4ZBEA

Crystal structure of kpc-2 beta-lactamase complexed with avibactam
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
264
structure length
264
Chain Sequence
b'TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenem-hydrolyzing beta-lactamase KPC
molecule tags Hydrolase/hydrolase inhibitor
source organism Klebsiella pneumoniae
publication title Inhibition of Klebsiella beta-Lactamases (SHV-1 and KPC-2) by Avibactam: A Structural Study.
pubmed doi rcsb
total genus 93
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zbeA00
3UNWA 3SS3A 1L0DA 3M2KA 4GB7A 3QNCA 1MWRA 2FFFB 3SS4A 1HVBA 3OCNA 3ZG0A 5FASA 3Q82A 5HAQA 5CEBA 5GLAA 4QY5A 3WS5A 5FDHA 1K4FA 1XXMA 4WBGA 3Q1FA 2A49A 3QHYA 3WRZA 4CPKA 3IT9A 1YMSA 4L0LA 4KZBA 1FSYA 4OOYA 3S1YA 3IF6B 4HEFA 3AGDA 4LV3A 5A92A 2V2FF 4F94A 3NCKA 3MFDA 4C6YA 5TGFA 1PWCA 4KZ9A 1BZAA 1FR1A 2G2WA 2PU2A 3E2KA 3D4FA 2J8YA 2C5WB 5EPHA 4ZJ1A 2WK0A 2HDRA 1G6AA 4WEKA 1NYMA 2Y2HA 2WZXA 5TFQA 3IXDA 3MZEA 3N8LA 3V39A 2OV5A 1S6RA 3UDXA 3G31A 1QMEA 3ZVWA 4WM9A 1CK3A 4DE3A 2HDQA 2X02A 2Y59A 3IHBA 3HBRA 5CHMA 4EV4A 1OMEA 4DF6A 1L2SA 3HLFA 3PBSA 1ESUA 1MWSA 1BLPA 1YLWA 2J7VA 4GD8A 4NETA 5DF8A 1NZOA 4JBFA 5FAOA 3IWOA 2Q9NA 2V1ZA 1I2SA 1JWZA 4MBFA 3IXGA 2WADA 1EI5A 1M6KA 5CHUA 5DTSA 3UO9A 1BLCA 1W8QA 4QY6A 2DRWA 3Q7ZA 3BLSA 4OLDA 1NY0A 3NBLA 4N9KA 4QU3A 1FR6A 2IWCA 4R0QA 3VP1A 1JWVA 1J9MA 2PBYA 4GN2A 3O86A 4LV2A 5DTTA 1RGZA 5EECA 3IH8A 4EWFA 2Y2MA 3LO7A 4GKUA 3LEZA 3BFGA 2V20A 1MPLA 3JYIA 2EXAA 1BSGA 3G32A 1YT4A 3ITAA 5I94A 4S2NA 1K54A 2XDMA 3G34A 2VGJA 4Q8IA 3S4XA 5GLCA 4DE2A 4JKTA 2RL3A 3EQVA 4PMAA 2EFXA 5GL9A 5HW3A 4P87A 3P98A 4LV0A 4KENB 4JXWA 4MNRA 4EBLA 1H5XA 4X53A 1K25A 2HPBA 3OPLA 1IELA 2JBFA 1K54C 2XFSA 5FQQA 4ZBEA 5CERA 4RA7A 4C3QA 3FWLA 4R1GA 1XGIA 2Y2OA 3FZCA 4S2JA 3ZVTA 4GOGA 5E43A 3LY3A 4K0XA 1ESIA 3W4OA 1K55C 4RVAA 1RGYA 4OPQA 5M19A 3N8RA 1K56A 2IWDA 3NY4A 1IEMA 2G2UA 1IYSA 2WKIA 4S2IA 1KGGA 1PW1A 5EVIC 3C7UA 4OKPA 1I5QA 1VQQA 3Q81A 3N7WA 4YFMA 2HDSA 1E4DA 2H5SA 4BQMA 1FCNA 3B3XA 3FV7A 4P6BA 4BL3A 3TSGA 2RCXA 2EX2A 4X55A 1Z6FA 1PZOA 5HFOA 1KDWA 4OPRA 1I2WA 2HP5A 3P09A 5F82A 4EUZA 1PYYA 5GHZA 3HUNA 2Y2LA 4UA6A 1TDLA 3IF5A 2XK1A 4JXGA 1K38A 5FI6A 3VFHA 3PBNA 4A5RA 3NC8A 2Y2NA 4MBHA 1Q2PA 1KE0A 1KE4A 1L0EA 3BFEA 3HVFA 4KG6A 2ZM0A 1IKIA 2IWBA 4JF4A 2WGWA 1IYOA 2UWXA 3HLBA 4FSFA 3GV9A 3TG9A 3WRTA 1E3UA 1M40A 3UDFA 1FCMA 3HLCA 3ITBA 3ZNTA 3BEBA 4XUZA 4KZ3A 2OLUA 1TDGA 4RX2A 1FQGA 4WYYA 4WMCA 4CJNA 4ID4A 1BTLA 3CZDA 2VGKA 1L0FA 5G18A 1MXOA 3ZG8B 2OLVA 3AGFA 3DWKA 3PBRA 4GDNA 1O07A 3NDGA 3OPRA 2X01A 2R9WA 2ZQDA 3BFDA 5CTMA 2Y2QA 1YLPA 5KSCA 4PM8A 5CEDA 3IXBA 2XLNA 3VSKA 3BFCA 3FKVA 1EROA 3WWXA 5FSRA 1NYYA 2WUQA 4N92A 4QD4A 3ZG9B 5CTNA 5KZHA 3IXHA 3WS2A 4P0MA 2XFTA 3VP0A 2ZJ9A 4JXSA 1W79A 2BG1A 2ZMAA 4B4ZA 4E3IA 5U47A 4EBPA 3VOYA 1DJCA 5M1AA 2P9VA 5FAQA 4DKIA 5HL1A 2OSUA 3NDEA 3M2JA 1ES5A 1DY6A 3N6IA 1ONHA 4WZ5C 4MBKA 1ZC2A 2Q9MA 5JYOA 3OPHA 1E25A 3UPNA 4P85A 4S2NC 3V5MA 3G4PA 5HX9A 4ZTKA 4IEDA 3G2YA 2P9VB 5EOOA 1BLHA 4DE0A 2Z2LB 4KZ4A 4QHCA 4BD0A 5FA7A 3PTEA 1N4OA 3IWIA 3ZCZA 1H8YA 1NRFA 1ES2A 5FQ9A 2H0TA 1ERMA 4EQIA 3BYDA 4KQOA 1NXYA 1BUEA 1YLTA 3ZFZA 1XA7A 2ZQCA 1NJ4A 1GA9A 4BENA 5BOHA 1EWZA 1PI4A 1LI0A 2XD5A 3LCEA 2WKHA 4IBXA 5L2FA 4GNUA 3ISGA 4ZJ2A 3ZNYA 1MY8A 1WYBA 1BLSA 1N9BA 2QMIA 3CMZA 4S2PA 5J8XA 1GHIA 4K0WA 2H0YA 1CEFA 5E2HA 1YLYA 4DDSA 3I7JA 4DRTA 3PAEA 3G30A 3OZHA 5E2EA 1KGEA 1XA1A 4X69A 1KE3A 3IF6C 2Y2KA 1LL9A 2I72A 4LCMA 2FFYA 1XKZA 4Y0UA 2JC7A 3V3RA 3BLMA 3HUOA 4O7DA 2C6WB 1O7EA 3Q07A 3HLWA 4B4XA 1S0WA 4N1HA 4PM9A 3ZDJA 1PIOA 3Q7VB 1YQSA 4WZ4A 5EVID 5CHJA 2HDUA 4DDYA 4WZ5A 3IWQA 5FQIA 5DF7A 1K57A 4HESA 1K56D 1H8ZA 1XP4A 4OONA 4OVDA 2XGNA 1IYQA 4S2LA 3IF6A 4U0XA 2EX6A 2Y2IA 4K91A 1MWUA 4QJGA 2XEPA 3UN7A 5HARA 2ZC3B 4R4RA 3OC2A 4X68A 4XXRA 5TR7A 4IBRA 5EVLA 2WAFA 3RXXA 4NK3A 4KZ8A 1PWGA 1QMFA 4R4SA 1TVFA 4X56A 3TOIA 4E6WA 3W8KA 2ZC5B 4HBTA 3UPOA 3LY4A 1NZUA 4OOMA 4X6TA 1XPBA 4Y7PA 3ZG5A 5JYPA 4YINA 3G2ZA 4Y0OA 3C4PA 4E3OA 4JF6A 4GD6A 2WGVA 1SHVA 4KZAA 4OH0A 3PBOA 3MZDA 2GDNA 2WGIA 4WEJA 5CRFA 3HREA 1BT5A 4ZAMA 3MKFA 1ES3A 3O88A 1CI8A 5EE8A 1BULA 4EBNA 1K6RA 2Y4AA 1E3UD 5FAPA 3DTMA 4E3NA 5CECA 2ZQ8A 2E8IA 3ZGAB 4KZ5A 4OQIA 4XUXA 1JTDA 5CXWA 3G35A 5EVIA 5FQKA 1YMXA 3VMAA 5KSHA 1CEGA 5GHYA 4GZBA 5DF9A 1ONGA 2ZC7A 4FD8A 4M3KA 4KG5A 5CGXA 5AQAA 2R9XA 3EQUA 3A3FA 3GR2A 3N4IA 5EOEA 4JXVA 5IHVA 3MXRA 4N9LA 3A3DA 4E3KA 1SDNA 3FKWA 1ES4A 4DXCA 2ZC6B 2XH9A 4PM5A 5M18A 4OP8A 1ZKJA 4OOLA 1HZOA 5E2GA 3SH7A 3N8SA 3UE0A 2Y91A 1JVJA 1PW8A 1LHYA 1JWPA 3MZFA 3GQZA 3UE3A 1HTZA 3BRMA 4R23A 5GHXA 2HP6A 5D3OA 5DTKA 3E2LA 1ZG4A 3VFFA 4DE1A 4MLLA 1ZG6A 3WS1A 2Y2PA 1K4EA 3O87A 3RXWA 3DW0A 4GDBA 4FH2A 4OPZA 1DJAA 3GRJA 3C4OA 4Z9QA 3C7VA 3OPPA 4HBUA 3V3SA 1MWTA 5DVAA 3VP3A 4N1XA 2EFUA 1PI5A 4OP5A 3VP4A 3DWZA 4KZ6A 3QNBA 1FSWA 2JCHA 2P74A 4JF5A 3ZG7B 3WS4A 2J9PA 1KVLA 3Q7VA 1RP5A 1MKIA 1XGJA 5A91A 4E6XA 4RYEA 1K57C 4H8RA 4B88A 4BD1A 5FI2A 4OPYA 2QPNA 4ZJ3A 3BM6A 4JPMA 2DNSA 3NI9A 3SS5A 3GMWA 4Y0TA 1Q2QA 1SCWA 4KQRA 3SH9A 2ZD8A 4BJPA 3OCLA 4QB8A 4BL2A 2J9OA 1RCJA 4UA9A 1KVMA 1YLJA 2Y2GA 4IVIA 5A93A 1IKGA 2EX8A 5E2FA 5FQMA 3M6HA 4PM6A 4BLMA 3HLDA 2ZM8A 1ERQA 2ZQ7A 3A3JA 3BFFA 4OQHA 3W4QA 4UHUA 1AXBA 3HL9A 1ALQA 1SDEA 5HAPA 3GTCA 2QZ6A 1LI9A 2JE5A 1W7FA 3ZHHA 1HD8A 1WYCA 4D2OA 2WZZA 2HP9A 2XD1A 1PWDA 2H10A 1YLZA 4LV1A 1G68A 1Y54A 1LLBA 2PU4A 2Y55A 3GSGA 3IHAA 4JLFA 4S2OA 2WYXA 4C75A 3MBZA 4E3JA 3UPPA 5A90A 4RX3A 3PAGA 4FH4A 3BECA 4OQGA 3CJMA 3C5AA 3HLEA 1MBLA 5GLBA 3V50A 1GCEA 1GA0A 3NIAA 4MEZA 4DXBA 2EX9A 4KZ7A 4OLGA 5CGSA 4PPRA 3AGEA 3FYZA 1GHMA 4E3MA 1W8YA 1LL5A 1SKFA 5FATA 3PBTA 4KQQA 1GHPA 2ZQAA 2ZLYA 2XQZA 4U3TA 4UAAA 5AQ7A 3UY6A 5CGWA 1YM1A 1IYPA 5AQBA 5GLDA 2EXBA 3VP2A 2WGWB 3IQAA 3W4PA 1U60A 3VSLA 4R3BA 2X71A 2XR0A 1K55A 5HAIA 1JTGA 2CC1A 5F1FA 4KG2A 4LCLA 4OQ0A 4R3JA 2Y2JA 2ZM2A 2BLSA 2B5RA 1TEMA 2ZQ9A 3HUMA 4S2MA 1DJBA 3MXSA 4ZDXA 4UA7A 2WKEA 1K6SA 1KGFA 4PM7A 5F1GA 2ZC4B 3VOZA 4E3LA 3SOIA 1VM1A 3M6BA 3UDIA 1PZPA 2XF3A 3WS0A 1FOFA 3GVBA 4WMCD 5EVIB 3PBQA 5AQ9A 4U0TA 2DCFA 3O3VA 3HLGA 1WE4A 3A3IA 4LENA 1C3BA 1CI9A 5EUAA 1L0GA 2WAEA 5KMWA 2A3UA 5FI7A 3CG5A 3RJUA 3SH8A 3UE1A 4WELA 5FQJA 1FCOA 3A3EA 4FCFA 5F83A 1XX2A 4S2KA 3MKEA 4IVKA 1W5DA 2Z2MB 3IH9A 3S22A 1KDSA
chains in the Genus database with same CATH superfamily
