M A;  5IO2 A;  1PX6 A;  5IMA A;  3R3E A;  4N10 A;  2K8V A;  3D22 A;  2H75 A;  5DCG A;  1T4Z A;  1WE0 A;  4FH8 A;  4ECJ A;  4ZL7 A;  3A2V A;  6GSS A;  5ECP B;  2H73 A;  1GUL A;  5A4W A;  4RI6 A;  5ECI B;  3EE2 A;  1GWC A;  2H71 A;  5C00 A;  2YWI A;  3IXR A;  3TUE A;  4WR4 A;  4POB A;  2C3N A;  2VD0 A;  2H70 A;  4E8E A;  4X1U A;  5EPF A;  3TRP A;  5A1N B;  2VAF A;  4ZXG A;  2IFQ B;  1O8X A;  4G0I A;  1R5A A;  2IN3 A;  3NOF A;  1U3A A;  1GLQ A;  3DGQ A;  4QQ7 A;  3D21 A;  1YQ1 A;  4IHU A;  4HJM A;  1J08 A;  4MH2 A;  3RHC A;  4YAV A;  2CX4 A;  6GSX A;  2O8V B;  2B5E A;  2E0Q A;  4ZL8 A;  4MZB A;  3WGX A;  2FUG 2;  1K0M A;  5AIV A;  1WMJ A;  4EC0 A;  2H1L A;  4LMV A;  1XBS A;  1A0F A;  3UJ1 A;  2UZ8 A;  2QSI A;  2JZT A;  4FQU A;  3IK9 A;  2MMO A;  1NHY A;  3QPM A;  5J4Y A;  1XVQ A;  2OBK A;  2AAW A;  2JL4 A;  4WBR D;  2J23 A;  4G9H A;  4K7N A;  5GZZ B;  1MTC A;  4MF5 A;  13GS A;  1DE2 A;  2B7K A;  1A2J A;  1GTA A;  1TP9 A;  4HU9 A;  2R4V A;  1PL1 A;  3LJR A;  3ZRE A;  4BVX B;  2DJ3 A;  3IRA A;  4AKH A;  5A34 A;  4KSO A;  3GUR A;  3W6G A;  5G30 A;  2IL3 A;  2M46 A;  1XZO A;  2LRT A;  4G0K A;  1AQV A;  3CSI A;  6GST A;  2MYG A;  1G7O A;  2YNX A;  1A24 A;  4TN8 A;  4JU5 A;  1XPV A;  4RQR A;  4XTS A;  4F0B A;  3CRT A;  2LST A;  1XWK A;  1ML6 A;  3KMN A;  2ZCT A;  5ECO B;  1H4O A;  4G01 A;  5IO0 A;  4NHZ A;  4WKW A;  2EIO A;  4K6X A;  5CYY A;  3E3E A;  1PGT A;  2EIR A;  1FB6 A;  5DAK B;  5FWG A;  4X4J A;  2IWT A;  3RBT A;  4XRD A;  3AY8 A;  2F3M A;  5ID2 B;  5DVB A;  2HI7 A;  1OAZ A;  3Q6O A;  1S3A A;  2FWH A;  1OE8 A;  1GSE A;  4ZIL A;  2BTO T;  1RW1 A;  1SU9 A;  2CVK A;  2JSY A;  2H66 A;  3MWH A;  2TIR A;  1TI3 A;  5DQY A;  1ST9 A;  2DJ2 A;  3DKS A;  3ZLP A;  3D4M A;  2LRN A;  3FEU A;  5ECS A;  2B3S A;  2OAC A;  3EIN A;  4GQF A;  4CW9 A;  2VM2 A;  3NZN A;  1MD4 A;  5IMV A;  3EU4 A;  2C0E A;  1SL0 B;  3ZL5 A;  2VD1 A;  5BMU B;  4ZL9 A;  5EY6 A;  1E6B A;  3BCI A;  4K1F A;  4V1A p;  5G2Z A;  4J56 E;  1C72 A;  2ON5 A;  3CMI A;  5A4V A;  1XOA A;  1SJZ A;  4V1A g;  1EP8 A;  1GSD A;  1M7T A;  5F0G A;  1R7H A;  