4ZBGA

Crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
166
structure length
154
Chain Sequence
HHHMHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGHIAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGYYRRFGFKAYFQCLAFGPDMPQGDVAYHAAFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title Crystal Structure of a GNAT family Acetyltransferase from Brucella melitensis in complex with Acetyl-CoA
rcsb
source organism Brucella abortus str. 2308 a
molecule tags Transferase
total genus 43
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zbgA00
4K30A 1VKCA 2B3VA 2J8NA 3R9EA 2DXQA 2PDOA 3C26A 4QVTA 3JUWA 4XPLA 4XPKA 3TE4A 1S5KA 2REFA 3DR8A 1WWZA 2G0BA 2ZW7A 2A4NA 3I9SA 1M4GA 3D8PA 2IL4A 2VBQA 1NSLA 3SXNA 3FRMA 4MI4A 3TFYA 1YLEA 3S6HA 4U5YA 3V8IA 1MK4A 4DNCA 4MY3A 3RYOA 5I0CA 4RI1A 1S7LA 1LRZA 3EO4A 5KTDA 1VHSA 3R1KA 5IB0A 2REEA 2CNMA 2CY2A 4UWIA 1KUXA 5HH1A 4FD7A 2B58A 2B4DA 2FSRA 2KCWA 2PC1A 3TCVA 2Q0YA 3BJ7A 1CM0A 4QC6A 3PGPA 2OU2A 4KVME 1PUAA 1YREA 3W6SA 4JXQA 5EC4A 1Y9WA 3PZJA 2I00A 2OZHA 2VZZA 3G3SA 3FXTA 1NMTA 4E2AA 2BL1A 4KOSA 3H4QA 3EY5A 4XNHC 4YGOA 3QB8A 3SHPA 2J8RA 1J4JA 2NMTA 1L0CA 5C88A 2B5GB 3GKRA 3TOAA 1GHEA 2FT0A 2VI7A 4HKFA 3CXPA 1YX0A 2ZW5A 5KTCA 1Z9UA 2Q4VA 1V0CA 1CJWA 1Z4EA 3BLNA 3I3GA 3TO9A 4KZTA 3SXOA 2FE7A 5HMNA 4J3GA 4B5PB 2OH1A 2WPWA 2F5IA 4KOWA 5F48A 1IICA 4QBJA 4NEXA 3F0AA 3UY5A 5H84A 4AG9A 2FCKA 1UFHA 2OB0A 2ATRA 3B8GA 5F49A 3W91A 2FIWA 4EVYA 1KUYA 2J8MA 4PSXA 2HUZA 2Q7BA 4H6UA 2HV2A 4HNYB 2GANA 4PV6A 4U9ZA 1U6MA 2Z10A 1RXTA 4R9MA 2D4PA 2Z11A 4NSQA 2O28A 4KOUA 4KORA 3TO6A 4F6AA 1BOBA 4LUAA 3D2PA 4CAVA 4MBUA 1IYKA 4F0YA 1YGHA 4B5PA 1MJBA 1XEBA 2X7BA 3VWEA 4I49A 2ZW6A 1XE4A 2HQYA 1IB1E 4MHDA 5H86A 2P6EA 2G3AA 4AG7A 3DSBA 4M85A 1I12A 1KZFA 1NE9A 4ZBGA 4GS4A 4AVAA 3R9FA 1OZPA 4UWJA 2AE6A 4MJ8A 4KUAA 5F47A 2Z0ZA 4CRYB 4JXRA 3P2HA 3N7ZA 1YVOA 3TOBA 5GCNA 5E96A 2PR1A 3MGDA 3ZZIA 3F8KA 2VEZA 3NE7A 4E0AA 2PR8A 4R87A 1XIXA 3R95A 4JJXA 5C82A 1QSMA 2ZPAA 1S7NA 3K9UA 3WR7A 2FS5A 4X5KA 2R7HA 4M3SA 3LODA 3BJ8A 4KVXA 2AJ6A 2FL4A 3EXNA 3QAHA 1YK3A 3TT2A 3FNCA 2D4OA 2Q04A 1S7FA 4PSWA 3DDDA 2Q4YA 4KVOE 1N71A 2BSWA 4KLVA 2BUEA 3S6KA 4QB9A 1R57A 2RC4A 1B87A 1S3ZA 1QSNA 3DNSA 2VQYA 5CNPA 2P6FA 2PQ8A 4QUSA 2JEVA 4UA3A 4II9A 1M1DA 2JLMA 3FBUA 4ORFA 4RS2A 1K4JA 2R8VA 5FVJA 2P6GA 3F5BA 4OLLA 1YR0A 3T9YA 4PK2A 2FXFA 5J8FA 1QSTA 4JLYA 1S60A 2H5MA 3KKWA 3FIXA 1MJAA 4ONUA 4Y49B 4CAWA 4NF1A 3S6GA 2GIVA 4IF5A 2CNSA 4KOYA 4KLWA 4XPDC 2CNTA 4LX9A 4HNXB 2EUIA 1I21A 2I79A 2ZW4A 2WPXA 3E0KA 2JDDA 4NXYA 3ZJ0A 1QSRA 3P2FA 1Q2CA 2GE3A 1I1DA 1S7KA 4HNWB 1YVKA 4CS0B 3CXQA 4FD5A 5IX3A 5EBVA 4FD4A 3FB3A 4KOTA 1RO5A 2OZUA 3CXSA 3JVNA 3D2MA 4KOVA 2QECA 5DWNA 1M4DA 4IUSA 5KTAA 2B3UA 4XPDB 1MJ9A 5DWMA 1Y7RA 1M4IA 3S6FA 1KUVA 2Y0MA 3FYNA 2QIRA 2JDCA 2PSWA 3EC4A 1PU9A 1B6BA 1IYLA 4R3LA 4KUBA 2C27A 4BMHA 5F46A 1TIQA 3D3SA 4Y49C 2ZXVA 3IWGA 2VZYA 2PRBA 3EFAA 3GY9A 4R3KA 3TO7A 1P4NA 2P0WA 1Z4RA 4CRZB 2OZGA 3DR6A 1M44A 3LD2A 1SQHA 1WK4A 2FIAA 1Q2DA 4OADA 2R1IA 4AVCA 3T90A 5J8CA 5ISVA 1XMTA 4CAXA 3TTHA 3R9GA 4AB7A 2R98A 3G8WA 4R57A 4U9YA 5JQ4A 4H89A 4L8AA 2G3TA 1P0HA 4JD6A 4KOXA 3VWDA 1FY7A 4UBRA 5IV0A 1Q2YA 2B4BA 4AVBA 4H6ZA 4B5OA 5JPHA 1Y9KA 2ARHA 4E8OA 2QMLA 2VXKA 4JWPA 3OWCA 4XNHB 3IGRA 1IIDA 3PP9A 2K5TA 1XF8A 4FD6A 2EVNA 3GYAA 4MY0A 2BEIA 2B5GA 4NCZA 4PK3A 3R96A 1QSOA 1BO4A 4L89A 4YFJA 3W6XA 2B4DB 1ON0A 4YRHA 4OAEA 2Q44A
chains in the Genus database with same CATH superfamily
