4ZBVB

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with benzyl t-antigen
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
261
Chain Sequence
NEQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA N-glycosidase
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule tags Hydrolase
total genus 80
structure length 261
sequence length 261
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zbvB01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zbvB02
3VSZA 3OJVA 3WINC 3BRDA 3AKGA 4I2SA 1G9BA 4OWKA 3BAQA 2VXTI 2Y9XE 2MIBA 3H6QA 1HWNB 2QYIB 5JMCA 4IZXA 3JUTA 1HWMB 1BFFA 4I4OA 1FMZA 4I96A 3CRHA 4L4IA 2NVHA 1F31A 4TLPA 5FZYA 4J23B 1DIWA 4X3AA 4ZGRB 4IYBA 3H6SE 3IM5A 4OEEA 4KEKA 3C9ZA 5BOWA 1TIEA 1T9FA 3BAHA 3ZXGA 3WO4A 3MALA 3FJKA 3O49A 1S0CA 2BEAA 1EVTA 3VSFA 2E4MC 4JPZA 1YTOA 3IM6A 1PZZA 1IRAX 3UJ0A 2FFUA 1WD4A 1M16A 4JKXB 4OEFA 4IONA 3F62B 1AF9A 4ZFUB 1AVAC 2K43A 2Q3NB 3FUQA 3WO2A 4AN6A 3AZVA 1S0BA 3B9UA 1UPSA 3VUOA 4QALA 3R4UA 3OJMA 2KI4A 4A7KA 3RMYA 4Z9WB 3A07A 4OUJA 4G6JA 3HMYA 5D62A 3A23A 3WMUA 2LIQA 4AN7B 2YUGA 1G9CA 1KNMA 3LLPA 2BFHA 4I4QA 2F2FA 41BIA 4XKIA 4P0JA 3Q7YA 3N7KA 1DJSB 5D61A 3BRGC 2K4AB 3CA5A 1II4A 4G6MA 4I4PA 1JY0A 4DEPA 3QYDA 4II0A 5BXRA 4CJMA 2VU9A 1DFQA 1ABRB 3FJBA 3VT2A 1HWPB 3AKHA 3FJ8A 1GGPB 1ISXA 3ZC8A 3FJHA 2D22A 2ET2A 3Q7XA 4QKSA 1JT3A 4IHZA 2F2FC 4J2SA 3H6RA 1BFGA 1AVXB 2DRZA 3O44A 3AJ6A 2D7RA 9ILBA 4Q9PA 3VT0A 1S0GA 1XZZA 2X2TA 1FGAA 1DQOA 4GOVA 1Z4SA 1MC9A 1BFBA 3SNVA 4IQPA 3UD8A 4I6IA 5EHAA 3FJDA 1YF8B 4JP0A 1EPWA 3OBRA 4QBVA 5BQUC 6I1BA 4LO2A 3HOMA 3AH4A 3F1RA 1JQZA 4JKQA 5BXTA 3RTJB 5FNWA 2RG9B 2I1BA 1YYNA 2Z49A 4I7IA 1FWUA 3HSMA 1L2HA 2ZQOA 4LO3A 4I8MA 4ZFYB 3AKIA 4I4VA 3IM7A 2HWAA 4JQ0A 1RY7A 4LO2C 4USPA 3W9TA 4I4UA 4GOYA 4EFQA 4I4SA 2KH2A 4Q9GA 1FWVA 3UD9A 3EF2A 3PHZA 2VLCA 2M49A 4I4YA 3PG0A 1NZKA 3D7WB 3ILAA 4J2KA 4EFRA 3BAUA 3IAGC 4DENA 2RSTA 1N4KA 4LO0A 2DRYA 3ZC9A 3HBWA 4I1BA 1R8OA 2NTDA 4XFSA 2ERMA 1HIBA 1IT0A 1G9DA 4ENDA 4HR6C 3BADA 3PMEA 5D63A 1P63A 1QXMA 1XYFA 1FMMS 2P39A 2NZ9A 1RG8A 1S0FA 1RZOB 4KC3A 3AZWA 5B2HA 3BX1C 3O3QA 1V6XA 1FV2A 4GP3A 4EB2B 2KLLA 4QO3A 1S0EA 3FFZA 1VCLA 3AH1A 5GAQA 3HN1A 2R9KB 5F8YA 4OWLA 1IOBA 1R8NA 1IHKA 3UD7A 1HCDA 3POKA 4D8HA 2D1ZA 3FJJA 3FJCA 1RMLA 1IJTA 3A22A 1JT5A 1NUNA 1BARA 1CE7B 4WBCA 2HZ9A 2VUAA 5F90A 1WBCA 1HCEA 2WRYA 1HWOB 1JT4A 5DSSB 31BIA 3KMVA 3T8SA 2J3PA 3N7JA 1ONKB 4X39A 4X38A 4R6UB 5FNXA 1IILA 2IHOA 4ZFWB 3Q7WA 2MLLB 3O5WB 5BXSA 4J2YA 3A21A 4I0YA 2AQZA 1TTUA 3PUBA 2HWMA 4QC4A 3OJ2A 4P0LA 3AJ5A 3VWCA 5F8SA 2NYYA 1DZDA 1W3GA 1W3AA 3RTIB 1BFCA 4OW4A 3ZX7A 5JLVA 5I1BA 2NP0A 2GO2A 3R4SA 3OGGA 4I37A 1DFCA 2HW9A 3N7MA 3NJ5A 4D0ZA 2NM1A 3AKFA 4LO7C 1I1BA 1Q03A 4IZEA 1M2TB 1OQLB 5DZUA 2K8RA 3CQAA 4GP0A 1PWAA 4ISQA 4ZKTB 4LO8B 2Z48A 4EFPA 2RQ9A 5BP5A 5HPZA 3I2AA 1IRPA 5EC5A 2XOAA 4LO7B 3TC2A 1MD6A 3BAVA 3FJFA 4I1EA 4Q91A 3RSJA 3FGMA 4P6AA 3OGFA 1ISWA 3H6RB 3VEQA 7I1BA 3JRRA 1J0SA 3OBTA 3CA1A 4LO1A 3WMVA 1V6VA 5BP5C 1WD3A 2L5XA 4H04A 3WINA 3P53A 1TWMA 2FGFA 1SR4A 2ZR1B 4A7ZA 2BEBA 4X37A 2P23A 1HKNA 2KKIA 3N7LA 1AXMA 4KEJA 3WA1A 4LO3C 4P0KA 3CA0A 1I1EA 5FZUA 4HA2A 21BIA 4IY9A 3O4CA 1K5UA 3BA4A 3N0KA 3FJ9A 4JRAA 1S0DA 4J2XA 1E0OA 2Y9FA 1SR4C 1XG6A 4QD2C 1DQGA 2AAIB 1BA7A 3O4BA 1V6WA 1A8DA 1ITBA 5DUYA 4GAIA 1FN0A 2MC2A 4I4RA 2E4MA 1AVWB 4ZOTA 4G9MA 4I3NA 1V6UA 5G00A 3LTQA 4JAWA 4LO0C 2FDBM 4QD2B 2FFVA 3VT1A 3CRIA 2GZBA 5E24E 1AFCA 3BAOA 3P6JA 1QQKA 4PC4A 3UDAA 3CA4A 4HJJA 4XFUA 2FO1A 4FGFA 3V0AA 4KBBA 2X2SA 2Y9WC 3BB2A 3V79C 1QQLA 1XHBA 1TP0A 2AFGA 3S8KA 2D7IA 3O4AA 1PUUB 3K1XA 1FQ9A 3O4OA 3CRGA 2QN4A 4I4XA 3HALA 1Z2VA 5F8WA 1Q04A 5FZZA 2IWTB 1TOOA 1PUMB 1JTCA 1YXWA 4F34A 2Q9XA 3BTAA 2D24A 2LIEA 5BVPI 3BA7A 1YBIA 3RMXA 1DZCA 1T4QA 4IY8A 3UJ4A 3NBEA 1ISVA 5EG6C 3I2XA 1CVSA 3V0AB 1FV3A 3V0BA 2KI6B 