4ZBGA

Crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
166
structure length
154
Chain Sequence
HHHMHIRKERPQDAAEIRQVTEAAFRPVAYSNQKEGEIVDALRAAKALTLSLVAEEDGQVLGHIAFSPVLIGGAEKGWYGLGPVSVLPARQGEGIGGKLIREGLAQLRGAGARGCVLLGDLGYYRRFGFKAYFQCLAFGPDMPQGDVAYHAAFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title Crystal Structure of a GNAT family Acetyltransferase from Brucella melitensis in complex with Acetyl-CoA
rcsb
source organism Brucella abortus str. 2308 a
molecule tags Transferase
total genus 43
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4zbgA00
4KORA 1I21A 3C26A 4GS4A 4KVOE 4QB9A 1CM0A 1IB1E 1QSNA 4XPKA 3QB8A 2P6FA 2VBQA 1QSTA 4JXQA 2ZPAA 2OZUA 4FD6A 5EC4A 4KVXA 3TCVA 4OAEA 1MK4A 1NSLA 4AVBA 2CY2A 4KOVA 3OWCA 4H6UA 3NE7A 2B58A 3DDDA 2OZGA 4CRYB 5H84A 4JWPA 4K30A 1QSOA 3F8KA 4UA3A 4OADA 1M4IA 4AVAA 2D4PA 2Z0ZA 2QIRA 1CJWA 4XPDC 5I0CA 5J8FA 2PR1A 3N7ZA 4MY3A 4ZBGA 1U6MA 2Z11A 2BL1A 3P2FA 3EO4A 4Y49C 2Z10A 3R1KA 2R1IA 3VWEA 1Y9WA 2Q44A 2J8NA 1LRZA 1S3ZA 4MI4A 2AE6A 1TIQA 5GCNA 4PK3A 3DSBA 3VWDA 2WPXA 4B5PB 2DXQA 1YR0A 2AJ6A 2PR8A 3QAHA 1M44A 2PQ8A 4NSQA 1NMTA 5KTAA 2PRBA 3T90A 5IB0A 3TOBA 4U9YA 1Q2YA 3B8GA 2OZHA 2ZW4A 1MJAA 3RYOA 2VQYA 2BEIA 4LX9A 2CNSA 1VHSA 1KZFA 2OH1A 4RI1A 4YGOA 5F47A 1ON0A 1S5KA 2ATRA 4F0YA 4KOUA 2FIWA 4MJ8A 3ZJ0A 3I9SA 2KCWA 2HV2A 3E0KA 3T9YA 1P4NA 2B3VA 2PSWA 2R8VA 4OLLA 3D2PA 1QSMA 2FE7A 4U9ZA 1V0CA 5ISVA 2FS5A 3LD2A 4KOTA 4QC6A 4RS2A 4I49A 2Q4VA 2J8RA 5H86A 4ONUA 4JXRA 4JJXA 4KLWA 1RO5A 4KOSA 4CRZB 4AVCA 4L8AA 2ZW5A 3BJ8A 2ZXVA 3F5BA 3LODA 3EY5A 3FRMA 3DNSA 1YGHA 2D4OA 4R87A 1XF8A 2JDDA 2G3TA 1MJBA 4HKFA 3JUWA 4M3SA 5IV0A 3G8WA 4B5PA 5KTCA 3EXNA 2ZW7A 3GKRA 1S7FA 2HQYA 4YRHA 3PP9A 1N71A 3SXNA 1Q2DA 3CXSA 2OU2A 1UFHA 4F6AA 1WK4A 1SQHA 3TT2A 3TFYA 2NMTA 3KKWA 2QMLA 1XE4A 4UWJA 1OZPA 4BMHA 4JD6A 4QBJA 2I79A 2VI7A 2REFA 3F0AA 2FSRA 2RC4A 2BUEA 3JVNA 2JLMA 1RXTA 4R9MA 3V8IA 3TO9A 2C27A 2VEZA 3D2MA 4NEXA 4CS0B 1KUVA 3FB3A 3PZJA 3PGPA 1P0HA 1IYKA 4PSWA 5F46A 2F5IA 2GANA 3IWGA 4H6ZA 3K9UA 1VKCA 4NCZA 3FBUA 1YVKA 3R9EA 3R96A 1S60A 4KZTA 1YLEA 4MBUA 3R95A 1Y7RA 1YX0A 4QVTA 3MGDA 4X5KA 2B3UA 2Q7BA 2PDOA 3S6KA 4NF1A 3S6HA 4L89A 4B5OA 2VZYA 3R9FA 4AG9A 1K4JA 2VZZA 4J3GA 4PK2A 3TE4A 4XNHB 1Y9KA 1B87A 4QUSA 1M1DA 4M85A 2P6EA 1FY7A 4NXYA 4Y49B 4R3LA 2B5GA 1IIDA 1L0CA 1GHEA 2QECA 4ORFA 5F49A 1S7KA 3FYNA 2G3AA 5FVJA 1QSRA 2X7BA 2Y0MA 5DWMA 4FD4A 1PUAA 3FIXA 4FD5A 1Z9UA 4U5YA 4KOYA 4YFJA 5JPHA 4HNYB 1B6BA 4EVYA 1XIXA 2H5MA 3EFAA 2REEA 5KTDA 4CAVA 3TO6A 1BOBA 4KUBA 1R57A 1IICA 5IX3A 3TTHA 2EVNA 3TOAA 4LUAA 4R3KA 2B5GB 5HMNA 2R98A 1BO4A 2FXFA 5E96A 4PSXA 3SHPA 2JEVA 1XMTA 3GYAA 3UY5A 4UBRA 1YVOA 4FD7A 5C82A 3IGRA 5EBVA 2FCKA 5J8CA 2ZW6A 1XEBA 4IF5A 5CNPA 2IL4A 2J8MA 3D8PA 1KUXA 3H4QA 3W6XA 2FT0A 4MY0A 4R57A 3DR6A 3BLNA 4PV6A 4CAWA 1Z4EA 4KVME 2EUIA 4E8OA 2HUZA 2JDCA 1I12A 2CNMA 3CXQA 4H89A 4XNHC 3W6SA 3SXOA 3WR7A 3D3SA 4CAXA 2OB0A 1Q2CA 1S7NA 2BSWA 1S7LA 3EC4A 3I3GA 4XPLA 3FNCA 4AB7A 1J4JA 4E0AA 4UWIA 4KUAA 2Q4YA 3R9GA 1YK3A 4HNWB 5DWNA 1KUYA 2B4BA 3S6FA 1IYLA 2B4DA 2GIVA 3TO7A 2ARHA 2FIAA 2GE3A 3S6GA 1I1DA 4IUSA 4MHDA 2WPWA 1NE9A 1PU9A 3GY9A 4E2AA 4HNXB 3G3SA 4XPDB 2VXKA 2A4NA 3ZZIA 2O28A 2I00A 4KLVA 5F48A 2G0BA 1MJ9A 4AG7A 4JLYA 2R7HA 4KOXA 5HH1A 3P2HA 1YREA 2Q0YA 3FXTA 4II9A 2B4DB 1M4GA 3DR8A 4DNCA 2K5TA 2Q04A 2FL4A 3W91A 5JQ4A 2CNTA 1Z4RA 4KOWA 1WWZA 5C88A 2P6GA 2PC1A 3BJ7A 3CXPA 2P0WA 1M4DA
chains in the Genus database with same CATH superfamily