3IS2B 1L0DA 4GB7A 2FFFB 1HVBA 3OCNA 2LB9A 2V8CA 1F98A 2Z6CA 1S1ZA 1K4FA 4WBGA 4CPKA 4L0LA 4KZBA 1FSYA 4OOYA 3IX4A 2B95A 4LV3A 5A92A 4C6YA 1PWCA 5K5BA 4KZ9A 2PU2A 3E2KA 4ZJ1A 2HDRA 1G6AA 4WEKA 2OAP1 4MN6A 3D9YA 3QP6A 3V39A 4Q0JA 4ESPA 4EERA 2PDRA 1ESUA 1YLWA 1NZOA 3DTKA 2V1ZA 3A0SA 2O0YA 3KYZA 1BLCA 4QY6A 3Q7ZA 4QPRA 3BLSA 3NBLA 1FR6A 2YKHA 1J9MA 3KSHA 5DTTA 5EECA 3UMDA 4Q0IA 3LEZA 3JYIA 2EXAA 4LLOB 2VGJA 4Q8IA 3S4XA 1T1BA 1UWPX 3P98A 4LV0A 1G5UA 4JXWA 1K25A 2EWWA 4L9EA 2XFSA 4GJ4A 3P7NA 5CERA 4RA7A 4R1GA 3FZCA 4S2JA 3LY3A 1LT0A 4OPQA 3QP5A 3LI8A 5M19A 3F1OA 3N8RA 4HP9A 3RH8B 1K56A 4Y0TA 4S2IA 4MN5A 1PW1A 4OKPA 1I5QA 1VQQA 4YNRA 3N7WA 2QWSA 1VETA 3F1PA 4P6BA 1OJ5A 3MF0A 1KDWA 5F82A 2PT7A 2XK1A 2K2NA 4AFIA 3NC8A 1KE4A 3BFEA 4KG6A 2IWBA 3WRTA 5F69A 1E3UA 1M40A 3UDFA 1OTDA 3ITBA 3BEBA 3NHQA 3IX3A 2W3DA 5HDCA 4ARZB 3ZG8B 3DWKA 4GDNA 1O07A 5FL3A 3NDGA 1UWNX 2Y2QA 4EETB 1YLPA 4PM8A 5CEDA 3BY8A 3V67A 5L10A 5HWVA 2XFTA 4JXSA 2E8JA 2ZMAA 2P9VA 1MZUA 2A24A 2XA7M 3NDEA 1ONHA 2Q9MA 5JYOA 3E98A 4S2NC 4ZTKA 3LR4A 1J3WA 2HZ5A 4KUKA 1T1AA 3PTEA 1N4OA 5AJGA 1H8YA 2H0TA 1ERMA 1NXYA 3IBRA 4ZRRA 1LI0A 3LCEA 2WKHA 5L2FA 2W27A 1WYBA 3CMZA 5TBMA 4EU0A 1CEFA 1SKOB 3CI6A 2CMNA 2PR6A 3CAXA 4X69A 3T1SA 3PYPA 1LL9A 4LCMA 3PHYA 3V3RA 3TW8A 3Q07A 4N1HA 4WZ4A 5CHJA 2HDUA 2ZOIA 4DDYA 4HESA 1IYQA 3OOVA 4I3IA 4FTXA 3R4KA 3OC2A 4R4RA 4X68A 4XXRA 5TR7A 2A2LA 4IBRA 4PKYA 4CLCB 3RXXA 2VK3A 4KZ8A 5FDSA 2JKGA 4CLCA 2VV6A 2VX8A 2JN7A 1D7EA 3ZG5A 4E3OA 4OH0A 3FC7A 4KZAA 2WGVA 4GD6A 4WEJA 3MZDA 2WGIA 4H6JB 1ES3A 5EE8A 5HPFA 3QP1A 3ZGAB 3UE6A 4XUXA 3G35A 1YMXA 4PAUA 3NOPC 5GHYA 2VA0A 4M3KA 4HY8A 4N9LA 3UB8A 4OOLA 1HZOA 4JGPA 4DJ3A 3N8SA 1JVJA 1PW8A 3QP2A 3W2ZA 3T4OA 1HTZA 5D3OA 5DTKA 3E2LA 4DE1A 3LIDA 1P9RA 2Y2PA 2V9AA 1HLUP 1T1CA 3C7VA 3OPPA 3VP3A 1ZHHB 1TS0A 4N1XA 1PI5A 2QJ5A 3QNBA 1FSWA 2JCHA 4JF5A 3U4LP 1KVLA 3Q7VA 3KX0X 4GS9A 5A91A 4E6XA 1OPXA 4RYEA 4MDZA 4B88A 4OPYA 2QPNA 5HZHA 1VHMA 3BM6A 2J3TC 3NI9A 2VEAA 2L0WA 1SCWA 3SH9A 2ZD8A 4QB8A 2Y2GA 1CQAA 1SKOA 3M6HA 2PD7A 3A3JA 3BFFA 4WLAA 4UHUA 1AXBA 5HAPA 5DKKA 2QZ6A 3ZHHA 1W7FA 2HP9A 3B42A 3KO6A 1PWDA 2H10A 4HJ6A 1VB6A 2WYXA 3CPTA 5DFYA 4BBUA 5EV0A 5IT5A 3EOIA 2V1BA 5GLBA 3V50A 4KZ7A 4PPRA 3FYZA 1LL5A 5FATA 4KQQA 5HPIA 5AQBA 5GLDA 4EEPA 3VSLA 5FEFA 5HAIA 1JTGA 2XRNA 4OQ0A 4LCLA 3UB5P 2Y2JA 2ZM2A 2BLSA 1TEMA 3MXSA 1XJ2A 2D01A 2VGLS 3VOZA 3SOIA 3WS0A 2XF3A 4IHQA 1FOFA 2EA9A 3GVBA 2FZ0A 5EVIB 3PBQA 5AQ9A 3S7NA 3BY9A 4G3KA 3PXPA 3FPWA 2A3UA 5FI7A 2GNXA 3E4QA 4WELA 5FQJA 3F1NA 3H82B 1XX2A 4S2KA 2VKSA 2Z2MB 3UNWA 3SS3A 4KUOA 1YKDA 3ZG0A 4FOFA 3TJZC 5HAQA 5GLAA 4GLQA 3WS5A 4IUHA 5MC7A 3Q1FA 3WRZA 1MKMA 4LRXC 2V2FF 4F94A 2G2WA 3D4FA 2J8YA 2WK0A 3TE8A 2Y2HA 2WZXA 3IXDA 5G4ZA 3MZEA 1OTBA 3UDXA 1QMEA 2ZMFA 1CK3A 1XJ4A 3HBRA 5CHMA 4EV4A 4XT2A 3PBSA 2WKQA 1BLPA 2J7VA 5DF8A 3IWOA 2Q9NA 1W8QA 3CITA 4N9KA 3KSGA 1V9ZA 3VP1A 1JWVA 2L4RA 4BWIA 4LV2A 4EWFA 2Y2MA 2OOLA 2V20A 4X1LA 1BSGA 3G32A 5I94A 4S2NA 1GSWA 3LI9A 2RL3A 3NECA 4PMAA 2EFXA 4KENB 1H5XA 4X53A 2HPBA 3OPLA 5FQQA 4C3QA 3FWLA 3VE4A 3W4OA 3NOUC 1K55C 2KDKA 5L8MA 3A0VA 1FCNA 1YPRA 2EX2A 5DJUA 1OJGA 1I2WA 2AVXA 4EUZA 3HUNA 2Y2LA 3IF5A 4JXGA 4A5RA 2Y2NA 4MBHA 1KE0A 3RFBA 2ZM0A 2WKRA 3HLBA 4FSFA 3EEHA 4R3AA 2M1CA 4RX2A 2NUTC 4WYYA 4HJ4A 2W3EA 4ID4A 1BTLA 1L0FA 1MXOA 2PR5A 3AGFA 3PBRA 3EGXC 1SZVA 2JKRI 1ZTUA 2XLNA 5J3WA 1W63M 3WWXA 1MC0A 4JGOA 4N92A 2JHEA 3IXHA 4P0MA 2ZJ9A 4E3IA 3C38A 5FAQA 4DKIA 3M2JA 1ES5A 4WZ5C 4L9GA 4MBKA 3OPHA 1E25A 3UPNA 2HJEA 3V5MA 3G4PA 4R6LA 5HX9A 4WUJA 3ZYTA 4IEDA 3G2YA 1H3QA 3UMEA 1GSXA 1NLYA 1NRFA 1ES2A 5FQ9A 4EQIA 4KQOA 1BUEA 1YLTA 3ZFZA 1XA7A 2VJWA 1GA9A 3GECA 5BOHA 1H8MA 1EWZA 3FG8A 1PI4A 2ZBBA 4IBXA 3ISGA 4S2PA 5J8XA 3H82A 3QP8A 1GHIA 2B18A 1S4SA 3F1NB 1CJFA 1YLYA 4DDSA 2BTFP 3I7JA 2M7UA 4DRTA 3K3DA 4CQHA 1H0MA 1KGEA 2I72A 3NULA 2JKRM 1XKZA 4Y0UA 2W3HA 1O7EA 3HLWA 3ZDJA 1PIOA 3KSFA 5EVID 1LL8A 2GZAA 1H8ZA 2PYPA 4S2LA 4U0XA 1MWUA 2XEPA 3MR0A 2O99A 4Y17A 1ACFA 2HV1A 1QMFA 4I5SA 1TVFA 4HBTA 4EQ1A 3UPOA 4E04A 3PR6A 3CPTB 4Y0OA 2O9CA 5CRFA 4ARZA 2GDNA 4LFUA 3HREA 1BT5A 4LRYC 1CI8A 1BULA 1K6RA 4P6ZM 4E3NA 2ZQ8A 4KZ5A 2G7UA 5KSHA 3DTEA 2W0NA 1Y28A 2M7VA 5CGXA 4KG5A 3BWLA 3GR2A 3N4IA 3E0YA 3MXRA 1S66L 4E3KA 3A3DA 3FKWA 2ZC6B 3EGDC 5J7EA 2XH9A 1A0KA 4OP8A 1XJ6A 3IBJA 1W63Q 4GS9B 1DP8A 3NJAA 5E2GA 4DN0A 3UE0A 2Y91A 1LHYA 3GQZA 3BRMA 2VLGA 5GHXA 4M4XA 1ZG4A 1ZG6A 3WS1A 1BYWA 3DW0A 4OPZA 4P6ZS 1DJAA 1MWTA 5DVAA 4OP5A 2EFUA 3R7WB 5HD5A 3ZG7B 1F2KA 1XGJA 3MFXA 1OTAA 3LR5A 5FI2A 4BD1A 2DNSA 3JVUA 5HSQA 3GMWA 1Q2QA 4KQRA 4BJPA 2W3GA 4BL2A 2J9OA 1RCJA 4UA9A 5A93A 1YLJA 3RTYA 1S4RA 4NXGA 5FQMA 4PM6A 3HLDA 2ZM8A 1ERQA 2ZQ7A 4OQHA 3HL9A 1STZA 3KYQA 3GTCA 4EEUA 3T1QB 3MXQA 2L1MA 1YLZA 1LLBA 3GSGA 3IHAA 3MBZA 4E3JA 3MSHA 3UPPA 1PRQA 5EVEA 5C5KA 4X1MA 3CJMA 3C5AA 3HLEA 3NIAA 4MEZA 4OLGA 4YOFA 1GHMA 4E3MA 1SKFA 4CLCE 4U3TA 5AQ7A 5CGWA 3DBAA 2EXBA 3VP2A 1U60A 2JKTM 4R3BA 2X71A 1KOUA 1K55A 4R3JA 4ZDXA 3T4KA 1DJBA 1PNEA 1KGFA 4PM7A 3LUQA 1CF0A 1P9WA 4WMCD 5EM1A 2DCFA 3HLGA 4LENA 1L0GA 5EUAA 2WAEA 3RJUA 4I39A 3SH8A 3UE1A 2BASA 4FCFA 5F83A 4EW7A 3MKEA 1AWIA 3S22A 3QNCA 3JVVA 1X0OA 3SS4A 5FASA 4F3LB 5CEBA 4GHIB 3H7WB 5FDHA 4YWZA 3QHYA 2K7SA 4BMWA 3IF6B 3AGDA 3L7HA 3NCKA 5TGFA 1BZAA 1FR1A 4BBVA 2Y79A 2JKTI 5TFQA 3N8LA 4PHTA 2OV5A 3O5YA 2P08A 4DE3A 2Y59A 4MN7A 1MWSA 4NETA 4JBFA 2DMWA 4MBFA 3IXGA 2WADA 5DTSA 4EUVA 2DRWA 1NY0A 2IWCA 3D72A 2B02A 3ZQ5A 3SW1A 3O86A 4G3WA 1RGZA 3LO7A 1YT4A 2QYBA 1K54A 3G34A 4JGQA 4UQIS 5GLCA 4JKTA 3EQVA 4HH2A 5GL9A 4P87A 2Q0OA 3A0RA 4EBLA 1IELA 1K54C 4H6JA 4ZBEA 3ZVTA 2Y2OA 4GOGA 2K31A 4K0XA 1ESIA 1F9IA 2W3FA 5DFXA 3T4JA 1RGYA 3RXWA 2G2UA 1IYSA 2WKIA 1KGGA 3C7UA 4YFMA 1E4DA 2H5SA 4HIAA 3P01A 3TSGA 2RCXA 1PZOA 5HFOA 3BQAA 3P09A 1PYYA 4UA6A 1TDLA 4CLCD 1K38A 5FI6A 3T12B 3VFHA 1L0EA 2ZL1A 3S7QA 2WGWA 1IYOA 2UWXA 3TG9A 3GV9A 3S7OA 2OAQ1 1FCMA 2OLUA 2I9VA 4WMCA 3VOLA 2VGKA 3HJIA 4R70A 3OPRA 2R9WA 2ZQDA 3BFDA 5KSCA 4K08A 1S67L 5FSRA 2WUQA 4QD4A 3WS2A 3VP0A 2BG1A 4B4ZA 2W1TA 4ME4A 5U47A 3VOYA 1DJCA 5M1AA 5HL1A 4KQDA 5HWTA 2OSUA 3N6IA 1ZC2A 2ACGA 4EXOA 3B47A 5TJJA 4HH3A 2P9VB 1BLHA 5A8BA 2Z2LB 4KZ4A 1D06A 4BD0A 2P04A 3BJNA 1JNUA 1NLZA 3IWIA 4NEED 3ZCZA 1P97A 3UB9A 3BYDA 4MMNA 2KLIA 2XD5A 4GNUA 5IS1A 1MY8A 1TS8A 1BLSA 2IA2A 2QMIA 2H0YA 2HGVA 4CLCC 3T1XA 4XT2B 1XJ3A 3G30A 5E2EA 2Y2KA 1FIKA 3LIBA 4B4XA 1S0WA 4PM9A 3Q7VB 1FILA 3IWQA 1VEUA 5FQIA 1K56D 5LBRA 4OONA 2XGNA 2Y2IA 4K91A 4QJGA 3UN7A 5HARA 2ZC3B 3G6OA 4JGRA 1IOUA 3BW6A 2WAFA 4NK3A 1TS6A 4I38A 4X56A 3TOIA 4E6WA 2ZC5B 4OOMA 4X6TA 3UB7A 1XPBA 5JYPA 3C4PA 4JF6A 1IFQA 1XFQA 3PBOA 4ZAMA 3O88A 3EEAA 4EBNA 2Y4AA 3SZTA 1E3UD 5L07A 3VE3A 4NKPA 4OQIA 1JTDA 5EVIA 4II7A 1CEGA 3CUEC 5DF9A 2ZC7A 4FD8A 2R9XA 3EQUA 1EW0A 1SDNA 4RQ9A 5DJTA 1ES4A 4PM5A 2O9BA 4WF0A 2VV8A 2PBDP 3SH7A 3R7WA 1JWPA 2QKPA 3UE3A 3T4SA 3VFFA 1K4EA 2V0UA 3O87A 4FH2A 2NUPC 3GRJA 1OT9A 3CUEA 4HBUA 3V3SA 3VP4A 2P74A 2J9PA 1L3LA 4I3AA 5F68A 1P0ZA 1RP5A 1MKIA 1K57C 2PAVP 4JPMA 4B93A 3JPUA 2HF6A 2W1TB 3DAVA 4IVIA 1IKGA 2EX8A 5E2FA 4BLMA 1N9OA 1SDEA 3LFVA 2J3WA 3IS2A 3CHWP 2V1AA 1HD8A 1WYCA 4D2OA 4UQIM 2XD1A 3LIEA 1G68A 1Y54A 2PU4A 4JLFA 4S2OA 2VGLM 2HJ9C 4Y13A 4EESA 3PAGA 4OQGA 1MBLA 2EX9A 3AGEA 1TD5A 4Y5FA 1GHPA 2ZQAA 2XQZA 