4ZBGA

Crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
166
structure length
154
Chain Sequence
HHHMHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGHIAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGYYRRFGFKAYFQCLAFGPDMPQGDVAYHAAFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a GNAT family Acetyltransferase from Brucella melitensis in complex with Acetyl-CoA
rcsb
molecule keywords Acetyltransferase
source organism Brucella abortus str. 2308 a
molecule tags Transferase
total genus 43
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zbgA00
2J8NA 3FNCA 4F0YA 1OZPA 4KZTA 1YLEA 3V8IA 2B3UA 2ZPAA 2FIAA 2FXFA 2R1IA 2ZW4A 1IYLA 3TTHA 3IWGA 3FYNA 4KORA 4XPDC 4YRHA 5F48A 3QB8A 1M44A 3LODA 3S6GA 4QC6A 3TOAA 2OH1A 2ZW6A 1S7NA 3R9EA 3FB3A 1QSOA 1P0HA 3E0KA 4MJ8A 3FBUA 3W6SA 4Y49B 4NEXA 2J8RA 2Q04A 4YFJA 5KTDA 4H6UA 2CY2A 4KVME 1CM0A 2B4BA 2VBQA 4B5PB 3SXNA 4XPLA 2AE6A 3DR6A 2OZGA 4KUAA 4AB7A 2WPXA 2QIRA 5F49A 4KOXA 4F6AA 4UWIA 4AVAA 4XPDB 4H6ZA 3T90A 4CRZB 5HH1A 3TO9A 2C27A 1U6MA 1S5KA 2Z0ZA 1YVOA 3TO6A 2B5GA 1KZFA 3GY9A 4QB9A 3ZJ0A 1Z9UA 3PZJA 3WR7A 1B6BA 4ORFA 2D4OA 4RI1A 3F5BA 3I9SA 2KCWA 3EO4A 1VKCA 5KTCA 4U9ZA 5DWMA 2PSWA 4PK2A 4EVYA 1Q2YA 2CNSA 4NXYA 4XPKA 2Y0MA 1XIXA 1Q2CA 1BO4A 4M3SA 4HNYB 2FL4A 3D3SA 4R57A 3VWDA 2HV2A 5F46A 5J8FA 3B8GA 3EC4A 4BMHA 4XNHC 2PR1A 2B58A 1QSMA 2BSWA 1S7KA 3GYAA 2REEA 2Q44A 2VZYA 5F47A 2P6EA 3D2MA 2VZZA 2HUZA 1KUVA 3TFYA 3S6KA 4U5YA 1MJ9A 3P2FA 4YGOA 2CNMA 5IV0A 3K9UA 4CAVA 4HNXB 1RO5A 4AVCA 4Y49C 5CNPA 1I1DA 1S7LA 4IF5A 2FT0A 3FXTA 1Y9KA 4LX9A 4E0AA 4CAXA 3JVNA 1QSNA 4UA3A 4KOSA 3R96A 4M85A 2PQ8A 2JEVA 4UWJA 4JXQA 1Y9WA 1IIDA 1Z4EA 1V0CA 2R98A 3N7ZA 3QAHA 3S6FA 4R87A 1M4IA 1NSLA 2Q4VA 2FCKA 5KTAA 1MK4A 2P6GA 5EBVA 1Z4RA 1SQHA 5ISVA 4KOTA 4KVOE 4QBJA 4OAEA 1IICA 2ATRA 3R9GA 3CXQA 2ZW5A 3FIXA 5FVJA 4AG9A 5EC4A 3G3SA 4H89A 1MJBA 1QSRA 4L89A 2D4PA 2QECA 4KUBA 4U9YA 2B4DB 3H4QA 2PR8A 2GE3A 4AVBA 4B5OA 1LRZA 1YREA 5JPHA 4KLWA 2R7HA 4FD4A 1MJAA 4JLYA 4JJXA 3TE4A 2QMLA 2H5MA 2GIVA 1CJWA 4ONUA 1BOBA 2I79A 3JUWA 1M4GA 1S60A 2DXQA 2P0WA 5E96A 2BUEA 4KLVA 4MY0A 2OB0A 3R95A 4UBRA 4OADA 2VEZA 3F8KA 3T9YA 2Z11A 1I21A 3R9FA 4ZBGA 2FS5A 2IL4A 1KUXA 5IX3A 3KKWA 4JXRA 1M1DA 4OLLA 2BL1A 3LD2A 3IGRA 5H86A 1P4NA 4B5PA 4NSQA 1ON0A 1XE4A 4CS0B 2NMTA 1KUYA 5C82A 3F0AA 2WPWA 2B3VA 2OU2A 5J8CA 4E8OA 4MY3A 4QVTA 4NF1A 2G0BA 1N71A 1RXTA 2JDCA 2K5TA 2ZW7A 3GKRA 2B5GB 3BLNA 2VXKA 4II9A 4L8AA 4X5KA 4KOUA 2HQYA 4PK3A 4KOWA 2Q7BA 3R1KA 2J8MA 4AG7A 4JWPA 1PUAA 3BJ7A 4NCZA 1IB1E 5JQ4A 2EUIA 2Q4YA 4RS2A 3FRMA 3OWCA 4FD6A 3TOBA 4DNCA 4MI4A 2BEIA 2O28A 3D2PA 2R8VA 2FIWA 2JDDA 1XF8A 4J3GA 2X7BA 3TO7A 4KVXA 2RC4A 3DNSA 5I0CA 2G3AA 4FD7A 2JLMA 3EXNA 1J4JA 1YK3A 1I12A 3RYOA 2FE7A 2PDOA 4IUSA 3EY5A 1IYKA 5DWNA 4CRYB 2G3TA 1WWZA 1WK4A 1QSTA 3TCVA 1FY7A 1L0CA 3MGDA 1YGHA 4LUAA 1M4DA 3UY5A 4R9MA 3W91A 3CXSA 1R57A 3G8WA 5C88A 1VHSA 3P2HA 4K30A 3W6XA 3DR8A 4R3LA 5GCNA 1Y7RA 4JD6A 2FSRA 2Q0YA 3DDDA 2EVNA 2A4NA 2AJ6A 4MBUA 3C26A 2F5IA 3SHPA 2Z10A 4QUSA 4E2AA 1B87A 1UFHA 3PP9A 4PSXA 2I00A 4HKFA 2VI7A 4R3KA 5HMNA 4KOVA 1NMTA 3PGPA 2CNTA 1PU9A 1XEBA 2GANA 1NE9A 1Q2DA 1YVKA 4MHDA 3TT2A 4GS4A 1YR0A 3I3GA 3EFAA 4PV6A 2VQYA 4PSWA 3ZZIA 2OZUA 2B4DA 3BJ8A 1K4JA 3NE7A 4I49A 5IB0A 4FD5A 3D8PA 3DSBA 1TIQA 2PC1A 4HNWB 1YX0A 2ARHA 3CXPA 1GHEA 1S3ZA 1S7FA 5H84A 3VWEA 2REFA 2P6FA 3S6HA 4KOYA 1XMTA 2OZHA 2PRBA 3SXOA 4XNHB 2ZXVA 4CAWA
chains in the Genus database with same CATH superfamily
