4ZCPA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cmp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
129
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIDIYAWLKRAGKFKATQRTEGVSTTDLIVRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Cholinephosphate cytidylyltransferase
total genus 41
structure length 129
sequence length 137
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcpA00
4J76A 3AL0C 3CVYA 1QRSA 3CR8A 1N78A 1TQ8A 1N2JA 3GMIA 3HZRA 3UY4A 5TS2A 1VBKA 1MOPA 3UOWA 4DDHA 4G6ZA 1VBMA 5DB4A 4CQNA 3P0IA 5F23A 3DO8A 4I6EA 3TQOA 3LCJA 3F3MA 2VTBA 3FG9A 3ZJUA 2DERA 1OWPA 1MC1A 4K03A 4EFKA 4GRIA 1J09A 4PBRA 1ZUNA 3CLUC 3D6UA 4EF6A 1NP7A 4NDAA 3SEZA 2AZXA 1O95C 1JIJA 1T9GS 5J58A 2D5BA 3FETA 4YP6A 2WQ6A 4JXZA 1F7UA 1JEEA 1N2EA 2QJOA 1JILA 1NUQA 3CLUD 1TYAE 2OQ2A 1UFVA 4OJMX 1N3LA 3ND6A 4K0RA 2HZ7A 3MLBA 4H3SA 4JZYA 4DDKA 2EJCA 1JEDA 1O95D 3A2KA 4ND7A 2XRYA 4MWCA 4CDNA 3LE8A 4MUNA 1KP2A 3U1VA 4DDMA 2CV1A 2JANA 1BS2A 2CSXA 1N75A 1NSYA 2PFSA 3FH0A 2NZ2A 3FOCA 4MVYA 2A7XA 5FO0A 4KPUB 1N1DA 3CLTD 3RHSA 1OWMA 3TZEA 2A84A 4A91A 4NAHA 4MVCA 4DLPA 4MVXA 1M83A 1NZJA 2HGZA 4I6GA 3TZLA 1J70A 3ISJA 4NAUA 1WXFA 4EG1A 1LW7A 4MUKA 2PZBA 3RFFA 4MQ6A 3VU8A 2BYTA 1OBCA 1NYLA 4ZT6A 1EFPB 2Z08A 2RE8A 3IOCA 1QJCA 4CT0A 3AKZA 3G5AA 1QRTA 2V0GA 4Q93A 4MW9A 1JECA 3ZGZA 4R2LA 1IQRA 2YXNA 2D54A 4FZJA 1O0CA 1IQUA 2A4MA 2DXIA 5LM3A 2H2AA 1T6XA 1NUUA 3P52A 3COYA 2A86A 3SZ3A 3A04A 2QUKA 3X1JA 2CUZA 1QRUA 3IUBA 4PBSA 3FIUA 1NUTA 1MBZA 3IH5A 3PNYA 5HUJA 2YY5A 4U8HA 3RBAA 5J59A 1LI5A 1U7DA 3H9BA 1WQ4A 1TFUA 1O96B 3ZIUA 1H3NA 4G5FA 1NUPA 1GTSA 2DPLA 5HUHA 2H29A 3KT0A 1OWLA 1PFWA 1PFVA 1GZUA 3HMQA 4HPWA 4MUJA 4EGAA 1V47A 1KAMA 3ZXIA 1QQTA 1T6YA 4ZCQA 1NURA 5IHXA 1KQOA 1MJHA 3IOEA 4KKVA 1M1ZA 4QRDA 1KH2A 1N2HA 2DR2A 4MW2A 1J20A 4XFJA 5K0TA 2X1MA 1GN8A 3MUEA 3L92A 3OP1A 1EFVB 1JIKA 2E0IA 4ZCPA 1J1ZA 2WSIA 3SDBA 2J09A 4E1AA 1PG0A 1T6ZA 2X0KA 3MXTA 3TQIA 2QTMA 4EG6A 4U7JA 1EJ2A 1RQGA 1MAWA 4NATA 4R2MA 2CV0A 2CV2A 4ARCA 3RK0A 2O8VA 3IOBA 4RUKA 1D2RA 1F4LA 3IVXA 1WZ2A 2E89A 3RK1A 3NV7A 3SYTA 1WQ3A 3M5WA 1H1TA 3H05A 1KQNA 3Q4GA 2YWBA 1K97A 3ND7A 1V8FA 4J75A 2E21A 3CLTC 1XNGA 1N2BA 3OTWA 1QU3A 4TS1A 2WQ7A 5J5AA 4MUEA 1COZA 2PXHA 2BTEA 5DEOA 3IVGA 1IHOA 2Z3VA 3DV2A 3P0HA 4G5YA 4OUDA 4JFAA 2QTRA 2A1UA 3COZA 2VXOA 1N77A 2QTNA 4CDMA 1M8JA 1WXGA 4MUIA 3FHJA 1FFYA 3FI0A 2PZAA 3GLVA 4F3RA 1IVSA 2YWCA 5TGTA 4UZFA 3E27A 1H3FA 1KKUA 1KR2A 3ELBA 4NZPA 1FYDA 1TEZA 1KH3A 1Q77A 2JAXA 2J08A 1JMVA 4HJXA 1JZQA 1VLHA 1M8KA 2I1LA 3CA8A 4EG4A 2B7LA 4S1OA 2CYBA 3X1KA 4MUFA 4AS1A 1R6XA 4MVWA 3COWA 5KWVA 4QBTA 3IODA 3N05A 3H97A 4KPUA 1HYBA 1QU2A 1IFXA 3GUZA 4OUDB 2DUMA 1U3DA 5H16A 1KAQA 1Y42X 2OV4A 4PBTA 3UK2A 3ND5A 5TEWA 3C8ZA 3I05A 1QTQA 1F7VA 3ZJVA 3AIIA 3IMCA 3K9WA 4PY2A 3X1MA 1F9AA 2IELA 4X0EA 5FNZA 3ZXSA 4I6JA 3S3TA 4R0NA 1QNFA 3AG6A 1EXDA 1GTRA 2D13A 2Z09A 4MWBA 1VL2A 1YUNA 5EKDA 4ZCRA 5LFAA 3IMGA 4ZT4A 4XFDA 4MW1A 1Q11A 1TYDE 4YBRA 1PFUA 1VBNA 3UC5A 4ZT2A 1ILEA 3CVWA 1ZJWA 1YUMA 1H3EA 3VGJA 5DASA 4ZCTA 3HFJA 1J21A 1N2GA 3G6KA 1P7PA 3COVA 1OBHA 4JXXA 3FWKA 2AG6A 3K32A 3DPIA 4MW4A 3IDFA 3VRHA 5BNZA 1JIIA 3BL5A 1U0BB 1O94D 1YIAA 4EG5A 2JA2A 1DNPA 1I6LA 1PFYA 3CLRD 1Q19A 2VTBB 1GPMA 2QUHA 1EUYA 5JBNA 2J5BA 1ULHA 4WSOA 2DEUA 4YMIA 3Q12A 2XRZA 4Q16A 1WJGA 2G36A 3IUEA 1XNJA 2A1TS 2HMAA 3PNVA 3UMVA 2CT8A 3TNJA 4ZCSA 4AQ7A 2J07A 1JHDA 3SP1A 4GU5A 1XNHA 3CLRC 1X6VA 1OWNA 3D6VA 3P0JA 4MWDA 4RPIA 1K4MA 2GOYA 1G8FA 3AG5A 1X8XA 5H7XA 2DETA 1MB2A 1R6TA 4XSVA 1YULA 1M8GA 3A4IA 5TEVA 1EE1A 5IJXA 1KH1A 3PXUA 4P2BA 3QTBA 4MW0A 4KR6A 2R5WA 1B6TA 3MMXA 1A8HA 2QJTA 2NSYA 3CVVA 1G8GA 3PRHA 5DK4A 3ZUGA 3H9CA 2A1UB 3SZGA 2CFOA 3JXEA 1OWOA 4EG8A 1J1UA 4U63A 1R6UA 2RD2A 1LI7A 3HV0A 3INNA 1Q15A 4HJRA 1S4MA 3PNBA 1CT9A 1KORA 2QJFA 5FO1A 1MB9A 3AFHA 2J4DA 4NX2A 2CYAA 3DLAA 1EUQA 4MAFA 1YI8A 2GM3A 3L93A 1T9GR 4ND6A 1U7XA 1M8PA 2PG3A 1O5TA 2X3FA 2ZP1A 2CYCA 1K4KA 1ZH6A 4YP5A 2ZUFA 1WXIA 2TS1A 1EFPA 1WXHA 1WKBA 4MWEA 3SEQA 1MAUA 4DE5A 1M8FA 1G8HA 3KT3A 2QUJA 4ARIA 3IVCA 2GKSA 4F4HA 1ZH0A 3N8HA 3QTTA 5KCMA 3CVXA 1N2OA 1NUSA 1IH8A 4HK4A 1KQPA 2ZUEA 3H99A 3A05A 1IRXA 4EG3A 3KT6A 5AHWA 4KR9A 2AKEA 2V0CA 3IMEA 1O0BA 1N2IA 1SURA 4MW6A 4MW5A 5HG0A 1GLNA 3HGMA 3KT8A 1WY5A 4L2IB 1O96A 4ZT3A 1PG2A 4MULA 4ZT5A 3QE4A 4KR7A 1I6MA 3ILVA 2EL7A 2E18A 4MUGA 4BWVA 4MW7A 3ZJTA 2QUIA 1O6BA 4WNYA 2A88A 5K0SA 4EG7A 4UZEA 1O94C 1IQ0A 1MRZA 3NBAA 2O5RA 2X1LA 1I6KA 1WXEA 2IJGX 2A1TR 4DJAA 1O97C 3N2YA 4YP7A 3RJZA 1XJQA 4MUHA 1YIDA 3MLAA 2PZ8A 3CVUA 2C5SA 4JYZA 1G59A 1I2DA 4L2IA 1KP3A 3CLSC 3N9IA 3Q10A 2IP1A 2DLCX 2PIDA 4MLPA 2WB2A 5LLTA 5KHAA 3HL4A 1WOYA 4ZT7A 1OD6A 3KFLA 1GAXA 3LOQA 1U3CA 1JGTA 1EFVA 1TYCA 1O97D 3TS1A 1JZSA 3FNRA 3FY4A 1TYBE 1K92A 4DNXA 1NI5A 3FDXA 3G59A 3NBKA 4QREA 3CLSD
chains in the Genus database with same CATH superfamily
