4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cholinephosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
3IVCA 1WQ4A 4NX2A 1O94D 1IFXA 3N05A 4FZJA 2OQ2A 1N2GA 2PZ8A 3FOCA 3SEZA 1JIJA 2D5BA 1O95D 1N2EA 3OP1A 4P2BA 4DLPA 2Z3VA 4MW4A 1IRXA 4MVWA 4DE5A 2CYBA 1NZJA 4NAHA 1FFYA 3PNYA 4NAUA 4ZT6A 1IQRA 3N2YA 4Q16A 4BWVA 1K4KA 1N3LA 2DETA 3TZLA 1IQ0A 5KHAA 3X1KA 5H7XA 4WNYA 1J70A 4PBRA 3N9IA 5BNZA 2A86A 4MUGA 4H3SA 1EFVB 1IH8A 4J75A 1MC1A 1CT9A 2YXNA 3HZRA 4EG1A 2Z09A 4DDHA 4JYZA 4K03A 1GTRA 2DXIA 1VL2A 3CLSD 4F4HA 4OUDB 4MUJA 1OWLA 1R6UA 1XJQA 1P7PA 3ND7A 3IOCA 3H97A 2DEUA 2DERA 1WXIA 1YULA 3G6KA 1LI7A 3LCJA 3QE4A 4YMIA 5JBNA 2CYCA 1HYBA 1QNFA 1OD6A 2A88A 2WQ7A 2NZ2A 5J59A 4EF6A 1J20A 4KR6A 4HPWA 3MUEA 3ND6A 4MAFA 4CQNA 2IELA 1EFVA 1XNJA 1WY5A 1GTSA 4KR7A 1TYAE 3COVA 4G6ZA 3CVWA 2CYAA 1O95C 2C5SA 4OUDA 3CLUC 3IUBA 4PY2A 3IVXA 3VU8A 3H9CA 5TEWA 3SZ3A 4GU5A 4QBTA 5DEOA 1KH2A 1QRTA 3U1VA 2PG3A 5FO1A 1N1DA 2WSIA 1FYDA 1MAWA 1F4LA 3L93A 3P0JA 4MWEA 1J1UA 2X0KA 3RK0A 2H2AA 3COZA 1I6LA 3RJZA 1NUTA 1WJGA 4AQ7A 5EKDA 1Y42X 1D2RA 2WQ6A 4MW7A 1NP7A 1NURA 3HFJA 2JAXA 1TEZA 3RHSA 1H3EA 1QRUA 1WXGA 3ZUGA 4RUKA 1T9GS 1GN8A 4JFAA 1NYLA 2QJFA 2Z08A 4ZT5A 4E1AA 3PRHA 4MW9A 4DNXA 3FI0A 5IHXA 1WOYA 1PFUA 2A1TS 2O5RA 1PG0A 2GKSA 1H1TA 2A1TR 2CFOA 1JECA 4HJRA 1O5TA 3LE8A 1YIAA 2A1UB 4HJXA 2D13A 3ND5A 3CVVA 4ARIA 1KP2A 3AG5A 4JXXA 1N2BA 5J5AA 2VTBB 1U7XA 2D54A 4ARCA 2GM3A 1OBCA 1KORA 1EJ2A 4MVYA 2B7LA 1KKUA 1PG2A 3MXTA 1G8GA 1KQOA 3HGMA 3VRHA 2H29A 2J5BA 2X1LA 2QTNA 5HUHA 4QRDA 1M1ZA 1OWPA 1JEEA 2E0IA 5FO0A 1GPMA 1Q11A 1TYBE 3MLAA 4ZCRA 1M83A 5DB4A 5FNZA 1QRSA 4ZT2A 4ZCQA 4MW1A 4XFJA 1O6BA 3ILVA 2A1UA 2YWBA 4JZYA 4U63A 4MW5A 1VBMA 1KH3A 1ZUNA 2TS1A 3SDBA 1O0CA 2G36A 1MRZA 3FHJA 1TYCA 