2J8NA 4P4JA 4CYQA 3PEIA 4W9YA 3FNCA 2PVVA 4F0YA 3CT9A 8CPAA 1OZPA 1LCPA 4KZTA 1YLEA 3CPAA 1Y0YA 2B3UA 2ZPAA 2FIAA 3V8IA 5JM6A 3GIUA 2FXFA 2R1IA 2AFZA 2CIJA 3PB8X 4OMEA 2ZW4A 5AG6A 1IYLA 3T8WA 3TTHA 3IWGA 3FYNA 4KORA 4XPDC 4YRHA 5F48A 4P10A 4FAIA 3QB8A 1UWYA 2WUUA 2PJ3A 1M44A 3LODA 3S6GA 4QC6A 3FVLA 3TOAA 4C2XA 2OH1A 2ZW6A 1S7NA 3R9EA 3FB3A 2ANPA 3KR4A 4PXCA 3IFEA 1QSOA 1P0HA 3E0KA 4MJ8A 3FBUA 5CBMA 2PJCA 1X10A 2G9DA 1LANA 3W6SA 3ISXA 2PCUA 2ZELA 2ZEMA 4Y49B 1AYEA 4NEXA 2J8RA 5BWAB 2Q04A 4YFJA 5KTDA 2BOAA 4H6UA 4DYOA 2DF5A 2CY2A 4NGTA 2EWBA 1ARMA 2OOTA 3B2YA 3SI0A 4UIBA 4KVME 4OC2A 1CM0A 4MFQA 2RB7A 2B4BA 2VBQA 4MHPA 4B5PB 4ZI6A 3SXNA 4XPLA 2AE6A 3DR6A 2OZGA 4KUAA 1ZG9A 4YU9A 4AB7A 4A32A 3S9NA 4OP4A 2WPXA 4ZY1A 2QIRA 5F49A 1VGYA 4KOXA 2Q43A 3D4UA 3H8FA 2ABZA 3SJXA 2C1CA 4UWIA 4F6AA 4AVAA 1YMEA 4H6ZA 4XPDB 3T90A 4C2YA 4CRZB 5HH1A 4C7IA 3TO9A 3TC8A 4P4EA 2C27A 1U6MA 1IY7A 1XJOA 4L89A 1S5KA 4Z65A 2Z0ZA 1YVOA 4A2ZA 3RAMA 3TO6A 3D68A 2B5GA 3IO1A 1IGBA 2AFOA 3RBUA 1KZFA 3GY9A 4QB9A 5LRJA 5DS0A 3ZJ0A 1Z9UA 3PZJA 2BCOA 3IEHA 1B6BA 1H8LA 2D4OA 3PBBA 4ORFA 3H8EA 3F5BA 3I9SA 2KCWA 3K2KA 4RI1A 4CGLA 3EO4A 5A27A 5A28A 1LAMA 1VKCA 1VIXA 5KTCA 4GXHA 4TWEA 2QJ8A 4U9ZA 2AFWA 5DWMA 1YLOA 3B7IA 1TKHA 3B35A 1Z8LA 2PSWA 4PK2A 4ZX8A 4A33A 4EVYA 1Q2YA 1QQ9A 2CNSA 4NXYA 2ZOGA 4XPKA 2Y0MA 1XIXA 1Q2CA 3VATA 4OC1A 1BO4A 3GB0A 4HPSA 4IAVA 4M3SA 5AG7A 2C6GA 3PFEA 1DTDA 2FL4A 3D3SA 4HNYB 4R57A 4MCQA 4UFXA 3VWDA 1CPXA 3B3WA 2HV2A 5D29A 4UCPA 5F46A 5J8FA 4B13A 3B8GA 1CPSA 4NGPA 3EC4A 4IHMA 4BMHA 2OR4A 4XNHC 3NH8A 2PR1A 2B58A 1TKJA 4NJRA 1QSMA 4GM5A 1BPMA 1LAPA 2BSWA 4O23A 3MRUA 1S7KA 2PJ8A 3GYAA 2HC9A 4MXUA 2REEA 2Q44A 4FUUA 2VZYA 4NJQA 5F47A 3RNZA 2ZENA 2ZEFA 2P6EA 3D2MA 2VZZA 2XEIA 2HUZA 1YSJA 2PJ6A 4G1PA 4TNUA 1ELLP 1KUVA 2V77A 3KHXA 6CPAA 1JQGA 3WR7A 2GU2A 3CZXA 3TFYA 4MFKA 3S6KA 3CDXA 4U5YA 1MJ9A 3P2FA 3HUVA 4F9VA 4R6TA 4CAEA 4F8ZA 4YGOA 2CNMA 4B14A 2GFQA 3K9UA 7CPAA 5IV0A 2DPTA 3B3SA 4HNXB 4CAVA 5K8MA 5HVFA 1LOKA 1RO5A 2WZNA 3FJUA 4MMOA 4Y49C 5CNPA 4AVCA 4UFVA 5HXDA 1I1DA 1VHEA 4P45A 2GREA 4EFDA 1S7LA 4IF5A 2FT0A 3FXTA 4K3NA 3I1UA 4MFZA 4B12A 3QNVA 3VH9A 1Y9KA 3KQXA 4LX9A 5AGEA 1ELMP 1LFWA 4E0AA 3NA6A 4CAXA 3JVNA 2PJ0A 2WSAA 4Q7AA 3BI0A 2F8HA 2O53A 1QSNA 2YNCA 4UA3A 4EMEA 4KOSA 3R96A 5LYLA 4M85A 3LWUA 1CG2A 2PJ2A 2PQ8A 2JEVA 3PB4X 4UWJA 1CP6A 4JXQA 4ZY0A 1Y9WA 1IIDA 1XMBA 4IK2A 1Z4EA 1V0CA 4UIAA 4PPZA 2R98A 4R76A 3N7ZA 3QAHA 4A31A 5AG4A 3S6FA 4PXEA 1PYTB 1M4IA 4R87A 1NSLA 2Q4VA 1YW6A 2FCKA 5KTAA 1MK4A 2P6GA 4P6YA 5EBVA 4ZX9A 1Z4RA 1SQHA 2Q7SA 2EK8A 5J1QA 5ISVA 4KOTA 2PJ9A 4OKOA 4C68A 4KVOE 4QBJA 4OAEA 5G22A 1XBUA 1IICA 2ATRA 3R9GA 4OC5A 1DE4C 3CXQA 5CPAA 2ZW5A 3FIXA 1Z5RA 5FVJA 4UCMA 4WJBA 4AG9A 2V8GA 3FX6A 3IC1A 5EC4A 2DEAA 3G3SA 4H89A 4OC3A 3KZWA 4H2KA 2NSMA 1MJBA 1QSRA 1ZO0A 2D4PA 2QECA 2JBKA 1XFOA 2ZEOA 4KUBA 3FEEA 4U9YA 2GLJA 4LQGA 2B4DB 3H4QA 4MRIA 4NFRA 5HVGA 2PR8A 4ONWA 1ARLA 1Z8WA 4CGOA 4CGMA 4BINA 2VL1A 2ODFA 4B11A 5ELYA 2GE3A 4P4DA 4AVBA 1Z2LA 4B5OA 1LRZA 1YREA 3LACA 3WABA 3RO0A 1TF8A 4BD9A 2PJBA 3NH5A 5JPHA 4KLWA 3D66A 2R7HA 4FD4A 4NGSA 1MJAA 3ISZA 4JLYA 3K9TA 2YNEA 2WYRA 4JJXA 5LRGA 4UFWA 4OC4A 3TE4A 2QMLA 1IOIA 2H5MA 2GIVA 1CJWA 2JBJA 5I4MA 4DUKA 3IWWA 4X3RA 4ONUA 1BOBA 2I79A 3JUWA 1M4GA 2PIYA 1S60A 3DGVA 3MN8A 4RUHA 2PIZA 2DXQA 2P0WA 5E96A 4RN7A 2BUEA 3IIBA 4A30A 2C6CA 3IJ3A 4KLVA 4MY0A 4M6GA 2OB0A 3R95A 5JGFA 4UBRA 4OADA 3V38A 2VEZA 2Z3LA 3F8KA 1CX8A 4DJLA 3T9YA 1BPNA 4NGQA 2Z11A 2DPSA 1Y7EA 1I21A 3R9FA 4PXBA 4CYOA 3NE8A 4ZBGA 2FS5A 4OIDA 2QVPA 4PQAA 2IL4A 1KUXA 5IX3A 4ZYQA 2Z3KA 2NYQA 4X2TA 3KKWA 4JXRA 2PJ4A 1M1DA 4OLLA 2EK9A 2BL1A 3BXMA 3LD2A 3IGRA 3KR5A 2ZEHA 2POKA 3L2NA 5LYFA 5H86A 1P4NA 1ZG8A 3A9LA 4NSQA 4A38A 4B5PA 2FVGA 4KSFA 4MFJA 4X8IA 5JH9A 1CP7A 1ON0A 1XE4A 4Q38A 4CS0B 1Z8TA 1KUYA 2NMTA 4F9UA 4CYPA 5C82A 4P44A 3H5ZA 3KHZA 4A94A 3F0AA 2WPWA 2B3VA 2ZEDA 2OU2A 3S9MA 2J9AA 1EE3P 4M6HA 5J8CA 4E8OA 1AMPA 4MY3A 4QVTA 2C6PA 4NF1A 2G0BA 3KASA 1N71A 1RXTA 2JDCA 2K5TA 2ZW7A 3GKRA 2B5GB 1BAVA 2RFHA 3BLNA 2PJ5A 2VXKA 5LRKA 4L8AA 4II9A 4X5KA 1A2ZA 4KOUA 1VHOA 3B3TA 2PE3A 3D7GA 3N5FA 2AFXA 1HDUA 2HQYA 4PK3A 4KOWA 2CF4A 4OIWA 2Q7BA 1TXRA 3R1KA 2J8MA 4CYNA 5K8NA 2IMOA 4AG7A 5AG5A 5IB9A 4JWPA 1PUAA 3BJ7A 4NCZA 1IB1E 2XEFA 4KSAA 2BO9A 3SJEA 4FBEA 5JQ4A 1FT7A 2EUIA 4R8FA 2Q4YA 4RS2A 1FNOA 1CBXA 2JEWA 3CPXA 3FRMA 3OWCA 4FD6A 3TOBA 4DNCA 1NSAA 2CXAA 5G1ZA 1F57A 2YNDA 4UEZA 2HB6A 4WWVA 3B3CA 3PB7X 4UF4A 2PJ1A 4MI4A 3JTKA 3SJFA 2BEIA 2O28A 3D2PA 2R8VA 3KI9A 4FWUA 4ZY2A 2FIWA 2ZOFA 2Z3MA 2CTBA 2EBJA 2V8DA 2JDDA 1XF8A 4J3GA 