4A0FA 5A6SB 3O4IA 1N3BA 4ZVQA 5BUQA 1A8UA 1ZOIA 1ZUWA 5DOZA 1QNLA 3CIOA 4I7EA 4LF8B 1TQ8A 4AXBA 1QYWA 4CW7A 3E9YA 4G0WA 4JGIA 1P60A 1AS0A 2V55B 4KLZA 4B8ZA 2DGDA 4N0MA 1E6UA 4LUCA 1DC6A 3I83A 4QU8A 2B7BA 3WDSA 1OB5A 1DELA 3E81A 5E7JA 5CCXA 5JAPA 2X5NA 3UCEA 3KR0A 2BN4A 4G9EA 2IXAA 2YDYA 4DYDA 1DUVG 3MQFA 3RYHA 1HUQA 3BK2A 2D4AA 4HYQA 1CTQA 3DKVA 4O2BB 5HFAA 2ZM5A 5BMVF 1U3GA 3PT9A 5ARCA 2Z5GA 4U2EA 3HNPA 1CZRA 3CLUC 1QP0A 1GILA 1RM4A 2YJGA 4NDAA 3CHYA 1KU6A 2C97A 3A26A 4N0DA 4BB9A 2NTEA 1V4VA 1O87A 1V8OA 2OO5A 3DMTA 2D5LA 1J9ZA 3MWEB 4MVJF 4RWEA 5CTAA 5K6RA 1F3LA 4HI0E 4OJYA 1SRRA 4V1CA 4JEIA 5KU1A 5HFJA 3EF1A 2BFMA 3WAKA 4XLTA 2ATXA 2AXEA 2YMQA 4YC7A 2XMQA 1N2EA 1VDMA 4KMRA 5DYIA 2PUTA 5ADHA 1KZGB 2W8ZA 4LJYA 3D4NA 2YZ7A 3ODPA 1UFVA 4LSWA 3WHPA 4EWLA 1D03A 3EQ9A 3THWB 1SXPA 3T7KA 2FW6A 1VI2A 1O1YA 3HBNA 3KKOA 4OYHA 5ECDA 5C8YB 5HILA 1ZUNB 3ITDA 4ZGWA 1PEAA 2P4UA 3U3JA 1IN4A 1IWPB 3VPGA 2N9UA 2UVDA 7GPBA 1XWWA 3FDIA 4U00A 1MPXA 2C9MA 5CLHA 1HLPA 2JJ8A 3AUTA 2LBPA 1I32A 2GB4A 3UCXA 4BYMA 1B14A 4Z1MA 1NF2A 1T29A 3L0IB 3IX7A 1Q7EA 4Q1AA 2PSJA 3IEXA 3O74A 3R77A 1R5BA 3A9CA 4OHZA 3RC2A 3T7EA 3WO1A 5EMHA 2H4YA 4LYAA 1F8YA 3UXHA 2VYNA 1N1DA 2EL9A 3TD6A 1SO8A 3G0HA 4XB6B 4AJLA 4D6YA 2B61A 4QXAA 3Q40A 4UTVA 1OI2A 1EPUA 4X93A 2P2DA 3GBVA 1ZXLA 2ZT6A 4HMQA 3WAGA 1B76A 1K6XA 4NAHA 3ZBPA 4A0HA 1R9JA 4DRXB 3UB2A 1P1JA 4MQEA 1BXRA 1FNBA 4YUWA 2R0QC 4HN4B 4I9GA 4DR3B 5CA0A 4CL0A 2DFTA 1SUIA 2NO0A 1SWVA 3KXDA 2IHZA 2WR8A 3OTGA 3QBEA 3FZGA 3SFTA 4LHYA 5JZ9A 1WXDA 1OBCA 1ND6A 1N6OA 3LFUA 4A1FA 4MV7A 5LQKA 4QFMA 2ISQA 2ERYA 3FUXA 4QULA 5LQMA 2DWUA 1S8OA 1CEEA 1I5RA 4P83A 4II3A 5EXXA 1JECA 4YAOA 4P38A 5KCZA 3DH0A 3VC7A 1QFXA 3IDOA 1ZGGA 1BE0A 2RI0A 4EA8A 3HSKA 3L7DA 1FLNA 4UCWA 4DV4B 1GZ6A 1VKRA 3QNUA 3H8JA 1A5ZA 2COKA 4WKGA 3KYCA 3KZOA 5ITWA 2Y1CA 3KZXA 2WU1A 3O26A 3ZIAA 1I51A 2FZ4A 5ED0A 4OF4A 2RC6A 3B3AA 3BIFA 3BDIA 2GJKA 3KR2A 4U8HA 4NH4A 5E4FA 4CLOB 2QG6A 1XJWA 3ZGOA 5CXUA 1TFUA 1QWSA 5BSKA 1CY6A 2ZBPA 3FMIA 4U7TB 2VJBA 4IRXA 1LLFA 5I9SA 1OE0A 4J0IA 2CB0A 4W1QA 4ZYUA 2VJKA 4OXQA 1HE2A 2WWRA 1WZEA 1C7IA 4U2KA 3KT0A 1QORA 1G20A 3ORHA 3NIFB 2HNKA 3HMQA 3LX5A 4Q1DA 5EKXA 1F8GA 2P9JA 4N47A 3AHFA 1KO7A 1IIRA 3C7KA 2P79A 3THXA 2O8DB 4K2HA 3RSHA 4H7HA 3RRJA 2AHRA 3OLXA 1L1RA 2PH7A 4IUCS 3T94A 1KEWA 1U2SA 2MU1A 4RCVA 5LZ2A 1V1JA 3UFBA 1QQBA 2HX1A 4QTUB 2TSYB 3RUAA 4R98A 2Q9CA 4EL5A 5GOZA 3TX6A 1B6RA 3LKDA 1EJ6A 2PV7A 2JDID 4N9QA 4LXXA 5EE5B 1YQGA 4MCIA 3OVMA 4EJFA 4YJ3A 1J1ZA 2DPXA 4N5HX 4E14A 1P31A 4X71A 1UEJA 1T6ZA 3D3KA 1UJ5A 5AHKA 4YMHA 6ABPA 4LF5B 3LBHA 4IVQA 4WLFA 2I2DA 2ZAGA 2XYRA 3OKFA 4P84A 5HF8A 3P20A 5IN5A 1RYNA 1WMEA 1K68A 4CL8A 1C0LA 3CTMA 3N5KA 2XVAA 1UPBA 2A33A 1QQ7A 1P3Y1 3WSTA 1E2EA 4CQMD 1E2FA 3DZKA 4O4LB 2NAPA 5TT0A 2CK3A 5TIIA 3UAYA 5DNYB 5K8LA 2WAMA 2B82A 2D3WA 1MJ5A 3QWHA 2C3YA 3QZUA 3MGKA 4Q01A 4Q4HB 1N9ZA 2BLLA 5CAEB 5TJHA 3UMBA 2JAPA 1ENPA 3L8YA 1Q92A 3D3QA 3U7RA 2ZBEA 5DN6A 3W8DA 3NWPA 3IPAA 4IXMA 1K66A 2HQOA 2BHTA 2ZKIA 5TQ0B 1RKVA 3QWIA 3ZTYA 4J75A 1MDFA 1TDJA 3X1YA 3HB5X 3S29A 4LDJA 5T5QA 2YIDA 4IFIA 3WBBA 5J5AA 4Q03A 1GARA 1EK1A 3FDZB 1HDYA 3FROA 2FYTA 5AKGA 2MCFA 1L7NA 1NU6A 1IZZA 4ZC1A 2A1UA 2G4CA 1D0IA 4OGGA 4HBGA 2GARA 5SZIA 3ZS9A 1VKJA 3BGSA 4GAEA 3D7LA 2ADOA 5ICCA 2PUBA 1XDUA 2ZBDA 3MWDA 4B71A 1OYYA 5F1PA 3PVCA 2BR5A 3OLYA 1UQRA 3E7WA 4HTAA 4XQ9A 1T9BA 2HTEA 1VIVA 2JCBA 1EFRA 1JFRA 2O06A 3CZQA 3T54A 1BYIA 3LC0A 4QRIA 5TQ0A 3H8SA 2BEUB 4A36A 2C3UA 2UV8A 1QZZA 2JH9A 3K9HA 3QELA 1P17A 4X64B 1ODSA 3K1AA 1VLHA 2V9ZA 4JJGA 1BZYA 4LOJA 1O7JA 3KPJA 4B3RB 5HQTA 2RGNC 1A2QA 3CA8A 3KKKA 2B7LA 2Q6OA 1LJUA 3TG8A 4FNGA 1RYHA 3WQQA 5K3CA 5KNCA 1FP2A 2Y1GA 3NNSA 1DVRA 2IOHA 1XZKA 2LIVA 2R6R1 3P2MA 5H70A 2ZWOA 1Q0RA 3RVDA 1I4DD 1E5VA 2DY0A 4G24A 3UA3A 2HJVA 5HE9A 3T35A 4FWBA 2ZRGA 4G25A 2ZE7A 3A3OA 1CJCA 2F48A 2HA2A 3LPNA 3KB6A 2C4VA 5HA5A 4PZ9A 1KBZA 2QLJA 3LECA 1J1IA 3AV3A 4EG0A 3NT4A 3H65A 4QPNA 1I7DA 2QLFA 2GZAA 4YALA 3G5UA 1Y8QB 1N8SA 1TIKA 1Z68A 1URPA 3I2IA 4L5YA 1LDGA 1LRKA 3PLRA 3DT8A 4CL2A 3X1MA 4RS4A 3A11A 4IIJB 3IT2A 4EGJA 3UJBA 4EO9A 3HZZA 1EVJA 3GCZA 2ODNA 3ZW7A 3VI3B 5F2NA 1F0NA 1TEXA 2HC9A 2IYRA 2P5SA 1ZMXA 2ZUCA 3HU2A 4G8DA 3FPFA 1P91A 4PQFA 1TCCA 1L7VC 3SIXA 1NPDA 2RGNA 1L7PA 1U9IC 2JIDA 3IVAA 3C24A 3SQMA 3AG6A 5KB3A 3MTAA 3DHNA 4GZ5A 3HDTA 1W19A 1WRBA 3QX9A 3RUFA 5AVQA 1RWXA 4H15A 1TVKA 2XBUA 3JWEA 4KV7A 3MCUA 4XIFA 2FUG1 3IP5A 3GPDG 3LY9A 5CB4F 2H08A 1BXKA 1WDTA 2W0MA 5AW3A 4TRRA 3JQFC 4XFDA 3GRYA 3ICOA 4KJXA 1Q1AA 1Y82A 3WRXC 3TH5A 4ZYZA 1OT3A 4QDTA 3GMDA 5JCJD 3N2ZB 4BNUA 2ZXFA 2XDAA 5KYKA 1SC3A 4LOKA 4XOIA 1A1SA 5JMTA 3ZHRA 4MKIA 4ZHSA 3MTIA 1EK2A 2FJUA 3HJBA 3VNVA 3BXPA 1UBKS 3STHA 2IHNA 4QQNA 4V0SA 4I1YA 4WY8A 3S28A 3VR4H 1E5QA 4BV2A 1IUNA 1JAZA 3HRHA 4IF4A 4BYGA 3MCTA 3M9XA 4UZSA 5HMMA 1W25A 3WJ7A 4PC3A 5E6SB 3COVA 2R8EA 2Y6VA 4DA8A 3X43A 4NHOA 4ESVA 1YFJA 1GAEO 3FCEA 4MW4A 2C0QA 2I7CA 4I1RA 1FFWA 1JW9B 4FPXA 2IYTA 4D8XA 3LAWA 4UREA 4TV9B 4WRRA 1SUAA 2NPFA 5EESA 1EUYA 1CV2A 3DW1X 2RGRA 2YJ3A 2B7CA 2D2IA 2I71A 3FNFA 3M49A 4JQZA 1MEEA 2EJWA 1PJBA 4CU2A 1C7EA 4ND1A 1HL3A 3WP1B 3MCVA 4YMVA 3R3JA 3QVXA 5JWHA 4M9CA 5HZHA 3SZOA 4MRMA 3MELA 4E33A 3DOIA 4REMA 4Y2GA 5EWMA 5LD2C 5IVKA 