2DSA A;  1TJD A;  3DRN A;  5D8I A;  4OO5 A;  2VLT A;  1VF2 A;  1Y25 A;  4PNF A;  3LG6 A;  4KGI A;  4KDY A;  2MMA A;  5INY A;  2HYX A;  1OKT A;  3NIV A;  3IV4 A;  4GLT A;  2NDO A;  5D9V A;  4ILF A;  5FHI A;  3GV1 A;  4TXO A;  1A0R P;  1E2Y A;  2YJ7 A;  1OC9 B;  1Y1U A;  1QGV A;  2X8C A;  3APQ A;  2GQL A;  1PKZ A;  1AC1 A;  1N8J A;  2LJR A;  5F06 A;  4MCU A;  4OD7 A;  1AQX A;  1EWX A;  2HXK A;  3A5I A;  2H30 A;  1URM A;  4HU7 A;  5H5S A;  2PMT A;  2YJH A;  2C80 A;  3ZVJ A;  3D5J A;  1YDK A;  4YH2 A;  3FR6 A;  1TKD B;  1F9M A;  2NBS A;  2VCV A;  3M0F A;  3FY7 A;  2R0P A;  2HRK A;  4DEJ A;  4KDU A;  3KGK A;  3H1N A;  2K9F A;  3J7Y b;  2CAI A;  1IYI A;  4KF9 A;  4MJC A;  3HVX A;  4MK3 A;  2FWE A;  2UV8 G;  3HJP A;  3EU3 A;  4MP4 A;  4XS4 A;  4L0U A;  4AI6 A;  4POM A;  3VWX A;  4TOP A;  1SK2 A;  5D9W A;  5F05 A;  3GFK A;  1JZW A;  19GS A;  4YKF A;  1MD3 A;  1A23 A;  3W8S A;  3IOS A;  1SK0 A;  5CRE A;  1QFN A;  4NHW A;  5LD0 A;  2H0H A;  1SL2 B;  3APS A;  2YP6 A;  2H8L A;  4N0Z A;  5KOW A;  2P5Q A;  1XWC A;  1PA3 A;  4KCE A;  2LKU A;  1TTZ A;  3TB2 A;  4D73 B;  3D0Z A;  4I97 A;  3HVS A;  4AKG A;  5AIX A;  4FIW A;  5IPH A;  3GKN A;  2ES7 A;  2VCT A;  4LL1 B;  3QAV A;  5A1N A;  2K8S A;  1OC8 A;  5DJL A;  4MMM A;  3ISO A;  2P5R A;  4LMW A;  2LV3 A;  3F4R A;  5COH A;  2B1K A;  4HEA 2;  1TK0 B;  1B4P A;  1GNW A;  2QA1 A;  5ELG A;  3QCP A;  2YCD A;  3RDW A;  4F0C A;  2PGT A;  1ERV A;  2KOK A;  4ZBB A;  5IIZ A;  1TXU A;  3LW9 A;  3TKS C;  2WFC A;  3HHV A;  3UAR A;  1K0N A;  3I9V 2;  2O85 A;  1K3L A;  2LEG A;  3G7I A;  1W4V A;  4FYB A;  4AJ6 A;  1B9X C;  2CV4 A;  2HZE B;  4JR6 A;  3LXZ A;  2XPD A;  2Z9S A;  1V2A A;  3RPN A;  4MJB A;  1Z7R A;  4MNN A;  2KLX A;  2C3T A;  4LA1 A;  4EO3 A;  2KP2 A;  4KUN A;  2WGR A;  5G5E A;  2GVP A;  4OFT A;  4FO5 A;  3WYW A;  3QAW A;  2L57 A;  1A2M A;  1FOV A;  5H5R A;  1AXD A;  3F9U A;  3OR5 A;  4PUA A;  2GQM A;  1SJ6 A;  2OJL A;  4HS1 A;  2XBQ A;  3L9V A;  3R2Q A;  2AV4 A;  4MZW A;  5DJM A;  4PUF C;  1UC7 A;  4IEL A;  2L6D A;  1KNG A;  4BVX A;  1YKC A;  1DSB A;  4OWY A;  5J3R A;  