4K30A 5AG7A 4OC2A 4AXVA 3KASA 4A95A 1VKCA 2B3VA 2J8NA 3IC1A 3R9EA 2DXQA 1HDUA 2PDOA 3C26A 4QVTA 3JUWA 4XPLA 1LOKA 1TF9A 2BCOA 4XPKA 2PJ7A 3TE4A 1S5KA 2REFA 3DR8A 4EMEA 1PYTB 2PCUA 4A30A 3SJGA 1WWZA 2G0BA 4UIBA 2ZW7A 1DE4C 3FEDA 2A4NA 3I9SA 1M4GA 3D8PA 2IL4A 1ZG8A 3N5FA 4UCMA 2VBQA 1YQEA 3FECA 4OC0A 3FJUA 1NSLA 4GXHA 3FRMA 4MFLA 4MI4A 1YLEA 5G20A 3SXNA 3TFYA 3S6HA 4G1PA 4C2XA 4U5YA 3FEEA 2DPSA 3V8IA 1MK4A 3CZXA 4DNCA 3BHXA 4EWTA 5LYDA 1QMUA 4MY3A 3RYOA 5I0CA 4RI1A 1S7LA 3KHZA 1LRZA 3EO4A 1OBRA 2ZEPA 5KTDA 2HC9A 1VHSA 2PRQA 3R1KA 1XOVA 2REEA 3V7ZA 5IB9A 2PJCA 5IB0A 2CNMA 2CY2A 2OR4A 3B35A 4UWIA 4X2TA 1KUXA 5HH1A 1Y0YA 4FD7A 2B58A 3H5ZA 2B4DA 1CX8A 2FSRA 2KCWA 3PEIA 2PC1A 3TCVA 1Z8XA 2Q0YA 1CM0A 3BJ7A 4QC6A 3PGPA 4B13A 2OU2A 4MCRA 5K8OA 4KVME 3KL9A 3RBUA 1PUAA 1YREA 3W6SA 3S9MA 4CGOA 3LACA 5AG5A 1CBXA 4JXQA 5EC4A 4O23A 1Y9WA 3PZJA 2I00A 4F9UA 2PJ4A 2OZHA 2VZZA 3G3SA 4FAIA 3RAMA 4K3NA 4R7MA 3FXTA 4MFKA 3D66A 2NYQA 1NMTA 4CGMA 4E2AA 2BL1A 1QQ9A 4KOSA 2PIYA 3H4QA 3EY5A 1LANA 2ABZA 2ZEOA 3SJEA 3D7GA 4XNHC 4P4FA 4YGOA 3NH4A 2PE3A 3QB8A 5G1ZA 4MHNA 5JH9A 2PVVA 3SHPA 4R8FA 2J8RA 1J4JA 4CPAA 2Z3NA 2NMTA 1L0CA 4RUHA 3LWUA 5C88A 2B5GB 3GKRA 3HUVA 4CAFA 3TOAA 1GYTA 1GHEA 1FT7A 3L2NA 4C2ZA 2FT0A 4KS9A 2VI7A 4HKFA 3CXPA 1XFOA 2EWBA 1YX0A 2ZW5A 5KTCA 3D67A 1Z8WA 2V8VA 3D68A 2WSAA 1KWMA 1Z9UA 4A31A 4CGNA 2Q4VA 1ZO0A 4KSAA 1V0CA 3NH5A 4ZX8A 4YWYA 3PB7X 5CBMA 4OP4A 1CJWA 1Z4EA 3GB0A 3BLNA 1Z8LA 2IJZA 3I3GA 4MCSA 4FUUA 4MCQA 1HDQA 3TO9A 4CYQA 4KZTA 2FVGA 4OC1A 4A33A 3SXOA 2FE7A 4OKOA 5HMNA 2PJ8A 1YSJA 3D7DA 4NFRA 4J3GA 4B5PB 2OH1A 2WPWA 3H8GA 2F5IA 4KOWA 2C6GA 4M6HA 5F48A 5LYFA 1HEEA 1IICA 4ZY2A 4NJRA 4QBJA 2Q51A 4NEXA 3F0AA 3UY5A 5H84A 1ARLA 4CYNA 4AG9A 2FCKA 1UFHA 1ZLIA 2ATRA 2OB0A 1M4LA 2V8GA 3B8GA 3IO1A 1FNOA 5F49A 4ZYQA 3W91A 2FIWA 1TF8A 2CTCA 3BI1A 1KUYA 1Y7EA 4EVYA 2J8MA 2PJ1A 2HUZA 4P6YA 4PSXA 4PQAA 4CGLA 3FMCA 2Q7BA 4H6UA 2AFXA 2XEGA 1BLLE 2EO8A 1F2OA 4PXCA 4A39A 2HV2A 1Z5RA 4TNUA 4R76A 1Z2LA 4B6ZA 4CYPA 3SI2A 4HNYB 2GANA 4DJLA 2RB7A 4PV6A 4U9ZA 1U6MA 2Z10A 3IWEA 1RXTA 4R9MA 4MFZA 4X8IA 1RTQA 4P44A 2YGWA 1ARMA 4PXEA 2D4PA 2Z11A 1XBUA 4NSQA 4NGPA 2EK8A 2O28A 2Q43A 4KOUA 1CG2A 4KORA 4C7HA 3MRUA 3SJFA 5THWA 3TO6A 4NGNA 1BOBA 2AFMA 4LUAA 3D2PA 2DF5A 4F6AA 4CAVA 4MBUA 1IYKA 4PXDA 4F0YA 5HVGA 1YGHA 3K9TA 4OC4A 4B5PA 7CPAA 3PRTA 4Q36A 2YNEA 2ZEGA 3GIUA 1MJBA 4MHYA 2I3CA 2QJ8A 1XEBA 2X7BA 3VWEA 2QYVA 2C6CA 4I49A 1R3NA 3LMSA 4OMEA 4TWEA 2ZW6A 1JQGA 1XE4A 2HQYA 4EFDA 1IB1E 2Z3KA 4MHDA 4CGPA 3GLJA 5H86A 2WUUA 2P6EA 4P10A 2G3AA 4ZY1A 4AG7A 3DSBA 1F2PA 3RNZA 1X12A 4M85A 1I12A 1KZFA 2ZOGA 1NE9A 4X3RA 4B14A 2CIJA 4ZBGA 4A37A 1ELLP 2IMOA 2PIZA 4KSFA 4MFJA 4MFQA 4GS4A 4AVAA 2ODFA 1OZPA 4UWJA 5AG6A 3R9FA 2AE6A 4MJ8A 3KR4A 1AUGA 4MFPA 3PFOA 4KUAA 5F47A 5JGFA 4UFWA 2Z0ZA 4CRYB 4JXRA 2ZEHA 3P2HA 4P4EA 3N7ZA 1YVOA 3TOBA 5GCNA 2F7VA 5E96A 2PR1A 4FBEA 4C68A 4BBHA 5HVHA 3K2KA 3MGDA 3IIBA 3ZZIA 3IFEA 3F8KA 2VEZA 3NE7A 4E0AA 5LYIA 2PR8A 2POKA 5ELYA 1YW4A 1VHEA 4R87A 1XIXA 3R95A 4JJXA 5C82A 1QSMA 2ZPAA 1S7NA 3K9UA 3WR7A 2FS5A 4X5KA 5D29A 2R7HA 4M3SA 5BWAB 2XEJA 3LODA 1ZG7A 3BJ8A 4KVXA 2AJ6A 3DGVA 2FL4A 2V8HA 5G22A 2YNDA 3EXNA 3QAHA 1YK3A 2AFSA 3TT2A 4OC3A 3FNCA 2D4OA 1BAVA 2Q04A 2WZNA 2JEWA 4MXUA 4UCNA 3B2YA 2QVPA 2C1CA 3PB4X 1IU8A 1S7FA 1DTDA 1TKHA 4PSWA 3DDDA 2AFUA 4W9YA 4WJBA 4P4IA 2Q4YA 4ZGYB 4MRIA 5LRKA 1XJOA 4KVOE 1N71A 2BSWA 4KLVA 2BUEA 3BI0A 3S6KA 4QB9A 3IU1A 4UEFA 2XEFA 3KR5A 1Q7LA 1R57A 2RC4A 2Z3PA 4A2ZA 1B87A 1NSAA 2CF4A 2C6PA 1S3ZA 5K8PA 1YMEA 1QSNA 4UIAA 3DNSA 2VQYA 5CNPA 4YU9A 2P6FA 2OOTA 3B3WA 2PQ8A 3CPAA 2JEVA 4QUSA 5EMIA 4UA3A 3PFEA 3SI1A 4II9A 1M1DA 2JLMA 3FBUA 3I1UA 4ORFA 1K4JA 2R8VA 3FH4A 4RS2A 3KQXA 5FVJA 2P6GA 3F5BA 4ONWA 4NGQA 1VHOA 3D7HA 3KZWA 3FX6A 4OLLA 1YR0A 3T9YA 3JTKA 3H8EA 3IU2A 4PK2A 2FXFA 5J8FA 2GREA 1QSTA 4JLYA 3T8WA 2JBKA 1S60A 2H5MA 3KKWA 3FIXA 4JYWA 3WC7A 5K8MA 1Z8TA 5HVFA 2O4HA 5CPAA 4F0XA 4MMOA 4LQ6A 4H2KA 3NFZA 1UWYA 4ZI6A 1MJAA 4ONUA 4F8ZA 1BPNA 2CXAA 4Y49B 2PJ0A 3IEHA 2F8HA 6CPAA 1LFWA 4CAWA 4NF1A 3S6GA 2GIVA 4IF5A 3VATA 2CNSA 2PJ5A 2ANPA 4KOYA 3NE8A 4KLWA 4XPDC 2CNTA 4LX9A 2IQ6A 2PJBA 4OIDA 4HNXB 2EUIA 4NGTA 3WC6A 1I21A 2I79A 2PVWA 2ZW4A 1CP6A 2NSMA 2WPXA 3FF3A 3E0KA 2JDDA 2Q7SA 4BINA 1XRYA 4NXYA 1IOIA 3ISXA 3ZJ0A 1QSRA 3P2FA 1TKJA 1Q2CA 2GE3A 1CPXA 1I1DA 1S7KA 2J9AA 4HNWB 5I4MA 2PJ6A 3PB8X 4JZ0A 1YVKA 4BD9A 4CS0B 4RN7A 4Z65A 8CPAA 4IHMA 4MCPA 3DLJA 3GUXA 2GU2A 3CXQA 4FD5A 2Z3MA 2PJ3A 5IX3A 4M6IA 4P4DA 4MHZA 2DEAA 5EBVA 1LAMA 3HLPA 2GLJA 4FD4A 1VGYA 3FB3A 1H8LA 3KQZA 4CYOA 4KOTA 1RO5A 2OZUA 2V77A 3CXSA 