3LQQA 4JODA 4UDXX 2XD9A 3HV2A 3SP1A 5GJBA 4E21A 4B3TB 1NVKA 4Y2UA 3P0JA 5JJCA 4MWDA 1WTCA 1H1LB 1SIWA 4AMYA 4AX8A 4PWZA 4B5KA 2GN6A 3K2QA 1E2NA 2XJ9A 3D7NA 2PJRA 4XGNA 2I4MA 3PLAE 1W4LA 4Z3DA 2VQFB 4U7DA 3SVZA 3WLOA 4URUR 1G5FA 3A4IA 3IR6A 4WEQA 1KE2A 3VHQA 2IDZA 4LRTB 1C7FA 2B94A 1X7YA 3AR7A 4HHEA 5E0OA 2CN1A 1RT9A 2R1ZA 4BMSA 5A0TA 3VKUA 3MMXA 1M2VB 2EHJA 2QJTA 2VDUE 3DXXA 4JVNA 5G41A 3RRMA 5BSHA 4LW8A 5YASA 5H4GA 1DMSA 1DC5A 1BWSA 4HQ0A 3UWPA 3IA7A 1C4XA 3HZHA 4BLPA 3OESA 4YQEA 4NBUA 5KMGB 1IUPA 3RE1A 3JQAD 3IAM1 3WFIA 4BVFA 2TMDA 4BO2A 1OXSC 4LDPA 4OBEA 1BCRA 3WAJA 3KQKA 1Q15A 4BIMA 5L7WA 2E4WA 2TECE 1XMPA 1P5RA 4Q12A 3KTOA 2BELA 1FTNA 4K8OA 4WQMA 3BG5A 1KZHA 3WXBA 4YYEA 4DJFC 2WTUA 3DZGA 5GJWC 3LGXA 4GO1A 3R5SA 3WB0A 5C4MA 5LKRA 4HVCA 2IPXA 4TUYF 1T15A 1SQ0A 1MABB 3RJMA 3USCS 5BOSB 2E87A 3JR3A 3OQIA 1PV2A 1ZJ4A 2H2WA 2PG3A 3BIOA 4FHFA 4KXXA 4WLEA 5TRTA 2CLCX 2GLTA 1GPBA 5JEEA 3EYAA 3G49A 1ZH6A 2QN6A 5AVJA 4DEYA 2QAJA 2CXHA 5EQFA 4FFNA 3EPHA 1I5EA 2WU0A 2I7XA 1DIOB 1D8AA 1SZCA 2ZRDA 3MS2A 4B82A 1VKNA 3REQB 3SEQA 3D8TA 4LGVA 2BM0A 4E31A 5KOHB 3Q0IA 1A9RA 1EJ0A 1MT3A 1U28C 3PJRA 1YZQA 5LMZA 1MGOA 5TQJA 1KQFA 4FGWA 3B6EA 3K1AB 4AMUA 3D4OA 3DQZA 1XKQA 3JY6A 3QTTA 1CR6A 1BCRB 2FTKE 4R8MA 4X1OA 3CVXA 3LHDA 4JBGA 3VU0A 3OO0A 1R6BX 4A3SA 4C3OB 1IXKA 3GRVA 3OWHA 1B3RA 3QWFA 4PXYA 1ODFA 1UAYA 4MVJA 3VX3A 4RZSA 3SF8B 3ZNPA 2FZEA 1LTQA 3DEZA 4C6SA 2B4AA 1LFAA 2IQ5A 2JGNA 1RM3A 3E2PA 2ODPA 4MW5A 1QGUA 3GEGA 4CM6A 5B7QA 3AEKB 1KPHA 3GEPA 4NPCA 4R2IA 4AUEA 5IARA 3ZWYA 1WMBA 2VLIA 2W4MA 5DMHA 5EIBC 3D8BA 3URMA 5L3SB 1SD5A 2QD1A 2OLJA 4NZNA 2ZRAA 1T5IA 4BWVA 1QH8A 3DMRA 3BERA 2F3SA 2QL9A 4HNTA 5C31A 3G1WA 4WNYA 5D6OA 5J2TF 3B3FA 1H23A 1HYQA 5IFLA 5K05A 4GEKA 1FL9A 1YVPA 3ZVRA 4AIIA 4EITA 1Y8QA 2I34A 2JGDA 3B1JA 4ZVVA 5IUJC 5COBA 3LPDA 3AF5A 4Q7EA 1R18A 1GPJA 1HYHA 4YCMA 4DJAA 2IBSA 1NBOA 2XSZA 3BKXA 3KJHA 5EJEA 5C37A 1RWPA 3PRYA 3TNDA 3QQPA 3M8KA 1RE1A 3FHLA 4GHWA 3UMFA 1CXZA 2PZ8A 1UKAA 1DEHA 2D5IA 4JR2A 4OHVA 1ZJ6A 5B4TA 5E6RB 1NVUQ 4M0EA 4QWMA 3KDPA 3VR2A 5EJ9A 2C2KA 3DCYA 3VJLA 1PVOA 1WUJS 3EVNA 2QTWB 1ZD5A 3Q5DA 1E2MA 4DBLC 5J2TA 1NYQA 1CE8B 3GFGA 1JZSA 1NW4A 2FPXA 3FZQA 3IURA 3B3GA 2XE6A 1PL0A 4I5DA 4QNMA 1Z7WA 2QYHA 4IS2A 1V5IA 1I4OA 2II6A 3U62A 5BWMA 3FUTA 4MKRA 3HB4X 4BQEA 4KU4A 4PIPA 5BSMA 2BFCB 3GZ4A 1P0CA 3QVGA 2XDYA 2Y4NA 1ETUA 2VAPA 4ZI5A 5EHXA 4OVKA 4AF6A 1TU0A 2OHXA 1NQUA 4B80A 5DOVA 1V16A 4KLAA 1U0SY 5IVDA 4CMEA 2R2AA 2C59A 2GHRA 2I2XB 4G1UC 4HAOA 3OX2A 1AUXA 4FJ0A 3ITKA 3UOWA 2G88A 1X3LA 1FNSA 4RJTA 3LWDA 1SMKA 3RRBA 3RAFC 721PA 4MQLA 4X24A 4Z7NB 3GLHA 3ZJUA 2QM8A 3BSYA 4TKMA 1G63A 5HJ5A 3GPLA 2QG4A 2XKAA 2FW8A 4GRIA 3V5NA 1NMZA 1YU6A 1XMJA 1ZOSA 4QFCA 1AN0A 5U4XA 3C43A 1XE3A 1OLXB 4B3IA 1L4KA 4L1KA 2PCJA 3KSDO 4O4IA 4MRMB 1UMDB 1CFJA 5EIHA 1QHEA 1NTRA 2Y1KA 1PT6A 3EBLA 1ZRHA 2UZIR 2A9VA 3B1XA 3F49S 3LHSA 4F5YA 4HGPA 1WB4A 3KQQA 5DYWA 2WK1A 3R8XA 4RTLA 4IHJF 5TY0A 3FNIA 1RR6A 3TTVA 1SVSA 4LI3X 4G0OA 1Y4ZA 1W4RA 1U0TA 4DUGA 2YZGA 2HMVA 4WKBA 3AR5A 4JLWA 1BOFA 2PXXA 5DHTA 2QJOA 1LNQA 3C5EA 3UUWA 4D9IA 4QJIA 3OD1A 5C1BA 2HZ7A 1FU8A 4WINA 1R8YA 4KGXA 3F5DA 3D8HA 3LWZA 3NOOA 1HM5A 3RS9A 3W5DA 1RTTA 4NU8X 1H9AA 3QLUC 2WSSD 3MFQA 1XLTA 1RP1A 2BFFA 4C4SA 2XRYA 3LYHA 4TRMA 2Q5FA 1Q1GA 1U99A 4YJGA 3SOZA 4WTOA 2Z6UA 2YN2A 3FYUA 4OHUA 4QBKA 4I19A 4GOKA 2IK8A 3ETLA 1ZN2A 3ILYA 5FBRB 3GLIB 5FTLA 3PFHA 4OFWA 1P4RA 2Q5CA 2P3OA 2PSFA 3SKXA 3GOQA 3I5XA 3NHAA 2AOUA 4Q21A 1L5HB 4UVEA 2ATIA 4QTXA 5C4IA 4ZVSA 1BJTA 5B7PA 1J0EA 1SOMA 4PTLA 1MENA 4JB0A 5EWLA 3W5SA 5DBGA 4BJ1A 3FFBA 5JJBA 4JGBA 4RLFA 3I0NA 4DMHA 1XZ8A 4DNOA 1TB4A 1QFZA 3B53X 4MAMA 5FPKA 4MVCA 4NK5A 5FR1A 3LCVB 1XTTA 1C7QA 1M83A 4Q9DA 1U8XX 1XL1A 5CT9A 5DNDA 1BW9A 4PLVA 4E5NA 4EBFA 2AJDA 4QO7A 5IABA 3SVLA 1BA2A 2CFIA 1IULA 1UK8A 3W1WA 1DAMA 5FNVF 3W6NA 4DA9A 3S2SA 4EG1A 1ECJA 1LW7A 2FLVA 3GBSA 2IZZA 5DLPA 3KZNA 3F9CA 1CERA 2QW0X 3GZNB 2VK4A 4QRHA 5AW0A 4PRZA 4YCJA 4CMBA 5CLGA 1ZR4A 3EEIA 1GFWA 3P26A 1IOZA 3L1HA 2H17A 2W48A 1TUEA 1RHJA 1ODJA 3AKDA 4R1PA 1P39A 1QCYA 1RWMA 2GXSA 3NDJA 3ZCUA 4UHDA 4G84A 1IONA 1U8TA 4RVGA 3VQTA 1DB3A 2CKDA 1AT1A 1L6IA 2Z9CA 1NW7A 5K51A 3SG0A 2JZCA 3UJ7A 3P9RA 2XWSA 3UT5B 2VVTA 4FZJA 3QA9A 1T4CB 1ULZA 3K7EA 1LSJA 1TL7C 4H1WA 4AICA 2R44A 1RWQA 1MRSA 3AUUA 2P4QA 3GLFB 4ARUA 2D1RA 5A4DA 3ML1A 1G3QA 1J0DA 1YBMA 2DT8A 1GSOA 2ILTA 1TMYA 3SZ3A 3QE9Y 3AW8A 3TCNA 3D7MA 1KFBB 4ARAA 3AXTA 4DSTA 4GI7A 1VBFA 2YINC 4MYUA 2ISSD 2UU9B 1OLUA 3TXAA 3D6NB 4Q05A 3ZW9A 1L4HA 2OZVA 4KITB 1Q17A 5D3KA 1VJ5A 3H04A 1KI2A 1NBIA 3GVCA 3N0WA 2PZKA 2HRRA 2EWVA 2IUTA 1YBAA 3GPCA 3UKDA 3CZRA 2GTHA 4QM6A 1U7HA 2Z0MA 1LNSA 2JGEA 5AQ1A 1QZXA 1IE3A 5IG2A 2GEUA 3MWDB 4F5DA 5KQRA 4JUBA 5DT2A 2E2WA 2G82A 2HF7A 1BGXT 1IDOA 2R8YA 4G8CA 5FEMA 3ZWKA 1CZNA 5C35A 4X8OA 3MCAA 1V8PA 1SIOA 5JXWA 1THMA 2NXJA 5LLSA 1YOBA 4UUAA 4M8NE 1O89A 3C15C 1HYEA 3ORYA 1YOVA 3GIWA 4NDZA 5AJZA 4Z4FA 3E0XA 2X76A 3UMCA 1ABBA 4IHKA 1GRNA 4B85A 4F38A 3CINA 4KXLA 4Z4EA 1S3GA 1YFKA 2ZSDA 2X1MA 5CJ2A 3VVLA 3ZJ5A 2HDNB 