4DSR A;  2A2S A;  1ACV A;  2VL2 A;  2CAQ A;  4WBJ A;  1RK4 A;  2DKI A;  3D6I A;  3EPT A;  3LQ7 A;  4CY6 A;  4TVE A;  2A2P A;  5HR2 A;  3HD5 A;  4EXJ A;  4Z7X A;  2EC4 A;  1FHE A;  3I69 A;  3N5O A;  2F8A A;  2GSS A;  3P7X A;  2E2G A;  5KEJ A;  1WWJ A;  4GWR A;  2IIY A;  3H79 A;  4XS1 A;  1PQN A;  3I6A A;  4POK A;  4I5Q A;  4G10 A;  2IME A;  1LBK A;  3F6D A;  2H19 A;  3J7Y k;  1PD2 1;  2N5F A;  3TCO A;  3LOR A;  4ZIJ A;  2LJA A;  2OE3 A;  4F2I A;  5DAK A;  1PN9 A;  4GXZ A;  3BD2 A;  5JCW A;  1QUW A;  5BRT A;  1AIU A;  3QAG A;  5B6N A;  3ED3 A;  5G5F A;  5IMF A;  3TDG A;  3P90 A;  2CT6 A;  4CDO A;  1THX A;  1X0R A;  1F3B A;  2HRA A;  4O7H A;  3FYG A;  4OCE A;  2HSN B;  3VPT A;  3DWV A;  2JZS A;  1ZL9 A;  1PN0 A;  2HRN A;  5JCU A;  1WRY A;  1GSU A;  2JU5 A;  3PPU A;  14GS A;  1FAA A;  1GSS A;  2DKH A;  3LXT A;  4PXO A;  4MAB A;  3FZA A;  3JCM L;  5AGY A;  3DML A;  2VM1 A;  2GSR A;  5BMU A;  2I9H A;  3G7Y A;  4QL7 A;  4IJ3 A;  3C1R A;  2HSY A;  1XW9 A;  2R3X A;  2YOI A;  3HJM A;  5ECM B;  3GSS A;  4RI7 A;  4EIP A;  3F4S A;  1GNE A;  1ABA A;  1SVM A;  2I3Y A;  1G0T A;  4F03 A;  1VRS D;  4QMK A;  1SVO A;  4KA0 A;  17GS A;  3GIX A;  1XCC A;  3DD3 A;  2DJ1 A;  5J9C A;  3IHQ A;  1OYJ A;  2HSH A;  3LYP A;  1OC9 A;  2PBJ A;  2ZUP A;  3FMW A;  3UEM A;  4ISD A;  2DMM A;  2H6X A;  4IKH A;  4ZB9 A;  1SEN A;  4FYC A;  2MBT A;  2A2R A;  1XIY A;  3GX8 A;  10GS A;  2X99 A;  4K5S A;  3GL5 A;  2GT6 A;  1HNC A;  4MJE A;  5D9T A;  1XXU A;  4USS A;  2HSM B;  1I9D A;  4GTU A;  3BJ5 A;  1JZO A;  2AUV A;  5CP1 A;  1O7U A;  4EF0 A;  2FA8 A;  4PNG A;  2LJK A;  2H1D A;  4MDC A;  4DSS B;  4WR5 A;  1ZZY A;  2YWO A;  4CY8 A;  3V1W A;  4JZQ A;  7GSS A;  2AJQ B;  4KCA A;  5CRD A;  2N5A A;  3KEB A;  2K6V A;  2OKA A;  4GCI A;  2PER A;  1VF3 A;  3H4K A;  1BX9 A;  1F3A A;  1Z3E A;  2RM6 A;  3HZ8 A;  3RAZ A;  2VL3 A;  4G19 A;  1A2L A;  2GST A;  1B9Y C;  3QR6 A;  4NMU A;  1XW6 A;  4PTS A;  2JAD A;  3KH9 A;  2DC5 A;  4Z2T A;  3Q19 A;  3LWA A;  2C3Q A;  5H5Q A;  4IS0 A;  3I43 A;  2WS2 A;  2REM A;  4TW5 A;  1ERW A;  3F4T A;  3ME7 A;  2VL9 A;  