2X7BA 3TO7A 4KVXA 4MFLA 3H8GA 2RC4A 2YGWA 4UCNA 3LMSA 3V7ZA 3NH4A 4MHYA 3DNSA 4A39A 5I0CA 2Z3NA 2ZEGA 3FECA 1IOFA 3WT4A 2G3AA 2GLFA 4LQ6A 5THWA 5LYDA 4FD7A 5D8NA 3TX8A 4MCRA 4MHNA 2CTCA 4MCPA 2JLMA 4NGRA 4F0XA 2YNCC 2AFSA 3EXNA 1J4JA 1HDQA 1I12A 1YK3A 3IWEA 2O4HA 3PFOA 4NGNA 3RYOA 2FE7A 2PDOA 1YQEA 4C7HA 4C2ZA 3KGQA 4IUSA 3EY5A 1IYKA 5DWNA 3FF3A 4M6IA 1JWQA 4B10A 2G3TA 1WWZA 1WK4A 3WC5A 1KWMA 3HLPA 3WC7A 4CAFA 4CRYB 1GYTA 1QSTA 3B3VA 4P4FA 3TCVA 1FY7A 4MCSA 3FMCA 4NGMA 1L0CA 1PCAA 4BBHA 3MGDA 1YGHA 1OBRA 4LUAA 1M4DA 2Z3PA 3UY5A 3FEDA 4PXDA 5K8PA 4R9MA 2ZEEA 2XEJA 3W91A 3CXSA 2F7VA 1R57A 3G8WA 2V8HA 5C88A 1VHSA 3P2HA 3WC6A 4K30A 3W6XA 1HEEA 3DR8A 1F2OA 4R3LA 5GCNA 3KQZA 1XRYA 2PJAA 4MHZA 2V8VA 1Y7RA 4JD6A 2FSRA 2Q0YA 3DDDA 1M4LA 2EVNA 5G20A 1XOVA 2A4NA 3D7HA 2AJ6A 4MBUA 3VARA 3C26A 4R7MA 5EMIA 1ZLHA 2AFMA 2F5IA 3SHPA 2Z10A 4Q36A 4QUSA 5LYIA 5HVHA 4E2AA 4KS9A 3DLJA 1B87A 1RTQA 1Q7LA 1UFHA 3D67A 3NFZA 3PP9A 1BLLE 4PSXA 2I00A 1YW4A 2AFUA 3SJGA 4HKFA 4JYWA 2I3CA 2VI7A 4R3KA 3SI1A 2PVWA 4UEEA 2Q4ZA 3BI1A 5HMNA 4KOVA 1NMTA 3PGPA 4OC0A 3PB6X 2CNTA 5K8OA 4B6ZA 1ZG7A 1PU9A 1TF9A 3FH4A 3D7FA 1XEBA 4YWYA 2GANA 1NE9A 1Q2DA 1YVKA 4MHDA 3TT2A 4GS4A 3S9LA 2EO8A 1YR0A 3I3GA 3EFAA 3IU2A 4PV6A 4EWTA 1F2PA 1QMUA 1TKFA 2VQYA 1Z8XA 4PSWA 2Q51A 3ZZIA 3KL9A 2OZUA 2B4DA 4ZGYB 3BJ8A 4JZ0A 3IU1A 4A37A 3PB9X 1Y0RA 2PRQA 2XEGA 1K4JA 2QYVA 1ZLIA 3NE7A 4I49A 3PRTA 4P4BA 5IB0A 3PBEA 4UEFA 4FD5A 3QAYA 3D8PA 2PJ7A 1AUGA 3DSBA 1TIQA 1R43A 2ZEPA 2PC1A 4A95A 1R3NA 4HNWB 1YX0A 2ARHA 3CXPA 4CGNA 2Z3OA 1GHEA 1S3ZA 1S7FA 3D7DA 1IU8A 3GLJA 2REFA 5H84A 3VWEA 2P6FA 4KSIA 4CGPA 4CPAA 3GUXA 3BHXA 3S6HA 3SI2A 4KOYA 1XMTA 5F09A 4P4IA 2IQ6A 4AXVA 2OZHA 2PRBA 3SXOA 1X12A 5G21A 3JRUA 4MFPA 4XNHB 3RZAA 2ZXVA 2IJZA 4CAWA
chains in the Genus database with same CATH topology
2J8NA 4CYQA 3FNCA 4F0YA 1OZPA 4KZTA 1YLEA 3V8IA 2B3UA 2ZPAA 2FIAA 2FXFA 2R1IA 5AG6A 2ZW4A 1IYLA 3TTHA 3IWGA 3FYNA 4KORA 4XPDC 4YRHA 5F48A 3QB8A 2WUUA 1M44A 3LODA 3S6GA 4QC6A 3TOAA 4C2XA 2OH1A 2ZW6A 1S7NA 3R9EA 3FB3A 1QSOA 1P0HA 3E0KA 4MJ8A 3FBUA 3W6SA 4Y49B 4NEXA 2J8RA 5BWAB 2Q04A 4YFJA 5KTDA 4H6UA 2CY2A 4KVME 1CM0A 4MFQA 2B4BA 2VBQA 4B5PB 3SXNA 4XPLA 2AE6A 3DR6A 2OZGA 4KUAA 4AB7A 4A32A 2WPXA 2QIRA 5F49A 4KOXA 4F6AA 4UWIA 4AVAA 4XPDB 4H6ZA 3T90A 4C2YA 4CRZB 5HH1A 4C7IA 3TO9A 2C27A 1U6MA 1S5KA 2Z0ZA 1YVOA 4A2ZA 3TO6A 2B5GA 1KZFA 3GY9A 4QB9A 3ZJ0A 1Z9UA 3PZJA 3WR7A 1B6BA 4ORFA 2D4OA 4RI1A 3F5BA 3I9SA 2KCWA 4CGLA 3EO4A 5A27A 5A28A 1VKCA 5KTCA 4U9ZA 5DWMA 2PSWA 4PK2A 4A33A 4EVYA 1Q2YA 2CNSA 4NXYA 4XPKA 2Y0MA 1XIXA 1Q2CA 1BO4A 5AG7A 4M3SA 4HNYB 2FL4A 3D3SA 4R57A 3VWDA 2HV2A 4UCPA 5F46A 5J8FA 4B13A 3B8GA 3EC4A 4BMHA 4XNHC 2PR1A 2B58A 1QSMA 2BSWA 1S7KA 4UFXA 3GYAA 2REEA 2Q44A 2VZYA 5F47A 2P6EA 3D2MA 2VZZA 2HUZA 1KUVA 3TFYA 4MFKA 3S6KA 4U5YA 1MJ9A 3P2FA 4CAEA 4YGOA 2CNMA 4B14A 5IV0A 3K9UA 2DPTA 4CAVA 4HNXB 1RO5A 4AVCA 4Y49C 5CNPA 4UFVA 1I1DA 1S7LA 4IF5A 2FT0A 3FXTA 4B12A 4MFZA 1Y9KA 4LX9A 5AGEA 4E0AA 4CAXA 3JVNA 2WSAA 1QSNA 2YNCA 4UA3A 4KOSA 3R96A 4M85A 2PQ8A 2JEVA 4UWJA 4JXQA 1Y9WA 1IIDA 1Z4EA 1V0CA 2R98A 3N7ZA 3QAHA 4A31A 5AG4A 3S6FA 4R87A 1M4IA 1NSLA 2Q4VA 2FCKA 5KTAA 1MK4A 2P6GA 5EBVA 1Z4RA 1SQHA 5ISVA 4KOTA 4C68A 4KVOE 4QBJA 4OAEA 5G22A 1IICA 2ATRA 3R9GA 3CXQA 2ZW5A 3FIXA 5FVJA 4UCMA 4AG9A 5EC4A 3G3SA 4H89A 1MJBA 1QSRA 1ZO0A 2D4PA 2QECA 4L89A 4KUBA 4U9YA 2B4DB 3H4QA 2PR8A 4CGOA 4CGMA 4B11A 2GE3A 4AVBA 4B5OA 1LRZA 1YREA 5JPHA 4KLWA 2R7HA 4FD4A 1MJAA 4JLYA 2YNEA 4JJXA 4UFWA 3TE4A 2QMLA 2H5MA 2GIVA 1CJWA 4ONUA 1BOBA 2I79A 3JUWA 1M4GA 1S60A 2DXQA 2P0WA 5E96A 4A30A 2BUEA 4KLVA 4MY0A 2OB0A 3R95A 4UBRA 4OADA 2VEZA 2Z3LA 3F8KA 3T9YA 2Z11A 2DPSA 1I21A 3R9FA 4CYOA 4ZBGA 2FS5A 2IL4A 1KUXA 5IX3A 2Z3KA 3KKWA 4JXRA 1M1DA 4OLLA 2BL1A 3LD2A 3IGRA 5H86A 1P4NA 3A9LA 4B5PA 4NSQA 4KSFA 4MFJA 1ON0A 1XE4A 4Q38A 4CS0B 2NMTA 1KUYA 4CYPA 5C82A 3H5ZA 3F0AA 2WPWA 2B3VA 2OU2A 5J8CA 4E8OA 4MY3A 4QVTA 4NF1A 2G0BA 1N71A 1RXTA 2JDCA 2K5TA 2ZW7A 3GKRA 2B5GB 3BLNA 2VXKA 4II9A 4L8AA 4X5KA 4KOUA 2HQYA 4PK3A 