4XFTA 1D0HA 3AH2A 4ISRA 1TWEA 3NBDA 1JLXA 4OWJA 1JT7A 3P6IA 4GAFA 4QBCA 2VSEA 1SZ6B 1ISZA 2VSAA 3IIRA 3NBCA 4KEIA 3E8LC 4YOLA 1W3FA 4FVVA 4Z8SB 1BLDA 4A7YA 4D0TA 4OEGA 4ZBVB 5BQUA 1BASA 1ISYA 3CAHA 3FJIA 2UUSA 3WO3A 8I1BA 4EEEB 2Y9GA 4G1RA 1JLYA 3NBNA 5DVHA 3FUOA 2DS0A 1PC8B 2ZQNA 3BRFA 3ZXDA 1G9AA 2ESUA 4L4HA 1K5VA 1S0LA 3I29B 5BXPA 3V0BB 2D23A 2D20A 3FJEA 3CA3A 3BA5A 3CU1B 1EYLA 4G9NA 1WBAA 1ILR1 1EV2A 1DLLA 3QR5A 4DCKC 1Q1UA 4USOA 2WBCA 4F83A 3FJAA 2D44A 4QKRA 3O4DA 1Z0HA 1G82A 2AXMA 2DREA 3BAGA 1BLAA 3MPPG 4EKXB 4LO1C 4ZLBB 2D43A 1AVUA 4ZA3B 3S8JA 2F8XC 2VXRA 3CA6A 4H9WA 1TFMB
chains in the Genus database with same CATH superfamily
3VSZA 3OJVA 3WINC 3BRDA 3AKGA 4I2SA 1G9BA 4OWKA 3BAQA 2VXTI 2Y9XE 2MIBA 3H6QA 1HWNB 2QYIB 5JMCA 4IZXA 3JUTA 1HWMB 1BFFA 4I4OA 1FMZA 4I96A 3CRHA 4L4IA 2NVHA 1F31A 4TLPA 5FZYA 4J23B 1DIWA 4X3AA 4ZGRB 4IYBA 3H6SE 3IM5A 4OEEA 4KEKA 3C9ZA 5BOWA 1TIEA 1T9FA 3BAHA 3ZXGA 3WO4A 3MALA 3FJKA 3O49A 1S0CA 2BEAA 1EVTA 3VSFA 2E4MC 4JPZA 1YTOA 3IM6A 1PZZA 1IRAX 3UJ0A 2FFUA 1WD4A 1M16A 4JKXB 4OEFA 4IONA 3F62B 1AF9A 4ZFUB 1AVAC 2K43A 2Q3NB 3FUQA 3WO2A 4AN6A 3AZVA 1S0BA 3B9UA 1UPSA 3VUOA 4QALA 3R4UA 3OJMA 2KI4A 4A7KA 3RMYA 4Z9WB 3A07A 4OUJA 4G6JA 3HMYA 5D62A 3A23A 3WMUA 2LIQA 4AN7B 2YUGA 1G9CA 1KNMA 3LLPA 2BFHA 4I4QA 2F2FA 41BIA 4XKIA 4P0JA 3Q7YA 3N7KA 1DJSB 5D61A 3BRGC 2K4AB 3CA5A 1II4A 4G6MA 4I4PA 1JY0A 4DEPA 4MZGB 3QYDA 4II0A 5BXRA 4CJMA 2VU9A 1DFQA 1ABRB 3FJBA 3VT2A 1HWPB 3AKHA 3FJ8A 1GGPB 1ISXA 3ZC8A 3FJHA 2D22A 2ET2A 3Q7XA 4QKSA 1JT3A 4IHZA 2F2FC 4J2SA 3H6RA 1BFGA 1AVXB 2DRZA 3O44A 3AJ6A 2D7RA 9ILBA 4Q9PA 3VT0A 1S0GA 1XZZA 2X2TA 1FGAA 1DQOA 4GOVA 1Z4SA 1MC9A 1BFBA 3SNVA 4IQPA 3UD8A 4I6IA 5EHAA 3FJDA 1YF8B 4JP0A 1EPWA 3OBRA 4QBVA 5BQUC 6I1BA 4LO2A 3HOMA 3AH4A 3F1RA 1JQZA 4JKQA 5BXTA 3RTJB 5FNWA 2RG9B 2I1BA 1YYNA 2Z49A 4I7IA 1FWUA 3HSMA 1L2HA 2ZQOA 4LO3A 4I8MA 4ZFYB 3AKIA 4I4VA 3IM7A 2HWAA 4JQ0A 1RY7A 4LO2C 4USPA 3W9TA 4I4UA 4GOYA 4EFQA 4I4SA 2KH2A 4Q9GA 1FWVA 3UD9A 3EF2A 3PHZA 2VLCA 2M49A 4I4YA 3PG0A 1NZKA 3D7WB 3ILAA 4J2KA 4EFRA 3BAUA 3IAGC 4DENA 2RSTA 4MZHA 1N4KA 4LO0A 2DRYA 3ZC9A 3HBWA 4I1BA 1R8OA 2NTDA 4XFSA 2ERMA 1HIBA 1IT0A 1G9DA 4ENDA 4HR6C 3BADA 3PMEA 5D63A 1P63A 1QXMA 1XYFA 1FMMS 2P39A 2NZ9A 1RG8A 1S0FA 1RZOB 4KC3A 3AZWA 5B2HA 3BX1C 3O3QA 1V6XA 1FV2A 4GP3A 4EB2B 2KLLA 4QO3A 1S0EA 3FFZA 1VCLA 3AH1A 5GAQA 3HN1A 2R9KB 5F8YA 4OWLA 1IOBA 1R8NA 1IHKA 3UD7A 1HCDA 3POKA 4D8HA 2D1ZA 3FJJA 3FJCA 1RMLA 1IJTA 3A22A 1JT5A 1NUNA 1BARA 1CE7B 4WBCA 2HZ9A 2VUAA 5F90A 1WBCA 1HCEA 2WRYA 1HWOB 1JT4A 5DSSB 31BIA 3KMVA 3T8SA 2J3PA 3N7JA 1ONKB 4X39A 4X38A 4R6UB 5FNXA 1IILA 2IHOA 4ZFWB 3Q7WA 2MLLB 3O5WB 5BXSA 4J2YA 3A21A 4I0YA 2AQZA 1TTUA 3PUBA 2HWMA 4QC4A 3OJ2A 4P0LA 3AJ5A 3VWCA 5F8SA 2NYYA 4UY4A 1DZDA 1W3GA 1W3AA 3RTIB 1BFCA 4OW4A 3ZX7A 5JLVA 5I1BA 2NP0A 2GO2A 3R4SA 3OGGA 4I37A 1DFCA 2HW9A 3N7MA 3NJ5A 4D0ZA 2NM1A 3AKFA 4LO7C 1I1BA 1Q03A 4IZEA 1M2TB 1OQLB 5DZUA 2K8RA 3CQAA 4GP0A 1PWAA 4MZFB 4ISQA 4ZKTB 4LO8B 2Z48A 4EFPA 2RQ9A 5BP5A 5HPZA 3I2AA 1IRPA 5EC5A 2XOAA 4LO7B 3TC2A 1MD6A 3BAVA 3FJFA 4I1EA 4Q91A 3RSJA 3FGMA 4P6AA 3OGFA 1ISWA 3H6RB 3VEQA 7I1BA 3JRRA 1J0SA 3OBTA 3CA1A 4LO1A 3WMVA 1V6VA 5BP5C 1WD3A 2L5XA 4H04A 3WINA 3P53A 1TWMA 2FGFA 1SR4A 2ZR1B 4A7ZA 2BEBA 4X37A 2P23A 1HKNA 2KKIA 3N7LA 1AXMA 4KEJA 3WA1A 4LO3C 4P0KA 3CA0A 1I1EA 5FZUA 4HA2A 21BIA 4IY9A 3O4CA 1K5UA 3BA4A 3N0KA 3FJ9A 4JRAA 1S0DA 4J2XA 1E0OA 2Y9FA 1SR4C 1XG6A 4QD2C 1DQGA 2AAIB 1BA7A 3O4BA 1V6WA 2NS2A 1A8DA 1ITBA 5DUYA 4GAIA 1FN0A 2MC2A 4I4RA 2E4MA 1AVWB 4ZOTA 4G9MA 4I3NA 1V6UA 5G00A 3LTQA 4JAWA 4LO0C 2FDBM 4QD2B 2FFVA 3VT1A 3CRIA 2GZBA 5E24E 1AFCA 3BAOA 3P6JA 1QQKA 4PC4A 3UDAA 3CA4A 4HJJA 4XFUA 2FO1A 4FGFA 3V0AA 4KBBA 2X2SA 2Y9WC 3BB2A 3V79C 1QQLA 1XHBA 1TP0A 2AFGA 3S8KA 2D7IA 3O4AA 1PUUB 3K1XA 1FQ9A 3O4OA 3CRGA 2QN4A 