4KORA 5AGEA 3V38A 1I21A 1DTDA 3C26A 4GS4A 4KVOE 1CM0A 1IB1E 1DE4C 1QSNA 2PJ1A 4XPKA 3QB8A 4FUUA 2PJCA 2P6FA 2VBQA 1QSTA 4UIAA 2ZEGA 2YNEA 4JXQA 3LMSA 4PXEA 2VL1A 4NGQA 2ZPAA 2OZUA 4FD6A 4UCNA 5EC4A 4KVXA 3TCVA 1UWYA 2ZOGA 4OAEA 1M4LA 1MK4A 3PEIA 4MCSA 2PJ6A 1NSLA 4AVBA 2CY2A 2IQ6A 4KOVA 4MCQA 2EK9A 1F2PA 3H5ZA 3OWCA 4H6UA 3NE7A 2B58A 3DDDA 2OZGA 4CRYB 3NFZA 1ZG8A 4CYQA 4X3RA 5H84A 4JWPA 1LOKA 2CXAA 5K8PA 4K30A 4NGMA 1QSOA 3F8KA 4UA3A 4OADA 1M4IA 3GIUA 4P6YA 2XEFA 4AVAA 2Z3MA 1KWMA 2PVWA 2D4PA 2GREA 3IC1A 2ODFA 2Z0ZA 3B2YA 3VATA 5G1ZA 1GYTA 2QIRA 1CJWA 4XPDC 5A27A 5I0CA 3PB6X 2HB6A 5J8FA 2PR1A 4A37A 3N7ZA 4MY3A 2PJAA 4P44A 4M6GA 1CP7A 4ZBGA 1U6MA 2Z11A 4OKOA 2BL1A 3FECA 3P2FA 1YLOA 5LYDA 2OR4A 3EO4A 4R7MA 2QVPA 2Z10A 4IAVA 4Y49C 2DEAA 4NGNA 2GU2A 2F7VA 3L2NA 3R1KA 2R1IA 4UCPA 2IJZA 3VWEA 2PRQA 1Y9WA 3D67A 2Q44A 3DGVA 3D7HA 1XOVA 2J8NA 1LRZA 3D7GA 4NGPA 4EMEA 1S3ZA 4MI4A 2AE6A 4JYWA 4ONWA 4MFKA 4OC3A 4MCPA 1TIQA 4RUHA 4PPZA 5D8NA 4CGNA 5GCNA 4ZGYB 3D4UA 4PK3A 3DSBA 3VWDA 2WPXA 2PE3A 4B5PB 2DXQA 3S9NA 4UF4A 3SI2A 2Q51A 1OBRA 4W9YA 1YR0A 5A28A 2AJ6A 2PR8A 3PFEA 3QAHA 4C7IA 1M44A 2PQ8A 3SJGA 3LWUA 2BCOA 4C68A 4ZX9A 3D66A 4NSQA 4MFPA 1NMTA 1QQ9A 5CPAA 3B7IA 1Y7EA 4DJLA 5KTAA 1BLLE 2YNCC 2PRBA 4RN7A 4X2TA 3CT9A 7CPAA 4MCRA 3T90A 1IGBA 5HVGA 1X12A 5IB0A 3TOBA 4U9YA 1Q2YA 3B8GA 3MN8A 4P4DA 1CG2A 4DYOA 2OZHA 2YGWA 4QB9A 2ZW4A 1IOFA 1MJAA 5AG7A 3RYOA 2VQYA 5LYIA 2BEIA 4LX9A 2CNSA 1VHSA 1KZFA 2PIYA 2OH1A 2Z3OA 4OIWA 1CP6A 4UFWA 4C2XA 4DUKA 4A2ZA 4RI1A 4YGOA 2I3CA 4MFQA 3IO1A 3PB4X 5F47A 1ON0A 1S5KA 1HDQA 2ATRA 1ARMA 4OMEA 1QMUA 4CAFA 4F0YA 5LYLA 4KOUA 2FIWA 2CTBA 4MFLA 4MJ8A 3ZJ0A 3I9SA 2Z3NA 2XEGA 4K3NA 4P4BA 2KCWA 2HV2A 4R6TA 4B14A 3E0KA 3T9YA 1P4NA 2B3VA 2PSWA 2R8VA 4OLLA 3D2PA 3KR5A 2V8HA 1QSMA 2POKA 5K8OA 2FE7A 4U9ZA 1V0CA 4NJQA 3CPXA 3SI1A 3N5FA 2PIZA 2JBKA 5ISVA 2JBJA 2FS5A 3A9LA 2WZNA 3LD2A 4P45A 4UEFA 5G21A 2ZEDA 4KOTA 4QC6A 1TF9A 5LRJA 4LQ6A 4RS2A 4KSAA 1YSJA 4I49A 4P4FA 1YW6A 3FH4A 3H8GA 2AFMA 2Q4VA 2J8RA 3IWEA 5H86A 4ONUA 4PXDA 1XFOA 3ISZA 4JXRA 2ZOFA 3FJUA 4JJXA 3FF3A 2J9AA 2PJBA 3WC5A 3D7FA 5THWA 4C2YA 2PJ7A 1RO5A 4KLWA 4KOSA 4CRZB 2OOTA 4AVCA 4L8AA 2ZW5A 3BJ8A 2ZXVA 4MXUA 1AUGA 3F5BA 4O23A 3QAYA 3LODA 3EY5A 2V8GA 3NH4A 3FRMA 1TF8A 3B3WA 3DNSA 3GB0A 3SJEA 3BI0A 4C2ZA 3V7ZA 1YGHA 2C6GA 2D4OA 4R87A 4CPAA 2JEWA 1XF8A 2JDDA 3LACA 2Q7SA 4GXHA 2G3TA 1MJBA 4HKFA 3VARA 3JUWA 3RAMA 3B35A 4UCMA 4G1PA 5AG6A 4M3SA 5IV0A 3G8WA 4B5PA 5KTCA 2DPSA 1BAVA 4IK2A 3EXNA 3ISXA 2ZW7A 4CYNA 4F0XA 1Z8WA 3GKRA 1Z8TA 5BWAB 1CPSA 1S7FA 2HQYA 4MFJA 1HDUA 3B3CA 4OC1A 4YRHA 4OC0A 4B11A 1PYTB 1TKHA 1N71A 2PJ4A 3PP9A 3IJ3A 3SXNA 3HLPA 4TWEA 4MFZA 1Q2DA 2O4HA 3CXSA 2OU2A 1UFHA 3KI9A 4F6AA 1VIXA 1WK4A 3WC7A 1SQHA 3TT2A 4P4JA 2NMTA 4MHZA 3TFYA 3KKWA 4YU9A 3FVLA 2QMLA 1IU8A 1XE4A 1YMEA 4UWJA 4KSFA 3CPAA 3JRUA 4AXVA 5JM6A 1OZPA 4BMHA 4JD6A 3RO0A 3WC6A 4QBJA 3FEDA 2I79A 4OP4A 1ELLP 2ZEPA 2AFWA 2V8VA 2VI7A 3BHXA 2REFA 4PQAA 5HVHA 2Q4ZA 3F0AA 2FSRA 2NYQA 1HEEA 3PBEA 4FBEA 2RC4A 2AFSA 2BUEA 2AFUA 3JVNA 2JLMA 1RXTA 4R9MA 3IEHA 3V8IA 1IY7A 4MHPA 2NSMA 3TO9A 3NA6A 2C27A 5CBMA 2ZEEA 1F57A 2VEZA 2GLFA 3D2MA 1AYEA 4NEXA 4CS0B 4CGOA 1LANA 3IWWA 1KUVA 3FB3A 3PZJA 3PGPA 1P0HA 2XEIA 1IYKA 3KQXA 4NJRA 4PSWA 5F46A 1Q7LA 3PBBA 4P10A 2F5IA 2GANA 4B13A 3IWGA 4OC5A 4YWYA 4H6ZA 3HUVA 3K9UA 1YW4A 1VKCA 4NCZA 3FBUA 1YVKA 3R9EA 3R96A 3RZAA 3B3VA 3NH8A 1IOIA 2CTCA 1S60A 4KZTA 4UIBA 3WT4A 1YLEA 4MBUA 3R95A 1R3NA 1Y7RA 1VGYA 1CBXA 1YX0A 2Q43A 4CAEA 4QVTA 3MGDA 2BOAA 3FMCA 2AFXA 2B3UA 4X5KA 5HVFA 2Q7BA 5IB9A 2PDOA 4KS9A 4BD9A 4ZY1A 3S6KA 3KHXA 3KZWA 4NF1A 1FT7A 3S6HA 4L89A 4B5OA 2PJ8A 2VZYA 5JH9A 1F2OA 4M6IA 5I4MA 1CX8A 1ELMP 2EK8A 1K4JA 3R9FA 4X8IA 2VZZA 4AG9A 4J3GA 4PK2A 3TE4A 1VHEA 2ANPA 1H8LA 4XNHB 4BBHA 1Y9KA 3IU2A 1B87A 2XEJA 4QUSA 3RBUA 4A33A 4UFVA 1ZG9A 1M1DA 3CDXA 4M85A 2P6EA 4LQGA 1FY7A 4NXYA 1PCAA 4Y49B 4R3LA 2B5GA 1IIDA 2GFQA 5K8NA 2EBJA 4CGMA 1L0CA 1GHEA 2QECA 4ORFA 4F9VA 5F49A 1S7KA 4R76A 2ZEMA 4F8ZA 3FYNA 1X10A 3B3TA 3BXMA 4Q38A 2G3AA 3D68A 1ZLIA 3MRUA 5FVJA 1QSRA 2X7BA 2Y0MA 1BPMA 5ELYA 5DWMA 4FAIA 4CGPA 4FD4A 1LAMA 1PUAA 3K9TA 4P4EA 1RTQA 3FIXA 2C6CA 2PJ9A 4FD5A 1Z9UA 4MMOA 4MRIA 4U5YA 4KOYA 4YFJA 5HXDA 5JPHA 4HNYB 1B6BA 4EVYA 3PFOA 1BPNA 1XJOA 1LFWA 1XIXA 2H5MA 2REEA 3EFAA 5KTDA 3PB7X 4NGTA 4CAVA 3S9MA 2DPTA 3TO6A 1BOBA 2ZEOA 1XMBA 1ZO0A 4KUBA 1R57A 4NFRA 1IICA 2C6PA 4B6ZA 3FEEA 5IX3A 3TTHA 2EVNA 3TOAA 4LUAA 4R3KA 2B5GB 5LRGA 5HMNA 4C7HA 2R98A 4M6HA 4ZY2A 1BO4A 2FXFA 4WWVA 5J1QA 2V8DA 3JTKA 4PSXA 4PXBA 2Z3KA 1R43A 5E96A 3SHPA 1FNOA 1XMTA 2JEVA 