3INNA 3TQIA 1PFVA 2XRZA 1NUQA 4Q93A 1OWMA 1Q19A 4MUFA 2BYTA 2E21A 4CT0A 1GAXA 3Q10A 2HGZA 3TS1A 1F7UA 1U7DA 4X0EA 1KAMA 1MB9A 2AKEA 1YIDA 2J07A 2PXHA 3FY4A 3CLRD 3BL5A 3D6VA 4WSOA 1IVSA 4I6GA 1WXHA 3AIIA 4I6EA 3MLBA 3E27A 1B6TA 3ZJUA 2PFSA 1JGTA 3A05A 2JANA 1QJCA 5DK4A 1PFYA 4NDAA 1KQPA 1MB2A 3ELBA 1T6ZA 2J09A 3AKZA 5LLTA 1H3NA 1KR2A 3FWKA 2QUHA 2E18A 4CDNA 3NBKA 3ISJA 2DPLA 2A84A 2CUZA 4MUKA 1VBNA 4MLPA 2R5WA 2RD2A 1I2DA 1O94C 4MWDA 3KT3A 3JXEA 1KH1A 2CSXA 1N75A 3IMGA 1XNGA 3H9BA 3CLTD 1J1ZA 1R6XA 1M8PA 1UFVA 3ZXIA 4EG6A 1N2JA 3IVGA 1EXDA 1I6MA 4R2MA 4ND7A 3MMXA 4YBRA 1A8HA 3A04A 4HK4A 1H3FA 4G5FA 5HUJA 1LW7A 1YUNA 4MVCA 1OBHA 2NSYA 3DO8A 3Q4GA 5F23A 3I05A 1U0BB 4U8HA 1TQ8A 3NBAA 3H05A 1ULHA 3TNJA 3KFLA 3SZGA 1NI5A 3FNRA 3FDXA 4ND6A 1MOPA 4L2IB 3RBAA 1GLNA 1YI8A 2J4DA 4KPUB 1T9GR 3RFFA 3X1MA 2E89A 3M5WA 1X8XA 2CV1A 1JILA 2AG6A 2V0GA 1N2OA 2EL7A 3CLSC 3IUEA 4PBSA 3UC5A 2BTEA 3CVXA 1LI5A 1OWNA 1EUQA 1U3CA 3SYTA 4EG3A 4MUEA 1ZJWA 1G8HA 3Q12A 3TZEA 3ZXSA 4MWCA 1ZH0A 1G8FA 3AL0C 3F3MA 2QUJA 3COWA 1XNHA 2IJGX 3NV7A 3GMIA 3FG9A 1WQ3A 3P0IA 4ZCPA 3CR8A 1JIIA 1O97D 4MVXA 3HV0A 3SP1A 4G5YA 3SEQA 2J08A 3FH0A 4L2IA 1NSYA 1KP3A 1G59A 2PIDA 4KPUA 3HL4A 3HMQA 2DUMA 2V0CA 3ZIUA 1JEDA 1EFPB 4U7JA 3CLTC 1T6YA 3S3TA 3IDFA 3AG6A 5H16A 4TS1A 1O0BA 2PZAA 3CVYA 1T6XA 2YWCA 4MUNA 4EFKA 1F9AA 3A2KA 2CT8A 2VTBA 4MULA 2ZUFA 4EGAA 3PNVA 4MW0A 4DDKA 3IODA 4UZFA 1S4MA 5IJXA 5TGTA 4MUIA 3CLUD 1K97A 4YP7A 1N77A 1V47A 4KKVA 1JIKA 4J76A 2X3FA 2OV4A 1K92A 4JXZA 1JZSA 3ZJTA 4MUHA 2X1MA 1I6KA 3DLAA 5TEVA 3X1JA 1X6VA 2CV0A 1EFPA 5K0SA 4F3RA 5J58A 3G5AA 1QU2A 4NZPA 1J21A 4NATA 3UOWA 4A91A 1JZQA 3CA8A 2QTRA 2QUIA 2VXOA 1MAUA 1O96B 3P52A 1KQNA 3PNBA 4ZT7A 2EJCA 5LM3A 1J09A 3QTTA 1DNPA 2CV2A 4YP6A 2RE8A 1YUMA 