4I4XA 3HALA 1Z2VA 5F8WA 1Q04A 5FZZA 2IWTB 1TOOA 1PUMB 1JTCA 1YXWA 4F34A 2Q9XA 3BTAA 2D24A 2LIEA 5BVPI 3BA7A 1YBIA 3RMXA 1DZCA 1T4QA 4IY8A 3UJ4A 3NBEA 1ISVA 5EG6C 3I2XA 1CVSA 3V0AB 1FV3A 3V0BA 2KI6B 4XFTA 1D0HA 3AH2A 4ISRA 1TWEA 3NBDA 1JLXA 4OWJA 1JT7A 3P6IA 4GAFA 4QBCA 2VSEA 1SZ6B 1ISZA 2VSAA 3IIRA 3NBCA 4KEIA 3E8LC 4YOLA 1W3FA 4FVVA 4Z8SB 1BLDA 4A7YA 4D0TA 4OEGA 4ZBVB 5BQUA 1BASA 1ISYA 3CAHA 3FJIA 2UUSA 3WO3A 8I1BA 4EEEB 2Y9GA 4G1RA 1JLYA 3NBNA 5DVHA 3FUOA 2DS0A 1PC8B 2ZQNA 3BRFA 3ZXDA 1G9AA 2ESUA 4L4HA 1K5VA 1S0LA 3I29B 5BXPA 3V0BB 2D23A 2D20A 3FJEA 3CA3A 3BA5A 4H75A 3CU1B 1EYLA 4G9NA 1WBAA 1ILR1 1EV2A 1DLLA 3QR5A 4DCKC 1Q1UA 4USOA 2WBCA 4F83A 3FJAA 2D44A 4QKRA 3O4DA 1Z0HA 1G82A 2AXMA 2DREA 3BAGA 1BLAA 3MPPG 4EKXB 4LO1C 4ZLBB 2D43A 1AVUA 4ZA3B 3S8JA 2F8XC 2VXRA 3CA6A 4H9WA 1TFMB
chains in the Genus database with same CATH topology
3VSZA 3OJVA 3WINC 3BRDA 3AKGA 4I2SA 1G9BA 4OWKA 3BAQA 2VXTI 2Y9XE 2MIBA 3H6QA 1HWNB 2QYIB 5JMCA 4IZXA 3JUTA 1HWMB 1BFFA 4I4OA 1FMZA 4I96A 3CRHA 4L4IA 2NVHA 1F31A 4TLPA 5FZYA 4J23B 1DIWA 4X3AA 4ZGRB 4IYBA 3H6SE 3IM5A 4OEEA 4KEKA 3C9ZA 5BOWA 1TIEA 1T9FA 3BAHA 3ZXGA 3WO4A 3MALA 3FJKA 3O49A 1S0CA 2BEAA 1EVTA 3VSFA 2E4MC 4JPZA 1YTOA 3IM6A 1PZZA 1IRAX 3UJ0A 2FFUA 1WD4A 1M16A 4JKXB 4OEFA 4IONA 3F62B 1AF9A 4ZFUB 1AVAC 2K43A 2Q3NB 3FUQA 3WO2A 4AN6A 3AZVA 1S0BA 3B9UA 1UPSA 3VUOA 4QALA 3R4UA 3OJMA 2KI4A 4A7KA 3RMYA 4Z9WB 3A07A 4OUJA 4G6JA 3HMYA 5D62A 3A23A 3WMUA 2LIQA 4AN7B 2YUGA 1G9CA 1KNMA 3LLPA 2BFHA 4I4QA 2F2FA 41BIA 4XKIA 4P0JA 3Q7YA 3N7KA 1DJSB 5D61A 3BRGC 2K4AB 3CA5A 1II4A 4G6MA 4I4PA 1JY0A 4DEPA 4MZGB 3QYDA 4II0A 5BXRA 4CJMA 2VU9A 1DFQA 1ABRB 3FJBA 3VT2A 1HWPB 3AKHA 3FJ8A 1GGPB 1ISXA 3ZC8A 3FJHA 2D22A 2ET2A 3Q7XA 4QKSA 1JT3A 4IHZA 2F2FC 4J2SA 3H6RA 1BFGA 1AVXB 2DRZA 3O44A 3AJ6A 2D7RA 9ILBA 4Q9PA 3VT0A 1S0GA 1XZZA 2X2TA 1FGAA 1DQOA 4GOVA 1Z4SA 1MC9A 1BFBA 3SNVA 4IQPA 3UD8A 4I6IA 5EHAA 3FJDA 1YF8B 4JP0A 1EPWA 3OBRA 4QBVA 5BQUC 6I1BA 4LO2A 3HOMA 3AH4A 3F1RA 1JQZA 4JKQA 5BXTA 3RTJB 5FNWA 2RG9B 2I1BA 1YYNA 2Z49A 4I7IA 1FWUA 3HSMA 1L2HA 2ZQOA 4LO3A 4I8MA 4ZFYB 3AKIA 4I4VA 3IM7A 2HWAA 4JQ0A 1RY7A 4LO2C 4USPA 3W9TA 4I4UA 4GOYA 4EFQA 4I4SA 2KH2A 4Q9GA 1FWVA 3UD9A 3EF2A 3PHZA 2VLCA 2M49A 4I4YA 3PG0A 1NZKA 3D7WB 3ILAA 4J2KA 4EFRA 3BAUA 3IAGC 4DENA 2RSTA 4MZHA 1N4KA 4LO0A 2DRYA 3ZC9A 3HBWA 4I1BA 1R8OA 2NTDA 4XFSA 2ERMA 1HIBA 1IT0A 1G9DA 4ENDA 4HR6C 3BADA 3PMEA 5D63A 1P63A 1QXMA 1XYFA 1FMMS 2P39A 2NZ9A 1RG8A 1S0FA 1RZOB 4KC3A 3AZWA 5B2HA 3BX1C 3O3QA 1V6XA 1FV2A 4GP3A 4EB2B 2KLLA 4QO3A 1S0EA 3FFZA 1VCLA 3AH1A 5GAQA 3HN1A 2R9KB 5F8YA 4OWLA 1IOBA 1R8NA 1IHKA 3UD7A 1HCDA 3POKA 4D8HA 2D1ZA 3FJJA 3FJCA 1RMLA 1IJTA 3A22A 1JT5A 1NUNA 1BARA 1CE7B 4WBCA 2HZ9A 2VUAA 5F90A 1WBCA 1HCEA 2WRYA 1HWOB 1JT4A 5DSSB 31BIA 3KMVA 3T8SA 2J3PA 3N7JA 1ONKB 4X39A 4X38A 4R6UB 5FNXA 1IILA 2IHOA 4ZFWB 3Q7WA 2MLLB 3O5WB 5BXSA 4J2YA 3A21A 4I0YA 2AQZA 1TTUA 3PUBA 2HWMA 4QC4A 3OJ2A 4P0LA 3AJ5A 3VWCA 5F8SA 2NYYA 4UY4A 1DZDA 1W3GA 1W3AA 3RTIB 1BFCA 4OW4A 3ZX7A 5JLVA 5I1BA 2NP0A 2GO2A 3R4SA 3OGGA 4I37A 1DFCA 2HW9A 3N7MA 3NJ5A 4D0ZA 2NM1A 3AKFA 4LO7C 1I1BA 1Q03A 4IZEA 1M2TB 1OQLB 5DZUA 2K8RA 3CQAA 4GP0A 1PWAA 4MZFB 4ISQA 4ZKTB 4LO8B 2Z48A 4EFPA 2RQ9A 5BP5A 5HPZA 3I2AA 1IRPA 5EC5A 2XOAA 4LO7B 3TC2A 1MD6A 3BAVA 3FJFA 4I1EA 4Q91A 3RSJA 3FGMA 4P6AA 3OGFA 1ISWA 3H6RB 3VEQA 7I1BA 3JRRA 1J0SA 3OBTA 3CA1A 4LO1A 3WMVA 1V6VA 5BP5C 1WD3A 2L5XA 4H04A 3WINA 3P53A 1TWMA 2FGFA 1SR4A 2ZR1B 4A7ZA 2BEBA 4X37A 2P23A 1HKNA 2KKIA 3N7LA 1AXMA 4KEJA 3WA1A 4LO3C 4P0KA 3CA0A 1I1EA 5FZUA 4HA2A 21BIA 4IY9A 3O4CA 1K5UA 3BA4A 3N0KA 3FJ9A 4JRAA 1S0DA 4J2XA 1E0OA 2Y9FA 1SR4C 1XG6A 4QD2C 1DQGA 2AAIB 1BA7A 3O4BA 1V6WA 2NS2A 1A8DA 1ITBA 5DUYA 4GAIA 1FN0A 2MC2A 4I4RA 2E4MA 1AVWB 4ZOTA 4G9MA 4I3NA 1V6UA 5G00A 3LTQA 4JAWA 4LO0C 2FDBM 4QD2B 2FFVA 