4KOWA 2Q7BA 3R1KA 4CYNA 2J8MA 4AG7A 5AG5A 4JWPA 1PUAA 3BJ7A 4NCZA 1IB1E 4KSAA 5JQ4A 2EUIA 2Q4YA 4RS2A 3FRMA 3OWCA 4FD6A 3TOBA 4DNCA 2CXAA 5G1ZA 2YNDA 4MI4A 3JTKA 2BEIA 2O28A 3D2PA 2R8VA 2FIWA 2Z3MA 2JDDA 1XF8A 4J3GA 2X7BA 3TO7A 4KVXA 4MFLA 2RC4A 2YGWA 4UCNA 3DNSA 5I0CA 2Z3NA 2G3AA 4FD7A 2JLMA 4F0XA 2YNCC 3EXNA 1J4JA 1YK3A 1I12A 3IWEA 3RYOA 2FE7A 2PDOA 4C7HA 4C2ZA 4IUSA 3EY5A 1IYKA 5DWNA 4B10A 2G3TA 1WWZA 1WK4A 4CAFA 4CRYB 1QSTA 3TCVA 1FY7A 4BBHA 1L0CA 3MGDA 1YGHA 4LUAA 1M4DA 2Z3PA 3UY5A 4R9MA 3W91A 3CXSA 1R57A 3G8WA 5C88A 1VHSA 3P2HA 4K30A 3W6XA 3DR8A 4R3LA 5GCNA 1Y7RA 4JD6A 2FSRA 2Q0YA 3DDDA 2EVNA 5G20A 2A4NA 2AJ6A 4MBUA 3C26A 2F5IA 3SHPA 2Z10A 4Q36A 4QUSA 4E2AA 4KS9A 1B87A 1UFHA 3PP9A 4PSXA 2I00A 4HKFA 2VI7A 4R3KA 5HMNA 4KOVA 1NMTA 3PGPA 2CNTA 1PU9A 1XEBA 2GANA 1NE9A 1Q2DA 1YVKA 4MHDA 3TT2A 4GS4A 1YR0A 3I3GA 3EFAA 3IU2A 4PV6A 2VQYA 4PSWA 3ZZIA 2OZUA 2B4DA 4ZGYB 3BJ8A 3IU1A 1K4JA 3NE7A 4I49A 5IB0A 4FD5A 3D8PA 3DSBA 1TIQA 2PC1A 4A95A 4HNWB 1YX0A 2ARHA 3CXPA 4CGNA 2Z3OA 1GHEA 1S3ZA 1S7FA 5H84A 3VWEA 4CGPA 2REFA 2P6FA 3S6HA 4KOYA 1XMTA 2OZHA 2PRBA 3SXOA 5G21A 4MFPA 4XNHB 2ZXVA 4CAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8N A;  3FNC A;  4F0Y A;  1OZP A;  4KZT A;  1YLE A;  3V8I A;  2B3U A;  2ZPA A;  2FIA A;  2FXF A;  2R1I A;  2ZW4 A;  1IYL A;  3TTH A;  3IWG A;  3FYN A;  4KOR A;  4XPD C;  4YRH A;  5F48 A;  3QB8 A;  1M44 A;  3LOD A;  3S6G A;  4QC6 A;  3TOA A;  2OH1 A;  2ZW6 A;  1S7N A;  3R9E A;  3FB3 A;  1QSO A;  1P0H A;  3E0K A;  4MJ8 A;  3FBU A;  3W6S A;  4Y49 B;  4NEX A;  2J8R A;  2Q04 A;  4YFJ A;  5KTD A;  4H6U A;  2CY2 A;  4KVM E;  1CM0 A;  2B4B A;  2VBQ A;  4B5P B;  3SXN A;  4XPL A;  2AE6 A;  3DR6 A;  2OZG A;  4KUA A;  4AB7 A;  2WPX A;  2QIR A;  5F49 A;  4KOX A;  4F6A A;  4UWI A;  4AVA A;  4XPD B;  4H6Z A;  3T90 A;  4CRZ B;  5HH1 A;  3TO9 A;  2C27 A;  1U6M A;  1S5K A;  2Z0Z A;  1YVO A;  3TO6 A;  2B5G A;  1KZF A;  3GY9 A;  4QB9 A;  3ZJ0 A;  1Z9U A;  3PZJ A;  3WR7 A;  1B6B A;  4ORF A;  2D4O A;  4RI1 A;  3F5B A;  3I9S A;  2KCW A;  3EO4 A;  1VKC A;  5KTC A;  4U9Z A;  5DWM A;  2PSW A;  4PK2 A;  4EVY A;  1Q2Y A;  2CNS A;  4NXY A;  4XPK A;  2Y0M A;  1XIX A;  1Q2C A;  1BO4 A;  4M3S A;  4HNY B;  2FL4 A;  3D3S A;  4R57 A;  3VWD A;  2HV2 A;  5F46 A;  5J8F A;  3B8G A;  3EC4 A;  4BMH A;  4XNH C;  2PR1 A;  2B58 A;  1QSM A;  2BSW A;  1S7K A;  3GYA A;  2REE A;  2Q44 A;  2VZY A;  5F47 A;  2P6E A;  3D2M A;  2VZZ A;  2HUZ A;  1KUV A;  3TFY A;  3S6K A;  4U5Y A;  1MJ9 A;  3P2F A;  4YGO A;  2CNM A;  5IV0 A;  3K9U A;  4CAV A;  4HNX B;  1RO5 A;  4AVC A;  4Y49 C;  5CNP A;  1I1D A;  1S7L A;  4IF5 A;  2FT0 A;  3FXT A;  1Y9K A;  4LX9 A;  4E0A A;  4CAX A;  3JVN A;  1QSN A;  4UA3 A;  4KOS A;  3R96 A;  4M85 A;  2PQ8 A;  2JEV A;  4UWJ A;  4JXQ A;  1Y9W A;  1IID A;  1Z4E A;  1V0C A;  2R98 A;  3N7Z A;  3QAH A;  3S6F A;  4R87 A;  1M4I A;  1NSL A;  2Q4V A;  2FCK A;  5KTA A;  1MK4 A;  2P6G A;  5EBV A;  1Z4R A;  1SQH A;  5ISV A;  4KOT A;  4KVO E;  4QBJ A;  4OAE A;  1IIC A;  2ATR A;  3R9G A;  3CXQ A;  2ZW5 A;  3FIX A;  5FVJ A;  4AG9 A;  5EC4 A;  3G3S A;  4H89 A;  1MJB A;  1QSR A;  4L89 A;  2D4P A;  2QEC A;  4KUB A;  4U9Y A;  2B4D B;  3H4Q A;  2PR8 A;  2GE3 A;  4AVB A;  4B5O A;  1LRZ A;  1YRE A;  5JPH A;  4KLW A;  2R7H A;  4FD4 A;  1MJA A;  4JLY A;  4JJX A;  3TE4 A;  2QML A;  2H5M A;  2GIV A;  1CJW A;  4ONU A;  1BOB A;  2I79 A;  3JUW A;  1M4G A;  1S60 A;  2DXQ A;  2P0W A;  5E96 A;  2BUE A;  4KLV A;  4MY0 A;  2OB0 A;  3R95 A;  4UBR A;  4OAD A;  2VEZ A;  3F8K A;  3T9Y A;  2Z11 A;  1I21 A;  3R9F A;  4ZBG A;  2FS5 A;  2IL4 A;  1KUX A;  5IX3 A;  3KKW A;  4JXR A;  1M1D A;  4OLL A;  2BL1 A;  3LD2 A;  3IGR A;  5H86 A;  1P4N A;  4B5P A;  4NSQ A;  1ON0 A;  1XE4 A;  4CS0 B;  2NMT A;  1KUY A;  5C82 A;  3F0A A;  2WPW A;  2B3V A;  2OU2 A;  5J8C A;  4E8O A;  4MY3 A;  4QVT A;  4NF1 A;  2G0B A;  1N71 A;  1RXT A;  2JDC A;  2K5T A;  2ZW7 A;  3GKR A;  2B5G B;  3BLN A;  2VXK A;  4II9 A;  4L8A A;  4X5K A;  4KOU A;  2HQY A;  4PK3 A;  