3GYAA 3UY5A 4UBRA 1YVOA 4A32A 4FD7A 5C82A 3IGRA 5EBVA 2FCKA 3IU1A 5J8CA 4R8FA 2ZW6A 1XEBA 2EO8A 3SJFA 4IF5A 1JQGA 4EFDA 5CNPA 2IL4A 2J8MA 3D8PA 1KUXA 3H4QA 4OC4A 4IHMA 1TKFA 1ZLHA 3W6XA 2V77A 2FT0A 4MY0A 4R57A 2HC9A 4Q7AA 4ZYQA 3DR6A 3SI0A 2RB7A 3BLNA 5LRKA 1TKJA 4PV6A 4CAWA 1Z4EA 1Y0YA 4KVME 2EUIA 4E8OA 1VHOA 2HUZA 2QYVA 2WSAA 2G9DA 2JDCA 1I12A 4ZX8A 2WUUA 1ZG7A 2CNMA 3CXQA 4H89A 4P4IA 4A30A 5EMIA 5JGFA 4XNHC 3W6SA 2CIJA 3SXOA 3PRTA 3WR7A 2BO9A 2AFZA 1Z8LA 3IFEA 3TX8A 3D3SA 1CPXA 4CAXA 2OB0A 1LAPA 1Q2CA 1NSAA 1JWQA 1S7NA 4Q36A 2BSWA 2C1CA 1S7LA 4MHYA 3WABA 3EC4A 2RFHA 3I3GA 3NH5A 4FWUA 4XPLA 3FNCA 4UEZA 4WJBA 1J4JA 3KGQA 3KQZA 4AB7A 3BI1A 4TNUA 4UWIA 3RNZA 4B10A 4E0AA 4KUAA 1EE3P 4F9UA 2Q4YA 3R9GA 1YK3A 4HNWB 5DWNA 1KUYA 2B4BA 4HPSA 3FX6A 3CZXA 3S6FA 1AMPA 4A38A 1IYLA 2B4DA 4JZ0A 2GIVA 3TO7A 2ARHA 5K8MA 2FIAA 2GE3A 1Y0RA 5LYFA 2ZEFA 3B3SA 1TXRA 3IIBA 3S6GA 1I1DA 2YNDA 4IUSA 4MHDA 3NE8A 3QNVA 2WPWA 6CPAA 3DLJA 4UEEA 3I1UA 2AFOA 4BINA 4A94A 2YNCA 1NE9A 1PU9A 3GY9A 4KSIA 3GLJA 3GUXA 4E2AA 4A39A 2PJ0A 3KL9A 4HNXB 1ARLA 5G22A 1XBUA 2Z3PA 3G3SA 4XPDB 2O53A 2VXKA 3KASA 2A4NA 3ZZIA 5AG4A 4Z65A 2O28A 4NGRA 2I00A 4KLVA 2PJ5A 3PB8X 4PXCA 1XRYA 5F09A 2CF4A 4NGSA 5F48A 2QJ8A 2ZENA 5AG5A 2G0BA 2PCUA 1MJ9A 4AG7A 3T8WA 4JLYA 2PJ2A 2R7HA 2IMOA 2ABZA 4OIDA 4MHNA 4KOXA 5HH1A 4UFXA 2F8HA 3KHZA 1A2ZA 3P2HA 2GLJA 1Z2LA 2DF5A 4EWTA 2ZEHA 1YQEA 1YREA 1Z8XA 2Q0YA 2FVGA 2WYRA 3K2KA 3FXTA 3TC8A 4CYOA 2PJ3A 4OC2A 1LCPA 4II9A 2B4DB 5D29A 1M4GA 3DR8A 3H8FA 4DNCA 4CYPA 2K5TA 2Q04A 2PVVA 3KR4A 2Z3LA 2FL4A 3W91A 5JQ4A 5G20A 2CNTA 4ZY0A 3VH9A 1Z4RA 4KOWA 1WWZA 5DS0A 4A95A 4GM5A 4CGLA 5C88A 2P6GA 4ZI6A 2PC1A 3BJ7A 3H8EA 4H2KA 2EWBA 3CXPA 2P0WA 2ZELA 1M4DA 1Z5RA 4A31A 3S9LA 3SJXA 3D7DA 3PB9X 4B12A 8CPAA
chains in the Genus database with same CATH topology
4KORA 5AGEA 1I21A 3C26A 4GS4A 4KVOE 4QB9A 1CM0A 1IB1E 1QSNA 4XPKA 3QB8A 2P6FA 2VBQA 1QSTA 4JXQA 2YNEA 2ZPAA 2OZUA 4FD6A 4UCNA 5EC4A 4KVXA 3TCVA 4OAEA 1MK4A 1NSLA 4AVBA 2CY2A 4KOVA 3OWCA 3H5ZA 4H6UA 3NE7A 2B58A 3DDDA 2OZGA 4CRYB 4CYQA 5H84A 4JWPA 2CXAA 4K30A 1QSOA 3F8KA 4UA3A 4OADA 1M4IA 4AVAA 2Z3MA 2D4PA 2Z0ZA 5G1ZA 2QIRA 1CJWA 4XPDC 5A27A 5I0CA 5J8FA 2PR1A 3N7ZA 4MY3A 4ZBGA 1U6MA 2Z11A 2BL1A 3P2FA 3EO4A 4Y49C 2Z10A 3R1KA 4UCPA 2R1IA 3VWEA 1Y9WA 2Q44A 2J8NA 1LRZA 1S3ZA 4MI4A 2AE6A 4MFKA 1TIQA 4CGNA 5GCNA 4ZGYB 4PK3A 3DSBA 3VWDA 2WPXA 4B5PB 2DXQA 1YR0A 5A28A 2AJ6A 2PR8A 3QAHA 4C7IA 1M44A 2PQ8A 4C68A 4NSQA 4MFPA 1NMTA 5KTAA 2YNCC 2PRBA 3T90A 5IB0A 3TOBA 4U9YA 1Q2YA 3B8GA 2OZHA 2YGWA 2ZW4A 1MJAA 3RYOA 5AG7A 2VQYA 2BEIA 4LX9A 2CNSA 1VHSA 1KZFA 2Z3OA 2OH1A 4UFWA 4C2XA 4A2ZA 4RI1A 4YGOA 4MFQA 5F47A 1ON0A 1S5KA 2ATRA 4CAFA 4F0YA 4KOUA 2FIWA 4MFLA 4MJ8A 3ZJ0A 3I9SA 2Z3NA 2KCWA 2HV2A 4B14A 3E0KA 3T9YA 1P4NA 2B3VA 2PSWA 2R8VA 4OLLA 3D2PA 1QSMA 2FE7A 4U9ZA 1V0CA 5ISVA 2FS5A 3A9LA 3LD2A 5G21A 4KOTA 4QC6A 4RS2A 4KSAA 4I49A 2Q4VA 2J8RA 3IWEA 5H86A 4ONUA 4JXRA 4JJXA 4C2YA 4KLWA 1RO5A 4KOSA 4CRZB 4AVCA 4L8AA 2ZW5A 3BJ8A 2ZXVA 3F5BA 3LODA 3EY5A 3FRMA 3DNSA 4C2ZA 1YGHA 2D4OA 4R87A 1XF8A 2JDDA 2G3TA 1MJBA 4HKFA 3JUWA 4UCMA 5AG6A 4M3SA 5IV0A 3G8WA 4B5PA 5KTCA 2DPSA 3EXNA 2ZW7A 4CYNA 4F0XA 3GKRA 5BWAB 1S7FA 2HQYA 4MFJA 4YRHA 4B11A 3PP9A 1N71A 3SXNA 4MFZA 1Q2DA 3CXSA 2OU2A 1UFHA 4F6AA 1WK4A 1SQHA 3TT2A 3TFYA 2NMTA 3KKWA 2QMLA 1XE4A 4UWJA 4KSFA 1OZPA 4BMHA 4JD6A 4QBJA 2I79A 2VI7A 2REFA 3F0AA 2FSRA 2RC4A 2BUEA 3JVNA 2JLMA 1RXTA 4R9MA 3V8IA 3TO9A 2C27A 2VEZA 3D2MA 4NEXA 4CS0B 4CGOA 1KUVA 3FB3A 3PZJA 3PGPA 1P0HA 1IYKA 4PSWA 5F46A 2F5IA 2GANA 3IWGA 4H6ZA 3K9UA 1VKCA 4NCZA 3FBUA 1YVKA 3R9EA 3R96A 1S60A 4KZTA 1YLEA 4MBUA 3R95A 1Y7RA 1YX0A 4CAEA 4QVTA 3MGDA 4X5KA 2B3UA 2Q7BA 2PDOA 4KS9A 3S6KA 4NF1A 3S6HA 4L89A 4B5OA 2VZYA 3R9FA 4AG9A 1K4JA 2VZZA 4J3GA 4PK2A 3TE4A 4XNHB 4BBHA 1Y9KA 3IU2A 1B87A 4QUSA 4A33A 4UFVA 1M1DA 4M85A 2P6EA 1FY7A 4NXYA 4Y49B 4R3LA 2B5GA 1IIDA 4CGMA 1L0CA 1GHEA 2QECA 4ORFA 5F49A 1S7KA 3FYNA 4Q38A 2G3AA 5FVJA 1QSRA 2X7BA 2Y0MA 5DWMA 4CGPA 4FD4A 1PUAA 3FIXA 4FD5A 1Z9UA 4U5YA 4KOYA 