4R6TA 3VH9A 1Y0RA 2AFOA 3JVNA 2QECA 3D2MA 3IWWA 4KOVA 5DWNA 4F9VA 1M4DA 4IUSA 4UEEA 4UF4A 2VL1A 3CDXA 3MN8A 5KTAA 3VARA 1PCAA 2B3UA 3BXMA 1MJ9A 4XPDB 4B11A 4Q7AA 1TXRA 5DWMA 4GM5A 1A2ZA 1Y7RA 3CT9A 1M4IA 2Q4ZA 3A9LA 4KSIA 3S6FA 1BPMA 5D8NA 4DYOA 3PBEA 1KUVA 3PB9X 1LAPA 2Y0MA 3FYNA 4OIWA 2QIRA 2JDCA 2PSWA 3B3VA 5LYLA 3EC4A 2XEIA 4ZX9A 4P45A 1PU9A 4B10A 4A94A 4C7IA 4B12A 1B6BA 1IYLA 3WABA 2BOAA 2Z3OA 3FVLA 1JWQA 4Q38A 5HXDA 2YNCA 3B3SA 1IY7A 3KGQA 3RO0A 4R3LA 4KUBA 4UFVA 1AYEA 4PXBA 2C27A 4BMHA 4WWVA 3JRUA 5F46A 4ZY0A 1TIQA 4UFXA 2V8DA 4IK2A 4PPZA 3D3SA 4Y49C 2ZXVA 3IWGA 4UEZA 2VZYA 1VIXA 4UCPA 2PRBA 3EFAA 5K8NA 4P4JA 3D7FA 3GY9A 4R3KA 3PB6X 3TO7A 2GLFA 1P4NA 5A28A 2P0WA 3PBBA 1Z4RA 2WYRA 2ZEDA 3H8FA 4CRZB 2OZGA 3DR6A 1M44A 3LD2A 1SQHA 1WK4A 2FIAA 1Q2DA 4OADA 2R1IA 3B7IA 4FWUA 2ZEMA 4AVCA 2PJAA 3T90A 5J8CA 2GFQA 5ISVA 1LCPA 1XMBA 1XMTA 4CAXA 2ZEFA 1ZLHA 1TKFA 2AFZA 3TTHA 5LRGA 5J1QA 3R9GA 5JM6A 4AB7A 4LQGA 5LRJA 2R98A 3G8WA 4R57A 2CTBA 2ZOFA 4H89A 4U9YA 5JQ4A 4L8AA 2PJ9A 3CPXA 2JBJA 2G3TA 5G21A 3D4UA 1EE3P 1IGBA 2DPTA 3B3TA 1P0HA 4IAVA 4OC5A 3V38A 4JD6A 1X10A 2O53A 4KOXA 1FY7A 2BO9A 4UBRA 3VWDA 5IV0A 2YNCC 1Q2YA 2B4BA 3NA6A 4NGMA 3RZAA 3SI0A 4A32A 3KHXA 3QAYA 4AVBA 3NH8A 4H6ZA 1ZG9A 2EK9A 5DS0A 4B5OA 5JPHA 1Y9KA 2ARHA 4E8OA 2QMLA 2Z3LA 2AFWA 2VXKA 4NGRA 4JWPA 1R43A 3B3CA 3OWCA 4NJQA 4XNHB 3IGRA 1IIDA 3PP9A 2RFHA 4NGSA 2K5TA 4CAEA 5F09A 2EBJA 2ZENA 4C2YA 1XF8A 1IOFA 4FD6A 5A27A 1YLOA 3QNVA 2EVNA 3GYAA 1CP7A 3TX8A 4A38A 3IJ3A 3ISZA 4MY0A 1YW6A 2PJ2A 2BEIA 2B5GA 4NCZA 4MHPA 1CPSA 3KI9A 4PK3A 2ZEEA 1ELMP 3R96A 3TC8A 1QSOA 1BO4A 2G9DA 4L89A 2HB6A 3SJXA 4YFJA 4M6GA 1F57A 2ZELA 4DUKA 3W6XA 2B4DB 3WC5A 3S9NA 1AMPA 1ON0A 4HPSA 3WT4A 3S9LA 5AGEA 4OAEA 4YRHA 2Q44A 4P4BA 5AG4A
chains in the Genus database with same CATH topology
4K30A 5AG7A 4A95A 1VKCA 2B3VA 2J8NA 3R9EA 2DXQA 2PDOA 3C26A 4QVTA 3JUWA 4XPLA 4XPKA 3TE4A 1S5KA 2REFA 3DR8A 4A30A 1WWZA 2G0BA 2ZW7A 2A4NA 3I9SA 1M4GA 3D8PA 2IL4A 4UCMA 2VBQA 1NSLA 3SXNA 4MFLA 3FRMA 4MI4A 5G20A 1YLEA 3TFYA 3S6HA 4C2XA 4U5YA 2DPSA 3V8IA 1MK4A 4DNCA 4MY3A 3RYOA 5I0CA 4RI1A 1S7LA 1LRZA 3EO4A 5KTDA 1VHSA 3R1KA 5IB0A 2REEA 2CNMA 2CY2A 4UWIA 1KUXA 5HH1A 4FD7A 2B58A 3H5ZA 2B4DA 2FSRA 2KCWA 2PC1A 3TCVA 2Q0YA 3BJ7A 1CM0A 4QC6A 3PGPA 4B13A 2OU2A 4KVME 1PUAA 1YREA 3W6SA 4CGOA 5AG5A 4JXQA 5EC4A 1Y9WA 3PZJA 2I00A 2OZHA 2VZZA 3G3SA 3FXTA 4MFKA 1NMTA 4E2AA 2BL1A 4KOSA 3H4QA 3EY5A 4XNHC 4YGOA 3QB8A 5G1ZA 3SHPA 2J8RA 1J4JA 2Z3NA 2NMTA 1L0CA 5C88A 2B5GB 3GKRA 4CAFA 3TOAA 1GHEA 4C2ZA 2FT0A 4KS9A 2VI7A 4HKFA 3CXPA 1YX0A 2ZW5A 5KTCA 2WSAA 1Z9UA 4A31A 4CGNA 2Q4VA 1ZO0A 4KSAA 1V0CA 1CJWA 1Z4EA 3BLNA 3I3GA 4CYQA 3TO9A 4KZTA 4A33A 3SXOA 2FE7A 5HMNA 4J3GA 4B5PB 2OH1A 2WPWA 2F5IA 4KOWA 5F48A 1IICA 4QBJA 4NEXA 3F0AA 3UY5A 5H84A 4CYNA 4AG9A 2FCKA 1UFHA 2OB0A 2ATRA 3B8GA 5F49A 3W91A 2FIWA 4EVYA 1KUYA 2J8MA 4PSXA 2HUZA 4CGLA 2Q7BA 4H6UA 2HV2A 4CYPA 4HNYB 2GANA 4PV6A 4U9ZA 3IWEA 1U6MA 2Z10A 1RXTA 4R9MA 4MFZA 2YGWA 2D4PA 2Z11A 4NSQA 2O28A 4KOUA 4KORA 4C7HA 3TO6A 4F6AA 1BOBA 4LUAA 3D2PA 4CAVA 4MBUA 1IYKA 4F0YA 1YGHA 4B5PA 4Q36A 2YNEA 1MJBA 1XEBA 2X7BA 3VWEA 4I49A 2ZW6A 1XE4A 2HQYA 1IB1E 2Z3KA 4MHDA 4CGPA 5H86A 2WUUA 2P6EA 2G3AA 4AG7A 3DSBA 4M85A 1I12A 1KZFA 1NE9A 4B14A 4ZBGA 4KSFA 4MFJA 4MFQA 4GS4A 4AVAA 5AG6A 1OZPA 4UWJA 3R9FA 2AE6A 4MJ8A 4MFPA 4KUAA 5F47A 4UFWA 2Z0ZA 4CRYB 4JXRA 3P2HA 3N7ZA 1YVOA 3TOBA 5GCNA 5E96A 2PR1A 4C68A 4BBHA 3MGDA 3ZZIA 3F8KA 2VEZA 3NE7A 4E0AA 2PR8A 4R87A 1XIXA 3R95A 4JJXA 5C82A 1QSMA 2ZPAA 1S7NA 3K9UA 3WR7A 2FS5A 4X5KA 2R7HA 4M3SA 5BWAB 3LODA 3BJ8A 4KVXA 2AJ6A 2FL4A 5G22A 2YNDA 3EXNA 3QAHA 1YK3A 3TT2A 3FNCA 2D4OA 2Q04A 4UCNA 1S7FA 4PSWA 3DDDA 2Q4YA 4ZGYB 4KVOE 1N71A 2BSWA 4KLVA 2BUEA 3S6KA 4QB9A 3IU1A 1R57A 2RC4A 2Z3PA 4A2ZA 1B87A 1S3ZA 1QSNA 3DNSA 2VQYA 5CNPA 2P6FA 2PQ8A 4QUSA 2JEVA 4UA3A 4II9A 1M1DA 2JLMA 3FBUA 4ORFA 4RS2A 1K4JA 2R8VA 5FVJA 2P6GA 3F5BA 4OLLA 1YR0A 3T9YA 3JTKA 3IU2A 4PK2A 2FXFA 5J8FA 1QSTA 4JLYA 1S60A 2H5MA 3KKWA 3FIXA 4F0XA 1MJAA 4ONUA 2CXAA 4Y49B 