1J0F A;  1B8X A;  2PVQ A;  5JCG A;  1BF5 A;  4ZB8 A;  3UIW A;  8GSS A;  4RQX A;  4WXT A;  5GAP D;  1V40 A;  3QFB C;  3DIE A;  4MPF A;  1K0A A;  1J9B A;  4K2X A;  3GKM A;  2YWN A;  1K0B A;  4O32 A;  3GTU B;  3LSZ A;  1OVN A;  4NPB A;  2VOC A;  3IC4 A;  2GZP A;  4D73 A;  4EIQ A;  4K8M A;  2ALB A;  4YQV A;  3MNG A;  5LCZ A;  1HNA A;  4WEY A;  1YY7 A;  3TOT A;  5KN1 A;  4IN0 A;  4W66 A;  1MDJ A;  4MPG A;  3QFA C;  3SBC A;  2V41 A;  4TR3 A;  11GS A;  1XOB A;  2H0I A;  2RLI A;  3MDK A;  5IM9 A;  4RUV A;  2V2G A;  2GZY A;  1W89 A;  1Z6M A;  1IYH A;  2WCI A;  3MYD A;  2FLS A;  3ZIT A;  2FNO A;  1X9W B;  1V58 A;  5G1L A;  2B1L A;  2X4A A;  4PQI A;  2PN8 A;  1EZK A;  5CRW A;  5J40 A;  2HZE A;  5J47 A;  4XCS A;  2DLX A;  5E4W A;  4L0W A;  2C0G A;  2C0D A;  4BL7 A;  3TKR A;  1GP1 A;  4HQZ A;  4KW6 A;  2VIM A;  5HQP A;  2KHP A;  3IA1 A;  4EVM A;  5HR0 A;  5IMZ A;  4I6X A;  3ERW A;  20GS A;  5KN3 A;  2DIZ A;  3EWL A;  4KSM A;  3C73 A;  3ME8 A;  2O87 A;  3Q74 A;  3IBH A;  1SKS B;  4L5L A;  2VLU A;  4H86 A;  1O81 A;  4ZB6 A;  3F3R A;  3IE3 A;  6GSY A;  2X8G A;  4GDF A;  5EL8 A;  4N0V A;  2P0G A;  2WB9 A;  4TR1 A;  1DBY A;  1EOG A;  3VPQ A;  3LYK A;  5B6M A;  2GZZ A;  3ZFB A;  5HFK A;  3VWU A;  3QOU A;  4GSS A;  2DIY A;  2O89 A;  1H75 A;  1TK8 B;  3KZQ A;  2OT3 A;  4KB3 A;  3GL3 A;  3ZIV A;  3A2W A;  3GMF A;  2ON7 A;  5B8A A;  1GRX A;  1EV4 A;  1S3D A;  3U6V A;  3TU3 B;  3EUR A;  4ULX A;  2XBI A;  1V57 A;  1QQ2 A;  1XWB A;  3U5R E;  3ZVJ D;  3FZ9 A;  4K2D A;  4MH3 A;  3ERG A;  4IQA A;  4AKX B;  3TKQ A;  3CYN A;  1MEK A;  3RHB A;  4EDZ A;  4Q5F A;  4CHS A;  2J9H A;  5L71 A;  2R37 A;  3G9B A;  1GSF A;  3F3Q A;  3TOU A;  4EE0 A;  3CSJ A;  5JWO B;  2BJX A;  1ILO A;  5D93 A;  2P31 A;  2CA8 A;  1FVJ A;  2H1G A;  4F9Z A;  5G1K A;  5HFI A;  1X9M B;  2R6K A;  3IAM 2;  5LNK e;  1PX7 A;  5IPG A;  1EP7 A;  2LNS A;  1K0C A;  2H76 A;  3TRX A;  5ECK B;  1MDI A;  3CTF A;  1XVW A;  1T8E B;  1G7E A;  2L6C A;  5DAL B;  2YAN A;  1BG5 A;  1NM3 A;  1VGL A;  2LQQ A;  1K0O A;  2LNT A;  4ID0 A;  3MAK A;  2IMK A;  3CTG A;  2EFD A;  1LU4 A;  