4YFJA 5JPHA 4HNYB 1B6BA 4EVYA 1XIXA 2H5MA 3EFAA 2REEA 5KTDA 4CAVA 2DPTA 3TO6A 1BOBA 1ZO0A 4KUBA 1R57A 1IICA 5IX3A 3TTHA 2EVNA 3TOAA 4LUAA 4R3KA 2B5GB 5HMNA 4C7HA 2R98A 1BO4A 2FXFA 3JTKA 5E96A 4PSXA 2Z3KA 3SHPA 2JEVA 1XMTA 3GYAA 3UY5A 4UBRA 1YVOA 4A32A 4FD7A 5C82A 3IGRA 5EBVA 2FCKA 3IU1A 5J8CA 2ZW6A 1XEBA 4IF5A 5CNPA 2IL4A 2J8MA 3D8PA 1KUXA 3H4QA 3W6XA 2FT0A 4MY0A 4R57A 3DR6A 3BLNA 4PV6A 4CAWA 1Z4EA 4KVME 2EUIA 4E8OA 2HUZA 2WSAA 2JDCA 1I12A 2WUUA 2CNMA 3CXQA 4H89A 4A30A 4XNHC 3W6SA 3SXOA 3WR7A 3D3SA 4CAXA 2OB0A 1Q2CA 1S7NA 4Q36A 2BSWA 1S7LA 3EC4A 3I3GA 4XPLA 3FNCA 4AB7A 1J4JA 4E0AA 4UWIA 4B10A 4KUAA 2Q4YA 3R9GA 1YK3A 4HNWB 5DWNA 1KUYA 2B4BA 3S6FA 1IYLA 2B4DA 2GIVA 3TO7A 2ARHA 2FIAA 2GE3A 3S6GA 1I1DA 2YNDA 4IUSA 4MHDA 2WPWA 2YNCA 1NE9A 1PU9A 3GY9A 4E2AA 4HNXB 5G22A 2Z3PA 3G3SA 4XPDB 2VXKA 2A4NA 3ZZIA 5AG4A 2O28A 2I00A 4KLVA 5F48A 5AG5A 2G0BA 1MJ9A 4AG7A 4JLYA 2R7HA 4KOXA 5HH1A 4UFXA 3P2HA 1YREA 2Q0YA 3FXTA 4CYOA 4II9A 2B4DB 1M4GA 3DR8A 4DNCA 4CYPA 2K5TA 2Q04A 2Z3LA 2FL4A 3W91A 5JQ4A 5G20A 2CNTA 4CGLA 1Z4RA 4KOWA 1WWZA 4A95A 5C88A 2P6GA 2PC1A 3BJ7A 3CXPA 2P0WA 1M4DA 4A31A 4B13A 4B12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOR A;  1I21 A;  3C26 A;  4GS4 A;  4KVO E;  4QB9 A;  1CM0 A;  1IB1 E;  1QSN A;  4XPK A;  3QB8 A;  2P6F A;  2VBQ A;  1QST A;  4JXQ A;  2ZPA A;  2OZU A;  4FD6 A;  5EC4 A;  4KVX A;  3TCV A;  4OAE A;  1MK4 A;  1NSL A;  4AVB A;  2CY2 A;  4KOV A;  3OWC A;  4H6U A;  3NE7 A;  2B58 A;  3DDD A;  2OZG A;  4CRY B;  5H84 A;  4JWP A;  4K30 A;  1QSO A;  3F8K A;  4UA3 A;  4OAD A;  1M4I A;  4AVA A;  2D4P A;  2Z0Z A;  2QIR A;  1CJW A;  4XPD C;  5I0C A;  5J8F A;  2PR1 A;  3N7Z A;  4MY3 A;  4ZBG A;  1U6M A;  2Z11 A;  2BL1 A;  3P2F A;  3EO4 A;  4Y49 C;  2Z10 A;  3R1K A;  2R1I A;  3VWE A;  1Y9W A;  2Q44 A;  2J8N A;  1LRZ A;  1S3Z A;  4MI4 A;  2AE6 A;  1TIQ A;  5GCN A;  4PK3 A;  3DSB A;  3VWD A;  2WPX A;  4B5P B;  2DXQ A;  1YR0 A;  2AJ6 A;  2PR8 A;  3QAH A;  1M44 A;  2PQ8 A;  4NSQ A;  1NMT A;  5KTA A;  2PRB A;  3T90 A;  5IB0 A;  3TOB A;  4U9Y A;  1Q2Y A;  3B8G A;  2OZH A;  2ZW4 A;  1MJA A;  3RYO A;  2VQY A;  2BEI A;  4LX9 A;  2CNS A;  1VHS A;  1KZF A;  2OH1 A;  4RI1 A;  4YGO A;  5F47 A;  1ON0 A;  1S5K A;  2ATR A;  4F0Y A;  4KOU A;  2FIW A;  4MJ8 A;  3ZJ0 A;  3I9S A;  2KCW A;  2HV2 A;  3E0K A;  3T9Y A;  1P4N A;  2B3V A;  2PSW A;  2R8V A;  4OLL A;  3D2P A;  1QSM A;  2FE7 A;  4U9Z A;  1V0C A;  5ISV A;  2FS5 A;  3LD2 A;  4KOT A;  4QC6 A;  4RS2 A;  4I49 A;  2Q4V A;  2J8R A;  5H86 A;  4ONU A;  4JXR A;  4JJX A;  4KLW A;  1RO5 A;  4KOS A;  4CRZ B;  4AVC A;  4L8A A;  2ZW5 A;  3BJ8 A;  2ZXV A;  3F5B A;  3LOD A;  3EY5 A;  3FRM A;  3DNS A;  1YGH A;  2D4O A;  4R87 A;  1XF8 A;  2JDD A;  2G3T A;  1MJB A;  4HKF A;  3JUW A;  4M3S A;  5IV0 A;  3G8W A;  4B5P A;  5KTC A;  3EXN A;  2ZW7 A;  3GKR A;  1S7F A;  2HQY A;  4YRH A;  3PP9 A;  1N71 A;  3SXN A;  1Q2D A;  3CXS A;  2OU2 A;  1UFH A;  4F6A A;  1WK4 A;  1SQH A;  3TT2 A;  3TFY A;  2NMT A;  3KKW A;  2QML A;  1XE4 A;  4UWJ A;  1OZP A;  4BMH A;  4JD6 A;  4QBJ A;  2I79 A;  2VI7 A;  2REF A;  3F0A A;  2FSR A;  2RC4 A;  2BUE A;  3JVN A;  2JLM A;  1RXT A;  4R9M A;  3V8I A;  3TO9 A;  2C27 A;  2VEZ A;  3D2M A;  4NEX A;  4CS0 B;  1KUV A;  3FB3 A;  3PZJ A;  3PGP A;  1P0H A;  1IYK A;  4PSW A;  5F46 A;  2F5I A;  2GAN A;  3IWG A;  4H6Z A;  3K9U A;  1VKC A;  4NCZ A;  3FBU A;  1YVK A;  3R9E A;  3R96 A;  1S60 A;  4KZT A;  1YLE A;  4MBU A;  3R95 A;  1Y7R A;  1YX0 A;  4QVT A;  3MGD A;  4X5K A;  2B3U A;  2Q7B A;  2PDO A;  3S6K A;  4NF1 A;  3S6H A;  4L89 A;  4B5O A;  2VZY A;  3R9F A;  4AG9 A;  1K4J A;  2VZZ A;  4J3G A;  4PK2 A;  3TE4 A;  4XNH B;  1Y9K A;  1B87 A;  4QUS A;  1M1D A;  4M85 A;  2P6E A;  1FY7 A;  4NXY A;  4Y49 B;  4R3L A;  2B5G A;  1IID A;  1L0C A;  1GHE A;  2QEC A;  4ORF A;  5F49 A;  1S7K A;  3FYN A;  2G3A A;  5FVJ A;  1QSR A;  2X7B A;  2Y0M A;  5DWM A;  4FD4 A;  1PUA A;  3FIX A;  4FD5 A;  1Z9U A;  4U5Y A;  4KOY A;  4YFJ A;  5JPH A;  4HNY B;  1B6B A;  4EVY A;  1XIX