4CAWA 4NF1A 3S6GA 2GIVA 4IF5A 2CNSA 4KOYA 4KLWA 4XPDC 2CNTA 4LX9A 4HNXB 2EUIA 1I21A 2I79A 2ZW4A 2WPXA 3E0KA 2JDDA 4NXYA 3ZJ0A 1QSRA 3P2FA 1Q2CA 2GE3A 1I1DA 1S7KA 4HNWB 1YVKA 4CS0B 3CXQA 4FD5A 2Z3MA 5IX3A 5EBVA 4FD4A 3FB3A 4CYOA 4KOTA 1RO5A 2OZUA 3CXSA 3JVNA 3D2MA 2QECA 4KOVA 5DWNA 1M4DA 4IUSA 5KTAA 2B3UA 4XPDB 1MJ9A 4B11A 5DWMA 1Y7RA 1M4IA 3A9LA 3S6FA 1KUVA 2Y0MA 3FYNA 2QIRA 2JDCA 2PSWA 3EC4A 1PU9A 4B10A 4C7IA 4B12A 1B6BA 1IYLA 2Z3OA 4Q38A 2YNCA 4R3LA 4KUBA 4UFVA 2C27A 4BMHA 5F46A 1TIQA 4UFXA 3D3SA 4Y49C 2ZXVA 3IWGA 2VZYA 4UCPA 2PRBA 3EFAA 3GY9A 4R3KA 3TO7A 1P4NA 5A28A 2P0WA 1Z4RA 4CRZB 3LD2A 2OZGA 1M44A 3DR6A 1SQHA 1WK4A 2FIAA 1Q2DA 4OADA 2R1IA 4AVCA 3T90A 5J8CA 5ISVA 1XMTA 4CAXA 3TTHA 3R9GA 4AB7A 2R98A 3G8WA 4R57A 4U9YA 5JQ4A 4H89A 4L8AA 2G3TA 5G21A 4CGMA 2DPTA 1P0HA 4JD6A 4KOXA 3VWDA 1FY7A 4UBRA 5IV0A 2YNCC 1Q2YA 2B4BA 4A32A 4AVBA 4H6ZA 4B5OA 5JPHA 1Y9KA 2ARHA 4E8OA 2QMLA 2Z3LA 2VXKA 4JWPA 3OWCA 4XNHB 3IGRA 1IIDA 3PP9A 4CAEA 2K5TA 4C2YA 1XF8A 4FD6A 5A27A 2EVNA 3GYAA 4MY0A 2BEIA 2B5GA 4NCZA 4PK3A 3R96A 1QSOA 1BO4A 4L89A 4YFJA 3W6XA 2B4DB 1ON0A 5AGEA 4OAEA 4YRHA 2Q44A 5AG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K30 A;  1VKC A;  2B3V A;  2J8N A;  3R9E A;  2DXQ A;  2PDO A;  3C26 A;  4QVT A;  3JUW A;  4XPL A;  4XPK A;  3TE4 A;  1S5K A;  2REF A;  3DR8 A;  1WWZ A;  2G0B A;  2ZW7 A;  2A4N A;  3I9S A;  1M4G A;  3D8P A;  2IL4 A;  2VBQ A;  1NSL A;  3SXN A;  3FRM A;  4MI4 A;  3TFY A;  1YLE A;  3S6H A;  4U5Y A;  3V8I A;  1MK4 A;  4DNC A;  4MY3 A;  3RYO A;  5I0C A;  4RI1 A;  1S7L A;  1LRZ A;  3EO4 A;  5KTD A;  1VHS A;  3R1K A;  5IB0 A;  2REE A;  2CNM A;  2CY2 A;  4UWI A;  1KUX A;  5HH1 A;  4FD7 A;  2B58 A;  2B4D A;  2FSR A;  2KCW A;  2PC1 A;  3TCV A;  2Q0Y A;  3BJ7 A;  1CM0 A;  4QC6 A;  3PGP A;  2OU2 A;  4KVM E;  1PUA A;  1YRE A;  3W6S A;  4JXQ A;  5EC4 A;  1Y9W A;  3PZJ A;  2I00 A;  2OZH A;  2VZZ A;  3G3S A;  3FXT A;  1NMT A;  4E2A A;  2BL1 A;  4KOS A;  3H4Q A;  3EY5 A;  4XNH C;  4YGO A;  3QB8 A;  3SHP A;  2J8R A;  1J4J A;  2NMT A;  1L0C A;  5C88 A;  2B5G B;  3GKR A;  3TOA A;  1GHE A;  2FT0 A;  2VI7 A;  4HKF A;  3CXP A;  1YX0 A;  2ZW5 A;  5KTC A;  1Z9U A;  2Q4V A;  1V0C A;  1CJW A;  1Z4E A;  3BLN A;  3I3G A;  3TO9 A;  4KZT A;  3SXO A;  2FE7 A;  5HMN A;  4J3G A;  4B5P B;  2OH1 A;  2WPW A;  2F5I A;  4KOW A;  5F48 A;  1IIC A;  4QBJ A;  4NEX A;  3F0A A;  3UY5 A;  5H84 A;  4AG9 A;  2FCK A;  1UFH A;  2OB0 A;  2ATR A;  3B8G A;  5F49 A;  3W91 A;  2FIW A;  4EVY A;  1KUY A;  2J8M A;  4PSX A;  2HUZ A;  2Q7B A;  4H6U A;  2HV2 A;  4HNY B;  2GAN A;  4PV6 A;  4U9Z A;  1U6M A;  2Z10 A;  1RXT A;  4R9M A;  2D4P A;  2Z11 A;  4NSQ A;  2O28 A;  4KOU A;  4KOR A;  3TO6 A;  4F6A A;  1BOB A;  4LUA A;  3D2P A;  4CAV A;  4MBU A;  1IYK A;  4F0Y A;  1YGH A;  4B5P A;  1MJB A;  1XEB A;  2X7B A;  3VWE A;  4I49 A;  2ZW6 A;  1XE4 A;  2HQY A;  1IB1 E;  4MHD A;  5H86 A;  2P6E A;  2G3A A;  4AG7 A;  3DSB A;  4M85 A;  1I12 A;  1KZF A;  1NE9 A;  4ZBG A;  4GS4 A;  4AVA A;  3R9F A;  1OZP A;  4UWJ A;  2AE6 A;  4MJ8 A;  4KUA A;  5F47 A;  2Z0Z A;  4CRY B;  4JXR A;  3P2H A;  3N7Z A;  1YVO A;  3TOB A;  5GCN A;  5E96 A;  2PR1 A;  3MGD A;  3ZZI A;  3F8K A;  2VEZ A;  3NE7 A;  4E0A A;  2PR8 A;  4R87 A;  1XIX A;  3R95 A;  4JJX A;  5C82 A;  1QSM A;  2ZPA A;  1S7N A;  3K9U A;  3WR7 A;  2FS5 A;  4X5K A;  2R7H A;  4M3S A;  3LOD A;  3BJ8 A;  4KVX A;  2AJ6 A;  2FL4 A;  3EXN A;  3QAH A;  1YK3 A;  3TT2 A;  3FNC A;  2D4O A;  2Q04 A;  1S7F A;  4PSW A;  3DDD A;  2Q4Y A;  4KVO E;  1N71 A;  2BSW A;  4KLV A;  2BUE A;  3S6K A;  4QB9 A;  1R57 A;  2RC4 A;  1B87 A;  1S3Z A;  1QSN A;  3DNS A;  2VQY A;  5CNP A;  2P6F A;  2PQ8 A;  4QUS A;  2JEV A;  4UA3 A;  4II9 A;  1M1D A;  2JLM A;  3FBU A;  4ORF A;  4RS2 A;  1K4J A;  2R8V A;  5FVJ A;  2P6G A;  3F5B A;  4OLL A;  1YR0 A;  3T9Y A;  4PK2 A;  2FXF A;  5J8F A;  1QST A;  4JLY A;  1S60 A;  2H5M A;  3KKW A;  3FIX A;  1MJA A;  4ONU A;  4Y49 B;  4CAW A;  4NF1 A;  3S6G A;  2GIV A;  4IF5 A;  2CNS A;  4KOY A;  4KLW