4UAAA 2PHYA 3UY6A 1YM1A 1ODVA 3HJKA 3W4PA 2WGWB 3IQAA 3FPVA 5F1FA 4KG2A 4NG2A 2ZQ9A 4Y3IA 2WKEA 1K6SA 2A24B 2EWVA 3M6BA 1PZPA 1OTEA 3GDIA 3T1RA 1YSQA 4U0TA 3O3VA 3A3IA 1C3BA 1CI9A 3F1PB 5KMWA 3T4TA 3CG5A 3K3CA 2XSSA 3T50A 1W5DA 3IH9A 1GSVA 2V0WA 1N9NA 3M2KA 1TS7A 1MWRA 1S1YA 3KYEA 3Q82A 4LRZE 4QY5A 2KX6A 1XXMA 4ETXA 2A49A 4FUWA 3IT9A 1YMSA 3S1YA 4HEFA 1DP9A 1XFNA 3MFDA 3LEQA 1D1JA 1WA9A 2C5WB 5EPHA 1DP6A 5HDSA 1YAXA 3NOTC 1G6OA 1NYMA 4Y15A 1S6RA 3G31A 1K0KA 3ZVWA 4WM9A 5DKLA 3H9WA 1VETB 2HDQA 2X02A 3IHBA 2J3TD 2GX5A 1OMEA 4HNBA 4DF6A 1L2SA 3HLFA 4GD8A 5FAOA 1I2SA 1JWZA 4HQAA 5CHUA 1EI5A 1M6KA 3UO9A 4HHDA 4B9OA 4OLDA 4QU3A 4R0QA 2PBYA 4GN2A 3E4PA 2WKPA 2OWJA 3IH8A 4GKUA 3BFGA 1MPLA 3ITAA 1VEUB 2OWHA 3T4QA 2ZMVA 2XDMA 4DE2A 5HW3A 1DRMA 4MNRA 3H7WA 2JBFA 1XGIA 5E43A 4RVAA 2IWDA 3NY4A 1IEMA 5EFWA 5EVIC 3Q81A 4Z1WA 2HDSA 4BQMA 3B3XA 3FV7A 4BL3A 4DJ2A 4X55A 1Z6FA 4OPRA 5IU1A 2HP5A 5GHZA 2LB5A 4WN5A 4D60A 3PBNA 5I5LA 2QJ7A 1Q2PA 4LGWA 1Y4OA 3LR0A 3HVFA 3C2WA 5L09A 1IKIA 4JF4A 5G4YA 4NXFA 3HLCA 3ZNTA 4XUZA 1YSPA 1F5MA 4KZ3A 1OTIA 1TDGA 3CWFA 1FQGA 4CJNA 1OT6A 3B33A 3CZDA 4X25A 5G18A 2OLVA 3MQ0A 3L9KA 3S7PA 3IX8A 3D3OA 5CTMA 2X01A 2UV0E 3IXBA 4NXBA 3VSKA 3BFCA 3FKVA 1EROA 1NYYA 3ZG9B 5CTNA 5KZHA 4O8GA 4R38A 1W79A 4EBPA 2ZOHA 1DY6A 4HI4A 4P85A 4LPZA 5AVEA 5EOOA 4DE0A 4HJ3A 4QHCA 5FA7A 3LICA 5F6AA 3OBFA 3LIAA 2ZQCA 1NJ4A 4UEYA 4BENA 4Y2FA 2D02A 2FH5A 4ZJ2A 3ZNYA 3K2NA 1N9BA 3LIFA 4K0WA 5HDDA 4O0PA 5E2HA 2VZWA 1LSVA 3PAEA 3BQ8A 3OZHA 1XA1A 3KSIA 1KE3A 3IF6C 3DTIA 4WL9A 2FFYA 5EM0A 1T19A 4L9FA 2JC7A 4NXEA 4O01A 2R78A 3BLMA 3HUOA 2C6WB 3MS6A 4O7DA 5KIZA 1NWZA 1YQSA 4WZ5A 2PD8A 5DF7A 1K57A 4BBTA 4OVDA 1XP4A 3IF6A 2EX6A 3MQOA 3EWKA 2VV7A 4GHIA 5EVLA 5J4EA 1PFLA 2P7JA 1PWGA 3LGOA 4R4SA 2Y8HA 2KOIA 5TBMB 3W8KA 3LY4A 1NZUA 4Y7PA 5FEGA 4YINA 3G2ZA 1SHVA 2J80A 3MKFA 4QWOA 1N9LA 5FAPA 3DTMA 2JKFA 5CECA 2YKFA 2E8IA 4ETZA 5HWWA 5FQKA 3VMAA 5CXWA 3MMHA 2XA7S 4GZBA 3E4OA 1ONGA 5AQAA 5EOEA 3A3FA 5IHVA 4HOIA 4JXVA 2PRFA 4DXCA 4F3LA 5M18A 1ZKJA 4PKYG 3MJQA 4MCWA 3MZFA 3TRCA 4R23A 2HP6A 4MLLA 3U2AA 1LSXA 5F5YA 4GDBA 3LYXA 3C4OA 4Z9QA 3VV4A 3F1OB 1T18A 3DWZA 4KZ6A 5CX7A 3T4LA 3WS4A 4GW9A 4H8RA 2Z6DA 4ZJ3A 3SS5A 2ZL1B 3OCLA 4DMZA 1KVMA 5HL6A 4IJGA 3W4QA 1V9YA 1ALQA 1LI9A 2JE5A 3C30A 3QP4A 2WZZA 3CLOA 4LV1A 4C75A 2Y55A 2XROA 5A90A 4RX3A 4FH4A 3BECA 1LSWA 3MQQA 1GCEA 1G28A 1GA0A 4DXBA 1TF1A 5CGSA 2V8FA 1W8YA 3PBTA 2MJ6A 2ZLYA 1IYPA 2XR0A 2GJ3A 3C8CA 2CC1A 2B5RA 4S2MA 3HUMA 3ULFA 4UA7A 4IUKA 1UGUA 5F1GA 2ZC4B 4GCZA 4E3LA 2H28A 1VM1A 3UDIA 3ICYA 4G3VA 3HCYA 2W1RA 2O9AA 2INWA 1WE4A 4Q0HA 2QHKA 5AVFA 4I3JA 3OLOA 1NRJA 2PYRA 3LR3A 3UB6A 1FCOA 3A3EA 4IVKA 1Z09A 5HD3A 4HP4A 1KDSA
chains in the Genus database with same CATH topology
3UNWA 3SS3A 1L0DA 3M2KA 4GB7A 3QNCA 1MWRA 2FFFB 3SS4A 1HVBA 3OCNA 3ZG0A 5FASA 3Q82A 5HAQA 5CEBA 5GLAA 4QY5A 3WS5A 5FDHA 1K4FA 1XXMA 4WBGA 3Q1FA 2A49A 3QHYA 3WRZA 4CPKA 3IT9A 1YMSA 4L0LA 4KZBA 1FSYA 4OOYA 3S1YA 3IF6B 4HEFA 3AGDA 4LV3A 5A92A 2V2FF 4F94A 3NCKA 3MFDA 4C6YA 5TGFA 1PWCA 4KZ9A 1BZAA 1FR1A 2G2WA 2PU2A 3E2KA 3D4FA 2J8YA 2C5WB 5EPHA 4ZJ1A 2WK0A 2HDRA 1G6AA 4WEKA 1NYMA 2Y2HA 2WZXA 5TFQA 3IXDA 3MZEA 3N8LA 3V39A 2OV5A 1S6RA 3UDXA 3G31A 1QMEA 3ZVWA 4WM9A 1CK3A 4DE3A 2HDQA 2X02A 2Y59A 3IHBA 3HBRA 5CHMA 4EV4A 1OMEA 4DF6A 1L2SA 3HLFA 3PBSA 1ESUA 1MWSA 1BLPA 1YLWA 2J7VA 4GD8A 4NETA 5DF8A 1NZOA 4JBFA 5FAOA 3IWOA 2Q9NA 2V1ZA 1I2SA 1JWZA 4MBFA 3IXGA 2WADA 1EI5A 1M6KA 5CHUA 5DTSA 3UO9A 1BLCA 1W8QA 4QY6A 2DRWA 3Q7ZA 3BLSA 4OLDA 1NY0A 3NBLA 4N9KA 4QU3A 1FR6A 2IWCA 4R0QA 3VP1A 1JWVA 1J9MA 2PBYA 4GN2A 3O86A 4LV2A 5DTTA 1RGZA 5EECA 3IH8A 4EWFA 2Y2MA 3LO7A 4GKUA 3LEZA 3BFGA 2V20A 1MPLA 3JYIA 2EXAA 1BSGA 3G32A 1YT4A 3ITAA 5I94A 4S2NA 1K54A 2XDMA 3G34A 2VGJA 4Q8IA 3S4XA 5GLCA 4DE2A 4JKTA 2RL3A 3EQVA 4PMAA 2EFXA 5GL9A 5HW3A 4P87A 3P98A 4LV0A 4KENB 4JXWA 4MNRA 4EBLA 1H5XA 4X53A 1K25A 2HPBA 3OPLA 1IELA 2JBFA 1K54C 2XFSA 5FQQA 4ZBEA 5CERA 4RA7A 4C3QA 3FWLA 4R1GA 1XGIA 2Y2OA 3FZCA 4S2JA 3ZVTA 4GOGA 5E43A 3LY3A 4K0XA 1ESIA 3W4OA 1K55C 4RVAA 1RGYA 4OPQA 5M19A 3N8RA 1K56A 2IWDA 3NY4A 1IEMA 2G2UA 1IYSA 2WKIA 4S2IA 1KGGA 1PW1A 5EVIC 3C7UA 4OKPA 1I5QA 1VQQA 3Q81A 3N7WA 4YFMA 2HDSA 1E4DA 2H5SA 4BQMA 1FCNA 3B3XA 3FV7A 4P6BA 4BL3A 3TSGA 2RCXA 2EX2A 4X55A 1Z6FA 1PZOA 5HFOA 1KDWA 4OPRA 1I2WA 2HP5A 3P09A 5F82A 4EUZA 1PYYA 5GHZA 3HUNA 2Y2LA 4UA6A 1TDLA 3IF5A 2XK1A 4JXGA 1K38A 5FI6A 3VFHA 3PBNA 4A5RA 3NC8A 2Y2NA 4MBHA 1Q2PA 1KE0A 1KE4A 1L0EA 3BFEA 3HVFA 4KG6A 2ZM0A 1IKIA 2IWBA 4JF4A 2WGWA 1IYOA 2UWXA 3HLBA 4FSFA 3GV9A 3TG9A 3WRTA 1E3UA 1M40A 3UDFA 1FCMA 3HLCA 3ITBA 3ZNTA 3BEBA 4XUZA 4KZ3A 2OLUA 1TDGA 4RX2A 1FQGA 4WYYA 4WMCA 4CJNA 4ID4A 1BTLA 3CZDA 2VGKA 1L0FA 5G18A 1MXOA 3ZG8B 2OLVA 3AGFA 3DWKA 3PBRA 4GDNA 1O07A 3NDGA 3OPRA 2X01A 2R9WA 2ZQDA 3BFDA 5CTMA 2Y2QA 1YLPA 5KSCA 4PM8A 5CEDA 3IXBA 2XLNA 3VSKA 3BFCA 3FKVA 1EROA 3WWXA 5FSRA 1NYYA 2WUQA 4N92A 4QD4A 3ZG9B 5CTNA 5KZHA 3IXHA 3WS2A 4P0MA 2XFTA 3VP0A 2ZJ9A 4JXSA 1W79A 2BG1A 2ZMAA 4B4ZA 4E3IA 5U47A 4EBPA 3VOYA 1DJCA 5M1AA 2P9VA 5FAQA 4DKIA 5HL1A 2OSUA 3NDEA 3M2JA 1ES5A 1DY6A 3N6IA 1ONHA 4WZ5C 4MBKA 1ZC2A 2Q9MA 5JYOA 3OPHA 1E25A 3UPNA 4P85A 4S2NC 3V5MA 3G4PA 5HX9A 4ZTKA 4IEDA 3G2YA 2P9VB 5EOOA 1BLHA 4DE0A 2Z2LB 4KZ4A 4QHCA 4BD0A 5FA7A 3PTEA 1N4OA 3IWIA 3ZCZA 1H8YA 1NRFA 1ES2A 5FQ9A 2H0TA 1ERMA 4EQIA 3BYDA 4KQOA 1NXYA 1BUEA 1YLTA 3ZFZA 1XA7A 2ZQCA 1NJ4A 1GA9A 4BENA 5BOHA 1EWZA 1PI4A 1LI0A 2XD5A 3LCEA 2WKHA 4IBXA 5L2FA 4GNUA 3ISGA 4ZJ2A 3ZNYA 1MY8A 1WYBA 1BLSA 1N9BA 2QMIA 3CMZA 4S2PA 5J8XA 1GHIA 4K0WA 2H0YA 1CEFA 5E2HA 1YLYA 4DDSA 3I7JA 4DRTA 3PAEA 3G30A 3OZHA 5E2EA 1KGEA 1XA1A 4X69A 1KE3A 3IF6C 2Y2KA 1LL9A 2I72A 4LCMA 2FFYA 1XKZA 4Y0UA 2JC7A 3V3RA 3BLMA 3HUOA 4O7DA 2C6WB 1O7EA 3Q07A 3HLWA 4B4XA 1S0WA 4N1HA 4PM9A 3ZDJA 1PIOA 3Q7VB 1YQSA 4WZ4A 5EVID 5CHJA 2HDUA 4DDYA 4WZ5A 3IWQA 5FQIA 5DF7A 1K57A 4HESA 1K56D 1H8ZA 1XP4A 4OONA 4OVDA 2XGNA 1IYQA 4S2LA 3IF6A 4U0XA 2EX6A 2Y2IA 4K91A 1MWUA 4QJGA 2XEPA 3UN7A 5HARA 2ZC3B 4R4RA 3OC2A 4X68A 4XXRA 5TR7A 4IBRA 5EVLA 2WAFA 3RXXA 4NK3A 4KZ8A 1PWGA 1QMFA 4R4SA 1TVFA 4X56A 3TOIA 4E6WA 3W8KA 2ZC5B 4HBTA 3UPOA 3LY4A 1NZUA 4OOMA 4X6TA 1XPBA 4Y7PA 3ZG5A 5JYPA 4YINA 3G2ZA 4Y0OA 3C4PA 4E3OA 4JF6A 4GD6A 2WGVA 1SHVA 4KZAA 4OH0A 3PBOA 3MZDA 2GDNA 2WGIA 4WEJA 5CRFA 3HREA 1BT5A 4ZAMA 3MKFA 1ES3A 3O88A 1CI8A 5EE8A 1BULA 4EBNA 1K6RA 2Y4AA 1E3UD 5FAPA 3DTMA 4E3NA 5CECA 2ZQ8A 2E8IA 3ZGAB 4KZ5A 4OQIA 4XUXA 1JTDA 5CXWA 3G35A 5EVIA 5FQKA 1YMXA 3VMAA 5KSHA 1CEGA 5GHYA 4GZBA 5DF9A 1ONGA 2ZC7A 4FD8A 4M3KA 4KG5A 5CGXA 5AQAA 2R9XA 3EQUA 3A3FA 3GR2A 3N4IA 5EOEA 4JXVA 5IHVA 3MXRA 4N9LA 3A3DA 4E3KA 1SDNA 3FKWA 1ES4A 4DXCA 2ZC6B 2XH9A 4PM5A 5M18A 4OP8A 1ZKJA 4OOLA 1HZOA 5E2GA 3SH7A 3N8SA 3UE0A 2Y91A 1JVJA 1PW8A 1LHYA 1JWPA 3MZFA 3GQZA 3UE3A 1HTZA 3BRMA 