A;  2H5M A;  3EFA A;  2REE A;  5KTD A;  4CAV A;  3TO6 A;  1BOB A;  4KUB A;  1R57 A;  1IIC A;  5IX3 A;  3TTH A;  2EVN A;  3TOA A;  4LUA A;  4R3K A;  2B5G B;  5HMN A;  2R98 A;  1BO4 A;  2FXF A;  5E96 A;  4PSX A;  3SHP A;  2JEV A;  1XMT A;  3GYA A;  3UY5 A;  4UBR A;  1YVO A;  4FD7 A;  5C82 A;  3IGR A;  5EBV A;  2FCK A;  5J8C A;  2ZW6 A;  1XEB A;  4IF5 A;  5CNP A;  2IL4 A;  2J8M A;  3D8P A;  1KUX A;  3H4Q A;  3W6X A;  2FT0 A;  4MY0 A;  4R57 A;  3DR6 A;  3BLN A;  4PV6 A;  4CAW A;  1Z4E A;  4KVM E;  2EUI A;  4E8O A;  2HUZ A;  2JDC A;  1I12 A;  2CNM A;  3CXQ A;  4H89 A;  4XNH C;  3W6S A;  3SXO A;  3WR7 A;  3D3S A;  4CAX A;  2OB0 A;  1Q2C A;  1S7N A;  2BSW A;  1S7L A;  3EC4 A;  3I3G A;  4XPL A;  3FNC A;  4AB7 A;  1J4J A;  4E0A A;  4UWI A;  4KUA A;  2Q4Y A;  3R9G A;  1YK3 A;  4HNW B;  5DWN A;  1KUY A;  2B4B A;  3S6F A;  1IYL A;  2B4D A;  2GIV A;  3TO7 A;  2ARH A;  2FIA A;  2GE3 A;  3S6G A;  1I1D A;  4IUS A;  4MHD A;  2WPW A;  1NE9 A;  1PU9 A;  3GY9 A;  4E2A A;  4HNX B;  3G3S A;  4XPD B;  2VXK A;  2A4N A;  3ZZI A;  2O28 A;  2I00 A;  4KLV A;  5F48 A;  2G0B A;  1MJ9 A;  4AG7 A;  4JLY A;  2R7H A;  4KOX A;  5HH1 A;  3P2H A;  1YRE A;  2Q0Y A;  3FXT A;  4II9 A;  2B4D B;  1M4G A;  3DR8 A;  4DNC A;  2K5T A;  2Q04 A;  2FL4 A;  3W91 A;  5JQ4 A;  2CNT A;  1Z4R A;  4KOW A;  1WWZ A;  5C88 A;  2P6G A;  2PC1 A;  3BJ7 A;  3CXP A;  2P0W A;  1M4D A; 
#chains in the Genus database with same CATH topology
 4KOR A;  5AGE A;  3V38 A;  1I21 A;  1DTD A;  3C26 A;  4GS4 A;  4KVO E;  1CM0 A;  1IB1 E;  1DE4 C;  1QSN A;  2PJ1 A;  4XPK A;  3QB8 A;  4FUU A;  2PJC A;  2P6F A;  2VBQ A;  1QST A;  4UIA A;  2ZEG A;  2YNE A;  4JXQ A;  3LMS A;  4PXE A;  2VL1 A;  4NGQ A;  2ZPA A;  2OZU A;  4FD6 A;  4UCN A;  5EC4 A;  4KVX A;  3TCV A;  1UWY A;  2ZOG A;  4OAE A;  1M4L A;  1MK4 A;  3PEI A;  4MCS A;  2PJ6 A;  1NSL A;  4AVB A;  2CY2 A;  2IQ6 A;  4KOV A;  4MCQ A;  2EK9 A;  1F2P A;  3H5Z A;  3OWC A;  4H6U A;  3NE7 A;  2B58 A;  3DDD A;  2OZG A;  4CRY B;  3NFZ A;  1ZG8 A;  4CYQ A;  4X3R A;  5H84 A;  4JWP A;  1LOK A;  2CXA A;  5K8P A;  4K30 A;  4NGM A;  1QSO A;  3F8K A;  4UA3 A;  4OAD A;  1M4I A;  3GIU A;  4P6Y A;  2XEF A;  4AVA A;  2Z3M A;  1KWM A;  2PVW A;  2D4P A;  2GRE A;  3IC1 A;  2ODF A;  2Z0Z A;  3B2Y A;  3VAT A;  5G1Z A;  1GYT A;  2QIR A;  1CJW A;  4XPD C;  5A27 A;  5I0C A;  3PB6 X;  2HB6 A;  5J8F A;  2PR1 A;  4A37 A;  3N7Z A;  4MY3 A;  2PJA A;  4P44 A;  4M6G A;  1CP7 A;  4ZBG A;  1U6M A;  2Z11 A;  4OKO A;  2BL1 A;  3FEC A;  3P2F A;  1YLO A;  5LYD A;  2OR4 A;  3EO4 A;  4R7M A;  2QVP A;  2Z10 A;  4IAV A;  4Y49 C;  2DEA A;  4NGN A;  2GU2 A;  2F7V A;  3L2N A;  3R1K A;  2R1I A;  4UCP A;  2IJZ A;  3VWE A;  2PRQ A;  1Y9W A;  3D67 A;  2Q44 A;  3DGV A;  3D7H A;  1XOV A;  2J8N A;  1LRZ A;  3D7G A;  4NGP A;  4EME A;  1S3Z A;  4MI4 A;  2AE6 A;  4JYW A;  4ONW A;  4MFK A;  4OC3 A;  4MCP A;  1TIQ A;  4RUH A;  4PPZ A;  5D8N A;  4CGN A;  5GCN A;  4ZGY B;  3D4U A;  4PK3 A;  3DSB A;  3VWD A;  2WPX A;  2PE3 A;  4B5P B;  2DXQ A;  3S9N A;  4UF4 A;  3SI2 A;  2Q51 A;  1OBR A;  4W9Y A;  1YR0 A;  5A28 A;  2AJ6 A;  2PR8 A;  3PFE A;  3QAH A;  4C7I A;  1M44 A;  2PQ8 A;  3SJG A;  3LWU A;  2BCO A;  4C68 A;  4ZX9 A;  3D66 A;  4NSQ A;  4MFP A;  1NMT A;  1QQ9 A;  5CPA A;  3B7I A;  1Y7E A;  4DJL A;  5KTA A;  1BLL E;  2YNC C;  2PRB A;  4RN7 A;  4X2T A;  3CT9 A;  7CPA A;  4MCR A;  3T90 A;  1IGB A;  5HVG A;  1X12 A;  5IB0 A;  3TOB A;  4U9Y A;  1Q2Y A;  3B8G A;  3MN8 A;  4P4D A;  1CG2 A;  4DYO A;  2OZH A;  2YGW A;  4QB9 A;  2ZW4 A;  1IOF A;  1MJA A;  5AG7 A;  3RYO A;  2VQY A;  5LYI A;  2BEI A;  4LX9 A;  2CNS A;  1VHS A;  1KZF A;  2PIY A;  2OH1 A;  2Z3O A;  4OIW A;  1CP6 A;  4UFW A;  4C2X A;  4DUK A;  4A2Z A;  4RI1 A;  4YGO A;  2I3C A;  4MFQ A;  3IO1 A;  3PB4 X;  5F47 A;  1ON0 A;  1S5K A;  1HDQ A;  2ATR A;  1ARM A;  4OME A;  1QMU A;  4CAF A;  4F0Y A;  5LYL A;  4KOU A;  2FIW A;  2CTB A;  4MFL A;  4MJ8 A;  3ZJ0 A;  3I9S A;  2Z3N A;  2XEG A;  4K3N A;  4P4B A;  2KCW A;  2HV2 A;  