A;  4XPD C;  2CNT A;  4LX9 A;  4HNX B;  2EUI A;  1I21 A;  2I79 A;  2ZW4 A;  2WPX A;  3E0K A;  2JDD A;  4NXY A;  3ZJ0 A;  1QSR A;  3P2F A;  1Q2C A;  2GE3 A;  1I1D A;  1S7K A;  4HNW B;  1YVK A;  4CS0 B;  3CXQ A;  4FD5 A;  5IX3 A;  5EBV A;  4FD4 A;  3FB3 A;  4KOT A;  1RO5 A;  2OZU A;  3CXS A;  3JVN A;  3D2M A;  4KOV A;  2QEC A;  5DWN A;  1M4D A;  4IUS A;  5KTA A;  2B3U A;  4XPD B;  1MJ9 A;  5DWM A;  1Y7R A;  1M4I A;  3S6F A;  1KUV A;  2Y0M A;  3FYN A;  2QIR A;  2JDC A;  2PSW A;  3EC4 A;  1PU9 A;  1B6B A;  1IYL A;  4R3L A;  4KUB A;  2C27 A;  4BMH A;  5F46 A;  1TIQ A;  3D3S A;  4Y49 C;  2ZXV A;  3IWG A;  2VZY A;  2PRB A;  3EFA A;  3GY9 A;  4R3K A;  3TO7 A;  1P4N A;  2P0W A;  1Z4R A;  4CRZ B;  2OZG A;  3DR6 A;  1M44 A;  3LD2 A;  1SQH A;  1WK4 A;  2FIA A;  1Q2D A;  4OAD A;  2R1I A;  4AVC A;  3T90 A;  5J8C A;  5ISV A;  1XMT A;  4CAX A;  3TTH A;  3R9G A;  4AB7 A;  2R98 A;  3G8W A;  4R57 A;  4U9Y A;  5JQ4 A;  4H89 A;  4L8A A;  2G3T A;  1P0H A;  4JD6 A;  4KOX A;  3VWD A;  1FY7 A;  4UBR A;  5IV0 A;  1Q2Y A;  2B4B A;  4AVB A;  4H6Z A;  4B5O A;  5JPH A;  1Y9K A;  2ARH A;  4E8O A;  2QML A;  2VXK A;  4JWP A;  3OWC A;  4XNH B;  3IGR A;  1IID A;  3PP9 A;  2K5T A;  1XF8 A;  4FD6 A;  2EVN A;  3GYA A;  4MY0 A;  2BEI A;  2B5G A;  4NCZ A;  4PK3 A;  3R96 A;  1QSO A;  1BO4 A;  4L89 A;  4YFJ A;  3W6X A;  2B4D B;  1ON0 A;  4YRH A;  4OAE A;  2Q44 A; 
#chains in the Genus database with same CATH topology
 4K30 A;  5AG7 A;  4OC2 A;  4AXV A;  3KAS A;  4A95 A;  1VKC A;  2B3V A;  2J8N A;  3IC1 A;  3R9E A;  2DXQ A;  1HDU A;  2PDO A;  3C26 A;  4QVT A;  3JUW A;  4XPL A;  1LOK A;  1TF9 A;  2BCO A;  4XPK A;  2PJ7 A;  3TE4 A;  1S5K A;  2REF A;  3DR8 A;  4EME A;  1PYT B;  2PCU A;  4A30 A;  3SJG A;  1WWZ A;  2G0B A;  4UIB A;  2ZW7 A;  1DE4 C;  3FED A;  2A4N A;  3I9S A;  1M4G A;  3D8P A;  2IL4 A;  1ZG8 A;  3N5F A;  4UCM A;  2VBQ A;  1YQE A;  3FEC A;  4OC0 A;  3FJU A;  1NSL A;  4GXH A;  3FRM A;  4MFL A;  4MI4 A;  1YLE A;  5G20 A;  3SXN A;  3TFY A;  3S6H A;  4G1P A;  4C2X A;  4U5Y A;  3FEE A;  2DPS A;  3V8I A;  1MK4 A;  3CZX A;  4DNC A;  3BHX A;  4EWT A;  5LYD A;  1QMU A;  4MY3 A;  3RYO A;  5I0C A;  4RI1 A;  1S7L A;  3KHZ A;  1LRZ A;  3EO4 A;  1OBR A;  2ZEP A;  5KTD A;  2HC9 A;  1VHS A;  2PRQ A;  3R1K A;  1XOV A;  2REE A;  3V7Z A;  5IB9 A;  2PJC A;  5IB0 A;  2CNM A;  2CY2 A;  2OR4 A;  3B35 A;  4UWI A;  4X2T A;  1KUX A;  5HH1 A;  1Y0Y A;  4FD7 A;  2B58 A;  3H5Z A;  2B4D A;  1CX8 A;  2FSR A;  2KCW A;  3PEI A;  2PC1 A;  3TCV A;  1Z8X A;  2Q0Y A;  1CM0 A;  3BJ7 A;  4QC6 A;  3PGP A;  4B13 A;  2OU2 A;  4MCR A;  5K8O A;  4KVM E;  3KL9 A;  3RBU A;  1PUA A;  1YRE A;  3W6S A;  3S9M A;  4CGO A;  3LAC A;  5AG5 A;  1CBX A;  4JXQ A;  5EC4 A;  4O23 A;  1Y9W A;  3PZJ A;  2I00 A;  4F9U A;  2PJ4 A;  2OZH A;  2VZZ A;  3G3S A;  4FAI A;  3RAM A;  4K3N A;  4R7M A;  3FXT A;  4MFK A;  3D66 A;  2NYQ A;  1NMT A;  4CGM A;  4E2A A;  2BL1 A;  1QQ9 A;  4KOS A;  2PIY A;  3H4Q A;  3EY5 A;  1LAN A;  2ABZ A;  2ZEO A;  3SJE A;  3D7G A;  4XNH C;  4P4F A;  4YGO A;  3NH4 A;  2PE3 A;  3QB8 A;  5G1Z A;  4MHN A;  5JH9 A;  2PVV A;  3SHP A;  4R8F A;  2J8R A;  1J4J A;  4CPA A;  2Z3N A;  2NMT A;  1L0C A;  4RUH A;  3LWU A;  5C88 A;  2B5G B;  3GKR A;  3HUV A;  4CAF A;  3TOA A;  1GYT A;  1GHE A;  1FT7 A;  3L2N A;  4C2Z A;  2FT0 A;  4KS9 A;  2VI7 A;  4HKF A;  3CXP A;  1XFO A;  2EWB A;  1YX0 A;  2ZW5 A;  5KTC A;  3D67 A;  1Z8W A;  2V8V A;  3D68 A;  2WSA A;  1KWM A;  1Z9U A;  4A31 A;  4CGN A;  2Q4V A;  1ZO0 A;  4KSA A;  1V0C A;  3NH5 A;  4ZX8 A;  4YWY A;  3PB7 X;  5CBM A;  4OP4 A;  1CJW A;  1Z4E A;  3GB0 A;  3BLN A;  1Z8L A;  2IJZ A;  3I3G A;  4MCS A;  4FUU A;  4MCQ A;  1HDQ A;  3TO9 A;  4CYQ A;  4KZT A;  2FVG A;  4OC1 A;  4A33 A;  3SXO A;  2FE7 A;  4OKO A;  5HMN A;  2PJ8 A;  1YSJ A;  3D7D A;  4NFR A;  4J3G A;  4B5P B;  2OH1 A;  2WPW A;  3H8G A;  2F5I A;  4KOW A;  2C6G A;  4M6H A;  5F48 A;  5LYF A;  1HEE A;  1IIC A;  4ZY2 A;  4NJR A;  4QBJ A;  2Q51 A;  4NEX A;  3F0A A;  3UY5 A;  