4R23A 5GHXA 2HP6A 5D3OA 5DTKA 3E2LA 1ZG4A 3VFFA 4DE1A 4MLLA 1ZG6A 3WS1A 2Y2PA 1K4EA 3O87A 3RXWA 3DW0A 4GDBA 4FH2A 4OPZA 1DJAA 3GRJA 3C4OA 4Z9QA 3C7VA 3OPPA 4HBUA 3V3SA 1MWTA 5DVAA 3VP3A 4N1XA 2EFUA 1PI5A 4OP5A 3VP4A 3DWZA 4KZ6A 3QNBA 1FSWA 2JCHA 2P74A 4JF5A 3ZG7B 3WS4A 2J9PA 1KVLA 3Q7VA 1RP5A 1MKIA 1XGJA 5A91A 4E6XA 4RYEA 1K57C 4H8RA 4B88A 4BD1A 5FI2A 4OPYA 2QPNA 4ZJ3A 3BM6A 4JPMA 2DNSA 3NI9A 3SS5A 3GMWA 4Y0TA 1Q2QA 1SCWA 4KQRA 3SH9A 2ZD8A 4BJPA 3OCLA 4QB8A 4BL2A 2J9OA 1RCJA 4UA9A 1KVMA 1YLJA 2Y2GA 4IVIA 5A93A 1IKGA 2EX8A 5E2FA 5FQMA 3M6HA 4PM6A 4BLMA 3HLDA 2ZM8A 1ERQA 2ZQ7A 3A3JA 3BFFA 4OQHA 3W4QA 4UHUA 1AXBA 3HL9A 1ALQA 1SDEA 5HAPA 3GTCA 2QZ6A 1LI9A 2JE5A 1W7FA 3ZHHA 1HD8A 1WYCA 4D2OA 2WZZA 2HP9A 2XD1A 1PWDA 2H10A 1YLZA 4LV1A 1G68A 1Y54A 1LLBA 2PU4A 2Y55A 3GSGA 3IHAA 4JLFA 4S2OA 2WYXA 4C75A 3MBZA 4E3JA 3UPPA 5A90A 4RX3A 3PAGA 4FH4A 3BECA 4OQGA 3CJMA 3C5AA 3HLEA 1MBLA 5GLBA 3V50A 1GCEA 1GA0A 3NIAA 4MEZA 4DXBA 2EX9A 4KZ7A 4OLGA 5CGSA 4PPRA 3AGEA 3FYZA 1GHMA 4E3MA 1W8YA 1LL5A 1SKFA 5FATA 3PBTA 4KQQA 1GHPA 2ZQAA 2ZLYA 2XQZA 4U3TA 4UAAA 5AQ7A 3UY6A 5CGWA 1YM1A 1IYPA 5AQBA 5GLDA 2EXBA 3VP2A 2WGWB 3IQAA 3W4PA 1U60A 3VSLA 4R3BA 2X71A 2XR0A 1K55A 5HAIA 1JTGA 2CC1A 5F1FA 4KG2A 4LCLA 4OQ0A 4R3JA 2Y2JA 2ZM2A 2BLSA 2B5RA 1TEMA 2ZQ9A 3HUMA 4S2MA 1DJBA 3MXSA 4ZDXA 4UA7A 2WKEA 1K6SA 1KGFA 4PM7A 5F1GA 2ZC4B 3VOZA 4E3LA 3SOIA 1VM1A 3M6BA 3UDIA 1PZPA 2XF3A 3WS0A 1FOFA 3GVBA 4WMCD 5EVIB 3PBQA 5AQ9A 4U0TA 2DCFA 3O3VA 3HLGA 1WE4A 3A3IA 4LENA 1C3BA 1CI9A 5EUAA 1L0GA 2WAEA 5KMWA 2A3UA 5FI7A 3CG5A 3RJUA 3SH8A 3UE1A 4WELA 5FQJA 1FCOA 3A3EA 4FCFA 5F83A 1XX2A 4S2KA 3MKEA 4IVKA 1W5DA 2Z2MB 3IH9A 3S22A 1KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UNW A;  3SS3 A;  1L0D A;  3M2K A;  4GB7 A;  3QNC A;  1MWR A;  2FFF B;  3SS4 A;  1HVB A;  3OCN A;  3ZG0 A;  5FAS A;  3Q82 A;  5HAQ A;  5CEB A;  5GLA A;  4QY5 A;  3WS5 A;  5FDH A;  1K4F A;  1XXM A;  4WBG A;  3Q1F A;  2A49 A;  3QHY A;  3WRZ A;  4CPK A;  3IT9 A;  1YMS A;  4L0L A;  4KZB A;  1FSY A;  4OOY A;  3S1Y A;  3IF6 B;  4HEF A;  3AGD A;  4LV3 A;  5A92 A;  2V2F F;  4F94 A;  3NCK A;  3MFD A;  4C6Y A;  5TGF A;  1PWC A;  4KZ9 A;  1BZA A;  1FR1 A;  2G2W A;  2PU2 A;  3E2K A;  3D4F A;  2J8Y A;  2C5W B;  5EPH A;  4ZJ1 A;  2WK0 A;  2HDR A;  1G6A A;  4WEK A;  1NYM A;  2Y2H A;  2WZX A;  5TFQ A;  3IXD A;  3MZE A;  3N8L A;  3V39 A;  2OV5 A;  1S6R A;  3UDX A;  3G31 A;  1QME A;  3ZVW A;  4WM9 A;  1CK3 A;  4DE3 A;  2HDQ A;  2X02 A;  2Y59 A;  3IHB A;  3HBR A;  5CHM A;  4EV4 A;  1OME A;  4DF6 A;  1L2S A;  3HLF A;  3PBS A;  1ESU A;  1MWS A;  1BLP A;  1YLW A;  2J7V A;  4GD8 A;  4NET A;  5DF8 A;  1NZO A;  4JBF A;  5FAO A;  3IWO A;  2Q9N A;  2V1Z A;  1I2S A;  1JWZ A;  4MBF A;  3IXG A;  2WAD A;  1EI5 A;  1M6K A;  5CHU A;  5DTS A;  3UO9 A;  1BLC A;  1W8Q A;  4QY6 A;  2DRW A;  3Q7Z A;  3BLS A;  4OLD A;  1NY0 A;  3NBL A;  4N9K A;  4QU3 A;  1FR6 A;  2IWC A;  4R0Q A;  3VP1 A;  1JWV A;  1J9M A;  2PBY A;  4GN2 A;  3O86 A;  4LV2 A;  5DTT A;  1RGZ A;  5EEC A;  3IH8 A;  4EWF A;  2Y2M A;  3LO7 A;  4GKU A;  3LEZ A;  3BFG A;  2V20 A;  1MPL A;  3JYI A;  2EXA A;  1BSG A;  3G32 A;  1YT4 A;  3ITA A;  5I94 A;  4S2N A;  1K54 A;  2XDM A;  3G34 A;  2VGJ A;  4Q8I A;  3S4X A;  5GLC A;  4DE2 A;  4JKT A;  2RL3 A;  3EQV A;  4PMA A;  2EFX A;  5GL9 A;  5HW3 A;  4P87 A;  3P98 A;  4LV0 A;  4KEN B;  4JXW A;  4MNR A;  4EBL A;  1H5X A;  4X53 A;  1K25 A;  2HPB A;  3OPL A;  1IEL A;  2JBF A;  1K54 C;  2XFS A;  5FQQ A;  4ZBE A;  5CER A;  4RA7 A;  4C3Q A;  3FWL A;  4R1G A;  1XGI A;  2Y2O A;  3FZC A;  4S2J A;  3ZVT A;  4GOG A;  5E43 A;  3LY3 A;  4K0X A;  1ESI A;  3W4O A;  1K55 C;  4RVA A;  1RGY A;  4OPQ A;  5M19 A;  3N8R A;  1K56 A;  2IWD A;  3NY4 A;  1IEM A;  2G2U A;  1IYS A;  2WKI A;  4S2I A;  1KGG A;  1PW1 A;  5EVI C;  3C7U A;  4OKP A;  1I5Q A;  1VQQ A;  3Q81 A;  3N7W A;  4YFM A;  2HDS A;  1E4D A;  2H5S A;  4BQM A;  1FCN A;  3B3X A;  3FV7 A;  4P6B A;  4BL3 A;  3TSG A;  2RCX A;  2EX2 A;  4X55 A;  1Z6F A;  1PZO A;  5HFO A;  1KDW A;  4OPR A;  1I2W A;  2HP5 A;  3P09 A;  5F82 A;  4EUZ A;  1PYY A;  5GHZ A;  3HUN A;  2Y2L A;  4UA6 A;  1TDL A;  3IF5 A;  2XK1 A;  4JXG A;  1K38 A;  5FI6 A;  3VFH A;  3PBN A;  4A5R A;  3NC8 A;  2Y2N A;  4MBH A;  1Q2P A;  1KE0 A;  1KE4 A;  1L0E A;  3BFE A;  3HVF A;  4KG6 A;  2ZM0 A;  1IKI A;  2IWB A;  4JF4 A;  2WGW A;  1IYO A;  2UWX A;  3HLB A;  4FSF A;  3GV9 A;  3TG9 A;  3WRT A;  1E3U A;  1M40 A;  3UDF A;  1FCM A;  3HLC A;  3ITB A;  3ZNT A;  3BEB A;  4XUZ A;  4KZ3 A;  2OLU A;  1TDG A;  4RX2 A;  1FQG A;  4WYY A;  4WMC A;  4CJN A;  4ID4 A;  1BTL A;  3CZD A;  2VGK A;  1L0F A;  5G18 A;  1MXO A;  3ZG8 B;  2OLV A;  3AGF A;  3DWK A;  3PBR A;  4GDN A;  1O07 A;  3NDG A;  3OPR A;  2X01 A;  2R9W A;  2ZQD A;  3BFD A;  5CTM A;  2Y2Q A;  1YLP A;  5KSC A;  4PM8 A;  5CED A;  3IXB A;  2XLN A;  3VSK A;  3BFC A;  3FKV A;  1ERO A;  3WWX A;  5FSR A;  1NYY A;  2WUQ A;  4N92 A;  4QD4 A;  3ZG9 B;  5CTN A;  5KZH A;  3IXH A;  3WS2 A;  4P0M A;  2XFT A;  3VP0 A;  2ZJ9 A;  4JXS A;  1W79 A;  2BG1 A;  2ZMA A;  4B4Z A;  4E3I A;  5U47 A;  4EBP A;  3VOY A;  1DJC A;  5M1A A;  2P9V A;  5FAQ A;  4DKI A;  5HL1 A;  2OSU A;  3NDE A;  3M2J A;  1ES5 A;  1DY6 A;  3N6I A;  1ONH A;  4WZ5 C;  4MBK A;  1ZC2 A;  2Q9M A;  5JYO A;  3OPH A;  1E25 A;  3UPN A;  4P85 A;  4S2N C;  3V5M A;  3G4P A;  5HX9 A;  4ZTK A;  4IED A;  3G2Y A;  2P9V B;  5EOO A;  1BLH A;  4DE0 A;  2Z2L B;  4KZ4 A;  4QHC A;  4BD0 A;  5FA7 A;  3PTE A;  1N4O A;  3IWI A;  3ZCZ A;  1H8Y A;  1NRF A;  1ES2 A;  5FQ9 A;  2H0T A;  1ERM A;  4EQI A;  3BYD A;  4KQO A;  1NXY A;  1BUE A;  1YLT A;  3ZFZ A;  1XA7 A;  2ZQC A;  1NJ4 A;  1GA9 A;  4BEN A;  5BOH A;  1EWZ A;  1PI4 A;  1LI0 A;  2XD5 A;  3LCE A;  2WKH A;  4IBX A;  5L2F A;  4GNU A;  3ISG A;  4ZJ2 A;  3ZNY A;  1MY8 A;  1WYB A;  1BLS A;  1N9B A;  2QMI A;  3CMZ A;  4S2P A;  5J8X A;  1GHI A;  4K0W A;  2H0Y A;  1CEF A;  5E2H A;  1YLY A;  4DDS A;  3I7J A;  4DRT A;  3PAE A;  3G30 A;  3OZH A;  5E2E A;  1KGE A;  1XA1 A;  4X69 A;  1KE3 A;  3IF6 C;  2Y2K A;  1LL9 A;  2I72 A;  4LCM A;  2FFY A;  1XKZ A;  4Y0U A;  2JC7 A;  3V3R A;  3BLM A;  3HUO A;  4O7D A;  2C6W B;  1O7E A;  3Q07 A;  3HLW A;  4B4X A;  1S0W A;  4N1H A;  4PM9 A;  3ZDJ A;  1PIO A;  3Q7V B;  1YQS A;  4WZ4 A;  5EVI D;  5CHJ A;  2HDU A;  4DDY A;  4WZ5 A;  3IWQ A;  5FQI A;  5DF7 A;  1K57 A;  4HES A;  1K56 D;  1H8Z A;  1XP4 A;  4OON A;  4OVD A;  2XGN A;  1IYQ A;  4S2L A;  3IF6 A;  4U0X A;  2EX6 A;  2Y2I A;  4K91 A;  1MWU A;  4QJG A;  2XEP A;  3UN7 A;  5HAR A;  2ZC3 B;  4R4R A;  3OC2 A;  4X68 A;  4XXR A;  5TR7 A;  4IBR A;  5EVL A;  2WAF A;  3RXX A;  4NK3 A;  4KZ8 A;  1PWG A;  1QMF A;  4R4S A;  1TVF A;  4X56 A;  3TOI A;  4E6W A;  3W8K A;  2ZC5 B;  4HBT A;  3UPO A;  3LY4 A;  