4R6T A;  4B14 A;  3E0K A;  3T9Y A;  1P4N A;  2B3V A;  2PSW A;  2R8V A;  4OLL A;  3D2P A;  3KR5 A;  2V8H A;  1QSM A;  2POK A;  5K8O A;  2FE7 A;  4U9Z A;  1V0C A;  4NJQ A;  3CPX A;  3SI1 A;  3N5F A;  2PIZ A;  2JBK A;  5ISV A;  2JBJ A;  2FS5 A;  3A9L A;  2WZN A;  3LD2 A;  4P45 A;  4UEF A;  5G21 A;  2ZED A;  4KOT A;  4QC6 A;  1TF9 A;  5LRJ A;  4LQ6 A;  4RS2 A;  4KSA A;  1YSJ A;  4I49 A;  4P4F A;  1YW6 A;  3FH4 A;  3H8G A;  2AFM A;  2Q4V A;  2J8R A;  3IWE A;  5H86 A;  4ONU A;  4PXD A;  1XFO A;  3ISZ A;  4JXR A;  2ZOF A;  3FJU A;  4JJX A;  3FF3 A;  2J9A A;  2PJB A;  3WC5 A;  3D7F A;  5THW A;  4C2Y A;  2PJ7 A;  1RO5 A;  4KLW A;  4KOS A;  4CRZ B;  2OOT A;  4AVC A;  4L8A A;  2ZW5 A;  3BJ8 A;  2ZXV A;  4MXU A;  1AUG A;  3F5B A;  4O23 A;  3QAY A;  3LOD A;  3EY5 A;  2V8G A;  3NH4 A;  3FRM A;  1TF8 A;  3B3W A;  3DNS A;  3GB0 A;  3SJE A;  3BI0 A;  4C2Z A;  3V7Z A;  1YGH A;  2C6G A;  2D4O A;  4R87 A;  4CPA A;  2JEW A;  1XF8 A;  2JDD A;  3LAC A;  2Q7S A;  4GXH A;  2G3T A;  1MJB A;  4HKF A;  3VAR A;  3JUW A;  3RAM A;  3B35 A;  4UCM A;  4G1P A;  5AG6 A;  4M3S A;  5IV0 A;  3G8W A;  4B5P A;  5KTC A;  2DPS A;  1BAV A;  4IK2 A;  3EXN A;  3ISX A;  2ZW7 A;  4CYN A;  4F0X A;  1Z8W A;  3GKR A;  1Z8T A;  5BWA B;  1CPS A;  1S7F A;  2HQY A;  4MFJ A;  1HDU A;  3B3C A;  4OC1 A;  4YRH A;  4OC0 A;  4B11 A;  1PYT B;  1TKH A;  1N71 A;  2PJ4 A;  3PP9 A;  3IJ3 A;  3SXN A;  3HLP A;  4TWE A;  4MFZ A;  1Q2D A;  2O4H A;  3CXS A;  2OU2 A;  1UFH A;  3KI9 A;  4F6A A;  1VIX A;  1WK4 A;  3WC7 A;  1SQH A;  3TT2 A;  4P4J A;  2NMT A;  4MHZ A;  3TFY A;  3KKW A;  4YU9 A;  3FVL A;  2QML A;  1IU8 A;  1XE4 A;  1YME A;  4UWJ A;  4KSF A;  3CPA A;  3JRU A;  4AXV A;  5JM6 A;  1OZP A;  4BMH A;  4JD6 A;  3RO0 A;  3WC6 A;  4QBJ A;  3FED A;  2I79 A;  4OP4 A;  1ELL P;  2ZEP A;  2AFW A;  2V8V A;  2VI7 A;  3BHX A;  2REF A;  4PQA A;  5HVH A;  2Q4Z A;  3F0A A;  2FSR A;  2NYQ A;  1HEE A;  3PBE A;  4FBE A;  2RC4 A;  2AFS A;  2BUE A;  2AFU A;  3JVN A;  2JLM A;  1RXT A;  4R9M A;  3IEH A;  3V8I A;  1IY7 A;  4MHP A;  2NSM A;  3TO9 A;  3NA6 A;  2C27 A;  5CBM A;  2ZEE A;  1F57 A;  2VEZ A;  2GLF A;  3D2M A;  1AYE A;  4NEX A;  4CS0 B;  4CGO A;  1LAN A;  3IWW A;  1KUV A;  3FB3 A;  3PZJ A;  3PGP A;  1P0H A;  2XEI A;  1IYK A;  3KQX A;  4NJR A;  4PSW A;  5F46 A;  1Q7L A;  3PBB A;  4P10 A;  2F5I A;  2GAN A;  4B13 A;  3IWG A;  4OC5 A;  4YWY A;  4H6Z A;  3HUV A;  3K9U A;  1YW4 A;  1VKC A;  4NCZ A;  3FBU A;  1YVK A;  3R9E A;  3R96 A;  3RZA A;  3B3V A;  3NH8 A;  1IOI A;  2CTC A;  1S60 A;  4KZT A;  4UIB A;  3WT4 A;  1YLE A;  4MBU A;  3R95 A;  1R3N A;  1Y7R A;  1VGY A;  1CBX A;  1YX0 A;  2Q43 A;  4CAE A;  4QVT A;  3MGD A;  2BOA A;  3FMC A;  2AFX A;  2B3U A;  4X5K A;  5HVF A;  2Q7B A;  5IB9 A;  2PDO A;  4KS9 A;  4BD9 A;  4ZY1 A;  3S6K A;  3KHX A;  3KZW A;  4NF1 A;  1FT7 A;  3S6H A;  4L89 A;  4B5O A;  2PJ8 A;  2VZY A;  5JH9 A;  1F2O A;  4M6I A;  5I4M A;  1CX8 A;  1ELM P;  2EK8 A;  1K4J A;  3R9F A;  4X8I A;  2VZZ A;  4AG9 A;  4J3G A;  4PK2 A;  3TE4 A;  1VHE A;  2ANP A;  1H8L A;  4XNH B;  4BBH A;  1Y9K A;  3IU2 A;  1B87 A;  2XEJ A;  4QUS A;  3RBU A;  4A33 A;  4UFV A;  1ZG9 A;  1M1D A;  3CDX A;  4M85 A;  2P6E A;  4LQG A;  1FY7 A;  4NXY A;  1PCA A;  4Y49 B;  4R3L A;  2B5G A;  1IID A;  2GFQ A;  5K8N A;  2EBJ A;  4CGM A;  1L0C A;  1GHE A;  2QEC A;  4ORF A;  4F9V A;  5F49 A;  1S7K A;  4R76 A;  2ZEM A;  4F8Z A;  3FYN A;  1X10 A;  3B3T A;  3BXM A;  4Q38 A;  2G3A A;  3D68 A;  1ZLI A;  3MRU A;  5FVJ A;  1QSR A;  2X7B A;  2Y0M A;  1BPM A;  5ELY A;  5DWM A;  4FAI A;  4CGP A;  4FD4 A;  1LAM A;  1PUA A;  3K9T A;  4P4E A;  1RTQ A;  3FIX A;  2C6C A;  2PJ9 A;  4FD5 A;  1Z9U A;  4MMO A;  4MRI A;  4U5Y A;  4KOY A;  4YFJ A;  5HXD A;  5JPH A;  4HNY B;  1B6B A;  4EVY A;  3PFO A;  1BPN A;  1XJO A;  1LFW A;  1XIX A;  2H5M A;  2REE A;  3EFA A;  5KTD A;  3PB7 X;  4NGT A;  4CAV A;  3S9M A;  2DPT A;  3TO6 A;  1BOB A;  2ZEO A;  1XMB A;  1ZO0 A;  4KUB A;  1R57 A;  4NFR A;  1IIC A;  2C6P A;  4B6Z A;  3FEE