1R4MA 3NIGB 5FPYA 3G2QA 3V97A 1NVBA 1KI6B 4YBZA 1LBEA 3Q6NA 3WHIA 3GX1A 3GDOA 4RGBA 5JYCA 1TJ4A 3MXTA 1RQLA 2JKZA 3M4YA 4KI0A 5HFNA 4BTVA 2R65A 1XXHA 4DTCA 2YBEA 4RKFA 5HTKA 3KWMA 3CY6A 5C5DA 4CETA 4HOYA 2FSUA 1EFCA 3FUVA 3O4RA 1WPQA 3OY2A 4M76B 1C30B 5DWQA 1KTIA 4GX1A 5G0TA 2XB4A 4ARCA 1GCAA 3CCBA 1V16B 1XA4A 1FVHA 4Q9LA 1CFZA 4X8LA 3UTDA 4IS3A 3ZN2A 5KWIA 2O7QA 4ATNA 4JP8A 3AX6A 2VRCA 3WGTA 3DD1A 4Q4DA 4UCFA 1A4UA 3TPFA 4IFTA 2P65A 2PUGA 5IYZB 3ZGVA 3DJYA 4K88A 1U1GA 3CF4G 5HQ3A 1KMNA 3F5SA 4AF7A 5KYWA 1GA1A 1JA0A 2YY7A 5EFZA 3OM0A 4XRGA 1ZSVA 4JJFA 1AGNA 2N47A 4KIJA 3ZD9A 2F1KA 4BO9A 1YVRA 5EZYA 3U7IA 4TYWA 3AKEA 4HGNA 1QU3A 4ICIA 4EVSA 2QRZA 4ANFA 2GN4A 1COZA 1ZM4A 2PXHA 4R9NA 4J4BA 4M1EA 2PU7A 1RLUA 2FMIA 3L1KA 2JLYA 1VB5A 4UEQA 2J0UA 1N5MA 1TF7A 2PWAA 4HGOA 4Q4LA 5K0CA 1H4SA 4M53A 4PX2A 4UNIA 3REGA 3D7SA 3LLCA 2ZYUX 2QTNA 4BB6A 1WXGA 2F1IA 2C88A 3LP8A 1IHPA 4KO8A 4ZJPA 5LYJF 1W44A 1N6RA 2IBMA 3SHVA 4QU0A 1CP2A 4V0KA 3ELBA 5KTTA 3NX4A 2E48A 4AO7A 1QAOA 3EGXA 3ET4A 1JI0A 3F6PA 3WI7A 4D97A 1PTJC 5JFGA 4X7BA 3OPYA 2UZ1A 3KLMX 4CTNA 3JWGA 1SUFA 3DA8A 1C1HA 4BLOA 3QF7A 3HLKA 4G0XA 3K20A 4R2XA 2IL1A 4AK9A 5EHGA 3M2PA 3GLIA 3KV3O 4MVJH 4O5OA 1W1WA 2ZIGA 4TMKA 3KQHA 2NNWB 2NQ8A 4YJGB 3LRPA 4FR2A 2BFFB 1EK6A 2V7PA 2Z3WA 2BFEB 3MM4A 3T3DA 1UT6A 2XMSA 4CM9A 1G2OA 2B4TO 2DPYA 4IXTA 1K7SN 2F6RA 2A1IA 2FA9A 3FB1A 4MVJD 2IV3A 1Y42X 2G76A 4ZO9A 4PBTA 4FHDA 1NW5A 2F59A 4UBMA 2XDQA 5TARA 1H0RA 1MN6A 3AI1A 1H8ED 3JQ8B 4WN3A 5AYVA 2OPHA 1LPNA 2NSHA 1H22A 4R69A 3AIIA 3BD8A 4D0SA 2FN9A 3CEMA 1CVIA 2GZRA 4CLEA 4FW8A 4D26A 3NYWA 1UBEA 3AKCA 1ZNXA 3TW8B 1KFKB 4FFDA 1KKLA 2P5TB 5HKLA 1PT8A 3RVBA 4PGAA 3E9CA 4XCVA 3MB5A 2FY8A 3I2GA 2P9ZA 1KAHA 3UMYA 2OHFA 3WNDA 3H2KA 1Z5VA 3ZE2B 3AIOA 1P7WA 2WJ3A 4GNKA 1OC4A 2YNMD 4ZCMA 2AC7A 1V2HE 5GTDA 1ZMOA 2PNFA 3HCWA 3MWKA 1CJSA 4NMXB 4TLAA 3X2SA 4DMCA 1L8QA 4C20A 1GPWB 4GWGA 4I0WB 3QPCA 2SKCA 4I3HA 4N9WA 2CJFA 2WSLA 4UFOA 3RT7A 2YS7A 3HY3A 1F0PA 4B83A 2ORYA 2YYSA 3CJTA 4DREA 1ZJWA 1IN7A 1L5WA 2JH8A 1SK8A 4IQ0A 4LRQA 4YXWD 5KMGA 2D74A 2L82A 4ZU6X 5LIPA 1I4EB 1NFRA 3PUZA 2BGJA 1UZAA 2W2LD 4GYJA 3VR3D 4N82A 2GZMA 3Q11A 4OH1A 1S7CA 2M6KA 3V33A 1WBDA 1P7PA 4Y7CA 3EAFA 4V0ME 1KYYA 4MKXA 5HGJA 1JIVA 4NY1A 3I37X 4QLAA 1QX3A 4Z9FA 1L4MA 1VJGA 1UWCA 5H59A 1GUDA 4KC0A 5FI1B 1T5OA 2QZPA 3PPVA 1XCPA 4FONA 2P40A 2YV1A 4HSEA 4IICA 2WWYA 2ZDQA 3C48A 3ZVNA 1XZPA 1GPMA 3E53A 4V03A 4RL6A 5E2AA 3OFSA 1ZGZA 4A82A 1CUGA 1KXZA 3QJYA 3EFOA 4WE3A 3JPYA 1XXHE 5IWCA 3PC8C 4EKDA 2XI4A 3R3SA 4XEHA 3ADOA 4OA8A 4KPYA 1Z4JA 3EDMA 3CRNA 1CVLA 2FRXA 1PF7E 4JI6B 1HA3A 1NKVA 3SX0A 3K4HA 5JNRA 4GL4A 5IJWA 2BBSA 1ZM7A 4AO8A 2H52A 4CI9A 4II2A 2VP0A 2DWQA 4LDQA 6GPBA 1YOVB 5IXYA 3QFHA 1U31A 1X1RA 5ES3A 1XK6A 4Y9SA 2GOYA 3H2YA 1X8XA 1XF9A 4U6SA 4JSRA 4LV8B 3B7GA 1TVKB 2B4KA 2IGTA 3EDRA 1M8GA 5KO2A 5JRJA 4RV9A 4IGKA 4E94A 3KIPA 2CVPA 5E9AA 1GCGA 3KYDA 4GKKB 4WFKA 4P2BA 6ADHA 4MW0A 2JGIA 1U5BB 2V7QD 3TSZA 1XOIA 3BGDA 1GPH1 3R8CA 1VXRA 5EINA 3TI9A 2ON6A 2ONZA 1PUXA 3OFJA 4D1YA 4Q7QA 5DYTA 5H3HA 3H5IA 3AB3A 2FB9A 2BEVB 3G2MA 3P2YA 5LVAA 4M1TA 2ATEA 3QX8A 1WV0A 1KARA 2VPZA 1OHHA 1SGWA 3VDQA 3GDWA 2BMDA 1JU4A 5GGXA 1DAIA 4HB3A 2PSHA 1K8YB 1JFFB 2RGXA 4EMTA 4QM7A 1NJ8A 1JHRA 2IX9A 5DWDA 1E4EB 1KYWA 1U3UA 4IGIA 5KSWB 4R84A 1PDVA 1TO1E 2PUWA 4HXEB 4LY3A 1LDBA 3WK6A 1FEZA 1GU0A 2IPLA 3PVSA 3P9ZA 3JQEA 5BPHA 4NX2A 4IKOA 2XT0A 3R6WA 1SB9A 1RRCA 1QIEA 4HFMA 1J9EA 2G8LA 3IAFA 3PUWA 5CNJA 3OG9A 3F3YA 1UWKA 5BW5A 1U11A 4R5MA 5AJWA 2AMFA 2BP7A 2X0FA 5CIYA 1WXIA 4RGQA 2IV2X 5I5EA 1GGJA 4E7OA 3EFEA 1WKBA 2BMVA 3FOEC 1IM8A 1VSTA 4QOEA 4OJNA 3DL7A 4G4SO 3HCFA 5CNIA 4CM4B 4D3SA 5JEDA 1F1BA 3G9TA 1KSJA 2B2CA 3JTEA 3WLEA 3AF3A 2PWPA 3IVCA 4WIAA 5IKEA 4FMDB 5SY9A 4JA0A 3TZCA 1E2PA 1Y8RB 5JDCA 2RAFA 1M6YA 5SY4A 1TKAA 3O4FA 4BMNA 3I64A 4B5LA 2PZGA 1R4NA 4BUCA 2ZAOA 2I8AA 4EG3A 2GUWA 3RB8A 1N25A 1CY8A 2WVHA 4KVGA 4ZRNA 3FTQA 4IUYA 2QAGA 2EJTA 1FW6A 4KFUA 5JSKA 1HEUA 1K63A 1YZNA 3OKAA 4ZXFA 3LPCA 2FN4A 4KTVE 5COAA 1W0JD 5JR3A 3E84A 1KVSA 1DG3A 4M49A 2GK3A 3N75A 1U7OA 1UPCA 1JDSA 4CF3A 1SC6A 1W48A 4W1SA 3NNNA 3DW3X 3T8YA 3L0ZA 1SG9A 3CURA 1M34E 4A8JA 1EVZA 2GZSA 4KQ2A 4R1SA 3P5SA 2WD9A 3UKJA 2A88A 1HDCA 3P96A 4M9XA 3TSCA 2C7PA 1LRJA 2GJAA 1FRNA 3BGOS 1EXMA 1MRZA 2ZQ5A 3FHCB 1MTZA 2X1LA 3H1BA 2XDQB 1O4WA 1BMFD 1ZGCA 5AM0A 3H2HA 3OPYI 2RHBA 3JQRA 4J0QA 3W5HA 1XDGA 3STYA 2AVDA 2CHGA 2ZE8A 1N5JA 3ITNA 4AQDA 4X7MA 5FV7A 1OFHA 3CVUA 1NF3A 3JTMA 2PAFA 3RQSA 1QHYA 2WJZB 4EJ6A 2PIDA 5LYJA 2PUCA 1PGNA 2XF8A 1PT7A 2QX4A 3EDYA 2YFHA 3GOHA 4TWRA 5G0VA 4XD7A 2V97A 5TMBA 4MS1B 1Z13A 1Q3KA 4OGKA 2ZWVA 3ZOZA 3X0DA 2V58A 3MWEA 5F21A 1V7ZA 2R6HA 2J3IA 3W9UA 2YIVX 3DDWA 5CUQA 5AICA 1YS4A 1Z18A 1E2IA 2W8BB 1TQDA 2OVFA 3CWQA 1RRMA 3LUFA 3O3CA 3CE9A 2CDAA 2PPVA 4Q3LA 2ZJ5A 2YY6A 2Y8EA 4IJVA 1DRJA 4L4ZA 3B8EA 3H9QA 4PQGA 5B58T 2GYYA 2EV9A 3MYYA 3T34A 2BJVA 2F3PA 5DM60 3A1CA 3HDHA 5KPJA 1IJFA 5EGSA 3A2NA 1RLOA 2W6JA 1YKFA 1AK9A 4N7MA 3ZE8A 1R00A 3ZWAA 1GAWA 3L6BA 4MMZB 2XLBA 5JXHA 3GGDA 3LQFA 3PX7A 