3VT1A 3CRIA 2GZBA 5E24E 1AFCA 3BAOA 3P6JA 1QQKA 4PC4A 3UDAA 3CA4A 4HJJA 4XFUA 2FO1A 4FGFA 3V0AA 4KBBA 2X2SA 2Y9WC 3BB2A 3V79C 1QQLA 1XHBA 1TP0A 2AFGA 3S8KA 2D7IA 3O4AA 1PUUB 3K1XA 1FQ9A 3O4OA 3CRGA 2QN4A 4I4XA 3HALA 1Z2VA 5F8WA 1Q04A 5FZZA 2IWTB 1TOOA 1PUMB 1JTCA 1YXWA 4F34A 2Q9XA 3BTAA 2D24A 2LIEA 5BVPI 3BA7A 1YBIA 3RMXA 1DZCA 1T4QA 4IY8A 3UJ4A 3NBEA 1ISVA 5EG6C 3I2XA 1CVSA 3V0AB 1FV3A 3V0BA 2KI6B 4XFTA 1D0HA 3AH2A 4ISRA 1TWEA 3NBDA 1JLXA 4OWJA 1JT7A 3P6IA 4GAFA 4QBCA 2VSEA 1SZ6B 1ISZA 2VSAA 3IIRA 3NBCA 4KEIA 3E8LC 4YOLA 1W3FA 4FVVA 4Z8SB 1BLDA 4A7YA 4D0TA 4OEGA 4ZBVB 5BQUA 1BASA 1ISYA 3CAHA 3FJIA 2UUSA 3WO3A 8I1BA 4EEEB 2Y9GA 4G1RA 1JLYA 3NBNA 5DVHA 3FUOA 2DS0A 1PC8B 2ZQNA 3BRFA 3ZXDA 1G9AA 2ESUA 4L4HA 1K5VA 1S0LA 3I29B 5BXPA 3V0BB 2D23A 2D20A 3FJEA 3CA3A 3BA5A 4H75A 3CU1B 1EYLA 4G9NA 1WBAA 1ILR1 1EV2A 1DLLA 3QR5A 4DCKC 1Q1UA 4USOA 2WBCA 4F83A 3FJAA 2D44A 4QKRA 3O4DA 1Z0HA 1G82A 2AXMA 2DREA 3BAGA 1BLAA 3MPPG 4EKXB 4LO1C 4ZLBB 2D43A 1AVUA 4ZA3B 3S8JA 2F8XC 2VXRA 3CA6A 4H9WA 1TFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSZ A;  3OJV A;  3WIN C;  3BRD A;  3AKG A;  4I2S A;  1G9B A;  4OWK A;  3BAQ A;  2VXT I;  2Y9X E;  2MIB A;  3H6Q A;  1HWN B;  2QYI B;  5JMC A;  4IZX A;  3JUT A;  1HWM B;  1BFF A;  4I4O A;  1FMZ A;  4I96 A;  3CRH A;  4L4I A;  2NVH A;  1F31 A;  4TLP A;  5FZY A;  4J23 B;  1DIW A;  4X3A A;  4ZGR B;  4IYB A;  3H6S E;  3IM5 A;  4OEE A;  4KEK A;  3C9Z A;  5BOW A;  1TIE A;  1T9F A;  3BAH A;  3ZXG A;  3WO4 A;  3MAL A;  3FJK A;  3O49 A;  1S0C A;  2BEA A;  1EVT A;  3VSF A;  2E4M C;  4JPZ A;  1YTO A;  3IM6 A;  1PZZ A;  1IRA X;  3UJ0 A;  2FFU A;  1WD4 A;  1M16 A;  4JKX B;  4OEF A;  4ION A;  3F62 B;  1AF9 A;  4ZFU B;  1AVA C;  2K43 A;  2Q3N B;  3FUQ A;  3WO2 A;  4AN6 A;  3AZV A;  1S0B A;  3B9U A;  1UPS A;  3VUO A;  4QAL A;  3R4U A;  3OJM A;  2KI4 A;  4A7K A;  3RMY A;  4Z9W B;  3A07 A;  4OUJ A;  4G6J A;  3HMY A;  5D62 A;  3A23 A;  3WMU A;  2LIQ A;  4AN7 B;  2YUG A;  1G9C A;  1KNM A;  3LLP A;  2BFH A;  4I4Q A;  2F2F A;  41BI A;  4XKI A;  4P0J A;  3Q7Y A;  3N7K A;  1DJS B;  5D61 A;  3BRG C;  2K4A B;  3CA5 A;  1II4 A;  4G6M A;  4I4P A;  1JY0 A;  4DEP A;  3QYD A;  4II0 A;  5BXR A;  4CJM A;  2VU9 A;  1DFQ A;  1ABR B;  3FJB A;  3VT2 A;  1HWP B;  3AKH A;  3FJ8 A;  1GGP B;  1ISX A;  3ZC8 A;  3FJH A;  2D22 A;  2ET2 A;  3Q7X A;  4QKS A;  1JT3 A;  4IHZ A;  2F2F C;  4J2S A;  3H6R A;  1BFG A;  1AVX B;  2DRZ A;  3O44 A;  3AJ6 A;  2D7R A;  9ILB A;  4Q9P A;  3VT0 A;  1S0G A;  1XZZ A;  2X2T A;  1FGA A;  1DQO A;  4GOV A;  1Z4S A;  1MC9 A;  1BFB A;  3SNV A;  4IQP A;  3UD8 A;  4I6I A;  5EHA A;  3FJD A;  1YF8 B;  4JP0 A;  1EPW A;  3OBR A;  4QBV A;  5BQU C;  6I1B A;  4LO2 A;  3HOM A;  3AH4 A;  3F1R A;  1JQZ A;  4JKQ A;  5BXT A;  3RTJ B;  5FNW A;  2RG9 B;  2I1B A;  1YYN A;  2Z49 A;  4I7I A;  1FWU A;  3HSM A;  1L2H A;  2ZQO A;  4LO3 A;  4I8M A;  4ZFY B;  3AKI A;  4I4V A;  3IM7 A;  2HWA A;  4JQ0 A;  1RY7 A;  4LO2 C;  4USP A;  3W9T A;  4I4U A;  4GOY A;  4EFQ A;  4I4S A;  2KH2 A;  4Q9G A;  1FWV A;  3UD9 A;  3EF2 A;  3PHZ A;  2VLC A;  2M49 A;  4I4Y A;  3PG0 A;  1NZK A;  3D7W B;  3ILA A;  4J2K A;  4EFR A;  3BAU A;  3IAG C;  4DEN A;  2RST A;  1N4K A;  4LO0 A;  2DRY A;  3ZC9 A;  3HBW A;  4I1B A;  1R8O A;  2NTD A;  4XFS A;  2ERM A;  1HIB A;  1IT0 A;  1G9D A;  4END A;  4HR6 C;  3BAD A;  3PME A;  5D63 A;  1P63 A;  1QXM A;  1XYF A;  1FMM S;  2P39 A;  2NZ9 A;  1RG8 A;  1S0F A;  1RZO B;  4KC3 A;  3AZW A;  5B2H A;  3BX1 C;  3O3Q A;  1V6X A;  1FV2 A;  4GP3 A;  4EB2 B;  2KLL A;  4QO3 A;  1S0E A;  3FFZ A;  1VCL A;  3AH1 A;  5GAQ A;  3HN1 A;  2R9K B;  5F8Y A;  4OWL A;  1IOB A;  1R8N A;  1IHK A;  3UD7 A;  1HCD A;  3POK A;  4D8H A;  2D1Z A;  3FJJ A;  3FJC A;  1RML A;  1IJT A;  3A22 A;  1JT5 A;  1NUN A;  1BAR A;  1CE7 B;  