5H84 A;  1ARL A;  4CYN A;  4AG9 A;  2FCK A;  1UFH A;  1ZLI A;  2ATR A;  2OB0 A;  1M4L A;  2V8G A;  3B8G A;  3IO1 A;  1FNO A;  5F49 A;  4ZYQ A;  3W91 A;  2FIW A;  1TF8 A;  2CTC A;  3BI1 A;  1KUY A;  1Y7E A;  4EVY A;  2J8M A;  2PJ1 A;  2HUZ A;  4P6Y A;  4PSX A;  4PQA A;  4CGL A;  3FMC A;  2Q7B A;  4H6U A;  2AFX A;  2XEG A;  1BLL E;  2EO8 A;  1F2O A;  4PXC A;  4A39 A;  2HV2 A;  1Z5R A;  4TNU A;  4R76 A;  1Z2L A;  4B6Z A;  4CYP A;  3SI2 A;  4HNY B;  2GAN A;  4DJL A;  2RB7 A;  4PV6 A;  4U9Z A;  1U6M A;  2Z10 A;  3IWE A;  1RXT A;  4R9M A;  4MFZ A;  4X8I A;  1RTQ A;  4P44 A;  2YGW A;  1ARM A;  4PXE A;  2D4P A;  2Z11 A;  1XBU A;  4NSQ A;  4NGP A;  2EK8 A;  2O28 A;  2Q43 A;  4KOU A;  1CG2 A;  4KOR A;  4C7H A;  3MRU A;  3SJF A;  5THW A;  3TO6 A;  4NGN A;  1BOB A;  2AFM A;  4LUA A;  3D2P A;  2DF5 A;  4F6A A;  4CAV A;  4MBU A;  1IYK A;  4PXD A;  4F0Y A;  5HVG A;  1YGH A;  3K9T A;  4OC4 A;  4B5P A;  7CPA A;  3PRT A;  4Q36 A;  2YNE A;  2ZEG A;  3GIU A;  1MJB A;  4MHY A;  2I3C A;  2QJ8 A;  1XEB A;  2X7B A;  3VWE A;  2QYV A;  2C6C A;  4I49 A;  1R3N A;  3LMS A;  4OME A;  4TWE A;  2ZW6 A;  1JQG A;  1XE4 A;  2HQY A;  4EFD A;  1IB1 E;  2Z3K A;  4MHD A;  4CGP A;  3GLJ A;  5H86 A;  2WUU A;  2P6E A;  4P10 A;  2G3A A;  4ZY1 A;  4AG7 A;  3DSB A;  1F2P A;  3RNZ A;  1X12 A;  4M85 A;  1I12 A;  1KZF A;  2ZOG A;  1NE9 A;  4X3R A;  4B14 A;  2CIJ A;  4ZBG A;  4A37 A;  1ELL P;  2IMO A;  2PIZ A;  4KSF A;  4MFJ A;  4MFQ A;  4GS4 A;  4AVA A;  2ODF A;  1OZP A;  4UWJ A;  5AG6 A;  3R9F A;  2AE6 A;  4MJ8 A;  3KR4 A;  1AUG A;  4MFP A;  3PFO A;  4KUA A;  5F47 A;  5JGF A;  4UFW A;  2Z0Z A;  4CRY B;  4JXR A;  2ZEH A;  3P2H A;  4P4E A;  3N7Z A;  1YVO A;  3TOB A;  5GCN A;  2F7V A;  5E96 A;  2PR1 A;  4FBE A;  4C68 A;  4BBH A;  5HVH A;  3K2K A;  3MGD A;  3IIB A;  3ZZI A;  3IFE A;  3F8K A;  2VEZ A;  3NE7 A;  4E0A A;  5LYI A;  2PR8 A;  2POK A;  5ELY A;  1YW4 A;  1VHE A;  4R87 A;  1XIX A;  3R95 A;  4JJX A;  5C82 A;  1QSM A;  2ZPA A;  1S7N A;  3K9U A;  3WR7 A;  2FS5 A;  4X5K A;  5D29 A;  2R7H A;  4M3S A;  5BWA B;  2XEJ A;  3LOD A;  1ZG7 A;  3BJ8 A;  4KVX A;  2AJ6 A;  3DGV A;  2FL4 A;  2V8H A;  5G22 A;  2YND A;  3EXN A;  3QAH A;  1YK3 A;  2AFS A;  3TT2 A;  4OC3 A;  3FNC A;  2D4O A;  1BAV A;  2Q04 A;  2WZN A;  2JEW A;  4MXU A;  4UCN A;  3B2Y A;  2QVP A;  2C1C A;  3PB4 X;  1IU8 A;  1S7F A;  1DTD A;  1TKH A;  4PSW A;  3DDD A;  2AFU A;  4W9Y A;  4WJB A;  4P4I A;  2Q4Y A;  4ZGY B;  4MRI A;  5LRK A;  1XJO A;  4KVO E;  1N71 A;  2BSW A;  4KLV A;  2BUE A;  3BI0 A;  3S6K A;  4QB9 A;  3IU1 A;  4UEF A;  2XEF A;  3KR5 A;  1Q7L A;  1R57 A;  2RC4 A;  2Z3P A;  4A2Z A;  1B87 A;  1NSA A;  2CF4 A;  2C6P A;  1S3Z A;  5K8P A;  1YME A;  1QSN A;  4UIA A;  3DNS A;  2VQY A;  5CNP A;  4YU9 A;  2P6F A;  2OOT A;  3B3W A;  2PQ8 A;  3CPA A;  2JEV A;  4QUS A;  5EMI A;  4UA3 A;  3PFE A;  3SI1 A;  4II9 A;  1M1D A;  2JLM A;  3FBU A;  3I1U A;  4ORF A;  1K4J A;  2R8V A;  3FH4 A;  4RS2 A;  3KQX A;  5FVJ A;  2P6G A;  3F5B A;  4ONW A;  4NGQ A;  1VHO A;  3D7H A;  3KZW A;  3FX6 A;  4OLL A;  1YR0 A;  3T9Y A;  3JTK A;  3H8E A;  3IU2 A;  4PK2 A;  2FXF A;  5J8F A;  2GRE A;  1QST A;  4JLY A;  3T8W A;  2JBK A;  1S60 A;  2H5M A;  3KKW A;  3FIX A;  4JYW A;  3WC7 A;  5K8M A;  1Z8T A;  5HVF A;  2O4H A;  5CPA A;  4F0X A;  4MMO A;  4LQ6 A;  4H2K A;  3NFZ A;  1UWY A;  4ZI6 A;  1MJA A;  4ONU A;  4F8Z A;  1BPN A;  2CXA A;  4Y49 B;  2PJ0 A;  3IEH A;  2F8H A;  6CPA A;  1LFW A;  4CAW A;  4NF1 A;  3S6G A;  2GIV A;  4IF5 A;  3VAT A;  2CNS A;  2PJ5 A;  2ANP A;  4KOY A;  3NE8 A;  4KLW A;  4XPD C;  2CNT A;  4LX9 A;  2IQ6 A;  2PJB A;  4OID A;  4HNX B;  2EUI A;  4NGT A;  3WC6 A;  1I21 A;  2I79 A;  2PVW A;  2ZW4 A;  1CP6 A;  2NSM A;  2WPX A;  3FF3 A;  3E0K A;  2JDD A;  2Q7S A;  4BIN A;  1XRY A;  4NXY A;  1IOI A;  3ISX A;  3ZJ0 A;  1QSR A;  3P2F A;  1TKJ A;  1Q2C A;  2GE3 A;  1CPX A;  1I1D A;  1S7K A;  2J9A A;  4HNW B;  5I4M A;  2PJ6 A;  3PB8 X;  4JZ0 A;  1YVK A;  4BD9 A;  4CS0 B;  4RN7 A;  4Z65 A;  8CPA