A;  5IX3 A;  3TTH A;  2EVN A;  3TOA A;  4LUA A;  4R3K A;  2B5G B;  5LRG A;  5HMN A;  4C7H A;  2R98 A;  4M6H A;  4ZY2 A;  1BO4 A;  2FXF A;  4WWV A;  5J1Q A;  2V8D A;  3JTK A;  4PSX A;  4PXB A;  2Z3K A;  1R43 A;  5E96 A;  3SHP A;  1FNO A;  1XMT A;  2JEV A;  3GYA A;  3UY5 A;  4UBR A;  1YVO A;  4A32 A;  4FD7 A;  5C82 A;  3IGR A;  5EBV A;  2FCK A;  3IU1 A;  5J8C A;  4R8F A;  2ZW6 A;  1XEB A;  2EO8 A;  3SJF A;  4IF5 A;  1JQG A;  4EFD A;  5CNP A;  2IL4 A;  2J8M A;  3D8P A;  1KUX A;  3H4Q A;  4OC4 A;  4IHM A;  1TKF A;  1ZLH A;  3W6X A;  2V77 A;  2FT0 A;  4MY0 A;  4R57 A;  2HC9 A;  4Q7A A;  4ZYQ A;  3DR6 A;  3SI0 A;  2RB7 A;  3BLN A;  5LRK A;  1TKJ A;  4PV6 A;  4CAW A;  1Z4E A;  1Y0Y A;  4KVM E;  2EUI A;  4E8O A;  1VHO A;  2HUZ A;  2QYV A;  2WSA A;  2G9D A;  2JDC A;  1I12 A;  4ZX8 A;  2WUU A;  1ZG7 A;  2CNM A;  3CXQ A;  4H89 A;  4P4I A;  4A30 A;  5EMI A;  5JGF A;  4XNH C;  3W6S A;  2CIJ A;  3SXO A;  3PRT A;  3WR7 A;  2BO9 A;  2AFZ A;  1Z8L A;  3IFE A;  3TX8 A;  3D3S A;  1CPX A;  4CAX A;  2OB0 A;  1LAP A;  1Q2C A;  1NSA A;  1JWQ A;  1S7N A;  4Q36 A;  2BSW A;  2C1C A;  1S7L A;  4MHY A;  3WAB A;  3EC4 A;  2RFH A;  3I3G A;  3NH5 A;  4FWU A;  4XPL A;  3FNC A;  4UEZ A;  4WJB A;  1J4J A;  3KGQ A;  3KQZ A;  4AB7 A;  3BI1 A;  4TNU A;  4UWI A;  3RNZ A;  4B10 A;  4E0A A;  4KUA A;  1EE3 P;  4F9U A;  2Q4Y A;  3R9G A;  1YK3 A;  4HNW B;  5DWN A;  1KUY A;  2B4B A;  4HPS A;  3FX6 A;  3CZX A;  3S6F A;  1AMP A;  4A38 A;  1IYL A;  2B4D A;  4JZ0 A;  2GIV A;  3TO7 A;  2ARH A;  5K8M A;  2FIA A;  2GE3 A;  1Y0R A;  5LYF A;  2ZEF A;  3B3S A;  1TXR A;  3IIB A;  3S6G A;  1I1D A;  2YND A;  4IUS A;  4MHD A;  3NE8 A;  3QNV A;  2WPW A;  6CPA A;  3DLJ A;  4UEE A;  3I1U A;  2AFO A;  4BIN A;  4A94 A;  2YNC A;  1NE9 A;  1PU9 A;  3GY9 A;  4KSI A;  3GLJ A;  3GUX A;  4E2A A;  4A39 A;  2PJ0 A;  3KL9 A;  4HNX B;  1ARL A;  5G22 A;  1XBU A;  2Z3P A;  3G3S A;  4XPD B;  2O53 A;  2VXK A;  3KAS A;  2A4N A;  3ZZI A;  5AG4 A;  4Z65 A;  2O28 A;  4NGR A;  2I00 A;  4KLV A;  2PJ5 A;  3PB8 X;  4PXC A;  1XRY A;  5F09 A;  2CF4 A;  4NGS A;  5F48 A;  2QJ8 A;  2ZEN A;  5AG5 A;  2G0B A;  2PCU A;  1MJ9 A;  4AG7 A;  3T8W A;  4JLY A;  2PJ2 A;  2R7H A;  2IMO A;  2ABZ A;  4OID A;  4MHN A;  4KOX A;  5HH1 A;  4UFX A;  2F8H A;  3KHZ A;  1A2Z A;  3P2H A;  2GLJ A;  1Z2L A;  2DF5 A;  4EWT A;  2ZEH A;  1YQE A;  1YRE A;  1Z8X A;  2Q0Y A;  2FVG A;  2WYR A;  3K2K A;  3FXT A;  3TC8 A;  4CYO A;  2PJ3 A;  4OC2 A;  1LCP A;  4II9 A;  2B4D B;  5D29 A;  1M4G A;  3DR8 A;  3H8F A;  4DNC A;  4CYP A;  2K5T A;  2Q04 A;  2PVV A;  3KR4 A;  2Z3L A;  2FL4 A;  3W91 A;  5JQ4 A;  5G20 A;  2CNT A;  4ZY0 A;  3VH9 A;  1Z4R A;  4KOW A;  1WWZ A;  5DS0 A;  4A95 A;  4GM5 A;  4CGL A;  5C88 A;  2P6G A;  4ZI6 A;  2PC1 A;  3BJ7 A;  3H8E A;  4H2K A;  2EWB A;  3CXP A;  2P0W A;  2ZEL A;  1M4D A;  1Z5R A;  4A31 A;  3S9L A;  3SJX A;  3D7D A;  3PB9 X;  4B12 A;  8CPA A; 
#chains in the Genus database with same CATH homology
 4KOR A;  5AGE A;  1I21 A;  3C26 A;  4GS4 A;  4KVO E;  4QB9 A;  1CM0 A;  1IB1 E;  1QSN A;  4XPK A;  3QB8 A;  2P6F A;  2VBQ A;  1QST A;  4JXQ A;  2YNE A;  2ZPA A;  2OZU A;  4FD6 A;  4UCN A;  5EC4 A;  4KVX A;  3TCV A;  4OAE A;  1MK4 A;  1NSL A;  4AVB A;  2CY2 A;  4KOV A;  3OWC A;  3H5Z A;  4H6U A;  3NE7 A;  2B58 A;  3DDD A;  2OZG A;  4CRY B;  4CYQ A;  5H84 A;  4JWP A;  2CXA A;  4K30 A;  1QSO A;  3F8K A;  4UA3 A;  4OAD A;  1M4I A;  4AVA A;  2Z3M A;  2D4P A;  2Z0Z A;  5G1Z A;  2QIR A;  1CJW A;  4XPD C;  5A27 A;  5I0C A;  5J8F A;  2PR1 A;  3N7Z A;  4MY3 A;  4ZBG A;  1U6M A;  2Z11 A;  2BL1 A;  3P2F A;  3EO4 A;  4Y49 C;  2Z10 A;  3R1K A;  4UCP A;  2R1I A;  3VWE A;  1Y9W A;  2Q44 A;  2J8N A;  1LRZ A;  1S3Z A;  4MI4 A;  2AE6 A;  4MFK A;  1TIQ A;  4CGN A;  5GCN A;  4ZGY B;  4PK3 A;  3DSB A;  3VWD A;  2WPX A;  4B5P B;  2DXQ A;  1YR0 A;  5A28 A;  2AJ6 A;  2PR8 A;  3QAH A;  4C7I A;  1M44 A;  2PQ8 A;  4C68 A;  4NSQ A;  4MFP A;  1NMT A;  5KTA A;  2YNC C;  2PRB A;  3T90 A;  5IB0 A;  3TOB A;  4U9Y A;  