4WBC A;  2HZ9 A;  2VUA A;  5F90 A;  1WBC A;  1HCE A;  2WRY A;  1HWO B;  1JT4 A;  5DSS B;  31BI A;  3KMV A;  3T8S A;  2J3P A;  3N7J A;  1ONK B;  4X39 A;  4X38 A;  4R6U B;  5FNX A;  1IIL A;  2IHO A;  4ZFW B;  3Q7W A;  2MLL B;  3O5W B;  5BXS A;  4J2Y A;  3A21 A;  4I0Y A;  2AQZ A;  1TTU A;  3PUB A;  2HWM A;  4QC4 A;  3OJ2 A;  4P0L A;  3AJ5 A;  3VWC A;  5F8S A;  2NYY A;  1DZD A;  1W3G A;  1W3A A;  3RTI B;  1BFC A;  4OW4 A;  3ZX7 A;  5JLV A;  5I1B A;  2NP0 A;  2GO2 A;  3R4S A;  3OGG A;  4I37 A;  1DFC A;  2HW9 A;  3N7M A;  3NJ5 A;  4D0Z A;  2NM1 A;  3AKF A;  4LO7 C;  1I1B A;  1Q03 A;  4IZE A;  1M2T B;  1OQL B;  5DZU A;  2K8R A;  3CQA A;  4GP0 A;  1PWA A;  4ISQ A;  4ZKT B;  4LO8 B;  2Z48 A;  4EFP A;  2RQ9 A;  5BP5 A;  5HPZ A;  3I2A A;  1IRP A;  5EC5 A;  2XOA A;  4LO7 B;  3TC2 A;  1MD6 A;  3BAV A;  3FJF A;  4I1E A;  4Q91 A;  3RSJ A;  3FGM A;  4P6A A;  3OGF A;  1ISW A;  3H6R B;  3VEQ A;  7I1B A;  3JRR A;  1J0S A;  3OBT A;  3CA1 A;  4LO1 A;  3WMV A;  1V6V A;  5BP5 C;  1WD3 A;  2L5X A;  4H04 A;  3WIN A;  3P53 A;  1TWM A;  2FGF A;  1SR4 A;  2ZR1 B;  4A7Z A;  2BEB A;  4X37 A;  2P23 A;  1HKN A;  2KKI A;  3N7L A;  1AXM A;  4KEJ A;  3WA1 A;  4LO3 C;  4P0K A;  3CA0 A;  1I1E A;  5FZU A;  4HA2 A;  21BI A;  4IY9 A;  3O4C A;  1K5U A;  3BA4 A;  3N0K A;  3FJ9 A;  4JRA A;  1S0D A;  4J2X A;  1E0O A;  2Y9F A;  1SR4 C;  1XG6 A;  4QD2 C;  1DQG A;  2AAI B;  1BA7 A;  3O4B A;  1V6W A;  1A8D A;  1ITB A;  5DUY A;  4GAI A;  1FN0 A;  2MC2 A;  4I4R A;  2E4M A;  1AVW B;  4ZOT A;  4G9M A;  4I3N A;  1V6U A;  5G00 A;  3LTQ A;  4JAW A;  4LO0 C;  2FDB M;  4QD2 B;  2FFV A;  3VT1 A;  3CRI A;  2GZB A;  5E24 E;  1AFC A;  3BAO A;  3P6J A;  1QQK A;  4PC4 A;  3UDA A;  3CA4 A;  4HJJ A;  4XFU A;  2FO1 A;  4FGF A;  3V0A A;  4KBB A;  2X2S A;  2Y9W C;  3BB2 A;  3V79 C;  1QQL A;  1XHB A;  1TP0 A;  2AFG A;  3S8K A;  2D7I A;  3O4A A;  1PUU B;  3K1X A;  1FQ9 A;  3O4O A;  3CRG A;  2QN4 A;  4I4X A;  3HAL A;  1Z2V A;  5F8W A;  1Q04 A;  5FZZ A;  2IWT B;  1TOO A;  1PUM B;  1JTC A;  1YXW A;  4F34 A;  2Q9X A;  3BTA A;  2D24 A;  2LIE A;  5BVP I;  3BA7 A;  1YBI A;  3RMX A;  1DZC A;  1T4Q A;  4IY8 A;  3UJ4 A;  3NBE A;  1ISV A;  5EG6 C;  3I2X A;  1CVS A;  3V0A B;  1FV3 A;  3V0B A;  2KI6 B;  4XFT A;  1D0H A;  3AH2 A;  4ISR A;  1TWE A;  3NBD A;  1JLX A;  4OWJ A;  1JT7 A;  3P6I A;  4GAF A;  4QBC A;  2VSE A;  1SZ6 B;  1ISZ A;  2VSA A;  3IIR A;  3NBC A;  4KEI A;  3E8L C;  4YOL A;  1W3F A;  4FVV A;  4Z8S B;  1BLD A;  4A7Y A;  4D0T A;  4OEG A;  4ZBV B;  5BQU A;  1BAS A;  1ISY A;  3CAH A;  3FJI A;  2UUS A;  3WO3 A;  8I1B A;  4EEE B;  2Y9G A;  4G1R A;  1JLY A;  3NBN A;  5DVH A;  3FUO A;  2DS0 A;  1PC8 B;  2ZQN A;  3BRF A;  3ZXD A;  1G9A A;  2ESU A;  4L4H A;  1K5V A;  1S0L A;  3I29 B;  5BXP A;  3V0B B;  2D23 A;  2D20 A;  3FJE A;  3CA3 A;  3BA5 A;  3CU1 B;  1EYL A;  4G9N A;  1WBA A;  1ILR 1;  1EV2 A;  1DLL A;  3QR5 A;  4DCK C;  1Q1U A;  4USO A;  2WBC A;  4F83 A;  3FJA A;  2D44 A;  4QKR A;  3O4D A;  1Z0H A;  1G82 A;  2AXM A;  2DRE A;  3BAG A;  1BLA A;  3MPP G;  4EKX B;  4LO1 C;  4ZLB B;  2D43 A;  1AVU A;  4ZA3 B;  3S8J A;  2F8X C;  2VXR A;  3CA6 A;  4H9W A;  1TFM B; 
#chains in the Genus database with same CATH topology
 3VSZ A;  3OJV A;  3WIN C;  3BRD A;  3AKG A;  4I2S A;  1G9B A;  4OWK A;  3BAQ A;  2VXT I;  2Y9X E;  2MIB A;  3H6Q A;  1HWN B;  2QYI B;  5JMC A;  4IZX A;  3JUT A;  1HWM B;  1BFF A;  4I4O A;  1FMZ A;  4I96 A;  3CRH A;  4L4I A;  2NVH A;  1F31 A;  4TLP A;  5FZY A;  4J23 B;  1DIW A;  4X3A A;  4ZGR B;  4IYB A;  3H6S E;  3IM5 A;  4OEE A;  4KEK A;  3C9Z A;  5BOW A;  1TIE A;  1T9F A;  3BAH A;  3ZXG A;  3WO4 A;  3MAL A;  3FJK A;  3O49 A;  1S0C A;  2BEA A;  1EVT A;  3VSF A;  2E4M C;  4JPZ A;  1YTO A;  3IM6 A;  1PZZ A;  1IRA X;  3UJ0 A;  2FFU A;  1WD4 A;  1M16 