1NZU A;  4OOM A;  4X6T A;  1XPB A;  4Y7P A;  3ZG5 A;  5JYP A;  4YIN A;  3G2Z A;  4Y0O A;  3C4P A;  4E3O A;  4JF6 A;  4GD6 A;  2WGV A;  1SHV A;  4KZA A;  4OH0 A;  3PBO A;  3MZD A;  2GDN A;  2WGI A;  4WEJ A;  5CRF A;  3HRE A;  1BT5 A;  4ZAM A;  3MKF A;  1ES3 A;  3O88 A;  1CI8 A;  5EE8 A;  1BUL A;  4EBN A;  1K6R A;  2Y4A A;  1E3U D;  5FAP A;  3DTM A;  4E3N A;  5CEC A;  2ZQ8 A;  2E8I A;  3ZGA B;  4KZ5 A;  4OQI A;  4XUX A;  1JTD A;  5CXW A;  3G35 A;  5EVI A;  5FQK A;  1YMX A;  3VMA A;  5KSH A;  1CEG A;  5GHY A;  4GZB A;  5DF9 A;  1ONG A;  2ZC7 A;  4FD8 A;  4M3K A;  4KG5 A;  5CGX A;  5AQA A;  2R9X A;  3EQU A;  3A3F A;  3GR2 A;  3N4I A;  5EOE A;  4JXV A;  5IHV A;  3MXR A;  4N9L A;  3A3D A;  4E3K A;  1SDN A;  3FKW A;  1ES4 A;  4DXC A;  2ZC6 B;  2XH9 A;  4PM5 A;  5M18 A;  4OP8 A;  1ZKJ A;  4OOL A;  1HZO A;  5E2G A;  3SH7 A;  3N8S A;  3UE0 A;  2Y91 A;  1JVJ A;  1PW8 A;  1LHY A;  1JWP A;  3MZF A;  3GQZ A;  3UE3 A;  1HTZ A;  3BRM A;  4R23 A;  5GHX A;  2HP6 A;  5D3O A;  5DTK A;  3E2L A;  1ZG4 A;  3VFF A;  4DE1 A;  4MLL A;  1ZG6 A;  3WS1 A;  2Y2P A;  1K4E A;  3O87 A;  3RXW A;  3DW0 A;  4GDB A;  4FH2 A;  4OPZ A;  1DJA A;  3GRJ A;  3C4O A;  4Z9Q A;  3C7V A;  3OPP A;  4HBU A;  3V3S A;  1MWT A;  5DVA A;  3VP3 A;  4N1X A;  2EFU A;  1PI5 A;  4OP5 A;  3VP4 A;  3DWZ A;  4KZ6 A;  3QNB A;  1FSW A;  2JCH A;  2P74 A;  4JF5 A;  3ZG7 B;  3WS4 A;  2J9P A;  1KVL A;  3Q7V A;  1RP5 A;  1MKI A;  1XGJ A;  5A91 A;  4E6X A;  4RYE A;  1K57 C;  4H8R A;  4B88 A;  4BD1 A;  5FI2 A;  4OPY A;  2QPN A;  4ZJ3 A;  3BM6 A;  4JPM A;  2DNS A;  3NI9 A;  3SS5 A;  3GMW A;  4Y0T A;  1Q2Q A;  1SCW A;  4KQR A;  3SH9 A;  2ZD8 A;  4BJP A;  3OCL A;  4QB8 A;  4BL2 A;  2J9O A;  1RCJ A;  4UA9 A;  1KVM A;  1YLJ A;  2Y2G A;  4IVI A;  5A93 A;  1IKG A;  2EX8 A;  5E2F A;  5FQM A;  3M6H A;  4PM6 A;  4BLM A;  3HLD A;  2ZM8 A;  1ERQ A;  2ZQ7 A;  3A3J A;  3BFF A;  4OQH A;  3W4Q A;  4UHU A;  1AXB A;  3HL9 A;  1ALQ A;  1SDE A;  5HAP A;  3GTC A;  2QZ6 A;  1LI9 A;  2JE5 A;  1W7F A;  3ZHH A;  1HD8 A;  1WYC A;  4D2O A;  2WZZ A;  2HP9 A;  2XD1 A;  1PWD A;  2H10 A;  1YLZ A;  4LV1 A;  1G68 A;  1Y54 A;  1LLB A;  2PU4 A;  2Y55 A;  3GSG A;  3IHA A;  4JLF A;  4S2O A;  2WYX A;  4C75 A;  3MBZ A;  4E3J A;  3UPP A;  5A90 A;  4RX3 A;  3PAG A;  4FH4 A;  3BEC A;  4OQG A;  3CJM A;  3C5A A;  3HLE A;  1MBL A;  5GLB A;  3V50 A;  1GCE A;  1GA0 A;  3NIA A;  4MEZ A;  4DXB A;  2EX9 A;  4KZ7 A;  4OLG A;  5CGS A;  4PPR A;  3AGE A;  3FYZ A;  1GHM A;  4E3M A;  1W8Y A;  1LL5 A;  1SKF A;  5FAT A;  3PBT A;  4KQQ A;  1GHP A;  2ZQA A;  2ZLY A;  2XQZ A;  4U3T A;  4UAA A;  5AQ7 A;  3UY6 A;  5CGW A;  1YM1 A;  1IYP A;  5AQB A;  5GLD A;  2EXB A;  3VP2 A;  2WGW B;  3IQA A;  3W4P A;  1U60 A;  3VSL A;  4R3B A;  2X71 A;  2XR0 A;  1K55 A;  5HAI A;  1JTG A;  2CC1 A;  5F1F A;  4KG2 A;  4LCL A;  4OQ0 A;  4R3J A;  2Y2J A;  2ZM2 A;  2BLS A;  2B5R A;  1TEM A;  2ZQ9 A;  3HUM A;  4S2M A;  1DJB A;  3MXS A;  4ZDX A;  4UA7 A;  2WKE A;  1K6S A;  1KGF A;  4PM7 A;  5F1G A;  2ZC4 B;  3VOZ A;  4E3L A;  3SOI A;  1VM1 A;  3M6B A;  3UDI A;  1PZP A;  2XF3 A;  3WS0 A;  1FOF A;  3GVB A;  4WMC D;  5EVI B;  3PBQ A;  5AQ9 A;  4U0T A;  2DCF A;  3O3V A;  3HLG A;  1WE4 A;  3A3I A;  4LEN A;  1C3B A;  1CI9 A;  5EUA A;  1L0G A;  2WAE A;  5KMW A;  2A3U A;  5FI7 A;  3CG5 A;  3RJU A;  3SH8 A;  3UE1 A;  4WEL A;  5FQJ A;  1FCO A;  3A3E A;  4FCF A;  5F83 A;  1XX2 A;  4S2K A;  3MKE A;  4IVK A;  1W5D A;  2Z2M B;  3IH9 A;  3S22 A;  1KDS A; 
#chains in the Genus database with same CATH topology
 3IS2 B;  1L0D A;  4GB7 A;  2FFF B;  1HVB A;  3OCN A;  2LB9 A;  2V8C A;  1F98 A;  2Z6C A;  1S1Z A;  1K4F A;  4WBG A;  4CPK A;  4L0L A;  4KZB A;  1FSY A;  4OOY A;  3IX4 A;  2B95 A;  4LV3 A;  5A92 A;  4C6Y A;  1PWC A;  5K5B A;  4KZ9 A;  2PU2 A;  3E2K A;  4ZJ1 A;  2HDR A;  1G6A A;  4WEK A;  2OAP 1;  4MN6 A;  3D9Y A;  3QP6 A;  3V39 A;  4Q0J A;  4ESP A;  4EER A;  2PDR A;  1ESU A;  1YLW A;  1NZO A;  3DTK A;  2V1Z A;  3A0S A;  2O0Y A;  3KYZ A;  1BLC A;  4QY6 A;  3Q7Z A;  4QPR A;  3BLS A;  3NBL A;  1FR6 A;  2YKH A;  1J9M A;  3KSH A;  5DTT A;  5EEC A;  3UMD A;  4Q0I A;  3LEZ A;  3JYI A;  2EXA A;  4LLO B;  2VGJ A;  4Q8I A;  3S4X A;  1T1B A;  1UWP X;  3P98 A;  4LV0 A;  1G5U A;  4JXW A;  1K25 A;  2EWW A;  4L9E A;  2XFS A;  4GJ4 A;  3P7N A;  5CER A;  4RA7 A;  4R1G A;  3FZC A;  4S2J A;  3LY3 A;  1LT0 A;  4OPQ A;  3QP5 A;  3LI8 A;  5M19 A;  3F1O A;  3N8R A;  4HP9 A;  3RH8 B;  1K56 A;  4Y0T A;  4S2I A;  4MN5 A;  1PW1 A;  4OKP A;  1I5Q A;  1VQQ A;  4YNR A;  3N7W A;  2QWS A;  1VET A;  3F1P A;  4P6B A;  1OJ5 A;  3MF0 A;  1KDW A;  5F82 A;  2PT7 A;  2XK1 A;  2K2N A;  4AFI A;  3NC8 A;  1KE4 A;  3BFE A;  4KG6 A;  2IWB A;  3WRT A;  5F69 A;  1E3U A;  1M40 A;  3UDF A;  1OTD A;  3ITB A;  3BEB A;  3NHQ A;  3IX3 A;  2W3D A;  5HDC A;  4ARZ B;  3ZG8 B;  3DWK A;  4GDN A;  1O07 A;  5FL3 A;  3NDG A;  1UWN X;  2Y2Q A;  4EET B;  1YLP A;  4PM8 A;  5CED A;  3BY8 A;  3V67 A;  5L10 A;  5HWV A;  2XFT A;  4JXS A;  2E8J A;  2ZMA A;  2P9V A;  1MZU A;  2A24 A;  2XA7 M;  3NDE A;  1ONH A;  2Q9M A;  5JYO A;  3E98 A;  4S2N C;  4ZTK A;  3LR4 A;  1J3W A;  2HZ5 A;  4KUK A;  1T1A A;  3PTE A;  1N4O A;  5AJG A;  1H8Y A;  2H0T A;  1ERM A;  1NXY A;  3IBR A;  4ZRR A;  1LI0 A;  3LCE A;  2WKH A;  5L2F A;  2W27 A;  1WYB A;  3CMZ A;  5TBM A;  4EU0 A;  1CEF A;  1SKO B;  3CI6 A;  2CMN A;  2PR6 A;  3CAX A;  4X69 A;  3T1S A;  3PYP A;  1LL9 A;  4LCM A;  3PHY A;  3V3R A;  3TW8 A;  3Q07 A;  4N1H A;  4WZ4 A;  5CHJ A;  2HDU A;  2ZOI A;  4DDY A;  4HES A;  1IYQ A;  3OOV A;  4I3I A;  4FTX A;  3R4K A;  3OC2 A;  4R4R A;  4X68 A;  4XXR A;  5TR7 A;  2A2L A;  4IBR A;  4PKY A;  4CLC B;  3RXX A;  2VK3 A;  4KZ8 A;  5FDS A;  2JKG A;  4CLC A;  2VV6 A;  2VX8 A;  2JN7 A;  1D7E A;  3ZG5 A;  4E3O A;  4OH0 A;  3FC7 A;  4KZA A;  2WGV A;  4GD6 A;  4WEJ A;  3MZD A;  2WGI A;  4H6J B;  1ES3 A;  5EE8 A;  5HPF A;  3QP1 A;  3ZGA B;  3UE6 A;  4XUX A;  3G35 A;  1YMX A;  4PAU A;  3NOP C;  5GHY A;  2VA0 A;  4M3K A;  4HY8 A;  4N9L A;  3UB8 A;  4OOL A;  1HZO A;  4JGP A;  4DJ3 A;  3N8S A;  1JVJ A;  1PW8 A;  3QP2 A;  3W2Z A;  3T4O A;  1HTZ A;  5D3O A;  5DTK A;  3E2L A;  4DE1 A;  3LID A;  1P9R A;  2Y2P A;  2V9A A;  1HLU P;  1T1C A;  3C7V A;  3OPP A;  3VP3 A;  1ZHH B;  1TS0 A;  4N1X A;  1PI5 A;  2QJ5 A;  3QNB A;  1FSW A;  2JCH A;  4JF5 A;  3U4L P;  1KVL A;  3Q7V A;  3KX0 X;  4GS9 A;  5A91 A;  4E6X A;  1OPX A;  4RYE A;  4MDZ A;  4B88 A;  4OPY A;  2QPN A;  5HZH A;  1VHM A;  3BM6 A;  2J3T C;  3NI9 A;  2VEA A;  2L0W A;  1SCW A;  3SH9 A;  2ZD8 A;  4QB8 A;  2Y2G A;  1CQA A;  1SKO A;  3M6H A;  2PD7 A;  3A3J A;  3BFF A;  4WLA A;  4UHU A;  1AXB A;  5HAP A;  5DKK A;  2QZ6 A;  3ZHH A;  1W7F A;  2HP9 A;  3B42 A;  3KO6 A;  1PWD A;  2H10 A;  4HJ6 A;  