2IMF A;  5A5K A;  4G0L A;  1Z5Y E;  1G6W A;  4BWQ A;  3P8W A;  1WJK A;  2WUL A;  4NV5 A;  3US3 A;  4ML6 A;  2HT9 A;  3ZMK A;  3FW2 A;  3LFL A;  4WF4 A;  2C8U A;  1CQG A;  3CBU A;  4POL A;  2IPA A;  4IQ1 A;  4AJ8 A;  1QK8 A;  4J57 E;  3GN3 A;  2IFQ A;  1K3O A;  3HDC A;  4V2L A;  5GSS A;  2YZH A;  1ZOF A;  1ON4 A;  2HFD A;  3L4N A;  9GSS A;  3O3T A;  4IJI A;  1GUK A;  2H0G A;  3VLN A;  1B48 A;  2FWG A;  3M1G A;  3FZ4 A;  3ZZX A;  2OBI A;  3FR3 A;  2A4H A;  4BA7 A;  3O76 A;  4AJ7 A;  4HDE A;  2LQO A;  5IMC A;  1BYE A;  3UMA A;  1K0D A;  1FB0 A;  4PX1 A;  5D96 A;  2I1U A;  4PGT A;  2V6O A;  2QA2 A;  1M2D A;  1OE7 A;  1V98 A;  6GSW A;  4PQ1 A;  2FA4 A;  2HE3 A;  5IMD A;  2HSM A;  1SYR A;  3HMJ G;  4HJ2 A;  22GS A;  5DBQ A;  2I81 A;  2H72 A;  3SWL A;  5B8B A;  2MZC A;  2TRX A;  2FGX A;  3VUR A;  4KND A;  4I2U A;  4DSS A;  4FYU A;  1NSW A;  5KN2 A;  3VI7 A;  2PVO C;  3IPZ A;  4TR0 A;  1GL8 A;  1GUH A;  5ABR A;  4HZ2 A;  4YQM A;  1JZR A;  1O8W A;  3G7J A;  3A3T A;  4HUA A;  3DVX A;  4PQH A;  4TXO B;  3EMP A;  4HOJ A;  2L59 A;  2EFE A;  4PUR A;  3ZTL A;  1HYU A;  3DYR A;  2EFH A;  3HJO A;  2I4A A;  2N5B A;  3FKF A;  1HQO A;  3QMX A;  5ECQ B;  3KP9 A;  2BMX A;  5KN0 A;  12GS A;  3IDV A;  1X5C A;  16GS A;  5F8B A;  5CNW A;  3C1S A;  4Q5R A;  1Q98 A;  3GTU A;  4BWS A;  2VCX A;  2WRT A;  2YZU A;  1M9B A;  1M99 A;  1TDI A;  1ZYQ B;  2D2Z A;  5ID2 A;  4EKZ A;  2IJY A;  4N11 A;  3KH7 A;  1BJX A;  3GRX A;  1JHB A;  1DE1 A;  4ECC A;  5ECL B;  4JRR A;  3QDN A;  2M80 A;  5G31 A;  1JZD A;  1FVK A;  3FHK A;  1ZGN A;  4X43 A;  4Z2U A;  1QMV A;  4OMV A;  1YJ6 A;  1BED A;  4MF6 A;  1PKW A;  4ZB7 A;  5J4U A;  1Q4J A;  2DJ0 A;  3HVV A;  1TI1 A;  2H6Z A;  2E7P A;  1M2B A;  3WT2 A;  1O85 A;  1USB A;  2GDR A;  4ZBD A;  3TGZ A;  3CXG A;  5CAX A;  1X5E A;  1ZCP A;  2FD3 A;  4HI7 A;  2AHE A;  4G2E A;  1ZMA A;  4YQU A;  5C04 A;  1YKA A;  2R0C A;  2O7K A;  2VCZ A;  2PU9 C;  3IK7 A;  2AB6 A;  1KTE A;  3DXB A;  4TKY A;  3O6T A;  3EMX A;  3L9S A;  1SJI A;  2YWM A;  1SK1 A;  2ZNM A;  1BG1 A;  3M9J A;  3UOM A;  1AQW A;  1EEJ A;  2WDU