A;  4JKX B;  4OEF A;  4ION A;  3F62 B;  1AF9 A;  4ZFU B;  1AVA C;  2K43 A;  2Q3N B;  3FUQ A;  3WO2 A;  4AN6 A;  3AZV A;  1S0B A;  3B9U A;  1UPS A;  3VUO A;  4QAL A;  3R4U A;  3OJM A;  2KI4 A;  4A7K A;  3RMY A;  4Z9W B;  3A07 A;  4OUJ A;  4G6J A;  3HMY A;  5D62 A;  3A23 A;  3WMU A;  2LIQ A;  4AN7 B;  2YUG A;  1G9C A;  1KNM A;  3LLP A;  2BFH A;  4I4Q A;  2F2F A;  41BI A;  4XKI A;  4P0J A;  3Q7Y A;  3N7K A;  1DJS B;  5D61 A;  3BRG C;  2K4A B;  3CA5 A;  1II4 A;  4G6M A;  4I4P A;  1JY0 A;  4DEP A;  4MZG B;  3QYD A;  4II0 A;  5BXR A;  4CJM A;  2VU9 A;  1DFQ A;  1ABR B;  3FJB A;  3VT2 A;  1HWP B;  3AKH A;  3FJ8 A;  1GGP B;  1ISX A;  3ZC8 A;  3FJH A;  2D22 A;  2ET2 A;  3Q7X A;  4QKS A;  1JT3 A;  4IHZ A;  2F2F C;  4J2S A;  3H6R A;  1BFG A;  1AVX B;  2DRZ A;  3O44 A;  3AJ6 A;  2D7R A;  9ILB A;  4Q9P A;  3VT0 A;  1S0G A;  1XZZ A;  2X2T A;  1FGA A;  1DQO A;  4GOV A;  1Z4S A;  1MC9 A;  1BFB A;  3SNV A;  4IQP A;  3UD8 A;  4I6I A;  5EHA A;  3FJD A;  1YF8 B;  4JP0 A;  1EPW A;  3OBR A;  4QBV A;  5BQU C;  6I1B A;  4LO2 A;  3HOM A;  3AH4 A;  3F1R A;  1JQZ A;  4JKQ A;  5BXT A;  3RTJ B;  5FNW A;  2RG9 B;  2I1B A;  1YYN A;  2Z49 A;  4I7I A;  1FWU A;  3HSM A;  1L2H A;  2ZQO A;  4LO3 A;  4I8M A;  4ZFY B;  3AKI A;  4I4V A;  3IM7 A;  2HWA A;  4JQ0 A;  1RY7 A;  4LO2 C;  4USP A;  3W9T A;  4I4U A;  4GOY A;  4EFQ A;  4I4S A;  2KH2 A;  4Q9G A;  1FWV A;  3UD9 A;  3EF2 A;  3PHZ A;  2VLC A;  2M49 A;  4I4Y A;  3PG0 A;  1NZK A;  3D7W B;  3ILA A;  4J2K A;  4EFR A;  3BAU A;  3IAG C;  4DEN A;  2RST A;  4MZH A;  1N4K A;  4LO0 A;  2DRY A;  3ZC9 A;  3HBW A;  4I1B A;  1R8O A;  2NTD A;  4XFS A;  2ERM A;  1HIB A;  1IT0 A;  1G9D A;  4END A;  4HR6 C;  3BAD A;  3PME A;  5D63 A;  1P63 A;  1QXM A;  1XYF A;  1FMM S;  2P39 A;  2NZ9 A;  1RG8 A;  1S0F A;  1RZO B;  4KC3 A;  3AZW A;  5B2H A;  3BX1 C;  3O3Q A;  1V6X A;  1FV2 A;  4GP3 A;  4EB2 B;  2KLL A;  4QO3 A;  1S0E A;  3FFZ A;  1VCL A;  3AH1 A;  5GAQ A;  3HN1 A;  2R9K B;  5F8Y A;  4OWL A;  1IOB A;  1R8N A;  1IHK A;  3UD7 A;  1HCD A;  3POK A;  4D8H A;  2D1Z A;  3FJJ A;  3FJC A;  1RML A;  1IJT A;  3A22 A;  1JT5 A;  1NUN A;  1BAR A;  1CE7 B;  4WBC A;  2HZ9 A;  2VUA A;  5F90 A;  1WBC A;  1HCE A;  2WRY A;  1HWO B;  1JT4 A;  5DSS B;  31BI A;  3KMV A;  3T8S A;  2J3P A;  3N7J A;  1ONK B;  4X39 A;  4X38 A;  4R6U B;  5FNX A;  1IIL A;  2IHO A;  4ZFW B;  3Q7W A;  2MLL B;  3O5W B;  5BXS A;  4J2Y A;  3A21 A;  4I0Y A;  2AQZ A;  1TTU A;  3PUB A;  2HWM A;  4QC4 A;  3OJ2 A;  4P0L A;  3AJ5 A;  3VWC A;  5F8S A;  2NYY A;  4UY4 A;  1DZD A;  1W3G A;  1W3A A;  3RTI B;  1BFC A;  4OW4 A;  3ZX7 A;  5JLV A;  5I1B A;  2NP0 A;  2GO2 A;  3R4S A;  3OGG A;  4I37 A;  1DFC A;  2HW9 A;  3N7M A;  3NJ5 A;  4D0Z A;  2NM1 A;  3AKF A;  4LO7 C;  1I1B A;  1Q03 A;  4IZE A;  1M2T B;  1OQL B;  5DZU A;  2K8R A;  3CQA A;  4GP0 A;  1PWA A;  4MZF B;  4ISQ A;  4ZKT B;  4LO8 B;  2Z48 A;  4EFP A;  2RQ9 A;  5BP5 A;  5HPZ A;  3I2A A;  1IRP A;  5EC5 A;  2XOA A;  4LO7 B;  3TC2 A;  1MD6 A;  3BAV A;  3FJF A;  4I1E A;  4Q91 A;  3RSJ A;  3FGM A;  4P6A A;  3OGF A;  1ISW A;  3H6R B;  3VEQ A;  7I1B A;  3JRR A;  1J0S A;  3OBT A;  3CA1 A;  4LO1 A;  3WMV A;  1V6V A;  5BP5 C;  1WD3 A;  2L5X A;  4H04 A;  3WIN A;  3P53 A;  1TWM A;  2FGF A;  1SR4 A;  2ZR1 B;  4A7Z A;  2BEB A;  4X37 A;  2P23 A;  1HKN A;  2KKI A;  3N7L A;  1AXM A;  4KEJ A;  3WA1 A;  4LO3 C;  4P0K A;  3CA0 A;  1I1E A;  5FZU A;  4HA2 A;  21BI A;  4IY9 A;  3O4C A;  1K5U A;  3BA4 A;  3N0K A;  3FJ9 A;  4JRA A;  1S0D A;  4J2X A;  1E0O A;  2Y9F A;  1SR4 C;  1XG6 A;  4QD2 C;  1DQG A;  2AAI B;  1BA7 A;  3O4B A;  1V6W A;  2NS2 A;  1A8D A;  1ITB A;  5DUY A;  4GAI A;  1FN0 A;  2MC2 A;  4I4R A;  2E4M A;  1AVW B;  4ZOT A;  4G9M A;  4I3N A;  1V6U A;  5G00 A;  3LTQ A;  4JAW A;  4LO0 C;  2FDB M;  4QD2 B;  2FFV