A;  4IHM A;  4MCP A;  3DLJ A;  3GUX A;  2GU2 A;  3CXQ A;  4FD5 A;  2Z3M A;  2PJ3 A;  5IX3 A;  4M6I A;  4P4D A;  4MHZ A;  2DEA A;  5EBV A;  1LAM A;  3HLP A;  2GLJ A;  4FD4 A;  1VGY A;  3FB3 A;  1H8L A;  3KQZ A;  4CYO A;  4KOT A;  1RO5 A;  2OZU A;  2V77 A;  3CXS A;  4R6T A;  3VH9 A;  1Y0R A;  2AFO A;  3JVN A;  2QEC A;  3D2M A;  3IWW A;  4KOV A;  5DWN A;  4F9V A;  1M4D A;  4IUS A;  4UEE A;  4UF4 A;  2VL1 A;  3CDX A;  3MN8 A;  5KTA A;  3VAR A;  1PCA A;  2B3U A;  3BXM A;  1MJ9 A;  4XPD B;  4B11 A;  4Q7A A;  1TXR A;  5DWM A;  4GM5 A;  1A2Z A;  1Y7R A;  3CT9 A;  1M4I A;  2Q4Z A;  3A9L A;  4KSI A;  3S6F A;  1BPM A;  5D8N A;  4DYO A;  3PBE A;  1KUV A;  3PB9 X;  1LAP A;  2Y0M A;  3FYN A;  4OIW A;  2QIR A;  2JDC A;  2PSW A;  3B3V A;  5LYL A;  3EC4 A;  2XEI A;  4ZX9 A;  4P45 A;  1PU9 A;  4B10 A;  4A94 A;  4C7I A;  4B12 A;  1B6B A;  1IYL A;  3WAB A;  2BOA A;  2Z3O A;  3FVL A;  1JWQ A;  4Q38 A;  5HXD A;  2YNC A;  3B3S A;  1IY7 A;  3KGQ A;  3RO0 A;  4R3L A;  4KUB A;  4UFV A;  1AYE A;  4PXB A;  2C27 A;  4BMH A;  4WWV A;  3JRU A;  5F46 A;  4ZY0 A;  1TIQ A;  4UFX A;  2V8D A;  4IK2 A;  4PPZ A;  3D3S A;  4Y49 C;  2ZXV A;  3IWG A;  4UEZ A;  2VZY A;  1VIX A;  4UCP A;  2PRB A;  3EFA A;  5K8N A;  4P4J A;  3D7F A;  3GY9 A;  4R3K A;  3PB6 X;  3TO7 A;  2GLF A;  1P4N A;  5A28 A;  2P0W A;  3PBB A;  1Z4R A;  2WYR A;  2ZED A;  3H8F A;  4CRZ B;  2OZG A;  3DR6 A;  1M44 A;  3LD2 A;  1SQH A;  1WK4 A;  2FIA A;  1Q2D A;  4OAD A;  2R1I A;  3B7I A;  4FWU A;  2ZEM A;  4AVC A;  2PJA A;  3T90 A;  5J8C A;  2GFQ A;  5ISV A;  1LCP A;  1XMB A;  1XMT A;  4CAX A;  2ZEF A;  1ZLH A;  1TKF A;  2AFZ A;  3TTH A;  5LRG A;  5J1Q A;  3R9G A;  5JM6 A;  4AB7 A;  4LQG A;  5LRJ A;  2R98 A;  3G8W A;  4R57 A;  2CTB A;  2ZOF A;  4H89 A;  4U9Y A;  5JQ4 A;  4L8A A;  2PJ9 A;  3CPX A;  2JBJ A;  2G3T A;  5G21 A;  3D4U A;  1EE3 P;  1IGB A;  2DPT A;  3B3T A;  1P0H A;  4IAV A;  4OC5 A;  3V38 A;  4JD6 A;  1X10 A;  2O53 A;  4KOX A;  1FY7 A;  2BO9 A;  4UBR A;  3VWD A;  5IV0 A;  2YNC C;  1Q2Y A;  2B4B A;  3NA6 A;  4NGM A;  3RZA A;  3SI0 A;  4A32 A;  3KHX A;  3QAY A;  4AVB A;  3NH8 A;  4H6Z A;  1ZG9 A;  2EK9 A;  5DS0 A;  4B5O A;  5JPH A;  1Y9K A;  2ARH A;  4E8O A;  2QML A;  2Z3L A;  2AFW A;  2VXK A;  4NGR A;  4JWP A;  1R43 A;  3B3C A;  3OWC A;  4NJQ A;  4XNH B;  3IGR A;  1IID A;  3PP9 A;  2RFH A;  4NGS A;  2K5T A;  4CAE A;  5F09 A;  2EBJ A;  2ZEN A;  4C2Y A;  1XF8 A;  1IOF A;  4FD6 A;  5A27 A;  1YLO A;  3QNV A;  2EVN A;  3GYA A;  1CP7 A;  3TX8 A;  4A38 A;  3IJ3 A;  3ISZ A;  4MY0 A;  1YW6 A;  2PJ2 A;  2BEI A;  2B5G A;  4NCZ A;  4MHP A;  1CPS A;  3KI9 A;  4PK3 A;  2ZEE A;  1ELM P;  3R96 A;  3TC8 A;  1QSO A;  1BO4 A;  2G9D A;  4L89 A;  2HB6 A;  3SJX A;  4YFJ A;  4M6G A;  1F57 A;  2ZEL A;  4DUK A;  3W6X A;  2B4D B;  3WC5 A;  3S9N A;  1AMP A;  1ON0 A;  4HPS A;  3WT4 A;  3S9L A;  5AGE A;  4OAE A;  4YRH A;  2Q44 A;  4P4B A;  5AG4 A; 
#chains in the Genus database with same CATH homology
 4K30 A;  5AG7 A;  4A95 A;  1VKC A;  2B3V A;  2J8N A;  3R9E A;  2DXQ A;  2PDO A;  3C26 A;  4QVT A;  3JUW A;  4XPL A;  4XPK A;  3TE4 A;  1S5K A;  2REF A;  3DR8 A;  4A30 A;  1WWZ A;  2G0B A;  2ZW7 A;  2A4N A;  3I9S A;  1M4G A;  3D8P A;  2IL4 A;  4UCM A;  2VBQ A;  1NSL A;  3SXN A;  4MFL A;  3FRM A;  4MI4 A;  5G20 A;  1YLE A;  3TFY A;  3S6H A;  4C2X A;  4U5Y A;  2DPS A;  3V8I A;  1MK4 A;  4DNC A;  4MY3 A;  3RYO A;  5I0C A;  4RI1 A;  1S7L A;  1LRZ A;  3EO4 A;  5KTD A;  1VHS A;  3R1K A;  5IB0 A;  2REE A;  2CNM A;  2CY2 A;  4UWI A;  1KUX A;  5HH1 A;  4FD7 A;  2B58 A;  3H5Z A;  2B4D A;  2FSR A;  2KCW A;  2PC1 A;  3TCV A;  2Q0Y A;  3BJ7 A;  1CM0 A;  4QC6 A;  3PGP A;  4B13 A;  2OU2 A;  4KVM E;  1PUA A;  1YRE A;  3W6S A;  4CGO A;  5AG5 A;  4JXQ A;  5EC4 A;  1Y9W A;  3PZJ A;  2I00 A;  2OZH A;  2VZZ A;  3G3S A;  3FXT A;  4MFK A;  1NMT A;  4E2A A;  2BL1 A;  4KOS A;  3H4Q A;  3EY5 A;  4XNH C;  4YGO A;  3QB8 A;  5G1Z A;  3SHP A;  2J8R A;  1J4J A;  2Z3N A;  2NMT A;  1L0C A;  5C88 A;  2B5G B;  3GKR A;  