4KOW A;  2Q7B A;  3R1K A;  2J8M A;  4AG7 A;  4JWP A;  1PUA A;  3BJ7 A;  4NCZ A;  1IB1 E;  5JQ4 A;  2EUI A;  2Q4Y A;  4RS2 A;  3FRM A;  3OWC A;  4FD6 A;  3TOB A;  4DNC A;  4MI4 A;  2BEI A;  2O28 A;  3D2P A;  2R8V A;  2FIW A;  2JDD A;  1XF8 A;  4J3G A;  2X7B A;  3TO7 A;  4KVX A;  2RC4 A;  3DNS A;  5I0C A;  2G3A A;  4FD7 A;  2JLM A;  3EXN A;  1J4J A;  1YK3 A;  1I12 A;  3RYO A;  2FE7 A;  2PDO A;  4IUS A;  3EY5 A;  1IYK A;  5DWN A;  4CRY B;  2G3T A;  1WWZ A;  1WK4 A;  1QST A;  3TCV A;  1FY7 A;  1L0C A;  3MGD A;  1YGH A;  4LUA A;  1M4D A;  3UY5 A;  4R9M A;  3W91 A;  3CXS A;  1R57 A;  3G8W A;  5C88 A;  1VHS A;  3P2H A;  4K30 A;  3W6X A;  3DR8 A;  4R3L A;  5GCN A;  1Y7R A;  4JD6 A;  2FSR A;  2Q0Y A;  3DDD A;  2EVN A;  2A4N A;  2AJ6 A;  4MBU A;  3C26 A;  2F5I A;  3SHP A;  2Z10 A;  4QUS A;  4E2A A;  1B87 A;  1UFH A;  3PP9 A;  4PSX A;  2I00 A;  4HKF A;  2VI7 A;  4R3K A;  5HMN A;  4KOV A;  1NMT A;  3PGP A;  2CNT A;  1PU9 A;  1XEB A;  2GAN A;  1NE9 A;  1Q2D A;  1YVK A;  4MHD A;  3TT2 A;  4GS4 A;  1YR0 A;  3I3G A;  3EFA A;  4PV6 A;  2VQY A;  4PSW A;  3ZZI A;  2OZU A;  2B4D A;  3BJ8 A;  1K4J A;  3NE7 A;  4I49 A;  5IB0 A;  4FD5 A;  3D8P A;  3DSB A;  1TIQ A;  2PC1 A;  4HNW B;  1YX0 A;  2ARH A;  3CXP A;  1GHE A;  1S3Z A;  1S7F A;  5H84 A;  3VWE A;  2REF A;  2P6F A;  3S6H A;  4KOY A;  1XMT A;  2OZH A;  2PRB A;  3SXO A;  4XNH B;  2ZXV A;  4CAW A; 
#chains in the Genus database with same CATH topology
 2J8N A;  4P4J A;  4CYQ A;  3PEI A;  4W9Y A;  3FNC A;  2PVV A;  4F0Y A;  3CT9 A;  8CPA A;  1OZP A;  1LCP A;  4KZT A;  1YLE A;  3CPA A;  1Y0Y A;  2B3U A;  2ZPA A;  2FIA A;  3V8I A;  5JM6 A;  3GIU A;  2FXF A;  2R1I A;  2AFZ A;  2CIJ A;  3PB8 X;  4OME A;  2ZW4 A;  5AG6 A;  1IYL A;  3T8W A;  3TTH A;  3IWG A;  3FYN A;  4KOR A;  4XPD C;  4YRH A;  5F48 A;  4P10 A;  4FAI A;  3QB8 A;  1UWY A;  2WUU A;  2PJ3 A;  1M44 A;  3LOD A;  3S6G A;  4QC6 A;  3FVL A;  3TOA A;  4C2X A;  2OH1 A;  2ZW6 A;  1S7N A;  3R9E A;  3FB3 A;  2ANP A;  3KR4 A;  4PXC A;  3IFE A;  1QSO A;  1P0H A;  3E0K A;  4MJ8 A;  3FBU A;  5CBM A;  2PJC A;  1X10 A;  2G9D A;  1LAN A;  3W6S A;  3ISX A;  2PCU A;  2ZEL A;  2ZEM A;  4Y49 B;  1AYE A;  4NEX A;  2J8R A;  5BWA B;  2Q04 A;  4YFJ A;  5KTD A;  2BOA A;  4H6U A;  4DYO A;  2DF5 A;  2CY2 A;  4NGT A;  2EWB A;  1ARM A;  2OOT A;  3B2Y A;  3SI0 A;  4UIB A;  4KVM E;  4OC2 A;  1CM0 A;  4MFQ A;  2RB7 A;  2B4B A;  2VBQ A;  4MHP A;  4B5P B;  4ZI6 A;  3SXN A;  4XPL A;  2AE6 A;  3DR6 A;  2OZG A;  4KUA A;  1ZG9 A;  4YU9 A;  4AB7 A;  4A32 A;  3S9N A;  4OP4 A;  2WPX A;  4ZY1 A;  2QIR A;  5F49 A;  1VGY A;  4KOX A;  2Q43 A;  3D4U A;  3H8F A;  2ABZ A;  3SJX A;  2C1C A;  4UWI A;  4F6A A;  4AVA A;  1YME A;  4H6Z A;  4XPD B;  3T90 A;  4C2Y A;  4CRZ B;  5HH1 A;  4C7I A;  3TO9 A;  3TC8 A;  4P4E A;  2C27 A;  1U6M A;  1IY7 A;  1XJO A;  4L89 A;  1S5K A;  4Z65 A;  2Z0Z A;  1YVO A;  4A2Z A;  3RAM A;  3TO6 A;  3D68 A;  2B5G A;  3IO1 A;  1IGB A;  2AFO A;  3RBU A;  1KZF A;  3GY9 A;  4QB9 A;  5LRJ A;  5DS0 A;  3ZJ0 A;  1Z9U A;  3PZJ A;  2BCO A;  3IEH A;  1B6B A;  1H8L A;  2D4O A;  3PBB A;  4ORF A;  3H8E A;  3F5B A;  3I9S A;  2KCW A;  3K2K A;  4RI1 A;  4CGL A;  3EO4 A;  5A27 A;  5A28 A;  1LAM A;  1VKC A;  1VIX A;  5KTC A;  4GXH A;  4TWE A;  2QJ8 A;  4U9Z A;  2AFW A;  5DWM A;  1YLO A;  3B7I A;  1TKH A;  3B35 A;  1Z8L A;  2PSW A;  4PK2 A;  4ZX8 A;  4A33 A;  4EVY A;  1Q2Y A;  1QQ9 A;  2CNS A;  4NXY A;  2ZOG A;  4XPK A;  2Y0M A;  1XIX A;  1Q2C A;  3VAT A;  4OC1 A;  1BO4 A;  3GB0 A;  4HPS A;  4IAV A;  4M3S A;  5AG7 A;  2C6G A;  3PFE A;  1DTD A;  2FL4 A;  3D3S A;  4HNY B;  4R57 A;  4MCQ A;  4UFX A;  3VWD A;  1CPX A;  3B3W A;  2HV2 A;  5D29 A;  4UCP A;  5F46 A;  5J8F A;  4B13 A;  3B8G A;  1CPS A;  4NGP A;  3EC4 A;  4IHM A;  4BMH A;  2OR4 A;  4XNH C;  3NH8 A;  2PR1 A;  2B58 A;  1TKJ A;  4NJR A;  1QSM A;  4GM5 A;  1BPM A;  1LAP A;  2BSW A;  4O23 A;  3MRU A;  1S7K A;  2PJ8 A;  3GYA A;  2HC9 A;  4MXU A;  2REE A;  2Q44 A;  4FUU A;  2VZY A;  4NJQ A;  5F47 A;  