1VB6 A;  2WYX A;  3CPT A;  5DFY A;  4BBU A;  5EV0 A;  5IT5 A;  3EOI A;  2V1B A;  5GLB A;  3V50 A;  4KZ7 A;  4PPR A;  3FYZ A;  1LL5 A;  5FAT A;  4KQQ A;  5HPI A;  5AQB A;  5GLD A;  4EEP A;  3VSL A;  5FEF A;  5HAI A;  1JTG A;  2XRN A;  4OQ0 A;  4LCL A;  3UB5 P;  2Y2J A;  2ZM2 A;  2BLS A;  1TEM A;  3MXS A;  1XJ2 A;  2D01 A;  2VGL S;  3VOZ A;  3SOI A;  3WS0 A;  2XF3 A;  4IHQ A;  1FOF A;  2EA9 A;  3GVB A;  2FZ0 A;  5EVI B;  3PBQ A;  5AQ9 A;  3S7N A;  3BY9 A;  4G3K A;  3PXP A;  3FPW A;  2A3U A;  5FI7 A;  2GNX A;  3E4Q A;  4WEL A;  5FQJ A;  3F1N A;  3H82 B;  1XX2 A;  4S2K A;  2VKS A;  2Z2M B;  3UNW A;  3SS3 A;  4KUO A;  1YKD A;  3ZG0 A;  4FOF A;  3TJZ C;  5HAQ A;  5GLA A;  4GLQ A;  3WS5 A;  4IUH A;  5MC7 A;  3Q1F A;  3WRZ A;  1MKM A;  4LRX C;  2V2F F;  4F94 A;  2G2W A;  3D4F A;  2J8Y A;  2WK0 A;  3TE8 A;  2Y2H A;  2WZX A;  3IXD A;  5G4Z A;  3MZE A;  1OTB A;  3UDX A;  1QME A;  2ZMF A;  1CK3 A;  1XJ4 A;  3HBR A;  5CHM A;  4EV4 A;  4XT2 A;  3PBS A;  2WKQ A;  1BLP A;  2J7V A;  5DF8 A;  3IWO A;  2Q9N A;  1W8Q A;  3CIT A;  4N9K A;  3KSG A;  1V9Z A;  3VP1 A;  1JWV A;  2L4R A;  4BWI A;  4LV2 A;  4EWF A;  2Y2M A;  2OOL A;  2V20 A;  4X1L A;  1BSG A;  3G32 A;  5I94 A;  4S2N A;  1GSW A;  3LI9 A;  2RL3 A;  3NEC A;  4PMA A;  2EFX A;  4KEN B;  1H5X A;  4X53 A;  2HPB A;  3OPL A;  5FQQ A;  4C3Q A;  3FWL A;  3VE4 A;  3W4O A;  3NOU C;  1K55 C;  2KDK A;  5L8M A;  3A0V A;  1FCN A;  1YPR A;  2EX2 A;  5DJU A;  1OJG A;  1I2W A;  2AVX A;  4EUZ A;  3HUN A;  2Y2L A;  3IF5 A;  4JXG A;  4A5R A;  2Y2N A;  4MBH A;  1KE0 A;  3RFB A;  2ZM0 A;  2WKR A;  3HLB A;  4FSF A;  3EEH A;  4R3A A;  2M1C A;  4RX2 A;  2NUT C;  4WYY A;  4HJ4 A;  2W3E A;  4ID4 A;  1BTL A;  1L0F A;  1MXO A;  2PR5 A;  3AGF A;  3PBR A;  3EGX C;  1SZV A;  2JKR I;  1ZTU A;  2XLN A;  5J3W A;  1W63 M;  3WWX A;  1MC0 A;  4JGO A;  4N92 A;  2JHE A;  3IXH A;  4P0M A;  2ZJ9 A;  4E3I A;  3C38 A;  5FAQ A;  4DKI A;  3M2J A;  1ES5 A;  4WZ5 C;  4L9G A;  4MBK A;  3OPH A;  1E25 A;  3UPN A;  2HJE A;  3V5M A;  3G4P A;  4R6L A;  5HX9 A;  4WUJ A;  3ZYT A;  4IED A;  3G2Y A;  1H3Q A;  3UME A;  1GSX A;  1NLY A;  1NRF A;  1ES2 A;  5FQ9 A;  4EQI A;  4KQO A;  1BUE A;  1YLT A;  3ZFZ A;  1XA7 A;  2VJW A;  1GA9 A;  3GEC A;  5BOH A;  1H8M A;  1EWZ A;  3FG8 A;  1PI4 A;  2ZBB A;  4IBX A;  3ISG A;  4S2P A;  5J8X A;  3H82 A;  3QP8 A;  1GHI A;  2B18 A;  1S4S A;  3F1N B;  1CJF A;  1YLY A;  4DDS A;  2BTF P;  3I7J A;  2M7U A;  4DRT A;  3K3D A;  4CQH A;  1H0M A;  1KGE A;  2I72 A;  3NUL A;  2JKR M;  1XKZ A;  4Y0U A;  2W3H A;  1O7E A;  3HLW A;  3ZDJ A;  1PIO A;  3KSF A;  5EVI D;  1LL8 A;  2GZA A;  1H8Z A;  2PYP A;  4S2L A;  4U0X A;  1MWU A;  2XEP A;  3MR0 A;  2O99 A;  4Y17 A;  1ACF A;  2HV1 A;  1QMF A;  4I5S A;  1TVF A;  4HBT A;  4EQ1 A;  3UPO A;  4E04 A;  3PR6 A;  3CPT B;  4Y0O A;  2O9C A;  5CRF A;  4ARZ A;  2GDN A;  4LFU A;  3HRE A;  1BT5 A;  4LRY C;  1CI8 A;  1BUL A;  1K6R A;  4P6Z M;  4E3N A;  2ZQ8 A;  4KZ5 A;  2G7U A;  5KSH A;  3DTE A;  2W0N A;  1Y28 A;  2M7V A;  5CGX A;  4KG5 A;  3BWL A;  3GR2 A;  3N4I A;  3E0Y A;  3MXR A;  1S66 L;  4E3K A;  3A3D A;  3FKW A;  2ZC6 B;  3EGD C;  5J7E A;  2XH9 A;  1A0K A;  4OP8 A;  1XJ6 A;  3IBJ A;  1W63 Q;  4GS9 B;  1DP8 A;  3NJA A;  5E2G A;  4DN0 A;  3UE0 A;  2Y91 A;  1LHY A;  3GQZ A;  3BRM A;  2VLG A;  5GHX A;  4M4X A;  1ZG4 A;  1ZG6 A;  3WS1 A;  1BYW A;  3DW0 A;  4OPZ A;  4P6Z S;  1DJA A;  1MWT A;  5DVA A;  4OP5 A;  2EFU A;  3R7W B;  5HD5 A;  3ZG7 B;  1F2K A;  1XGJ A;  3MFX A;  1OTA A;  3LR5 A;  5FI2 A;  4BD1 A;  2DNS A;  3JVU A;  5HSQ A;  3GMW A;  1Q2Q A;  4KQR A;  4BJP A;  2W3G A;  4BL2 A;  2J9O A;  1RCJ A;  4UA9 A;  5A93 A;  1YLJ A;  3RTY A;  1S4R A;  4NXG A;  5FQM A;  4PM6 A;  3HLD A;  2ZM8 A;  1ERQ A;  2ZQ7 A;  4OQH A;  3HL9 A;  1STZ A;  3KYQ A;  3GTC A;  4EEU A;  3T1Q B;  3MXQ A;  2L1M A;  1YLZ A;  1LLB A;  3GSG A;  3IHA A;  3MBZ A;  4E3J A;  3MSH A;  3UPP A;  1PRQ A;  5EVE A;  5C5K A;  4X1M A;  3CJM A;  3C5A A;  3HLE A;  3NIA A;  4MEZ A;  4OLG A;  4YOF A;  1GHM A;  4E3M A;  1SKF A;  4CLC E;  4U3T A;  5AQ7 A;  5CGW A;  3DBA A;  2EXB A;  3VP2 A;  1U60 A;  2JKT M;  4R3B A;  2X71 A;  1KOU A;  1K55 A;  4R3J A;  4ZDX A;  3T4K A;  1DJB A;  1PNE A;  1KGF A;  4PM7 A;  3LUQ A;  1CF0 A;  1P9W A;  4WMC D;  5EM1 A;  2DCF A;  3HLG A;  4LEN A;  1L0G A;  5EUA A;  2WAE A;  3RJU A;  4I39 A;  3SH8 A;  3UE1 A;  2BAS A;  4FCF A;  5F83 A;  4EW7 A;  3MKE A;  1AWI A;  3S22 A;  3QNC A;  3JVV A;  1X0O A;  3SS4 A;  5FAS A;  4F3L B;  5CEB A;  4GHI B;  3H7W B;  5FDH A;  4YWZ A;  3QHY A;  2K7S A;  4BMW A;  3IF6 B;  3AGD A;  3L7H A;  3NCK A;  5TGF A;  1BZA A;  1FR1 A;  4BBV A;  2Y79 A;  2JKT I;  5TFQ A;  3N8L A;  4PHT A;  2OV5 A;  3O5Y A;  2P08 A;  4DE3 A;  2Y59 A;  4MN7 A;  1MWS A;  4NET A;  4JBF A;  2DMW A;  4MBF A;  3IXG A;  2WAD A;  5DTS A;  4EUV A;  2DRW A;  1NY0 A;  2IWC A;  3D72 A;  2B02 A;  3ZQ5 A;  3SW1 A;  3O86 A;  4G3W A;  1RGZ A;  3LO7 A;  1YT4 A;  2QYB A;  1K54 A;  3G34 A;  4JGQ A;  4UQI S;  5GLC A;  4JKT A;  3EQV A;  4HH2 A;  5GL9 A;  4P87 A;  2Q0O A;  3A0R A;  4EBL A;  1IEL A;  1K54 C;  4H6J A;  4ZBE A;  3ZVT A;  2Y2O A;  4GOG A;  2K31 A;  4K0X A;  1ESI A;  1F9I A;  2W3F A;  5DFX A;  3T4J A;  1RGY A;  3RXW A;  2G2U A;  1IYS A;  2WKI A;  1KGG A;  3C7U A;  4YFM A;  1E4D A;  2H5S A;  4HIA A;  3P01 A;  3TSG A;  2RCX A;  1PZO A;  5HFO A;  3BQA A;  3P09 A;  1PYY A;  4UA6 A;  1TDL A;  4CLC D;  1K38 A;  5FI6 A;  3T12 B;  3VFH A;  1L0E A;  2ZL1 A;  3S7Q A;  2WGW A;  1IYO A;  2UWX A;  3TG9 A;  3GV9 A;  3S7O A;  2OAQ 1;  1FCM A;  2OLU A;  2I9V A;  4WMC A;  3VOL A;  2VGK A;  3HJI A;  4R70 A;  3OPR A;  2R9W A;  2ZQD A;  3BFD A;  5KSC A;  4K08 A;  1S67 L;  5FSR A;  2WUQ A;  4QD4 A;  3WS2 A;  3VP0 A;  2BG1 A;  4B4Z A;  2W1T A;  4ME4 A;  5U47 A;  3VOY A;  1DJC A;  5M1A A;  5HL1 A;  4KQD A;  5HWT A;  2OSU A;  3N6I A;  1ZC2 A;  2ACG A;  4EXO A;  3B47 A;  5TJJ A;  4HH3 A;  2P9V B;  1BLH A;  5A8B A;  2Z2L B;  4KZ4 A;  1D06 A;  4BD0 A;  2P04 A;  3BJN A;  1JNU A;  1NLZ A;  3IWI A;  4NEE D;  3ZCZ A;  1P97 A;  3UB9 A;  3BYD A;  4MMN A;  2KLI A;  2XD5 A;  4GNU A;  5IS1 A;  1MY8 A;  1TS8 A;  1BLS A;  2IA2 A;  2QMI A;  2H0Y A;  2HGV A;  4CLC C;  3T1X A;  4XT2 B;  1XJ3 A;  3G30 A;  5E2E A;  2Y2K A;  1FIK A;  3LIB A;  4B4X A;  1S0W A;  4PM9 A;  3Q7V B;  1FIL A;  3IWQ A;  1VEU A;  5FQI A;  1K56 D;  5LBR A;  4OON A;  2XGN A;  2Y2I A;  4K91 A;  4QJG A;  3UN7 A;  5HAR A;  2ZC3 B;  3G6O A;  4JGR A;  1IOU A;  3BW6 A;  2WAF A;  4NK3 A;  1TS6 A;  4I38 A;  4X56 A;  3TOI A;  4E6W A;  2ZC5 B;  4OOM A;  4X6T A;  3UB7 A;  1XPB A;  5JYP A;  3C4P A;  4JF6 A;  1IFQ A;  1XFQ A;  3PBO A;  4ZAM A;  3O88 A;  3EEA A;  4EBN A;  2Y4A A;  3SZT A;  1E3U D;  5L07 A;  3VE3 A;  4NKP A;  4OQI A;  1JTD