A;  3VT1 A;  3CRI A;  2GZB A;  5E24 E;  1AFC A;  3BAO A;  3P6J A;  1QQK A;  4PC4 A;  3UDA A;  3CA4 A;  4HJJ A;  4XFU A;  2FO1 A;  4FGF A;  3V0A A;  4KBB A;  2X2S A;  2Y9W C;  3BB2 A;  3V79 C;  1QQL A;  1XHB A;  1TP0 A;  2AFG A;  3S8K A;  2D7I A;  3O4A A;  1PUU B;  3K1X A;  1FQ9 A;  3O4O A;  3CRG A;  2QN4 A;  4I4X A;  3HAL A;  1Z2V A;  5F8W A;  1Q04 A;  5FZZ A;  2IWT B;  1TOO A;  1PUM B;  1JTC A;  1YXW A;  4F34 A;  2Q9X A;  3BTA A;  2D24 A;  2LIE A;  5BVP I;  3BA7 A;  1YBI A;  3RMX A;  1DZC A;  1T4Q A;  4IY8 A;  3UJ4 A;  3NBE A;  1ISV A;  5EG6 C;  3I2X A;  1CVS A;  3V0A B;  1FV3 A;  3V0B A;  2KI6 B;  4XFT A;  1D0H A;  3AH2 A;  4ISR A;  1TWE A;  3NBD A;  1JLX A;  4OWJ A;  1JT7 A;  3P6I A;  4GAF A;  4QBC A;  2VSE A;  1SZ6 B;  1ISZ A;  2VSA A;  3IIR A;  3NBC A;  4KEI A;  3E8L C;  4YOL A;  1W3F A;  4FVV A;  4Z8S B;  1BLD A;  4A7Y A;  4D0T A;  4OEG A;  4ZBV B;  5BQU A;  1BAS A;  1ISY A;  3CAH A;  3FJI A;  2UUS A;  3WO3 A;  8I1B A;  4EEE B;  2Y9G A;  4G1R A;  1JLY A;  3NBN A;  5DVH A;  3FUO A;  2DS0 A;  1PC8 B;  2ZQN A;  3BRF A;  3ZXD A;  1G9A A;  2ESU A;  4L4H A;  1K5V A;  1S0L A;  3I29 B;  5BXP A;  3V0B B;  2D23 A;  2D20 A;  3FJE A;  3CA3 A;  3BA5 A;  4H75 A;  3CU1 B;  1EYL A;  4G9N A;  1WBA A;  1ILR 1;  1EV2 A;  1DLL A;  3QR5 A;  4DCK C;  1Q1U A;  4USO A;  2WBC A;  4F83 A;  3FJA A;  2D44 A;  4QKR A;  3O4D A;  1Z0H A;  1G82 A;  2AXM A;  2DRE A;  3BAG A;  1BLA A;  3MPP G;  4EKX B;  4LO1 C;  4ZLB B;  2D43 A;  1AVU A;  4ZA3 B;  3S8J A;  2F8X C;  2VXR A;  3CA6 A;  4H9W A;  1TFM B; 
#chains in the Genus database with same CATH homology
 3VSZ A;  3OJV A;  3WIN C;  3BRD A;  3AKG A;  4I2S A;  1G9B A;  4OWK A;  3BAQ A;  2VXT I;  2Y9X E;  2MIB A;  3H6Q A;  1HWN B;  2QYI B;  5JMC A;  4IZX A;  3JUT A;  1HWM B;  1BFF A;  4I4O A;  1FMZ A;  4I96 A;  3CRH A;  4L4I A;  2NVH A;  1F31 A;  4TLP A;  5FZY A;  4J23 B;  1DIW A;  4X3A A;  4ZGR B;  4IYB A;  3H6S E;  3IM5 A;  4OEE A;  4KEK A;  3C9Z A;  5BOW A;  1TIE A;  1T9F A;  3BAH A;  3ZXG A;  3WO4 A;  3MAL A;  3FJK A;  3O49 A;  1S0C A;  2BEA A;  1EVT A;  3VSF A;  2E4M C;  4JPZ A;  1YTO A;  3IM6 A;  1PZZ A;  1IRA X;  3UJ0 A;  2FFU A;  1WD4 A;  1M16 A;  4JKX B;  4OEF A;  4ION A;  3F62 B;  1AF9 A;  4ZFU B;  1AVA C;  2K43 A;  2Q3N B;  3FUQ A;  3WO2 A;  4AN6 A;  3AZV A;  1S0B A;  3B9U A;  1UPS A;  3VUO A;  4QAL A;  3R4U A;  3OJM A;  2KI4 A;  4A7K A;  3RMY A;  4Z9W B;  3A07 A;  4OUJ A;  4G6J A;  3HMY A;  5D62 A;  3A23 A;  3WMU A;  2LIQ A;  4AN7 B;  2YUG A;  1G9C A;  1KNM A;  3LLP A;  2BFH A;  4I4Q A;  2F2F A;  41BI A;  4XKI A;  4P0J A;  3Q7Y A;  3N7K A;  1DJS B;  5D61 A;  3BRG C;  2K4A B;  3CA5 A;  1II4 A;  4G6M A;  4I4P A;  1JY0 A;  4DEP A;  4MZG B;  3QYD A;  4II0 A;  5BXR A;  4CJM A;  2VU9 A;  1DFQ A;  1ABR B;  3FJB A;  3VT2 A;  1HWP B;  3AKH A;  3FJ8 A;  1GGP B;  1ISX A;  3ZC8 A;  3FJH A;  2D22 A;  2ET2 A;  3Q7X A;  4QKS A;  1JT3 A;  4IHZ A;  2F2F C;  4J2S A;  3H6R A;  1BFG A;  1AVX B;  2DRZ A;  3O44 A;  3AJ6 A;  2D7R A;  9ILB A;  4Q9P A;  3VT0 A;  1S0G A;  1XZZ A;  2X2T A;  1FGA A;  1DQO A;  4GOV A;  1Z4S A;  1MC9 A;  1BFB A;  3SNV A;  4IQP A;  3UD8 A;  4I6I A;  5EHA A;  3FJD A;  1YF8 B;  4JP0 A;  1EPW A;  3OBR A;  4QBV A;  5BQU C;  6I1B A;  4LO2 A;  3HOM A;  3AH4 A;  3F1R A;  1JQZ A;  4JKQ A;  5BXT A;  3RTJ B;  5FNW A;  2RG9 B;  2I1B A;  1YYN A;  2Z49 A;  4I7I A;  1FWU A;  3HSM A;  1L2H A;  2ZQO A;  4LO3 A;  4I8M A;  4ZFY B;  3AKI A;  4I4V A;  3IM7 A;  2HWA A;  4JQ0 A;  1RY7 A;  4LO2 C;  4USP A;  3W9T A;  4I4U A;  4GOY A;  4EFQ A;  4I4S A;  2KH2 A;  4Q9G A;  1FWV A;  3UD9 A;  3EF2 A;  3PHZ A;  2VLC A;  2M49 A;  4I4Y A;  3PG0 A;  1NZK A;  3D7W B;  3ILA A;  4J2K A;  4EFR A;  3BAU A;  3IAG C;  4DEN A;  2RST A;  4MZH A;  1N4K A;  4LO0 A;  2DRY A;  3ZC9 A;  3HBW A;  4I1B