3RNZ A;  2ZEN A;  2ZEF A;  2P6E A;  3D2M A;  2VZZ A;  2XEI A;  2HUZ A;  1YSJ A;  2PJ6 A;  4G1P A;  4TNU A;  1ELL P;  1KUV A;  2V77 A;  3KHX A;  6CPA A;  1JQG A;  3WR7 A;  2GU2 A;  3CZX A;  3TFY A;  4MFK A;  3S6K A;  3CDX A;  4U5Y A;  1MJ9 A;  3P2F A;  3HUV A;  4F9V A;  4R6T A;  4CAE A;  4F8Z A;  4YGO A;  2CNM A;  4B14 A;  2GFQ A;  3K9U A;  7CPA A;  5IV0 A;  2DPT A;  3B3S A;  4HNX B;  4CAV A;  5K8M A;  5HVF A;  1LOK A;  1RO5 A;  2WZN A;  3FJU A;  4MMO A;  4Y49 C;  5CNP A;  4AVC A;  4UFV A;  5HXD A;  1I1D A;  1VHE A;  4P45 A;  2GRE A;  4EFD A;  1S7L A;  4IF5 A;  2FT0 A;  3FXT A;  4K3N A;  3I1U A;  4MFZ A;  4B12 A;  3QNV A;  3VH9 A;  1Y9K A;  3KQX A;  4LX9 A;  5AGE A;  1ELM P;  1LFW A;  4E0A A;  3NA6 A;  4CAX A;  3JVN A;  2PJ0 A;  2WSA A;  4Q7A A;  3BI0 A;  2F8H A;  2O53 A;  1QSN A;  2YNC A;  4UA3 A;  4EME A;  4KOS A;  3R96 A;  5LYL A;  4M85 A;  3LWU A;  1CG2 A;  2PJ2 A;  2PQ8 A;  2JEV A;  3PB4 X;  4UWJ A;  1CP6 A;  4JXQ A;  4ZY0 A;  1Y9W A;  1IID A;  1XMB A;  4IK2 A;  1Z4E A;  1V0C A;  4UIA A;  4PPZ A;  2R98 A;  4R76 A;  3N7Z A;  3QAH A;  4A31 A;  5AG4 A;  3S6F A;  4PXE A;  1PYT B;  1M4I A;  4R87 A;  1NSL A;  2Q4V A;  1YW6 A;  2FCK A;  5KTA A;  1MK4 A;  2P6G A;  4P6Y A;  5EBV A;  4ZX9 A;  1Z4R A;  1SQH A;  2Q7S A;  2EK8 A;  5J1Q A;  5ISV A;  4KOT A;  2PJ9 A;  4OKO A;  4C68 A;  4KVO E;  4QBJ A;  4OAE A;  5G22 A;  1XBU A;  1IIC A;  2ATR A;  3R9G A;  4OC5 A;  1DE4 C;  3CXQ A;  5CPA A;  2ZW5 A;  3FIX A;  1Z5R A;  5FVJ A;  4UCM A;  4WJB A;  4AG9 A;  2V8G A;  3FX6 A;  3IC1 A;  5EC4 A;  2DEA A;  3G3S A;  4H89 A;  4OC3 A;  3KZW A;  4H2K A;  2NSM A;  1MJB A;  1QSR A;  1ZO0 A;  2D4P A;  2QEC A;  2JBK A;  1XFO A;  2ZEO A;  4KUB A;  3FEE A;  4U9Y A;  2GLJ A;  4LQG A;  2B4D B;  3H4Q A;  4MRI A;  4NFR A;  5HVG A;  2PR8 A;  4ONW A;  1ARL A;  1Z8W A;  4CGO A;  4CGM A;  4BIN A;  2VL1 A;  2ODF A;  4B11 A;  5ELY A;  2GE3 A;  4P4D A;  4AVB A;  1Z2L A;  4B5O A;  1LRZ A;  1YRE A;  3LAC A;  3WAB A;  3RO0 A;  1TF8 A;  4BD9 A;  2PJB A;  3NH5 A;  5JPH A;  4KLW A;  3D66 A;  2R7H A;  4FD4 A;  4NGS A;  1MJA A;  3ISZ A;  4JLY A;  3K9T A;  2YNE A;  2WYR A;  4JJX A;  5LRG A;  4UFW A;  4OC4 A;  3TE4 A;  2QML A;  1IOI A;  2H5M A;  2GIV A;  1CJW A;  2JBJ A;  5I4M A;  4DUK A;  3IWW A;  4X3R A;  4ONU A;  1BOB A;  2I79 A;  3JUW A;  1M4G A;  2PIY A;  1S60 A;  3DGV A;  3MN8 A;  4RUH A;  2PIZ A;  2DXQ A;  2P0W A;  5E96 A;  4RN7 A;  2BUE A;  3IIB A;  4A30 A;  2C6C A;  3IJ3 A;  4KLV A;  4MY0 A;  4M6G A;  2OB0 A;  3R95 A;  5JGF A;  4UBR A;  4OAD A;  3V38 A;  2VEZ A;  2Z3L A;  3F8K A;  1CX8 A;  4DJL A;  3T9Y A;  1BPN A;  4NGQ A;  2Z11 A;  2DPS A;  1Y7E A;  1I21 A;  3R9F A;  4PXB A;  4CYO A;  3NE8 A;  4ZBG A;  2FS5 A;  4OID A;  2QVP A;  4PQA A;  2IL4 A;  1KUX A;  5IX3 A;  4ZYQ A;  2Z3K A;  2NYQ A;  4X2T A;  3KKW A;  4JXR A;  2PJ4 A;  1M1D A;  4OLL A;  2EK9 A;  2BL1 A;  3BXM A;  3LD2 A;  3IGR A;  3KR5 A;  2ZEH A;  2POK A;  3L2N A;  5LYF A;  5H86 A;  1P4N A;  1ZG8 A;  3A9L A;  4NSQ A;  4A38 A;  4B5P A;  2FVG A;  4KSF A;  4MFJ A;  4X8I A;  5JH9 A;  1CP7 A;  1ON0 A;  1XE4 A;  4Q38 A;  4CS0 B;  1Z8T A;  1KUY A;  2NMT A;  4F9U A;  4CYP A;  5C82 A;  4P44 A;  3H5Z A;  3KHZ A;  4A94 A;  3F0A A;  2WPW A;  2B3V A;  2ZED A;  2OU2 A;  3S9M A;  2J9A A;  1EE3 P;  4M6H A;  5J8C A;  4E8O A;  1AMP A;  4MY3 A;  4QVT A;  2C6P A;  4NF1 A;  2G0B A;  3KAS A;  1N71 A;  1RXT A;  2JDC A;  2K5T A;  2ZW7 A;  3GKR A;  2B5G B;  1BAV A;  2RFH A;  3BLN A;  2PJ5 A;  2VXK A;  5LRK A;  4L8A A;  4II9 A;  4X5K A;  1A2Z A;  4KOU A;  1VHO A;  3B3T A;  2PE3 A;  3D7G A;  3N5F A;  2AFX A;  1HDU A;  2HQY A;  4PK3 A;  4KOW A;  2CF4 A;  4OIW A;  2Q7B A;  1TXR A;  3R1K A;  2J8M A;  4CYN A;  5K8N A;  2IMO A;  4AG7 A;  5AG5 A;  5IB9 A;  4JWP A;  1PUA A;  3BJ7 A;  4NCZ A;  1IB1 E;  2XEF A;  4KSA A;  2BO9 A;  3SJE A;  4FBE A;  5JQ4 A;  1FT7 A;  2EUI A;  4R8F A;  2Q4Y A;  4RS2 A;  1FNO A;  1CBX A;  2JEW A;  3CPX A;  3FRM A;  3OWC A;  4FD6 A;  3TOB A;  4DNC A;  1NSA A;  2CXA A;  5G1Z