2CHUA 2H4WA 3C6MA 3OT4A 3U56A 5IEBA 2VJQA 1RAHA 1Y80A 5HCNA 3V2UA 3K09C 1OWPA 1MC1A 4K03A 1FQKA 1GVNB 2DULA 5EUQB 4D4KA 4IH9A 2DWPA 3PPYA 4F2WA 1ZN7A 2H8KA 4EY5A 1OTXA 1WG8A 2XEDA 4O6VA 1Z17A 3OHPA 1IATA 1M1YA 2G1JA 4WOBA 4YQZA 2IXFA 1A5TA 2HXYA 2FCRA 2X15A 2LZ0A 3MAGA 3T7JA 2LP4Y 3DVQX 2VFAA 2ZJ6A 1M34A 4JXZA 2HL6A 1VE7A 3NYQA 2EKDA 4NBLA 4B45A 1DKMA 2WDZA 1ZJZA 4JX9A 3RUHA 1NUQA 1E9CA 2OQ2A 3N2KB 1E2QA 4LMRA 3BF8A 2SNIE 3OEHA 4L74A 4JZYA 2YVAA 2O8BB 1JAHA 4M9SA 3C7TA 3MMSA 3T7SA 4BNLA 1A1VA 1XRRA 3EBOA 1WU7A 3ZU2A 2CLHB 1LW6E 1A76A 1JAIA 1EFKA 1HT0A 1NE2A 1SEPA 3LVBA 3WL8A 3ESAA 1Z4IA 1I9CA 2ZTVA 1JEOA 5MN4A 1WVGA 1OXXK 3BL6A 3KAKA 4WACA 5EFOA 4O8ZA 1NR5A 4G26A 5BWOA 2V7BA 5HSGA 2CVOA 3QPVA 2A0UA 2GESA 3G1UA 4FFBB 1TJPB 5IM4A 4OOFA 3A7EA 3TGPA 4S0ZA 5IC5A 1L5GB 1X7ZA 2WC1A 4XIIA 2A7XA 3AERB 1M2EA 4ODIA 1GCUA 2A5GA 3A1WA 4LJRA 2HEIA 4R9SA 2H1LA 2V7QA 3T7CA 4KHZA 1DJLA 1I1NA 2JFGA 2WHRA 3MWFA 3F5MA 4TYPA 1V7QA 2C77A 2IWRA 3TZEA 1UWLA 1UANA 5CBPA 5C46F 2VRWA 3K6KA 4X41A 5AKLA 1UH5A 1YB2A 1YJBA 3ENWA 4MVXA 1RAGA 3VTAA 2HGZA 2C4MA 2Z2JA 4M9RA 4YNBA 3NH9A 2RK3A 3PUYA 3L0DA 4ISCA 3PEEA 4KMSA 3DE1X 4DANA 2AXQA 2FPUA 4J7XA 3S2EA 1JPJA 2IBTA 4D0RA 3TZQA 4BE4A 4RTOA 1DCMA 1NSTA 1WU8A 5FI0B 1K6MA 1N7HA 3EDOA 4KPFC 2JI7A 3BIJA 4HDNA 4N54A 4NS1A 3BMCB 5I9LA 1KMHB 3MQ2A 3JYQA 4FTWA 4J4TA 1HT1E 4J2HA 3B89A 4S2UA 4YFYA 1I3NA 1YJCA 3H6GA 4EECA 1UAGA 1SQSA 4BJHB 4RTJA 4MW9A 4PLTA 4ZQEA 3RU3A 4PLZA 4C06A 2BY4A 4Q82A 2CHEA 5G0WA 4J0CA 4XM2A 2D54A 3PQ7A 4P3PA 1CUCA 3GVXA 5CH5A 3FOAA 5IK2A 3T3GA 4RY9A 4HMOA 5DTMA 2ZRCA 2PTHA 1NQAO 2G40A 3RUPA 1O08A 4J7UA 2FSFA 3ROGA 2XGSA 3EW7A 3A6PC 1U80A 4HWSA 5HKKD 4B3XA 3NAGA 1SVIA 4G0YA 2PKQP 3IE2A 3UK6A 1V37A 3SEAA 4OI4A 1I3LA 2H65A 3VISA 3UBTA 3RAJA 1L5VA 1PSDA 2GK7A 3G2NA 3PXBA 5T41A 5CK4A 3W2FA 4MVJM 1AH2A 4AZVA 2OO3A 3TAHA 2LW7A 3A1UA 3Q2IA 1OX4A 3RRYA 4ZYLA 1TZMA 4YJ3B 2ZIXA 5E3IA 3IGFA 2DQYA 3OKPA 2P11A 1QAQA 3UMSA 1YJQA 3NS7A 4NOKA 3O82A 4DDTA 2WMNB 3CE6A 4L27A 3VNQA 2UYYA 3EEYA 5LMCA 3QPDA 4QT4A 2XZPA 5G2OA 3WZ2A 5DPMA 4PPFA 3MWJA 1R9MA 3BM5A 3H9GA 3NETA 2NUAA 3IEUA 5BOVA 3UAWA 2PX6A 4JLKA 4Q1VA 1KDVA 4DV7B 1ISPA 4CXMA 1ZISA 3I1JA 5EHQA 2E49A 1TKCA 2MTBA 3DLCA 4V2UA 5C18A 1XLUA 1Q16A 4OXXA 3WV5A 3NYRA 4OLFA 3ZZUA 1NX6A 3LDAA 3RAEC 2O8FB 2Y1EA 4PRKA 5KWEA 5HE8A 4JZKA 3PDUA 2WKSA 4BEWA 1C8BA 2XXAA 2WFMA 4TN5A 1HO3A 2G1UA 1KY2A 1Y1RA 5JPDA 4CM7A 1I01A 2DX7A 2Q4EA 4QA9A 2WUDA 4B0OA 2PM8A 2GFQA 3IB3A 3KEGA 1KGSA 1GYQA 4V0MA 2IXDA 4MJ7A 5B55A 2BZ0A 2R6AA 3OEHD 4PSKA 1Z39A 4FNMA 5HYVA 4RMJA 3D9QX 2D6FA 4MP6A 3LI2A 3O8RA 4ALKA 4HZUA 2BTQB 5EJ4A 3IQGX 2V3VA 4MSUA 1RI1A 2ISCA 3FKJA 1MAHA 4PXSA 2WJPA 1YZGA 4MUBA 3EPJA 2I54A 5JXGA 1W47A 1XA0A 1QHXA 2JKYA 3IOBA 1XN1A 5KVSA 2C4UA 2GWRA 2HI0A 3AETA 4M87A 3R7FA 3UT0A 5ANRB 3SM9A 4A0SA 2FWJA 1RXEA 4MEAA 1PS9A 1WA5A 4XGRA 1Y5IA 4GM4A 2GM9A 2QVZX 4LTMA 3IUSA 4RMGA 5KOIA 4CKCA 4ABTA 4M6WB 1RWBA 2P1DA 1SBZA 3Q4GA 3F6YA 3TTTA 1XZGA 1TUGA 2I3ZA 4MDHA 3OI7A 4ZQIA 4K5QA 4C7JA 3VZCA 3JVDA 1K97A 1NMEA 1NPTO 2E21A 2XOKA 4EZIA 4FFSA 2FR1A 1W85A 2ZI6A 1OREA 3EWSA 3GEEA 2Q3EA 5H4HA 1AQLA 1E1RD 1U8FO 2IHBA 3KSUA 3NHYA 3P94A 4JLSA 5C7OO 3OF5A 5I3ZA 4CUJA 4PQYA 1ZA2A 4TWIA 3EOAI 4DLAA 3AF6A 1COWA 1MABA 3JQGB 3LT2A 4G5YA 4HTFA 1SXGA 3NU1A 1INLA 3COZA 1CULC 4HXYA 4UCXA 2FG6C 2JLWA 3TIXB 2D2XA 4HB0A 3PC6A 5AW6A 5K3BA 1FFYA 1U0HC 2VPIA 3GLVA 1VJDA 4F3RA 3M6IA 3MVEA 3MEQA 2A9PA 1ILWA 5JALA 4F71A 5I7VA 2AG1A 2HMSA 2TMYA 3PZRA 3QENA 1FFEA 4WKOA 4LFAB 4NZ9A 1XDSA 5HIMA 2UVQA 3QXXA 1KPGA 5I7FA 2QF7A 1CUSA 5HJEA 1BW9B 5SYNA 4MB2A 4FB4A 4MYTA 2VT2A 3RRZA 4YPOA 1P74A 1OH8A 4Q66C 4EG4A 3ONFA 5JQWA 1KVTA 3F98A 3IE0A 2WB4A 1EX6A 4KBYA 3VVBA 3ONEA 2WTMA 1SHJA 1NC1A 2JK1A 4QXPA 3TM5A 3GDHA 1PU2A 1X8JA 4NCKA 5F9MA 4E30A 3GLKA 3Q7EA 4CIWA 3GGCA 4A2QA 4AN0A 3D43A 3IHKA 3WYAA 1CLEA 1QU2A 1E96A 4M0FA 3OJXA 1Q0HA 1E9RA 2A78A 4IMPA 1PDWA 3Q0TA 2AFRA 2IP4A 1ML4A 5DIZA 3I05A 4YCAA 1OUMA 1ZGJA 5JQGB 1UBJS 5AVTA 4UU0A 3WGOA 1W0JA 2DPHA 3T5TA 1IVNA 2RJ3A 2AFIA 2KM1A 2M6RA 5JO9A 2AEFA 5EP2A 1W93A 4NV3A 4V38A 1K8ZB 5KKAA 3KVYA 1NOIA 4YV1A 4HGYA 5AJUA 1JKJA 4JITA 5DM0A 1ECFA 4E3WA 4Z9AA 1QVZA 2HWWA 2K87A 2NXWA 3CVJA 3PC8A 2YZNA 5AKKA 3IAS6 4F4DA 4PCVA 1VZ2A 2CBZA 2IYVA 4M83A 5KYGA 4ZV4A 1GTRA 4V2IA 5EJMA 3AYXB 2AUTA 2XCIA 3CZ4A 4W5RA 5LWQA 1U8ZA 3EFHA 5ETJA 5F76A 3ROKA 4C0SA 1QQAA 1EESA 1VYTA 2YJTD 1OTHA 2R4TA 2Y0DA 3BCUA 5EKDA 1ZQ1A 2VDWA 2BEWA 2O2JA 2IX3A 2PJZA 3TUZC 4JOBA 3RTDA 1XTRA 3Q3CA 1Y98A 5SYAA 4WW0A 2PH1A 4FMCB 1U9IA 2QQ0A 2V7WA 3DOJA 4BFYA 3VGJA 3OJ0A 3V46A 1QH0A 3CPSA 3MJHA 3DBRA 5CM2Z 3LLVA 2F00A 3ZX5A 2XUKA 4XWAA 3FPJA 3HTXA 4QXQA 1V4NA 5C34B 4D3FA 2P8SA 3I52A 1SCUA 1UPUA 3IQFA 3LQYA 2DT5A 4IINA 4KFSA 4XQCA 5HBGA 2PMFA 3H0KA 4BMYA 5JNWA 2OCLA 2X4LA 1QF6A 2H51A 4YAFA 3K2BA 1WMFA 4JKIA 4LTDA 4CLOA 3K32A 1ZI6A 3HBJA 3KXIA 1J0AA 1DRKA 3TMKA 2OSVA 4FKMA 4X95A 4GPBA 3EZYA 4I9FA 2AA3A 1EX7A 1G5TA 1I6WA 1X9IA 1MG5A 3GA7A 2ZSJA 1Q19A 3MC1A 5F64A 3CBGA 2B0CA 4UUNA 3GXOA 2I6SA 3G23A 1E6LA 4LYFA 4RFSA 4WY5A 