1Q2Y A;  3B8G A;  2OZH A;  2YGW A;  2ZW4 A;  1MJA A;  3RYO A;  5AG7 A;  2VQY A;  2BEI A;  4LX9 A;  2CNS A;  1VHS A;  1KZF A;  2Z3O A;  2OH1 A;  4UFW A;  4C2X A;  4A2Z A;  4RI1 A;  4YGO A;  4MFQ A;  5F47 A;  1ON0 A;  1S5K A;  2ATR A;  4CAF A;  4F0Y A;  4KOU A;  2FIW A;  4MFL A;  4MJ8 A;  3ZJ0 A;  3I9S A;  2Z3N A;  2KCW A;  2HV2 A;  4B14 A;  3E0K A;  3T9Y A;  1P4N A;  2B3V A;  2PSW A;  2R8V A;  4OLL A;  3D2P A;  1QSM A;  2FE7 A;  4U9Z A;  1V0C A;  5ISV A;  2FS5 A;  3A9L A;  3LD2 A;  5G21 A;  4KOT A;  4QC6 A;  4RS2 A;  4KSA A;  4I49 A;  2Q4V A;  2J8R A;  3IWE A;  5H86 A;  4ONU A;  4JXR A;  4JJX A;  4C2Y A;  4KLW A;  1RO5 A;  4KOS A;  4CRZ B;  4AVC A;  4L8A A;  2ZW5 A;  3BJ8 A;  2ZXV A;  3F5B A;  3LOD A;  3EY5 A;  3FRM A;  3DNS A;  4C2Z A;  1YGH A;  2D4O A;  4R87 A;  1XF8 A;  2JDD A;  2G3T A;  1MJB A;  4HKF A;  3JUW A;  4UCM A;  5AG6 A;  4M3S A;  5IV0 A;  3G8W A;  4B5P A;  5KTC A;  2DPS A;  3EXN A;  2ZW7 A;  4CYN A;  4F0X A;  3GKR A;  5BWA B;  1S7F A;  2HQY A;  4MFJ A;  4YRH A;  4B11 A;  3PP9 A;  1N71 A;  3SXN A;  4MFZ A;  1Q2D A;  3CXS A;  2OU2 A;  1UFH A;  4F6A A;  1WK4 A;  1SQH A;  3TT2 A;  3TFY A;  2NMT A;  3KKW A;  2QML A;  1XE4 A;  4UWJ A;  4KSF A;  1OZP A;  4BMH A;  4JD6 A;  4QBJ A;  2I79 A;  2VI7 A;  2REF A;  3F0A A;  2FSR A;  2RC4 A;  2BUE A;  3JVN A;  2JLM A;  1RXT A;  4R9M A;  3V8I A;  3TO9 A;  2C27 A;  2VEZ A;  3D2M A;  4NEX A;  4CS0 B;  4CGO A;  1KUV A;  3FB3 A;  3PZJ A;  3PGP A;  1P0H A;  1IYK A;  4PSW A;  5F46 A;  2F5I A;  2GAN A;  3IWG A;  4H6Z A;  3K9U A;  1VKC A;  4NCZ A;  3FBU A;  1YVK A;  3R9E A;  3R96 A;  1S60 A;  4KZT A;  1YLE A;  4MBU A;  3R95 A;  1Y7R A;  1YX0 A;  4CAE A;  4QVT A;  3MGD A;  4X5K A;  2B3U A;  2Q7B A;  2PDO A;  4KS9 A;  3S6K A;  4NF1 A;  3S6H A;  4L89 A;  4B5O A;  2VZY A;  3R9F A;  4AG9 A;  1K4J A;  2VZZ A;  4J3G A;  4PK2 A;  3TE4 A;  4XNH B;  4BBH A;  1Y9K A;  3IU2 A;  1B87 A;  4QUS A;  4A33 A;  4UFV A;  1M1D A;  4M85 A;  2P6E A;  1FY7 A;  4NXY A;  4Y49 B;  4R3L A;  2B5G A;  1IID A;  4CGM A;  1L0C A;  1GHE A;  2QEC A;  4ORF A;  5F49 A;  1S7K A;  3FYN A;  4Q38 A;  2G3A A;  5FVJ A;  1QSR A;  2X7B A;  2Y0M A;  5DWM A;  4CGP A;  4FD4 A;  1PUA A;  3FIX A;  4FD5 A;  1Z9U A;  4U5Y A;  4KOY A;  4YFJ A;  5JPH A;  4HNY B;  1B6B A;  4EVY A;  1XIX A;  2H5M A;  3EFA A;  2REE A;  5KTD A;  4CAV A;  2DPT A;  3TO6 A;  1BOB A;  1ZO0 A;  4KUB A;  1R57 A;  1IIC A;  5IX3 A;  3TTH A;  2EVN A;  3TOA A;  4LUA A;  4R3K A;  2B5G B;  5HMN A;  4C7H A;  2R98 A;  1BO4 A;  2FXF A;  3JTK A;  5E96 A;  4PSX A;  2Z3K A;  3SHP A;  2JEV A;  1XMT A;  3GYA A;  3UY5 A;  4UBR A;  1YVO A;  4A32 A;  4FD7 A;  5C82 A;  3IGR A;  5EBV A;  2FCK A;  3IU1 A;  5J8C A;  2ZW6 A;  1XEB A;  4IF5 A;  5CNP A;  2IL4 A;  2J8M A;  3D8P A;  1KUX A;  3H4Q A;  3W6X A;  2FT0 A;  4MY0 A;  4R57 A;  3DR6 A;  3BLN A;  4PV6 A;  4CAW A;  1Z4E A;  4KVM E;  2EUI A;  4E8O A;  2HUZ A;  2WSA A;  2JDC A;  1I12 A;  2WUU A;  2CNM A;  3CXQ A;  4H89 A;  4A30 A;  4XNH C;  3W6S A;  3SXO A;  3WR7 A;  3D3S A;  4CAX A;  2OB0 A;  1Q2C A;  1S7N A;  4Q36 A;  2BSW A;  1S7L A;  3EC4 A;  3I3G A;  4XPL A;  3FNC A;  4AB7 A;  1J4J A;  4E0A A;  4UWI A;  4B10 A;  4KUA A;  2Q4Y A;  3R9G A;  1YK3 A;  4HNW B;  5DWN A;  1KUY A;  2B4B A;  3S6F A;  1IYL A;  2B4D A;  2GIV A;  3TO7 A;  2ARH A;  2FIA A;  2GE3 A;  3S6G A;  1I1D A;  2YND A;  4IUS A;  4MHD A;  2WPW A;  2YNC A;  1NE9 A;  1PU9 A;  3GY9 A;  4E2A A;  4HNX B;  5G22 A;  2Z3P A;  3G3S A;  4XPD B;  2VXK A;  2A4N A;  3ZZI A;  5AG4 A;  2O28 A;  2I00 A;  4KLV A;  5F48 A;  5AG5 A;  2G0B A;  1MJ9 A;  4AG7 A;  4JLY A;  2R7H A;  4KOX A;  5HH1 A;  4UFX A;  3P2H A;  1YRE A;  2Q0Y A;  3FXT A;  4CYO A;  4II9 A;  2B4D B;  1M4G A;  3DR8 A;  4DNC A;  4CYP A;  2K5T A;  2Q04 A;  2Z3L A;  2FL4 A;  3W91 A;  5JQ4 A;  5G20 A;  2CNT A;  4CGL A;  1Z4R A;  4KOW A;  1WWZ A;  4A95 A;  5C88 A;  2P6G A;  2PC1 A;  3BJ7 A;  3CXP A;  2P0W A;  1M4D A;  4A31 A;  4B13 A;  4B12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...