A;  1F57 A;  2YND A;  4UEZ A;  2HB6 A;  4WWV A;  3B3C A;  3PB7 X;  4UF4 A;  2PJ1 A;  4MI4 A;  3JTK A;  3SJF A;  2BEI A;  2O28 A;  3D2P A;  2R8V A;  3KI9 A;  4FWU A;  4ZY2 A;  2FIW A;  2ZOF A;  2Z3M A;  2CTB A;  2EBJ A;  2V8D A;  2JDD A;  1XF8 A;  4J3G A;  2X7B A;  3TO7 A;  4KVX A;  4MFL A;  3H8G A;  2RC4 A;  2YGW A;  4UCN A;  3LMS A;  3V7Z A;  3NH4 A;  4MHY A;  3DNS A;  4A39 A;  5I0C A;  2Z3N A;  2ZEG A;  3FEC A;  1IOF A;  3WT4 A;  2G3A A;  2GLF A;  4LQ6 A;  5THW A;  5LYD A;  4FD7 A;  5D8N A;  3TX8 A;  4MCR A;  4MHN A;  2CTC A;  4MCP A;  2JLM A;  4NGR A;  4F0X A;  2YNC C;  2AFS A;  3EXN A;  1J4J A;  1HDQ A;  1I12 A;  1YK3 A;  3IWE A;  2O4H A;  3PFO A;  4NGN A;  3RYO A;  2FE7 A;  2PDO A;  1YQE A;  4C7H A;  4C2Z A;  3KGQ A;  4IUS A;  3EY5 A;  1IYK A;  5DWN A;  3FF3 A;  4M6I A;  1JWQ A;  4B10 A;  2G3T A;  1WWZ A;  1WK4 A;  3WC5 A;  1KWM A;  3HLP A;  3WC7 A;  4CAF A;  4CRY B;  1GYT A;  1QST A;  3B3V A;  4P4F A;  3TCV A;  1FY7 A;  4MCS A;  3FMC A;  4NGM A;  1L0C A;  1PCA A;  4BBH A;  3MGD A;  1YGH A;  1OBR A;  4LUA A;  1M4D A;  2Z3P A;  3UY5 A;  3FED A;  4PXD A;  5K8P A;  4R9M A;  2ZEE A;  2XEJ A;  3W91 A;  3CXS A;  2F7V A;  1R57 A;  3G8W A;  2V8H A;  5C88 A;  1VHS A;  3P2H A;  3WC6 A;  4K30 A;  3W6X A;  1HEE A;  3DR8 A;  1F2O A;  4R3L A;  5GCN A;  3KQZ A;  1XRY A;  2PJA A;  4MHZ A;  2V8V A;  1Y7R A;  4JD6 A;  2FSR A;  2Q0Y A;  3DDD A;  1M4L A;  2EVN A;  5G20 A;  1XOV A;  2A4N A;  3D7H A;  2AJ6 A;  4MBU A;  3VAR A;  3C26 A;  4R7M A;  5EMI A;  1ZLH A;  2AFM A;  2F5I A;  3SHP A;  2Z10 A;  4Q36 A;  4QUS A;  5LYI A;  5HVH A;  4E2A A;  4KS9 A;  3DLJ A;  1B87 A;  1RTQ A;  1Q7L A;  1UFH A;  3D67 A;  3NFZ A;  3PP9 A;  1BLL E;  4PSX A;  2I00 A;  1YW4 A;  2AFU A;  3SJG A;  4HKF A;  4JYW A;  2I3C A;  2VI7 A;  4R3K A;  3SI1 A;  2PVW A;  4UEE A;  2Q4Z A;  3BI1 A;  5HMN A;  4KOV A;  1NMT A;  3PGP A;  4OC0 A;  3PB6 X;  2CNT A;  5K8O A;  4B6Z A;  1ZG7 A;  1PU9 A;  1TF9 A;  3FH4 A;  3D7F A;  1XEB A;  4YWY A;  2GAN A;  1NE9 A;  1Q2D A;  1YVK A;  4MHD A;  3TT2 A;  4GS4 A;  3S9L A;  2EO8 A;  1YR0 A;  3I3G A;  3EFA A;  3IU2 A;  4PV6 A;  4EWT A;  1F2P A;  1QMU A;  1TKF A;  2VQY A;  1Z8X A;  4PSW A;  2Q51 A;  3ZZI A;  3KL9 A;  2OZU A;  2B4D A;  4ZGY B;  3BJ8 A;  4JZ0 A;  3IU1 A;  4A37 A;  3PB9 X;  1Y0R A;  2PRQ A;  2XEG A;  1K4J A;  2QYV A;  1ZLI A;  3NE7 A;  4I49 A;  3PRT A;  4P4B A;  5IB0 A;  3PBE A;  4UEF A;  4FD5 A;  3QAY A;  3D8P A;  2PJ7 A;  1AUG A;  3DSB A;  1TIQ A;  1R43 A;  2ZEP A;  2PC1 A;  4A95 A;  1R3N A;  4HNW B;  1YX0 A;  2ARH A;  3CXP A;  4CGN A;  2Z3O A;  1GHE A;  1S3Z A;  1S7F A;  3D7D A;  1IU8 A;  3GLJ A;  2REF A;  5H84 A;  3VWE A;  2P6F A;  4KSI A;  4CGP A;  4CPA A;  3GUX A;  3BHX A;  3S6H A;  3SI2 A;  4KOY A;  1XMT A;  5F09 A;  4P4I A;  2IQ6 A;  4AXV A;  2OZH A;  2PRB A;  3SXO A;  1X12 A;  5G21 A;  3JRU A;  4MFP A;  4XNH B;  3RZA A;  2ZXV A;  2IJZ A;  4CAW A; 
#chains in the Genus database with same CATH homology
 2J8N A;  4CYQ A;  3FNC A;  4F0Y A;  1OZP A;  4KZT A;  1YLE A;  3V8I A;  2B3U A;  2ZPA A;  2FIA A;  2FXF A;  2R1I A;  5AG6 A;  2ZW4 A;  1IYL A;  3TTH A;  3IWG A;  3FYN A;  4KOR A;  4XPD C;  4YRH A;  5F48 A;  3QB8 A;  2WUU A;  1M44 A;  3LOD A;  3S6G A;  4QC6 A;  3TOA A;  4C2X A;  2OH1 A;  2ZW6 A;  1S7N A;  3R9E A;  3FB3 A;  1QSO A;  1P0H A;  3E0K A;  4MJ8 A;  3FBU A;  3W6S A;  4Y49 B;  4NEX A;  2J8R A;  5BWA B;  2Q04 A;  4YFJ A;  5KTD A;  4H6U A;  2CY2 A;  4KVM E;  1CM0 A;  4MFQ A;  2B4B A;  2VBQ A;  4B5P B;  3SXN A;  4XPL A;  2AE6 A;  3DR6 A;  2OZG A;  4KUA A;  4AB7 A;  4A32 A;  2WPX A;  2QIR A;  5F49 A;  4KOX A;  4F6A A;  4UWI A;  4AVA A;  4XPD B;  4H6Z A;  3T90 A;  4C2Y A;  4CRZ B;  5HH1 A;  4C7I A;  3TO9 A;  2C27 A;  1U6M A;  1S5K A;  2Z0Z A;  1YVO A;  4A2Z A;  3TO6 A;  2B5G A;  1KZF A;  3GY9 A;  4QB9 A;  3ZJ0 A;  1Z9U A;  3PZJ A;  3WR7 A;  1B6B A;  4ORF A;  2D4O A;  4RI1 A;  3F5B A;  3I9S A;  2KCW A;  4CGL A;  3EO4 A;  5A27 A;  5A28 A;  1VKC A;  5KTC A;  4U9Z A;  5DWM A;  2PSW A;  