A;  1R8O A;  2NTD A;  4XFS A;  2ERM A;  1HIB A;  1IT0 A;  1G9D A;  4END A;  4HR6 C;  3BAD A;  3PME A;  5D63 A;  1P63 A;  1QXM A;  1XYF A;  1FMM S;  2P39 A;  2NZ9 A;  1RG8 A;  1S0F A;  1RZO B;  4KC3 A;  3AZW A;  5B2H A;  3BX1 C;  3O3Q A;  1V6X A;  1FV2 A;  4GP3 A;  4EB2 B;  2KLL A;  4QO3 A;  1S0E A;  3FFZ A;  1VCL A;  3AH1 A;  5GAQ A;  3HN1 A;  2R9K B;  5F8Y A;  4OWL A;  1IOB A;  1R8N A;  1IHK A;  3UD7 A;  1HCD A;  3POK A;  4D8H A;  2D1Z A;  3FJJ A;  3FJC A;  1RML A;  1IJT A;  3A22 A;  1JT5 A;  1NUN A;  1BAR A;  1CE7 B;  4WBC A;  2HZ9 A;  2VUA A;  5F90 A;  1WBC A;  1HCE A;  2WRY A;  1HWO B;  1JT4 A;  5DSS B;  31BI A;  3KMV A;  3T8S A;  2J3P A;  3N7J A;  1ONK B;  4X39 A;  4X38 A;  4R6U B;  5FNX A;  1IIL A;  2IHO A;  4ZFW B;  3Q7W A;  2MLL B;  3O5W B;  5BXS A;  4J2Y A;  3A21 A;  4I0Y A;  2AQZ A;  1TTU A;  3PUB A;  2HWM A;  4QC4 A;  3OJ2 A;  4P0L A;  3AJ5 A;  3VWC A;  5F8S A;  2NYY A;  4UY4 A;  1DZD A;  1W3G A;  1W3A A;  3RTI B;  1BFC A;  4OW4 A;  3ZX7 A;  5JLV A;  5I1B A;  2NP0 A;  2GO2 A;  3R4S A;  3OGG A;  4I37 A;  1DFC A;  2HW9 A;  3N7M A;  3NJ5 A;  4D0Z A;  2NM1 A;  3AKF A;  4LO7 C;  1I1B A;  1Q03 A;  4IZE A;  1M2T B;  1OQL B;  5DZU A;  2K8R A;  3CQA A;  4GP0 A;  1PWA A;  4MZF B;  4ISQ A;  4ZKT B;  4LO8 B;  2Z48 A;  4EFP A;  2RQ9 A;  5BP5 A;  5HPZ A;  3I2A A;  1IRP A;  5EC5 A;  2XOA A;  4LO7 B;  3TC2 A;  1MD6 A;  3BAV A;  3FJF A;  4I1E A;  4Q91 A;  3RSJ A;  3FGM A;  4P6A A;  3OGF A;  1ISW A;  3H6R B;  3VEQ A;  7I1B A;  3JRR A;  1J0S A;  3OBT A;  3CA1 A;  4LO1 A;  3WMV A;  1V6V A;  5BP5 C;  1WD3 A;  2L5X A;  4H04 A;  3WIN A;  3P53 A;  1TWM A;  2FGF A;  1SR4 A;  2ZR1 B;  4A7Z A;  2BEB A;  4X37 A;  2P23 A;  1HKN A;  2KKI A;  3N7L A;  1AXM A;  4KEJ A;  3WA1 A;  4LO3 C;  4P0K A;  3CA0 A;  1I1E A;  5FZU A;  4HA2 A;  21BI A;  4IY9 A;  3O4C A;  1K5U A;  3BA4 A;  3N0K A;  3FJ9 A;  4JRA A;  1S0D A;  4J2X A;  1E0O A;  2Y9F A;  1SR4 C;  1XG6 A;  4QD2 C;  1DQG A;  2AAI B;  1BA7 A;  3O4B A;  1V6W A;  2NS2 A;  1A8D A;  1ITB A;  5DUY A;  4GAI A;  1FN0 A;  2MC2 A;  4I4R A;  2E4M A;  1AVW B;  4ZOT A;  4G9M A;  4I3N A;  1V6U A;  5G00 A;  3LTQ A;  4JAW A;  4LO0 C;  2FDB M;  4QD2 B;  2FFV A;  3VT1 A;  3CRI A;  2GZB A;  5E24 E;  1AFC A;  3BAO A;  3P6J A;  1QQK A;  4PC4 A;  3UDA A;  3CA4 A;  4HJJ A;  4XFU A;  2FO1 A;  4FGF A;  3V0A A;  4KBB A;  2X2S A;  2Y9W C;  3BB2 A;  3V79 C;  1QQL A;  1XHB A;  1TP0 A;  2AFG A;  3S8K A;  2D7I A;  3O4A A;  1PUU B;  3K1X A;  1FQ9 A;  3O4O A;  3CRG A;  2QN4 A;  4I4X A;  3HAL A;  1Z2V A;  5F8W A;  1Q04 A;  5FZZ A;  2IWT B;  1TOO A;  1PUM B;  1JTC A;  1YXW A;  4F34 A;  2Q9X A;  3BTA A;  2D24 A;  2LIE A;  5BVP I;  3BA7 A;  1YBI A;  3RMX A;  1DZC A;  1T4Q A;  4IY8 A;  3UJ4 A;  3NBE A;  1ISV A;  5EG6 C;  3I2X A;  1CVS A;  3V0A B;  1FV3 A;  3V0B A;  2KI6 B;  4XFT A;  1D0H A;  3AH2 A;  4ISR A;  1TWE A;  3NBD A;  1JLX A;  4OWJ A;  1JT7 A;  3P6I A;  4GAF A;  4QBC A;  2VSE A;  1SZ6 B;  1ISZ A;  2VSA A;  3IIR A;  3NBC A;  4KEI A;  3E8L C;  4YOL A;  1W3F A;  4FVV A;  4Z8S B;  1BLD A;  4A7Y A;  4D0T A;  4OEG A;  4ZBV B;  5BQU A;  1BAS A;  1ISY A;  3CAH A;  3FJI A;  2UUS A;  3WO3 A;  8I1B A;  4EEE B;  2Y9G A;  4G1R A;  1JLY A;  3NBN A;  5DVH A;  3FUO A;  2DS0 A;  1PC8 B;  2ZQN A;  3BRF A;  3ZXD A;  1G9A A;  2ESU A;  4L4H A;  1K5V A;  1S0L A;  3I29 B;  5BXP A;  3V0B B;  2D23 A;  2D20 A;  3FJE A;  3CA3 A;  3BA5 A;  4H75 A;  3CU1 B;  1EYL A;  4G9N A;  1WBA A;  1ILR 1;  1EV2 A;  1DLL A;  3QR5 A;  4DCK C;  1Q1U A;  4USO A;  2WBC A;  4F83 A;  3FJA A;  2D44 A;  4QKR A;  3O4D A;  1Z0H A;  1G82 A;  2AXM A;  2DRE A;  3BAG A;  1BLA A;  3MPP G;  4EKX B;  4LO1 C;  4ZLB B;  2D43 A;  1AVU A;  4ZA3 B;  3S8J A;  2F8X C;  2VXR A;  3CA6 A;  4H9W A;  1TFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...