5LZ7A 2PA0A 1E1QA 5KTYA 2WRZA 3ESDA 3JRXA 2X40A 2CVZA 4GZLA 1DEOA 4FFOA 4INZA 3W2HA 1WJGA 3IUEA 4MI6A 4FBMA 2CNLA 2A2ZA 4EGSA 4G4SP 3JW8A 4OK5A 5LBIA 2CT8A 5LA6B 1A2KC 1KL7A 1ZI8A 4I55B 3KUDA 5A7HA 2GHQA 5JY1A 2PQ0A 2QRKA 3DEAA 1MO3A 1TE2A 1JDTA 2NVUB 4ILEA 4BQFA 4ASUA 4KQCA 5AI5A 4YT2A 1IB6A 4BO7A 1FDWA 2ZXUA 2GI4A 1K06A 3F1KA 1DKLA 4RFVA 1EQ2A 2QMUA 3V4LA 1EE1A 5B3JC 4PYIA 1WQ1R 4YI3A 1NM5A 1V48A 1X3SA 1KZ9A 4ZCIA 1IL0A 2AJTA 2H9IA 1GT91 1RDFA 3DBHA 4LV5B 4TX1A 3KQLA 1G8GA 1GR1A 1XD8A 2DPGA 4OQMA 3QPUA 4EKIA 3NM5A 3ZQ4A 2FX5A 3B9BA 4WWHA 2IU0A 5IKPA 1U90A 3DDUA 3VGPA 1E5LA 3EF3A 2B8TA 2GT1A 1UINA 2JBAA 1JR2A 3RREA 4R40A 4ERXA 1MVLA 3RFUA 1FF9A 1ZLYA 2XYQA 4QYIA 5JT1A 1JNXX 3FPSA 1AQJA 1LLCA 1WTAA 4DIOA 2B20A 1Z15A 1SOUA 4UULA 1KIFA 1RBYA 1MB9A 2QX8A 1UP6A 3IT1A 4PPGA 3UPTA 4LSZA 4JD5A 2CYAA 2EARA 3LXXA 2CJWA 2WWVD 2PLRA 1X7YB 5F73A 4HG2A 4UDNA 5P21A 3SVTA 1MW8X 2EOAA 2C4WA 4BEBA 4RYLA 3S7TA 4E08A 4EO4A 2GZDA 3GRRA 1MORA 4XWTA 4HQFA 3EDCA 3S44A 3U9SA 1ADCA 5DHPA 2R5FA 3E5NA 4YTEA 1JTFA 3VV2A 1SKMA 3H11A 4BL5A 4ZVRA 4AWXA 4BNZA 2XWJI 2ZQYA 3W5UA 4BMXA 4KN9S 2VHTA 3ECAA 4MWEA 2IPOA 3VDRA 3CKYA 1VRCA 2FXIA 5KZMB 1P81A 3WLRA 1DWOA 2BGKA 4AU1A 4NYIQ 1T9DA 3L8ZA 4KQGA 4RACA 5FLKA 3FTCA 3CJQA 4PGHA 1N6LA 5BYBA 5JH7F 2GEDA 3PYXA 2QYSA 3BA1A 4DLYA 2PRSA 3WB2A 1CC1S 3LWNA 1EEXB 4GSLA 4XB2A 3OQPA 4G9BA 1KETA 2Q5OA 3KUXA 1IUOA 4YRSA 4UTNA 2GQ0A 5JZMA 3A05A 3E7PA 4RDXA 1UBOS 5AHWA 3RAGA 2L42A 1X7WA 1IU9A 1DKRA 1F6WA 1N8TA 3CNOA 4MGKR 4W5TA 5KDLA 2ADMA 1N2IA 3AJ9A 3MJEA 4A15A 2GNAA 4ED9A 5DYYA 2QVYX 3NTLA 2ACEA 4FIDA 1ACMA 4ZAXA 5CM8B 4J9UE 2EKPA 2QX9A 2B5VA 3H2SA 2HWUA 4LNHA 2QMOA 2WWGA 4ZCLA 5HR5A 1GY8A 1R0KA 1PO7A 1CR2A 2XPCA 4CMKA 3U44A 2NACA 5CH3A 4MW7A 1ESDA 1NDQA 2XMDA 5IULC 1O6BA 4HZGA 3ZJTA 1V7CA 1CE8A 3AJ8A 3BE4A 2EEPA 4MWGA 3ZS8A 2VQSA 1XDZA 3S8YA 3TNYA 3QA3E 5T7BA 4MR7B 2QQGA 1L7RA 3MTDA 3HABA 3HWWA 1Z4QA 3Q87B 4HGZA 3VO2A 3PKZA 5AKJA 3VNBA 3BD9A 2XQJA 2KMLA 5T4FA 1NM5C 5TB5A 2O4CA 4NMHA 4I5EA 4X3OA 5A4IS 2IZ1A 4ACBA 1CRQA 1Z45A 2LXNA 3C5VA 4L2IA 4L8LA 4ZTZB 2IP1A 3EQ6A 3S1AB 5IC4A 1I10A 3ZHYA 2YOGA 1KSFX 1Y3DE 4FGZA 4G65A 5SY6A 5IVHA 3PFIA 4KNVA 2GILA 3H2BA 1A8PA 1RBMA 3DEHA 3KQTA 1JGTA 4E1BA 2BCEA 3U3KA 1VSQA 3EQ7A 3GCGA 4N3CA 2SECE 1G1MA 1GQOA 1T2CA 2REOA 4Q3CA 3C16C 2DSTA 1W36C 4DNXA 2X22A 2B0JA 1SPXA 2BHRA 5SZJA 1U9JA 3R41A 4HV4A 1ZXBA 4WESA 1E59A 1U0JA 4P3NA 3ROQA 1DEAA 2OYSA 2HD4A 3AMVA 2W22A 3A6GA 3TQQA 3OOSA 3UF0A 2QZSA 4CEIA 3L18A 3HYSA 4ERNA 1R2QA 2XCOA 1MJNA 3KC2A 3HZRA 4KLNA 1KZ4A 2PS1A 3A06A 2FPGB 3KCQA 2ZJ0A 4MGEA 4DCSA 1LDMA 1S2LA 2COEA 2Q5HA 3KM0A 4BVJA 2CFRA 1NY6A 2I3AA 4CCYB 1O5IA 3JD1A 5JZVA 4DDHA 2YTZA 1K9SA 1VBMA 3VDMA 1P3JA 1M2JA 3HI6A 2HMWA 3SFZA 3TLCA 2I4TA 4RTPA 2QV7A 4I8IA 4Q1BA 4D9FA 1IAVA 1Q7TA 2JD1A 2WZCA 3BIXA 3H2JA 1JB1A 3HP4A 3NVAA 1H69A 2ZAYA 5E2IA 1J5PA 3JS5A 3S27A 2R8PA 1FUIA 2QZZA 4M60A 1M6VB 3ONNA 4WD3A 1C1DB 3WIEA 3TLGA 1RC0A 1RABA 1A7AA 1CQXA 3RFTA 3NUGA 2IWHA 3U7FB 2Z5VA 2J7KA 3SEZA 2AYZA 4CQLB 2VHWA 4EVRA 3AHCA 4BFTA 2RFLA 4JEHA 2XODA 1KDZA 1NN5A 4PZ0A 1SVMA 2JH3A 5KTOA 4WUTA 2VSYA 2W2OA 2D7JA 5C8VA 3AOEC 3DP9A 4FT4A 3TOCA 4B7UA 3HDJA 4XWGA 4TWJA 4QVKA 4RSGA 2Q7XA 2KJQA 2UYQA 3K9BA 3OUUA 2REBA 5AJYA 5AKXA 1CUIA 3I01M 5D7BA 1Q0ZA 5FPQA 2I4IA 4MRSA 5L7TA 3TGLA 4MUMA 5KYTA 1Z2DA 2R751 3KHUA 2JL1A 3E7DA 5CPBA 5DLQC 3QSYA 3GJ6A 2UYGA 1RYYA 3A1NA 4QNNA 4S2EA 1REQA 3GFPA 3HACA 2BISA 3PQ3A 1VKHA 2PCLA 1EQUA 4J0FA 1HNNA 2WPDD 4O4LF 1RVDA 2PKCA 4Q7JB 4K6KA 2O3UA 2PFSA 2XYGA 2FKNA 4JC8A 4R7ZA 3WKEA 1V6CA 5JTUA 3OAAA 1GP2A 4UBNA 3CEJA 4W5NA 1K3UB 4DIFA 4CGZA 1VSBA 4RSMA 2FF7A 2C9CA 4ZI7A 4NYMQ 4UFPA 1DG9A 2XWPA 1L4LA 1ZINA 4IIBA 4JNCA 1G5RA 4JVOA 1KFJB 1P4GA 3OQHA 4WFQA 4A8TA 1PGJA 1FUYB 4HAIA 4DXHA 1JPVA 1V0JA 1RZUA 3BS4A 5DN9A 4DQXA 3K8YA 4BTLA 4RTRA 1SUEA 1HG1A 3QUCA 1BQ3A 5DEIA 1OFUA 3W6ZA 1E1LA 3TZLA 1ECLA 4DKJA 4IH4A 1J70A 1NRXA 3RU7A 2OFOA 2ZUDA 3HLTA 2RHRA 3AKYA 2YVQA 1EE9A 2PS3A 5INTA 3JWJA 3OSZA 1BG6A 2DH5A 2XEXA 3TLYA 3GO4A 4J8PA 1DAEA 4KRYA 3C3EA 5JNVA 3C6XA 1WKVA 3TM4A 3KG2A 2PIAA 3RT9A 2QQFA 1F1JA 3ASZA 5AHRA 3TIIA 2E5FA 4ALNA 4DM3A 2C54A 3H5VA 1NRIA 4N65A 1QG2A 4AJNA 2HK6A 5LXTA 2VQEB 1EU1A 4NG5A 4DLXA 2JAWA 2NW6A 2CLLB 2Z8XA 3DV9A 3NWJA 1RYEA 1IQRA 2P6PA 1E1YA 4ZYXA 5A5VA 4E6EA 1GOTA 3CLHA 2IYFA 1SR8A 4QOJA 3WIOA 3WNCA 4AUNA 3VO8A 4E5DA 5LM3A 5IT0A 2GAIA 1MIOA 1HLGA 3AEQA 4DCVA 3GUYA 5CA0F 2C0PA 2ZT8A 2XTAA 3W7VA 4EX6A 4FW9A 3I6ZA 1QR6A 3W4JA 4CMIA 3CX7A 4NBSA 4DLTA 3HCNA 3QYPA 4TKLA 5LA6F 1H2YA 4LHWA 3EVCA 1E2BA 3Q8MA 4BKRA 5BNIA 1S9DA 3LDUA 2NUTB 5KKNB 2WVAA 3F9IA 1EXWA 1LLUA 4R1TA 4G5XA 3EG9B 3IV7A 3L40A 3UK7A 4J1SA 1QPBA 4CQMB 5FD8A 4FILA 3MGCA 4OP3A 4J07A 2OXEA 1IC6A 2Q4DA 1KNXA 4UDOA 1FTYA 1IN1A 2GCOB 4BAGA 4BXOA 5CH8A 4Z0PA 4N18A 1XEWY 2R4QA 3AQ4A 1C0PA 1DEXA 2YWJA 3OCXA 1DOAA 2HPAA 3V1MA 1SCJA 1T8PA 3E8SA 2JIPA 4L8VA 3E4DA 1PR9A 2Z6VA 4ZZ2A 3NHLA 3SY8A 5BPFA 2FMTA 2PLFA 3PEFA 4GVLA 3AI2A 3C5CA 4NKRA 3QXGA 5BQ3A 1G9SA 4QJ5A 2DR2A 4JT4A 1V96A 3EY4A 4Y6LA 3GYBA 3MTEA 2IEBA 