A;  4BVY B;  2JSZ A;  2V6K A;  5A5H B;  2HLS A;  3RPP A;  4WF5 A;  3VK9 A;  3KCM A;  3VWV A;  2VKZ G;  1TXX A;  3M8N A;  5AN1 A;  4J2F A;  3W8J A;  3HXS A;  3IR4 A;  4K5R A;  2M72 A;  4V2N A;  1VF1 A;  4DSQ A;  3UVT A;  3WGD A;  3ERF A;  1DUG A;  1EOH A;  1UN2 A;  3KTB A;  4OFN A;  1TRU A;  1EGR A;  5JWQ B;  3QD9 A;  1AW9 A;  4L5O A;  2YPM A;  2YV9 A;  3VI5 A;  4MA9 A;  2LUS A;  3GST A;  3TRQ A;  1R4W A;  5CRH A;  18GS A;  1THO A;  3N9J A;  4O5Q A;  2IMI A;  3KTL A;  1SYX A;  1SKW B;  1GH2 A;  1T3B A;  3KM6 A;  4IP6 A;  5J9B A;  4IW9 A;  2VO4 A;  3DVW A;  5HR3 A;  2B5Y A;  4E68 A;  3A2X A;  1Z6N A;  2YV7 A;  4OCF A;  5ENU A;  5FT3 A;  5JWR B;  2FY6 A;  1TK5 B;  2OAD A;  3C8E A;  3IAS 2;  4IGJ A;  4O5R A;  1YF1 A;  4AF2 A;  4DVC A;  4K0G A;  2O5V A;  4Q5Q A;  1SD8 A;  1N2A A;  3ZFL A;  1RQM A;  3M3M A;  2GT5 A;  5ECH B;  1TU8 A;  2VUP A;  2IMD A;  5DAL A;  4GRF A;  3PR8 A;  2F51 A;  3KMO A;  4KX4 A;  4I8B A;  6GSV A;  2E2M A;  2RM5 A;  1VF4 A;  3VWW A;  1FO5 A;  1Z9H A;  2HZF A;  5A4U A;  5GAN D;  5J41 A;  2L5L A;  1ERT A;  1U3I A;  4LLR A;  3APO A;  2PWJ A;  3CRU A;  2TRC P;  2F9S A;  2RUF A;  2LS5 A;  1FW1 A;  4ECB A;  2JAC A;  2L4C A;  5DQS A;  4KH7 A;  2LRC A;  3F0I A;  2X49 A;  4YKG A;  1UVZ A;  2HQT A;  3UAP A;  2HNL A;  2DML A;  4EUY A;  2WJU A;  1WIK A;  4JED A;  1O6J A;  1KEB A;  4K7O A;  4JE1 A;  1SL1 B;  1PMT A;  5EVO A;  3FZ5 A;  4JBB A;  1YZX A;  3GUS A;  2L4Q A;  5D9X A;  2C1Y A;  1ERU A;  2NVL A;  4I2T A;  1TRW A;  1XWA A;  4QL9 A;  4Q5N A;  4ACS A;  4XIH A;  4E8H A;  3P2A A;  4X0X A;  4Z2R A;  3MIX A;  2XC2 A;  1X9S B;  1S3C A;  3EVI A;  4MLY A;  1M9A A;  2CVB A;  2G2Q A;  3IC8 A;  2H1B A;  2K18 A;  2FHE A;  1WP0 A;  3GH9 A;  3BOA A;  4XHM A;  3E9J B;  1O73 A;  3M9K A;  2F8F A;  3ZYW A;  4A5P A;  4KAE A;  1YVL A;  3HYP A;  4EL1 A;  1GLP A;  1EGO A;  2H01 A;  1AUC A;  2VCW A;  1AAZ A;  4NV2 A;  3KIJ A;  3WGE A;  4K9Z A;  3BBY A;  3TJJ A;  3ZIJ A;  1T7P B;  4HQS A;  1GSQ A;  2GS3 A;  1F37 A;  4BPY A;  1R5P A;  1ZYE A;  3GH6 A;  4GSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...