4PK2 A;  4A33 A;  4EVY A;  1Q2Y A;  2CNS A;  4NXY A;  4XPK A;  2Y0M A;  1XIX A;  1Q2C A;  1BO4 A;  5AG7 A;  4M3S A;  4HNY B;  2FL4 A;  3D3S A;  4R57 A;  3VWD A;  2HV2 A;  4UCP A;  5F46 A;  5J8F A;  4B13 A;  3B8G A;  3EC4 A;  4BMH A;  4XNH C;  2PR1 A;  2B58 A;  1QSM A;  2BSW A;  1S7K A;  4UFX A;  3GYA A;  2REE A;  2Q44 A;  2VZY A;  5F47 A;  2P6E A;  3D2M A;  2VZZ A;  2HUZ A;  1KUV A;  3TFY A;  4MFK A;  3S6K A;  4U5Y A;  1MJ9 A;  3P2F A;  4CAE A;  4YGO A;  2CNM A;  4B14 A;  5IV0 A;  3K9U A;  2DPT A;  4CAV A;  4HNX B;  1RO5 A;  4AVC A;  4Y49 C;  5CNP A;  4UFV A;  1I1D A;  1S7L A;  4IF5 A;  2FT0 A;  3FXT A;  4B12 A;  4MFZ A;  1Y9K A;  4LX9 A;  5AGE A;  4E0A A;  4CAX A;  3JVN A;  2WSA A;  1QSN A;  2YNC A;  4UA3 A;  4KOS A;  3R96 A;  4M85 A;  2PQ8 A;  2JEV A;  4UWJ A;  4JXQ A;  1Y9W A;  1IID A;  1Z4E A;  1V0C A;  2R98 A;  3N7Z A;  3QAH A;  4A31 A;  5AG4 A;  3S6F A;  4R87 A;  1M4I A;  1NSL A;  2Q4V A;  2FCK A;  5KTA A;  1MK4 A;  2P6G A;  5EBV A;  1Z4R A;  1SQH A;  5ISV A;  4KOT A;  4C68 A;  4KVO E;  4QBJ A;  4OAE A;  5G22 A;  1IIC A;  2ATR A;  3R9G A;  3CXQ A;  2ZW5 A;  3FIX A;  5FVJ A;  4UCM A;  4AG9 A;  5EC4 A;  3G3S A;  4H89 A;  1MJB A;  1QSR A;  1ZO0 A;  2D4P A;  2QEC A;  4L89 A;  4KUB A;  4U9Y A;  2B4D B;  3H4Q A;  2PR8 A;  4CGO A;  4CGM A;  4B11 A;  2GE3 A;  4AVB A;  4B5O A;  1LRZ A;  1YRE A;  5JPH A;  4KLW A;  2R7H A;  4FD4 A;  1MJA A;  4JLY A;  2YNE A;  4JJX A;  4UFW A;  3TE4 A;  2QML A;  2H5M A;  2GIV A;  1CJW A;  4ONU A;  1BOB A;  2I79 A;  3JUW A;  1M4G A;  1S60 A;  2DXQ A;  2P0W A;  5E96 A;  4A30 A;  2BUE A;  4KLV A;  4MY0 A;  2OB0 A;  3R95 A;  4UBR A;  4OAD A;  2VEZ A;  2Z3L A;  3F8K A;  3T9Y A;  2Z11 A;  2DPS A;  1I21 A;  3R9F A;  4CYO A;  4ZBG A;  2FS5 A;  2IL4 A;  1KUX A;  5IX3 A;  2Z3K A;  3KKW A;  4JXR A;  1M1D A;  4OLL A;  2BL1 A;  3LD2 A;  3IGR A;  5H86 A;  1P4N A;  3A9L A;  4B5P A;  4NSQ A;  4KSF A;  4MFJ A;  1ON0 A;  1XE4 A;  4Q38 A;  4CS0 B;  2NMT A;  1KUY A;  4CYP A;  5C82 A;  3H5Z A;  3F0A A;  2WPW A;  2B3V A;  2OU2 A;  5J8C A;  4E8O A;  4MY3 A;  4QVT A;  4NF1 A;  2G0B A;  1N71 A;  1RXT A;  2JDC A;  2K5T A;  2ZW7 A;  3GKR A;  2B5G B;  3BLN A;  2VXK A;  4II9 A;  4L8A A;  4X5K A;  4KOU A;  2HQY A;  4PK3 A;  4KOW A;  2Q7B A;  3R1K A;  4CYN A;  2J8M A;  4AG7 A;  5AG5 A;  4JWP A;  1PUA A;  3BJ7 A;  4NCZ A;  1IB1 E;  4KSA A;  5JQ4 A;  2EUI A;  2Q4Y A;  4RS2 A;  3FRM A;  3OWC A;  4FD6 A;  3TOB A;  4DNC A;  2CXA A;  5G1Z A;  2YND A;  4MI4 A;  3JTK A;  2BEI A;  2O28 A;  3D2P A;  2R8V A;  2FIW A;  2Z3M A;  2JDD A;  1XF8 A;  4J3G A;  2X7B A;  3TO7 A;  4KVX A;  4MFL A;  2RC4 A;  2YGW A;  4UCN A;  3DNS A;  5I0C A;  2Z3N A;  2G3A A;  4FD7 A;  2JLM A;  4F0X A;  2YNC C;  3EXN A;  1J4J A;  1YK3 A;  1I12 A;  3IWE A;  3RYO A;  2FE7 A;  2PDO A;  4C7H A;  4C2Z A;  4IUS A;  3EY5 A;  1IYK A;  5DWN A;  4B10 A;  2G3T A;  1WWZ A;  1WK4 A;  4CAF A;  4CRY B;  1QST A;  3TCV A;  1FY7 A;  4BBH A;  1L0C A;  3MGD A;  1YGH A;  4LUA A;  1M4D A;  2Z3P A;  3UY5 A;  4R9M A;  3W91 A;  3CXS A;  1R57 A;  3G8W A;  5C88 A;  1VHS A;  3P2H A;  4K30 A;  3W6X A;  3DR8 A;  4R3L A;  5GCN A;  1Y7R A;  4JD6 A;  2FSR A;  2Q0Y A;  3DDD A;  2EVN A;  5G20 A;  2A4N A;  2AJ6 A;  4MBU A;  3C26 A;  2F5I A;  3SHP A;  2Z10 A;  4Q36 A;  4QUS A;  4E2A A;  4KS9 A;  1B87 A;  1UFH A;  3PP9 A;  4PSX A;  2I00 A;  4HKF A;  2VI7 A;  4R3K A;  5HMN A;  4KOV A;  1NMT A;  3PGP A;  2CNT A;  1PU9 A;  1XEB A;  2GAN A;  1NE9 A;  1Q2D A;  1YVK A;  4MHD A;  3TT2 A;  4GS4 A;  1YR0 A;  3I3G A;  3EFA A;  3IU2 A;  4PV6 A;  2VQY A;  4PSW A;  3ZZI A;  2OZU A;  2B4D A;  4ZGY B;  3BJ8 A;  3IU1 A;  1K4J A;  3NE7 A;  4I49 A;  5IB0 A;  4FD5 A;  3D8P A;  3DSB A;  1TIQ A;  2PC1 A;  4A95 A;  4HNW B;  1YX0 A;  2ARH A;  3CXP A;  4CGN A;  2Z3O A;  1GHE A;  1S3Z A;  1S7F A;  5H84 A;  3VWE A;  4CGP A;  2REF A;  2P6F A;  3S6H A;  4KOY A;  1XMT A;  2OZH A;  2PRB A;  3SXO A;  5G21 A;  4MFP A;  4XNH B;  2ZXV A;  4CAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...