3E9ZA 4ONEA 3CCCA 1PSZA 3D31A 2XZOA 2PX5A 3C6BA 5H0IA 1U7PA 1WPGA 2VC2B 4YV7A 1YTLA 3L6RA 3L79A 3UB3A 3K5WA 1YL7A 1PG0A 2QSZA 5KYYB 2R11A 4ENTA 1O0SA 4MA4A 1EZZA 5A71A 3KYDB 4BXOB 4H0NA 3T06B 2HSDA 1VZ3A 4IILA 4RADA 2PANA 4UUBA 3LNCA 5GV8A 4YT4A 2NU6B 1C9KA 4GX0A 4H16A 2CV2A 2JIZD 4KW7A 4FYWA 1D2EA 2Z9BA 2PLAA 1QF7A 3RK0A 3ER9A 1VJ0A 3K5HA 3CO0S 1XU7A 2QVBA 3OOJA 3UEOA 5HHTA 1Z5UA 5ALJA 4F9FA 5CPFA 1NVXQ 4JBYA 1M5UA 3PNQA 3NHKA 2QTFA 2I2FA 4XASA 2WU8A 3IDAA 1H1TA 3AUYA 5BNFA 3NNDA 1U5CA 1XYVA 4DC0A 1FNMA 4HUTA 1XZFA 1KI6A 3GU3A 1MZPA 3CLKA 3WMXA 1XRSB 3DKKA 1BQ4A 5A0VA 4HWRA 4IIFA 1D9ZA 3UZUA 1B1CA 1YWGO 4J6EA 2WHPB 2XGMA 5EZSA 4N0QA 2MSWA 3VH1A 1W5BA 2HUNA 3C7CB 5KNCH 1E2DA 3I9JA 5JTTA 1QZUA 2QTRA 5EWJA 1G38A 2CDBA 2FDXA 4TZTA 5KTKA 2R00C 2DWCA 2VXOA 4MDEA 1ISMA 3K4PA 1XDBA 4DA0A 2WM3A 4ZJZA 2J3MA 3GFVA 5DNEA 4YXFA 3LOUA 5IAGA 1Z6TA 4RBNA 1IVSA 4S3MA 3AR8A 2XE4A 4KN6A 4L5BA 5BVHA 1MFPA 1OROA 3IXLA 1N2CE 4MHTA 2W6OA 4XR4A 2GJ8A 3LUCA 3BB4A 2H2GA 2RG7A 2EBWA 1UBCA 3LM8A 3OMWA 2GAOA 2OHOA 4FUTA 4IO1A 1MPTA 1YDEA 2ORED 4PICA 4I81A 4N6NA 3MGAA 1M8KA 3FKSA 1G8AA 4UDYX 1F60A 1U0RA 1D3AA 2C31A 4H7EA 4OBWA 1KRWA 4PXAA 1C14A 2RHJA 1NI4A 3KWLA 4X1IB 4CF5A 2XMCA 3DPUA 2FF5A 2ZB4A 2M6SA 3PQ5A 3X3HA 4LF7B 4MS3B 3OICA 1FSSA 5IBPA 2CZQA 5K0EA 3T0FA 1ONSA 2P9TA 5EVCA 4N41A 4ES6A 1WULS 3WG9A 1UK9A 3AU8A 4BLTA 4EKGA 1Y9EA 4L8WB 2QLLA 5C4GB 5B7GA 1FVXA 5K4HA 3OQVA 2YXPX 1A9TA 3OOWA 1OA1A 4ZI7B 5JU6A 4H1TA 1QIFA 5BVHB 2B1RA 5DDIP 1QS0B 3P9KA 3HCRA 5TEWA 1TZKA 1LV7A 4BUZA 2GD6A 3CISA 1P2VA 1RLIA 1LC0A 4KQFA 4QSHA 4DV3B 5BT9A 1OU0A 4XTRA 4PY2A 1MV8A 1B15A 1WDLA 2G7ZA 4W5HA 1BROA 3PL5A 1TEHA 4NNJA 5IT4A 2X8WA 4RM3A 3MMPA 1E6EA 4I6JA 1YAHA 2BMAA 2F9MA 2H5JA 5J47A 3HP7A 3ANNA 1UZLA 3B52X 1JAXA 1XTZA 3JYPA 2XA2A 1GJRA 2V8OA 2QDKA 3FUUA 3TE6A 4AJIA 3J7AC 1XIVA 5AVYA 2PO7A 5DKFA 2X8AA 2Q2NA 2ZLBA 3OIWA 4J94A 5FFFA 2FEAA 2QU8A 3WRYC 3RU9A 5C3MA 5C52B 4X65B 4ZT4A 4DLWA 2R60A 4GOND 3O9ZA 2DF8A 2D8MA 1CEXA 1Q11A 1TYDE 3LG2A 1Q83A 3MG9A 2WAOA 4FGSA 1QCCA 2NUPB 1RWWA 1B2RA 3RR2A 4B9EA 5E7IA 2X77A 4Q47A 4AYXA 2QW1A 2YNMC 1X7DA 3W8EA 1W0CA 3DMNA 4FHZA 4EFDA 3ZLJA 1JDUA 2C5AA 4JHLA 2XD4A 4WBNA 1CDOA 3PRKE 4DA4A 2VOJA 2GAFA 1II8A 2PH5A 4D0LB 3W90A 3U49A 4PANA 2GBFA 2O05A 4GI5A 3G9XA 1HOXA 2D2FA 2I4RA 4IG9A 3L7IA 3T3EA 5JH7A 3URKA 4PG8A 1BH6A 3SF0A 5AXBA 3R6DA 1GKKA 1T3HA 2JA2A 1I6LA 4FYYA 2Z6QA 4B81A 1K5GA 4LCJA 2RGUA 2ZTMA 3PQ8A 1XZMA 4YMIA 4ON9A 3WIDA 2F3RA 2G4VA 3FCUB 2WUVA 4EAQA 4EY8A 3UO8B 4ZI3A 5KVAA 2K7FA 2XRZA 1MXHA 4FSHA 2G36A 3S6JA 3VKHA 2ZJAA 3AINA 4LYGA 2ZVJA 4RF3A 2W6MA 3V2IA 2FFBA 1ZI9A 3IBYA 1GRQA 4XD2A 4YAJA 1V95A 3RYFA 1VG1A 3Q2OA 1R4MB 1RKQA 1VTKA 4UHJA 2VDQB 3NLLA 3AHJA 4HDKA 4HVTA 4NZOA 5DM70 1M34B 3R09A 1QC5B 5CW2A 2O2CA 2QMQA 4REQB 2QHXA 5DSXA 1RI3A 3QEBZ 4Q1CA 2XLCA 3A36A 5FUMA 4FYXA 4OB6A 1YBHA 5D85A 4N3AA 2R1TA 4EEXA 5KX5B 3GL9A 4WXPA 3CC8A 2FDRA 4TKUB 3NG1A 3L8HA 1N6KA 1JG7A 2OFPA 4F4FA 1QO7A 1QQ6A 1XHFA 3FKSD 1A9YA 2CD9A 2Y1FA 2AR0A 4QELA 4U3JB 3IPRA 5HX7A 5LU9A 3WGMA 2JZOA 2XQGA 4OY3A 1TJ3A 1C7RA 2WSYB 1N5RA 4R0VA 1LF0A 1PZEA 3W5CA 1NNEA 4FDTA 4DG9A 4FCWA 3EVTA 3TQTA 1A9OA 2QN9A 5HKOA 2HRDA 4HS9A 4QXOA 3Q15C 1KNQA 3BT7A 3G8YA 3OFKA 2FX2A 2ZJFA 4IX1A 2G0AA 3SPXA 2G0TA 3OT1A 4I5FA 1T5HX 3DUFB 4RORA 1YS6A 3BHIA 4H3KB 2PL1A 2BCJQ 4G3XA 5ALTA 3RGGA 1CU1A 4TV9F 3E9NA 3HBLA 4L08A 2XVMA 4LF6B 5ED4A 3N0RA 1NATA 1SBQA 3H8WA 4WXYB 4QJBA 3DDHA 1LVUA 1TM1E 1EVEA 3KWJA 4G36A 4PX5A 2F8MA 2Y9PB 1DJNA 5LIRA 1OX6A 3D3NA 1LBTA 5JI3E 4AAYA 4EGCB 1DBRA 1K4KA 3CXUA 2E1RA 3FCYA 4D9EA 3DVAA 1GFIA 3T1OA 2FOLA 1F2TA 2AOUB 1POWA 2J9GA 2QS9A 1NLYA 4HDNB 1NJFA 5TGDA 2OV1A 3VOBA 4BB0A 5EWMB 2ZIAA 3UN1A 3WYFA 2XGJA 4DE5A 2QYTA 5FJJA 3OX1A 4E5MA 4B2IA 2ZCJA 3ID6C 4B6FA 4ARIA 4EKYA 3MN1A 1RW4A 1QR2A 1VFPA 3KVNA 3QEMA 3QMPA 4ZA2A 3A6FA 3VBCA 4CVNA 2F2TA 4Q6BA 4TROA 4JYPA 8LDHA 2Q41A 3NFRA 3QKSA 5DBIA 3ZJ4A 4HK4A 1VLVA 2PK3A 4I9UA 1DCFA 4P9NA 4TTSA 1HE1C 4CL3A 4CQJA 1HNXB 2YHUA 4MIYA 4KLCA 2Z83A 1M10A 1AKEA 2VT7A 3IMEA 4AROA 3IILA 3IEPA 2HO5A 1KC1A 1E0DA 3IPXA 2D00A 3EXHB 3GAFA 1N34B 5ECGC 1KAOA 5KJCA 4DHWA 5DRTA 1PG2A 3QLVA 1FYWA 3KYJB 3DYVA 2GFIA 1VCHA 5KVVA 1N2ZA 2F8LA 2HGSA 2JLRA 1MA3A 1DRUA 3OOEA 3MJFA 3GCWA 5A05A 5JNLA 3L7JA 2PRKA 1BN7A 3MT7A 3B9RA 1HDEA 4AMGA 3RC8A 1XTUA 3LC7O 5D00A 4CM8B 2BEKA 1FUUA 4YRJA 1RD4A 3Q7IA 4BQIA 2IH4A 1AUQA 3CN7A 2VBIA 5IP5A 3NM6B 3RO7A 1FDTA 1XKXA 2OEPA 1GL3A 4NBVA 4R1NA 4WA7A 2J4FA 3S7ZA 3AESA 2YYAA 3WB1A 3H2ZA 2J33A 2PGOA 1F9EA 1V35A 1I2DA 1XUOA 4QATA 5FHQA 1GDTA 1VKZA 1O9BA 3L1JA 1DJOA 2IIPA 4BV8A 3LCRA 4BPBA 1JR3E 3L4BC 1P80A 4HKTA 2WWHA 4WZAB 3WIVA 1MP0A 3PNSA 1PGPA 1ZM3A 4QD3A 4RIIA 4MV5A 5FI3A 4KFRA 1M75A 5KNDA 2Q5EA 3BORA 3CKLA 4KDRA 2JIMA 1AMOA 5KOHA 4RFSB 1GGKA 1OKKA 2C4KA 3OQ1A 4MKFA 5FIUA 5ESWA 2ZR7A 3CZAA 3IP3A 3AETB 3K0FB 2OY0A 5EIFA 3ZHQA 5JHHB 3B12A 2VZ9A 5JARA 3O94A 2RGDA 1IK6A 1PJCA 3B60A 4QYWA 2CCGA 2E6KA 3LW8A 2ZI3A 5E38A 5AUPB 1KEPA 1N2JA 1GYPA 5DGXA 2IS4A 2NV6A 2VP2A 3KOUA 1MB3A 2PFGA 1VMDA 3BFPA 1RSZA 5EWLB 