A;  5EVI A;  4II7 A;  1CEG A;  3CUE C;  5DF9 A;  2ZC7 A;  4FD8 A;  2R9X A;  3EQU A;  1EW0 A;  1SDN A;  4RQ9 A;  5DJT A;  1ES4 A;  4PM5 A;  2O9B A;  4WF0 A;  2VV8 A;  2PBD P;  3SH7 A;  3R7W A;  1JWP A;  2QKP A;  3UE3 A;  3T4S A;  3VFF A;  1K4E A;  2V0U A;  3O87 A;  4FH2 A;  2NUP C;  3GRJ A;  1OT9 A;  3CUE A;  4HBU A;  3V3S A;  3VP4 A;  2P74 A;  2J9P A;  1L3L A;  4I3A A;  5F68 A;  1P0Z A;  1RP5 A;  1MKI A;  1K57 C;  2PAV P;  4JPM A;  4B93 A;  3JPU A;  2HF6 A;  2W1T B;  3DAV A;  4IVI A;  1IKG A;  2EX8 A;  5E2F A;  4BLM A;  1N9O A;  1SDE A;  3LFV A;  2J3W A;  3IS2 A;  3CHW P;  2V1A A;  1HD8 A;  1WYC A;  4D2O A;  4UQI M;  2XD1 A;  3LIE A;  1G68 A;  1Y54 A;  2PU4 A;  4JLF A;  4S2O A;  2VGL M;  2HJ9 C;  4Y13 A;  4EES A;  3PAG A;  4OQG A;  1MBL A;  2EX9 A;  3AGE A;  1TD5 A;  4Y5F A;  1GHP A;  2ZQA A;  2XQZ A;  4UAA A;  2PHY A;  3UY6 A;  1YM1 A;  1ODV A;  3HJK A;  3W4P A;  2WGW B;  3IQA A;  3FPV A;  5F1F A;  4KG2 A;  4NG2 A;  2ZQ9 A;  4Y3I A;  2WKE A;  1K6S A;  2A24 B;  2EWV A;  3M6B A;  1PZP A;  1OTE A;  3GDI A;  3T1R A;  1YSQ A;  4U0T A;  3O3V A;  3A3I A;  1C3B A;  1CI9 A;  3F1P B;  5KMW A;  3T4T A;  3CG5 A;  3K3C A;  2XSS A;  3T50 A;  1W5D A;  3IH9 A;  1GSV A;  2V0W A;  1N9N A;  3M2K A;  1TS7 A;  1MWR A;  1S1Y A;  3KYE A;  3Q82 A;  4LRZ E;  4QY5 A;  2KX6 A;  1XXM A;  4ETX A;  2A49 A;  4FUW A;  3IT9 A;  1YMS A;  3S1Y A;  4HEF A;  1DP9 A;  1XFN A;  3MFD A;  3LEQ A;  1D1J A;  1WA9 A;  2C5W B;  5EPH A;  1DP6 A;  5HDS A;  1YAX A;  3NOT C;  1G6O A;  1NYM A;  4Y15 A;  1S6R A;  3G31 A;  1K0K A;  3ZVW A;  4WM9 A;  5DKL A;  3H9W A;  1VET B;  2HDQ A;  2X02 A;  3IHB A;  2J3T D;  2GX5 A;  1OME A;  4HNB A;  4DF6 A;  1L2S A;  3HLF A;  4GD8 A;  5FAO A;  1I2S A;  1JWZ A;  4HQA A;  5CHU A;  1EI5 A;  1M6K A;  3UO9 A;  4HHD A;  4B9O A;  4OLD A;  4QU3 A;  4R0Q A;  2PBY A;  4GN2 A;  3E4P A;  2WKP A;  2OWJ A;  3IH8 A;  4GKU A;  3BFG A;  1MPL A;  3ITA A;  1VEU B;  2OWH A;  3T4Q A;  2ZMV A;  2XDM A;  4DE2 A;  5HW3 A;  1DRM A;  4MNR A;  3H7W A;  2JBF A;  1XGI A;  5E43 A;  4RVA A;  2IWD A;  3NY4 A;  1IEM A;  5EFW A;  5EVI C;  3Q81 A;  4Z1W A;  2HDS A;  4BQM A;  3B3X A;  3FV7 A;  4BL3 A;  4DJ2 A;  4X55 A;  1Z6F A;  4OPR A;  5IU1 A;  2HP5 A;  5GHZ A;  2LB5 A;  4WN5 A;  4D60 A;  3PBN A;  5I5L A;  2QJ7 A;  1Q2P A;  4LGW A;  1Y4O A;  3LR0 A;  3HVF A;  3C2W A;  5L09 A;  1IKI A;  4JF4 A;  5G4Y A;  4NXF A;  3HLC A;  3ZNT A;  4XUZ A;  1YSP A;  1F5M A;  4KZ3 A;  1OTI A;  1TDG A;  3CWF A;  1FQG A;  4CJN A;  1OT6 A;  3B33 A;  3CZD A;  4X25 A;  5G18 A;  2OLV A;  3MQ0 A;  3L9K A;  3S7P A;  3IX8 A;  3D3O A;  5CTM A;  2X01 A;  2UV0 E;  3IXB A;  4NXB A;  3VSK A;  3BFC A;  3FKV A;  1ERO A;  1NYY A;  3ZG9 B;  5CTN A;  5KZH A;  4O8G A;  4R38 A;  1W79 A;  4EBP A;  2ZOH A;  1DY6 A;  4HI4 A;  4P85 A;  4LPZ A;  5AVE A;  5EOO A;  4DE0 A;  4HJ3 A;  4QHC A;  5FA7 A;  3LIC A;  5F6A A;  3OBF A;  3LIA A;  2ZQC A;  1NJ4 A;  4UEY A;  4BEN A;  4Y2F A;  2D02 A;  2FH5 A;  4ZJ2 A;  3ZNY A;  3K2N A;  1N9B A;  3LIF A;  4K0W A;  5HDD A;  4O0P A;  5E2H A;  2VZW A;  1LSV A;  3PAE A;  3BQ8 A;  3OZH A;  1XA1 A;  3KSI A;  1KE3 A;  3IF6 C;  3DTI A;  4WL9 A;  2FFY A;  5EM0 A;  1T19 A;  4L9F A;  2JC7 A;  4NXE A;  4O01 A;  2R78 A;  3BLM A;  3HUO A;  2C6W B;  3MS6 A;  4O7D A;  5KIZ A;  1NWZ A;  1YQS A;  4WZ5 A;  2PD8 A;  5DF7 A;  1K57 A;  4BBT A;  4OVD A;  1XP4 A;  3IF6 A;  2EX6 A;  3MQO A;  3EWK A;  2VV7 A;  4GHI A;  5EVL A;  5J4E A;  1PFL A;  2P7J A;  1PWG A;  3LGO A;  4R4S A;  2Y8H A;  2KOI A;  5TBM B;  3W8K A;  3LY4 A;  1NZU A;  4Y7P A;  5FEG A;  4YIN A;  3G2Z A;  1SHV A;  2J80 A;  3MKF A;  4QWO A;  1N9L A;  5FAP A;  3DTM A;  2JKF A;  5CEC A;  2YKF A;  2E8I A;  4ETZ A;  5HWW A;  5FQK A;  3VMA A;  5CXW A;  3MMH A;  2XA7 S;  4GZB A;  3E4O A;  1ONG A;  5AQA A;  5EOE A;  3A3F A;  5IHV A;  4HOI A;  4JXV A;  2PRF A;  4DXC A;  4F3L A;  5M18 A;  1ZKJ A;  4PKY G;  3MJQ A;  4MCW A;  3MZF A;  3TRC A;  4R23 A;  2HP6 A;  4MLL A;  3U2A A;  1LSX A;  5F5Y A;  4GDB A;  3LYX A;  3C4O A;  4Z9Q A;  3VV4 A;  3F1O B;  1T18 A;  3DWZ A;  4KZ6 A;  5CX7 A;  3T4L A;  3WS4 A;  4GW9 A;  4H8R A;  2Z6D A;  4ZJ3 A;  3SS5 A;  2ZL1 B;  3OCL A;  4DMZ A;  1KVM A;  5HL6 A;  4IJG A;  3W4Q A;  1V9Y A;  1ALQ A;  1LI9 A;  2JE5 A;  3C30 A;  3QP4 A;  2WZZ A;  3CLO A;  4LV1 A;  4C75 A;  2Y55 A;  2XRO A;  5A90 A;  4RX3 A;  4FH4 A;  3BEC A;  1LSW A;  3MQQ A;  1GCE A;  1G28 A;  1GA0 A;  4DXB A;  1TF1 A;  5CGS A;  2V8F A;  1W8Y A;  3PBT A;  2MJ6 A;  2ZLY A;  1IYP A;  2XR0 A;  2GJ3 A;  3C8C A;  2CC1 A;  2B5R A;  4S2M A;  3HUM A;  3ULF A;  4UA7 A;  4IUK A;  1UGU A;  5F1G A;  2ZC4 B;  4GCZ A;  4E3L A;  2H28 A;  1VM1 A;  3UDI A;  3ICY A;  4G3V A;  3HCY A;  2W1R A;  2O9A A;  2INW A;  1WE4 A;  4Q0H A;  2QHK A;  5AVF A;  4I3J A;  3OLO A;  1NRJ A;  2PYR A;  3LR3 A;  3UB6 A;  1FCO A;  3A3E A;  4IVK A;  1Z09 A;  5HD3 A;  4HP4 A;  1KDS A; 
#chains in the Genus database with same CATH homology
 3UNW A;  3SS3 A;  1L0D A;  3M2K A;  4GB7 A;  3QNC A;  1MWR A;  2FFF B;  3SS4 A;  1HVB A;  3OCN A;  3ZG0 A;  5FAS A;  3Q82 A;  5HAQ A;  5CEB A;  5GLA A;  4QY5 A;  3WS5 A;  5FDH A;  1K4F A;  1XXM A;  4WBG A;  3Q1F A;  2A49 A;  3QHY A;  3WRZ A;  4CPK A;  3IT9 A;  1YMS A;  4L0L A;  4KZB A;  1FSY A;  4OOY A;  3S1Y A;  3IF6 B;  4HEF A;  3AGD A;  4LV3 A;  5A92 A;  2V2F F;  4F94 A;  3NCK A;  3MFD A;  4C6Y A;  5TGF A;  1PWC A;  4KZ9 A;  1BZA A;  1FR1 A;  2G2W A;  2PU2 A;  3E2K A;  3D4F A;  2J8Y A;  2C5W B;  5EPH A;  4ZJ1 A;  2WK0 A;  2HDR A;  1G6A A;  4WEK A;  1NYM A;  2Y2H A;  2WZX A;  5TFQ A;  3IXD A;  3MZE A;  3N8L A;  3V39 A;  2OV5 A;  1S6R A;  3UDX A;  3G31 A;  1QME A;  3ZVW A;  4WM9 A;  1CK3 A;  4DE3 A;  2HDQ A;  2X02 A;  2Y59 A;  3IHB A;  3HBR A;  5CHM A;  4EV4 A;  1OME A;  4DF6 A;  1L2S A;  3HLF A;  3PBS A;  1ESU A;  1MWS A;  1BLP A;  1YLW A;  2J7V A;  4GD8 A;  4NET A;  5DF8 A;  1NZO A;  4JBF A;  5FAO A;  3IWO A;  2Q9N A;  2V1Z A;  1I2S A;  1JWZ A;  4MBF A;  3IXG A;  2WAD A;  1EI5 A;  1M6K A;  5CHU A;  5DTS A;  3UO9 A;  1BLC A;  1W8Q A;  4QY6 A;  2DRW A;  3Q7Z A;  3BLS A;  4OLD A;  1NY0 A;  3NBL A;  4N9K A;  4QU3 A;  1FR6 A;  2IWC A;  4R0Q A;  3VP1 A;  1JWV A;  1J9M A;  2PBY A;  4GN2 A;  3O86 A;  4LV2 A;  5DTT A;  1RGZ A;  5EEC A;  3IH8 A;  4EWF A;  2Y2M A;  3LO7 A;  4GKU A;  3LEZ A;  3BFG A;  2V20 A;  1MPL A;  3JYI A;  2EXA A;  1BSG A;  3G32 A;  1YT4 A;  3ITA A;  5I94 A;  4S2N A;  1K54 A;  2XDM A;  3G34 A;  2VGJ A;  4Q8I A;  3S4X A;  5GLC A;  4DE2 A;  4JKT A;  2RL3 A;  3EQV A;  4PMA A;  2EFX A;  5GL9 A;  5HW3 A;  4P87 A;  3P98 A;  4LV0 A;  4KEN B;  4JXW A;  4MNR A;  4EBL A;  1H5X A;  4X53 A;  1K25 A;  2HPB A;  3OPL A;  1IEL A;  2JBF A;  1K54 C;  2XFS A;  5FQQ A;  4ZBE A;  5CER A;  4RA7 A;  4C3Q A;  3FWL A;  4R1G