4CAF A;  3TOA A;  1GHE A;  4C2Z A;  2FT0 A;  4KS9 A;  2VI7 A;  4HKF A;  3CXP A;  1YX0 A;  2ZW5 A;  5KTC A;  2WSA A;  1Z9U A;  4A31 A;  4CGN A;  2Q4V A;  1ZO0 A;  4KSA A;  1V0C A;  1CJW A;  1Z4E A;  3BLN A;  3I3G A;  4CYQ A;  3TO9 A;  4KZT A;  4A33 A;  3SXO A;  2FE7 A;  5HMN A;  4J3G A;  4B5P B;  2OH1 A;  2WPW A;  2F5I A;  4KOW A;  5F48 A;  1IIC A;  4QBJ A;  4NEX A;  3F0A A;  3UY5 A;  5H84 A;  4CYN A;  4AG9 A;  2FCK A;  1UFH A;  2OB0 A;  2ATR A;  3B8G A;  5F49 A;  3W91 A;  2FIW A;  4EVY A;  1KUY A;  2J8M A;  4PSX A;  2HUZ A;  4CGL A;  2Q7B A;  4H6U A;  2HV2 A;  4CYP A;  4HNY B;  2GAN A;  4PV6 A;  4U9Z A;  3IWE A;  1U6M A;  2Z10 A;  1RXT A;  4R9M A;  4MFZ A;  2YGW A;  2D4P A;  2Z11 A;  4NSQ A;  2O28 A;  4KOU A;  4KOR A;  4C7H A;  3TO6 A;  4F6A A;  1BOB A;  4LUA A;  3D2P A;  4CAV A;  4MBU A;  1IYK A;  4F0Y A;  1YGH A;  4B5P A;  4Q36 A;  2YNE A;  1MJB A;  1XEB A;  2X7B A;  3VWE A;  4I49 A;  2ZW6 A;  1XE4 A;  2HQY A;  1IB1 E;  2Z3K A;  4MHD A;  4CGP A;  5H86 A;  2WUU A;  2P6E A;  2G3A A;  4AG7 A;  3DSB A;  4M85 A;  1I12 A;  1KZF A;  1NE9 A;  4B14 A;  4ZBG A;  4KSF A;  4MFJ A;  4MFQ A;  4GS4 A;  4AVA A;  5AG6 A;  1OZP A;  4UWJ A;  3R9F A;  2AE6 A;  4MJ8 A;  4MFP A;  4KUA A;  5F47 A;  4UFW A;  2Z0Z A;  4CRY B;  4JXR A;  3P2H A;  3N7Z A;  1YVO A;  3TOB A;  5GCN A;  5E96 A;  2PR1 A;  4C68 A;  4BBH A;  3MGD A;  3ZZI A;  3F8K A;  2VEZ A;  3NE7 A;  4E0A A;  2PR8 A;  4R87 A;  1XIX A;  3R95 A;  4JJX A;  5C82 A;  1QSM A;  2ZPA A;  1S7N A;  3K9U A;  3WR7 A;  2FS5 A;  4X5K A;  2R7H A;  4M3S A;  5BWA B;  3LOD A;  3BJ8 A;  4KVX A;  2AJ6 A;  2FL4 A;  5G22 A;  2YND A;  3EXN A;  3QAH A;  1YK3 A;  3TT2 A;  3FNC A;  2D4O A;  2Q04 A;  4UCN A;  1S7F A;  4PSW A;  3DDD A;  2Q4Y A;  4ZGY B;  4KVO E;  1N71 A;  2BSW A;  4KLV A;  2BUE A;  3S6K A;  4QB9 A;  3IU1 A;  1R57 A;  2RC4 A;  2Z3P A;  4A2Z A;  1B87 A;  1S3Z A;  1QSN A;  3DNS A;  2VQY A;  5CNP A;  2P6F A;  2PQ8 A;  4QUS A;  2JEV A;  4UA3 A;  4II9 A;  1M1D A;  2JLM A;  3FBU A;  4ORF A;  4RS2 A;  1K4J A;  2R8V A;  5FVJ A;  2P6G A;  3F5B A;  4OLL A;  1YR0 A;  3T9Y A;  3JTK A;  3IU2 A;  4PK2 A;  2FXF A;  5J8F A;  1QST A;  4JLY A;  1S60 A;  2H5M A;  3KKW A;  3FIX A;  4F0X A;  1MJA A;  4ONU A;  2CXA A;  4Y49 B;  4CAW A;  4NF1 A;  3S6G A;  2GIV A;  4IF5 A;  2CNS A;  4KOY A;  4KLW A;  4XPD C;  2CNT A;  4LX9 A;  4HNX B;  2EUI A;  1I21 A;  2I79 A;  2ZW4 A;  2WPX A;  3E0K A;  2JDD A;  4NXY A;  3ZJ0 A;  1QSR A;  3P2F A;  1Q2C A;  2GE3 A;  1I1D A;  1S7K A;  4HNW B;  1YVK A;  4CS0 B;  3CXQ A;  4FD5 A;  2Z3M A;  5IX3 A;  5EBV A;  4FD4 A;  3FB3 A;  4CYO A;  4KOT A;  1RO5 A;  2OZU A;  3CXS A;  3JVN A;  3D2M A;  2QEC A;  4KOV A;  5DWN A;  1M4D A;  4IUS A;  5KTA A;  2B3U A;  4XPD B;  1MJ9 A;  4B11 A;  5DWM A;  1Y7R A;  1M4I A;  3A9L A;  3S6F A;  1KUV A;  2Y0M A;  3FYN A;  2QIR A;  2JDC A;  2PSW A;  3EC4 A;  1PU9 A;  4B10 A;  4C7I A;  4B12 A;  1B6B A;  1IYL A;  2Z3O A;  4Q38 A;  2YNC A;  4R3L A;  4KUB A;  4UFV A;  2C27 A;  4BMH A;  5F46 A;  1TIQ A;  4UFX A;  3D3S A;  4Y49 C;  2ZXV A;  3IWG A;  2VZY A;  4UCP A;  2PRB A;  3EFA A;  3GY9 A;  4R3K A;  3TO7 A;  1P4N A;  5A28 A;  2P0W A;  1Z4R A;  4CRZ B;  3LD2 A;  2OZG A;  1M44 A;  3DR6 A;  1SQH A;  1WK4 A;  2FIA A;  1Q2D A;  4OAD A;  2R1I A;  4AVC A;  3T90 A;  5J8C A;  5ISV A;  1XMT A;  4CAX A;  3TTH A;  3R9G A;  4AB7 A;  2R98 A;  3G8W A;  4R57 A;  4U9Y A;  5JQ4 A;  4H89 A;  4L8A A;  2G3T A;  5G21 A;  4CGM A;  2DPT A;  1P0H A;  4JD6 A;  4KOX A;  3VWD A;  1FY7 A;  4UBR A;  5IV0 A;  2YNC C;  1Q2Y A;  2B4B A;  4A32 A;  4AVB A;  4H6Z A;  4B5O A;  5JPH A;  1Y9K A;  2ARH A;  4E8O A;  2QML A;  2Z3L A;  2VXK A;  4JWP A;  3OWC A;  4XNH B;  3IGR A;  1IID A;  3PP9 A;  4CAE A;  2K5T A;  4C2Y A;  1XF8 A;  4FD6 A;  5A27 A;  2EVN A;  3GYA A;  4MY0 A;  2BEI A;  2B5G A;  4NCZ A;  4PK3 A;  3R96 A;  1QSO A;  1BO4 A;  4L89 A;  4YFJ A;  3W6X A;  2B4D B;  1ON0 A;  5AGE A;  4OAE A;  4YRH A;  2Q44 A;  5AG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...