2IH5A 4GPIB 2X0JA 3NBUA 2BM1A 1WV1A 2W93A 4HATA 4IRMA 5EMNA 1RKBA 2FLKA 4XQEA 1Y5MA 1FX1A 2B1QA 3EARA 4Z51A 3F7MA 5F1YA 4X6UA 4C08A 2Z1NA 3HR7A 4I5IA 4K9QA 4C3VA 4EFKA 4DJDC 3U4DA 2FEOA 4UUMA 4DLNA 3A1TA 3D54D 3KVVA 3O93A 4M99A 4M0CA 1NMXA 4XPIA 3R75A 3T52A 2IOQA 4HAWA 2ZB7A 3AEYA 3W8FA 2C3PA 3O2QB 2FPWA 1YL6A 2LCFA 5GM2A 3GLRA 4CTMA 3R0QA 4Y9TA 2QD4A 4TLLB 4BNGA 4Z7JA 3AY3A 3AUKA 4UBOA 5ER6A 1A4RA 5K7SA 1JDZA 1ZITA 4UBLA 2FWPA 2EGGA 3PQDA 2J31A 3I8OA 4YAGA 3E1KA 2NYRA 4N3BA 3OLQA 2PAAA 3Q88A 5F51A 5JE8A 1CDEA 3P97A 4FZ3A 5AKHA 4ZHQB 1I2AA 1QG6A 1RXWA 2QB5A 1NVWQ 1BC5A 4UXIA 1JG1A 4B3BA 2JD0A 2HV8A 3HXLA 3HU5A 2EJCA 4Z8XA 4H7IA 2V9PA 1JQKA 2HMTA 1I13A 3EG5A 4RH0A 4IQ8A 3VSEA 4C0AC 2BH2A 1FFDA 3WLFA 1H0KA 1ZVVA 3HEAA 3Q7SA 3AONB 1FSFA 3CO5A 3P19A 4MS4B 5B64A 5KHLB 1USIA 3KL4A 3IUMA 4DDMA 4F46A 5CG2A 2JANA 1GZ5A 3RS8A 2WG1A 4L4UA 5DULA 1R0XA 1XX6A 3E22B 1SKYB 4I4CA 3ODGA 3FX2A 2AJLI 2D1YA 5ALXA 2XKBA 4OHMA 1BVRA 3PUIA 4O4HA 2D7CA 1MB0A 1P6QA 3FSJX 5AUOB 3GN1A 4ALMA 4JJIA 5HNKA 3BDVA 5LMUB 5DGIA 4TTQA 1G8MA 1NVAA 1OWMA 3TXXA 1QE5A 1B42A 1Z29A 1Z22A 2Z4TA 4Y9UA 4F4IA 1XP8A 3UICA 2MSKA 4HO1X 5T4BA 1ZO8A 3O84A 1Z06A 3F7TA 5ELXA 4K0KB 1UZNA 2HO4A 1BSVA 1JIUA 4BNJA 4EZEA 1FDRA 3QU2A 2PWYA 4PYRA 5DW0A 2YNMA 4DR1B 2FSVA 4GOOD 2Y3IA 3VYUB 5ALSA 1T3TA 5KC9A 5L3QB 4Y30A 4EP1A 2FMXA 1CJBA 4ZO7A 5A5GA 2RE8A 4UAJA 4ZVTA 1Y7IA 4CT0A 1JSXA 4B6JA 3EA0A 3GNLA 3WOVA 4O4HB 2CUTA 3QX7A 4N5MA 1ZIYA 4HNUA 1VECA 2E4ZA 1CQZA 4FLMA 4R2LA 4Y1FA 2P68A 3GEBA 3I9LA 2R8OA 3J81A 4PFJA 5TPZA 4E5VA 3HA2A 2WIFA 4BQRA 3SE0A 4GMXA 3O7MA 3W6UA 3KOXA 1A2BA 1YI1A 2YHSA 5IUNC 2XIJA 3DMYA 2PD3A 2QX7A 3GFOA 2WI8A 5D1NA 2WJGA 4BRUA 3GUCA 3GD7A 2ETVA 3DNPA 1YE3A 2EZ9A 3FIUA 3IH5A 1U1EA 1A50B 4NCHA 1XRNA 3FYUB 5AUQA 5ALRA 1LI5A 2HQBA 4DDVA 3N3BC 1DRWA 3IV9A 4IGAA 1KOFA 3BQNB 3ESYA 3GT0A 3D8UA 3Q9NA 4F8JA 2ZUVA 3SQDA 2JIOA 1THTA 1NUPA 3MJSA 2HKIA 4FS8A 4MRAA 3WK9A 4DPMA 5BXYA 3RRNA 4PLPA 3W1EA 3DAHA 3DLPX 4D9GA 3M1LA 1SC4A 1PG5A 4DV5B 1GZUA 2BZSA 2UYOA 3DD5A 8ADHA 1KAMA 3ZXIA 4U2BA 1N8KA 1W46A 2HYDA 1Q6YA 2RC5A 1RIIA 4CM8A 1YGPA 5E2BA 4M88A 3VKVA 5ERGB 3EIHA 1EDBA 4L28A 3SC6A 4B3HA 3I1FA 4PYNA 1TIBA 3VYSB 1NR1A 1CQJA 3RC1A 2NO9A 1FFAA 4YRAA 5KNLA 3O8QB 1ZHOA 2VXBA 4YRNA 2X4DA 4K6GA 1BEZA 2J9FA 1D6JA 2JF0A 3ADCA 3K0CC 2INGX 4UBKA 4ZN6A 1AKVA 2ZCVA 3LKVA 3KO8A 4L3VA 3JQ9C 1Z82A 2L18A 3DFIA 2QJWA 3SZLA 4KFCA 3QJGA 3ZHVA 1OZAA 1F48A 4X60A 3K0EA 2X0KA 2C92A 3PCXA 4PWYA 3LDFA 3RSLA 3WSWA 3ZZ1A 4GECA 1FJ2A 2OBXA 2QI9F 1FFSA 1RADA 1UXHA 4UUPA 3C7DB 1WW3A 3VJMA 3VMMA 1MAWA 4GG1A 3PDIB 4M1ZA 5JDIC 5D6NA 5A06A 1XQWA 3IEVA 3AVXA 4G1MB 1HDXA 2RCNA 3AHIA 1KEKA 3PI6A 4RUKA 1W5FA 4C4XA 3CRMA 3KR1A 4AJOA 1SA0B 1LX6A 2ZEJA 4E5UA 3PQ6A 2J3KA 2LUOA 3HFRA 1GZ7A 4H1HA 4HDRA 4TMTA 3K9NA 4D7AA 1E5TA 1B0UA 2FPIA 2G67A 3OE7A 1K4YA 2OUKA 4GT1A 4HBZA 2V54A 5JAMA 5JW6A 2C1ZA 3AGPA 5LOVA 4AY6A 2KWIA 3EIEA 4GKVA 4IJKA 3RW9A 3TQSA 8MHTA 3BAFA 3CLTC 1RQXA 3UMRA 3CYFA 1I7QB 2C82A 3QVTA 5GWXA 4TTTS 3UJDA 3OX4A 2VNAA 2HSEA 1M1XB 3PWTA 3TK1A 1M2KA 1YFZA 2AR7A 2EZUA 2VJOA 2WFAA 4OQ4A 4CIAA 5E9QA 1U2DA 1VDZA 3IEIA 4RO0A 2JAOA 3A58B 4JLPA 4M0UA 1MZVA 3CONA 2F4VB 3SBOA 1CF9A 4BLUA 1WD5A 1N77A 3MRXA 1P5ZB 7ABPA 1RI2A 1LDEA 1UBUS 4JWTA 1ULBA 1GAJA 4P31A 3D6AA 4Z1OA 3FHTA 2FETA 2WBLC 4DRZA 1FIUA 4JYCA 3WNQA 3QY9A 3T99A 3IAS1 1RJ9A 2WLTA 3BXGA 4DJ5X 4ETNA 2ZB8A 1PEYA 4HY3A 4DMLA 1FYDA 1AMNA 4ND8B 4F56A 5BV7A 3QW4B 4MV9A 4RVOA 3ZWCA 3G2OA 1JA1A 2CL5A 4X1KB 2HIGA 2LKDA 1QHNA 2WWWA 4TUYA 4X54A 3UW3A 2XKJE 3EZGA 1THZA 1OAAA 2MINA 4EK9A 3RS5A 1JKMA 2J9YB 1BIFA 4TSFD 2WYVA 4CQNA 1ORWA 3AEKA 1Z37A 3MUOA 2GZ1A 3PPWA 4GIBA 5KTMA 3PIIA 1QGUB 2C99A 3TLXA 5JFTA 1X0XA 1FTSA 1JMYA 2DPMA 2OCYC 3ZQUA 3COWA 1TM3E 3LLSA 4C7BA 3H97A 2LWIA 1T9HA 1OYOA 3K9LA 2A58A 3KOYA 4GW3A 4RHFA 4TV8F 2CNDA 3GUZA 1OYWA 1BMFA 1F2DA 2XAAA 3KBBA 3NZEA 5EZQA 3VV3A 4B6RA 2I9PA 3IIIA 2WE7A 3NTOA 2IS1A 3REFA 1T34A 3D02A 1WB5A 2FX3A 1L5RA 1LH0A 3QVJA 4GPAA 4ENUA 5L4NA 2FOIA 1WEKA 3CZMA 3OZTA 3MWGA 3UAGA 1XQ9A 1J0BA 2IELA 4LNUA 4JXKA 1TCBA 1OB2A 3MAAC 4ENQA 1Y4UA 2PJDA 3AOEA 4H6PA 1B0ZA 1RAAA 3S3TA 3RJ9A 2IODA 1NPYA 4QTTB 1WR8A 3V34A 2X7HA 3OM9A 4LHXA 1T5TA 4ZTBA 4LMPA 3JYLA 2ZK7A 4FOOA 2ECOA 4O2RA 3TLKA 3N3AC 4D3ZA 3AR9A 4CG0A 3U09A 4J0JA 4HLCA 2ZT7A 3PP8A 1R88A 5IFKA 3X1ZA 4W9RA 1QOZA 4QXRA 1IPEA 3OCUA 2B99A 3IKVA 2PZFA 1BU5A 3QIAA 4HP8A 1WDWB 1RMYA 2YQZA 4ZALA 5BRAA 3D81A 3A0UA 3SLGA 2GEFA 3DL0A 1SHUX 4IIJA 3FYHA 3Q85A 4KK3A 4ZT2A 3CVWA 3I45A 1U02A 1GRRA 1LTHR 1YUMA 2DWOA 2QTLA 3KJXA 2GZ2A 4N4AA 2QV0A 3WGZA 3L7LA 3GP3A 3A6DA 2I6QA 2Z3ZA 3HFJA 4W7IA 4RLHA 3WGYA 5C53B 1YV9A 2BFNA 4U39A 1XDWA 1GPNA 4NONA 5LUBA 1EBFA 1T25A 4HT3B 4YYZA 2BFOA 3MRSA 5DJ5A 5A9RA 1CJVC 3ABRB 4JLUA 4KG7A 4MLDA 4MS3A 4XVQA 5ILGA 5JHGB 3DEIA 1ESZA 4HLUC 5A9TA 3LHFA 4GBGA 4XCQA 2WDPA 3CW9A 2C29D 1Z8HA 3QF4A 3RBVA 1MOSA 3WIBA 3RYCB 1YACA 2OMKA 5B2ZA 1AQYA 1OX4B 3AP1A 4ZV7A 1I2ZA 4DIDA 1KJQA 5K9ZA 4G0UA 1H2FA 1V6AA 1Y7TA 2FGKA 2HBRA 4BO6A 4NMLA 3PEWA 1B0PA 4MVJG 4FP9A 4X3CA 3VR5A 4YRMA