A;  1XGI A;  2Y2O A;  3FZC A;  4S2J A;  3ZVT A;  4GOG A;  5E43 A;  3LY3 A;  4K0X A;  1ESI A;  3W4O A;  1K55 C;  4RVA A;  1RGY A;  4OPQ A;  5M19 A;  3N8R A;  1K56 A;  2IWD A;  3NY4 A;  1IEM A;  2G2U A;  1IYS A;  2WKI A;  4S2I A;  1KGG A;  1PW1 A;  5EVI C;  3C7U A;  4OKP A;  1I5Q A;  1VQQ A;  3Q81 A;  3N7W A;  4YFM A;  2HDS A;  1E4D A;  2H5S A;  4BQM A;  1FCN A;  3B3X A;  3FV7 A;  4P6B A;  4BL3 A;  3TSG A;  2RCX A;  2EX2 A;  4X55 A;  1Z6F A;  1PZO A;  5HFO A;  1KDW A;  4OPR A;  1I2W A;  2HP5 A;  3P09 A;  5F82 A;  4EUZ A;  1PYY A;  5GHZ A;  3HUN A;  2Y2L A;  4UA6 A;  1TDL A;  3IF5 A;  2XK1 A;  4JXG A;  1K38 A;  5FI6 A;  3VFH A;  3PBN A;  4A5R A;  3NC8 A;  2Y2N A;  4MBH A;  1Q2P A;  1KE0 A;  1KE4 A;  1L0E A;  3BFE A;  3HVF A;  4KG6 A;  2ZM0 A;  1IKI A;  2IWB A;  4JF4 A;  2WGW A;  1IYO A;  2UWX A;  3HLB A;  4FSF A;  3GV9 A;  3TG9 A;  3WRT A;  1E3U A;  1M40 A;  3UDF A;  1FCM A;  3HLC A;  3ITB A;  3ZNT A;  3BEB A;  4XUZ A;  4KZ3 A;  2OLU A;  1TDG A;  4RX2 A;  1FQG A;  4WYY A;  4WMC A;  4CJN A;  4ID4 A;  1BTL A;  3CZD A;  2VGK A;  1L0F A;  5G18 A;  1MXO A;  3ZG8 B;  2OLV A;  3AGF A;  3DWK A;  3PBR A;  4GDN A;  1O07 A;  3NDG A;  3OPR A;  2X01 A;  2R9W A;  2ZQD A;  3BFD A;  5CTM A;  2Y2Q A;  1YLP A;  5KSC A;  4PM8 A;  5CED A;  3IXB A;  2XLN A;  3VSK A;  3BFC A;  3FKV A;  1ERO A;  3WWX A;  5FSR A;  1NYY A;  2WUQ A;  4N92 A;  4QD4 A;  3ZG9 B;  5CTN A;  5KZH A;  3IXH A;  3WS2 A;  4P0M A;  2XFT A;  3VP0 A;  2ZJ9 A;  4JXS A;  1W79 A;  2BG1 A;  2ZMA A;  4B4Z A;  4E3I A;  5U47 A;  4EBP A;  3VOY A;  1DJC A;  5M1A A;  2P9V A;  5FAQ A;  4DKI A;  5HL1 A;  2OSU A;  3NDE A;  3M2J A;  1ES5 A;  1DY6 A;  3N6I A;  1ONH A;  4WZ5 C;  4MBK A;  1ZC2 A;  2Q9M A;  5JYO A;  3OPH A;  1E25 A;  3UPN A;  4P85 A;  4S2N C;  3V5M A;  3G4P A;  5HX9 A;  4ZTK A;  4IED A;  3G2Y A;  2P9V B;  5EOO A;  1BLH A;  4DE0 A;  2Z2L B;  4KZ4 A;  4QHC A;  4BD0 A;  5FA7 A;  3PTE A;  1N4O A;  3IWI A;  3ZCZ A;  1H8Y A;  1NRF A;  1ES2 A;  5FQ9 A;  2H0T A;  1ERM A;  4EQI A;  3BYD A;  4KQO A;  1NXY A;  1BUE A;  1YLT A;  3ZFZ A;  1XA7 A;  2ZQC A;  1NJ4 A;  1GA9 A;  4BEN A;  5BOH A;  1EWZ A;  1PI4 A;  1LI0 A;  2XD5 A;  3LCE A;  2WKH A;  4IBX A;  5L2F A;  4GNU A;  3ISG A;  4ZJ2 A;  3ZNY A;  1MY8 A;  1WYB A;  1BLS A;  1N9B A;  2QMI A;  3CMZ A;  4S2P A;  5J8X A;  1GHI A;  4K0W A;  2H0Y A;  1CEF A;  5E2H A;  1YLY A;  4DDS A;  3I7J A;  4DRT A;  3PAE A;  3G30 A;  3OZH A;  5E2E A;  1KGE A;  1XA1 A;  4X69 A;  1KE3 A;  3IF6 C;  2Y2K A;  1LL9 A;  2I72 A;  4LCM A;  2FFY A;  1XKZ A;  4Y0U A;  2JC7 A;  3V3R A;  3BLM A;  3HUO A;  4O7D A;  2C6W B;  1O7E A;  3Q07 A;  3HLW A;  4B4X A;  1S0W A;  4N1H A;  4PM9 A;  3ZDJ A;  1PIO A;  3Q7V B;  1YQS A;  4WZ4 A;  5EVI D;  5CHJ A;  2HDU A;  4DDY A;  4WZ5 A;  3IWQ A;  5FQI A;  5DF7 A;  1K57 A;  4HES A;  1K56 D;  1H8Z A;  1XP4 A;  4OON A;  4OVD A;  2XGN A;  1IYQ A;  4S2L A;  3IF6 A;  4U0X A;  2EX6 A;  2Y2I A;  4K91 A;  1MWU A;  4QJG A;  2XEP A;  3UN7 A;  5HAR A;  2ZC3 B;  4R4R A;  3OC2 A;  4X68 A;  4XXR A;  5TR7 A;  4IBR A;  5EVL A;  2WAF A;  3RXX A;  4NK3 A;  4KZ8 A;  1PWG A;  1QMF A;  4R4S A;  1TVF A;  4X56 A;  3TOI A;  4E6W A;  3W8K A;  2ZC5 B;  4HBT A;  3UPO A;  3LY4 A;  1NZU A;  4OOM A;  4X6T A;  1XPB A;  4Y7P A;  3ZG5 A;  5JYP A;  4YIN A;  3G2Z A;  4Y0O A;  3C4P A;  4E3O A;  4JF6 A;  4GD6 A;  2WGV A;  1SHV A;  4KZA A;  4OH0 A;  3PBO A;  3MZD A;  2GDN A;  2WGI A;  4WEJ A;  5CRF A;  3HRE A;  1BT5 A;  4ZAM A;  3MKF A;  1ES3 A;  3O88 A;  1CI8 A;  5EE8 A;  1BUL A;  4EBN A;  1K6R A;  2Y4A A;  1E3U D;  5FAP A;  3DTM A;  4E3N A;  5CEC A;  2ZQ8 A;  2E8I A;  3ZGA B;  4KZ5 A;  4OQI A;  4XUX A;  1JTD A;  5CXW A;  3G35 A;  5EVI A;  5FQK A;  1YMX A;  3VMA A;  5KSH A;  1CEG A;  5GHY A;  4GZB A;  5DF9 A;  1ONG A;  2ZC7 A;  4FD8 A;  4M3K A;  4KG5 A;  5CGX A;  5AQA A;  2R9X A;  3EQU A;  3A3F A;  3GR2 A;  3N4I A;  5EOE A;  4JXV A;  5IHV A;  3MXR A;  4N9L A;  3A3D A;  4E3K A;  1SDN A;  3FKW A;  1ES4 A;  4DXC A;  2ZC6 B;  2XH9 A;  4PM5 A;  5M18 A;  4OP8 A;  1ZKJ A;  4OOL A;  1HZO A;  5E2G A;  3SH7 A;  3N8S A;  3UE0 A;  2Y91 A;  1JVJ A;  1PW8 A;  1LHY A;  1JWP A;  3MZF A;  3GQZ A;  3UE3 A;  1HTZ A;  3BRM A;  4R23 A;  5GHX A;  2HP6 A;  5D3O A;  5DTK A;  3E2L A;  1ZG4 A;  3VFF A;  4DE1 A;  4MLL A;  1ZG6 A;  3WS1 A;  2Y2P A;  1K4E A;  3O87 A;  3RXW A;  3DW0 A;  4GDB A;  4FH2 A;  4OPZ A;  1DJA A;  3GRJ A;  3C4O A;  4Z9Q A;  3C7V A;  3OPP A;  4HBU A;  3V3S A;  1MWT A;  5DVA A;  3VP3 A;  4N1X A;  2EFU A;  1PI5 A;  4OP5 A;  3VP4 A;  3DWZ A;  4KZ6 A;  3QNB A;  1FSW A;  2JCH A;  2P74 A;  4JF5 A;  3ZG7 B;  3WS4 A;  2J9P A;  1KVL A;  3Q7V A;  1RP5 A;  1MKI A;  1XGJ A;  5A91 A;  4E6X A;  4RYE A;  1K57 C;  4H8R A;  4B88 A;  4BD1 A;  5FI2 A;  4OPY A;  2QPN A;  4ZJ3 A;  3BM6 A;  4JPM A;  2DNS A;  3NI9 A;  3SS5 A;  3GMW A;  4Y0T A;  1Q2Q A;  1SCW A;  4KQR A;  3SH9 A;  2ZD8 A;  4BJP A;  3OCL A;  4QB8 A;  4BL2 A;  2J9O A;  1RCJ A;  4UA9 A;  1KVM A;  1YLJ A;  2Y2G A;  4IVI A;  5A93 A;  1IKG A;  2EX8 A;  5E2F A;  5FQM A;  3M6H A;  4PM6 A;  4BLM A;  3HLD A;  2ZM8 A;  1ERQ A;  2ZQ7 A;  3A3J A;  3BFF A;  4OQH A;  3W4Q A;  4UHU A;  1AXB A;  3HL9 A;  1ALQ A;  1SDE A;  5HAP A;  3GTC A;  2QZ6 A;  1LI9 A;  2JE5 A;  1W7F A;  3ZHH A;  1HD8 A;  1WYC A;  4D2O A;  2WZZ A;  2HP9 A;  2XD1 A;  1PWD A;  2H10 A;  1YLZ A;  4LV1 A;  1G68 A;  1Y54 A;  1LLB A;  2PU4 A;  2Y55 A;  3GSG A;  3IHA A;  4JLF A;  4S2O A;  2WYX A;  4C75 A;  3MBZ A;  4E3J A;  3UPP A;  5A90 A;  4RX3 A;  3PAG A;  4FH4 A;  3BEC A;  4OQG A;  3CJM A;  3C5A A;  3HLE A;  1MBL A;  5GLB A;  3V50 A;  1GCE A;  1GA0 A;  3NIA A;  4MEZ A;  4DXB A;  2EX9 A;  4KZ7 A;  4OLG A;  5CGS A;  4PPR A;  3AGE A;  3FYZ A;  1GHM A;  4E3M A;  1W8Y A;  1LL5 A;  1SKF A;  5FAT A;  3PBT A;  4KQQ A;  1GHP A;  2ZQA A;  2ZLY A;  2XQZ A;  4U3T A;  4UAA A;  5AQ7 A;  3UY6 A;  5CGW A;  1YM1 A;  1IYP A;  5AQB A;  5GLD A;  2EXB A;  3VP2 A;  2WGW B;  3IQA A;  3W4P A;  1U60 A;  3VSL A;  4R3B A;  2X71 A;  2XR0 A;  1K55 A;  5HAI A;  1JTG A;  2CC1 A;  5F1F A;  4KG2 A;  4LCL A;  4OQ0 A;  4R3J A;  2Y2J A;  2ZM2 A;  2BLS A;  2B5R A;  1TEM A;  2ZQ9 A;  3HUM A;  4S2M A;  1DJB A;  3MXS A;  4ZDX A;  4UA7 A;  2WKE A;  1K6S A;  1KGF A;  4PM7 A;  5F1G A;  2ZC4 B;  3VOZ A;  4E3L A;  3SOI A;  1VM1 A;  3M6B A;  3UDI A;  1PZP A;  2XF3 A;  3WS0 A;  1FOF A;  3GVB A;  4WMC D;  5EVI B;  3PBQ A;  5AQ9 A;  4U0T A;  2DCF A;  3O3V A;  3HLG A;  1WE4 A;  3A3I A;  4LEN A;  1C3B A;  1CI9 A;  5EUA A;  1L0G A;  2WAE A;  5KMW A;  2A3U A;  5FI7 A;  3CG5 A;  3RJU A;  3SH8 A;  3UE1 A;  4WEL A;  5FQJ A;  1FCO A;  3A3E A;  4FCF A;  5F83 A;  1XX2 A;  4S2K A;  3MKE A;  4IVK A;  1W5D A;  2Z2M B;  3IH9 A;  3S22 A;  1KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...