1V8FA 2JA2A 1KAQA 1QQTA 3K32A 1N2HA 3AFHA 1O97C 3IOEA 5KWVA 4DDMA 4DJAA 3RK1A 3IOBA 1PFWA 3FETA 4EG7A 4ZCSA 1BS2A 3KT8A 2QJOA 4AS1A 1ILEA 1RQGA 1ZH6A 4ZT4A 1SURA 3GUZA 2ZUEA 2QUKA 3DV2A 3G59A 1U3DA 4CDMA 1WZ2A 3FIUA 4MQ6A 1M8KA 1R6TA 3CVUA 4R2LA 2AZXA 3A4IA 1O96A 3H99A 1K4MA 1NUPA 1JHDA 2O8VA 4GRIA 2QTMA 4YP5A 1IHOA 3ZJVA 2WB2A 3PXUA 3UMVA 1M8FA 3VGJA 2ZP1A 3L92A 3IMCA 5K0TA 2HMAA 2IP1A 1OWOA 3UY4A 3QTBA 4EG8A 5LFAA 5AHWA 1N78A 1COZA 1EE1A 4R0NA 3CLRC 2HZ7A 1Q15A 4UZEA 1TFUA 1JMVA 2A7XA 3TQOA 2DR2A 4K0RA 3OTWA 2YY5A 3IMEA 1IQUA 2I1LA 2XRYA 3GLVA 3LOQA 1MJHA 4PBTA 4XSVA 4MW2A 4ZCTA 4ZT3A 3C8ZA 3COYA 1Q77A 4MW6A 1M8GA 5HG0A 2QJTA 4S1OA 2A4MA 2PZBA 3N8HA 1F7VA 3KT0A 1NUUA 3D6UA 4MWBA 1M8JA 1VLHA 5KCMA 1WXEA 1NUSA 1WKBA 5TS2A 1GZUA 3UK2A 2GOYA 4OJMX 4EG4A 1QU3A 5DASA 1WXFA 1QTQA 4QREA 4RPIA 1MBZA 1N2IA 3ZGZA 2DLCX 4XFDA 3P0HA 4I6JA 4KR9A 1VBKA 3DPIA 3KT6A 4EG5A 1EUYA 3IH5A 3K9WA 1TYDE
chains in the Genus database with same CATH superfamily
5DOZA 5F9MA 1XVTA 3TUJC 3PDIB 3LSYA 2K5UA 1H0SA 2WSYB 3UV7A 4XWKA 3MCZA 1XOIA 5A9SB 1PEDA 5JFTA 3HLKA 2OCAA 2XTAA 2HRDA 1KS2A 3FYSA 5GZ1A 5TDHA 1LPPA 1TUGA 5F3RA 3TVYA 3AK4A 2OKCA 1RE1A 1I36A 1RACA 1KBOA 1X0XA 2RCYA 4NG4A 2BCGY 3AFGA 3F6EX 4DE5A 4HDSA 2AZDA 3G5LA 4FZVA 1YXMA 2AKYA 4FLFA 4ASUA 2JLYA 1RWVA 1XRMA 5A0VA 4AMVA 4R1UA 4ZT6A 5LP1A 5BXYA 2WZQA 3OIFA 3EFHA 3RE1A 4BNZA 2ZTSA 2QTVA 3A4NA 1K4KA 1XROA 3DOEA 3GGCA 4XGRA 3DZIA 4YLEA 1NVGA 4AP5A 1A5ZA 1OYYA 1RI5A 3BMNB 3ZN2A 4OLBA 2R1ZA 1MDFA 4U7FA 1BMFD 5C7IO 4DY4A 4DPKA 7GPBA 1CRZA 1NAIA 1NRJB 1QYIA 1GNQA 1Z4OA 4NJOA 2L42A 3GMDA 5DTJA 3N9IA 3K0SA 3ZWVA 2A86A 2NTNA 3HSKA 3CMCO 5EZYF 2CSUA 3UB2A 4I3GA 5DTMA 1LV8A 1VCMA 3CH4B 4DANA 1G9SA 5FQOA 2JBWA 3EG9A 4WI1A 2CNWA 2BC9A 3GLGB 1CVLA 1T4BA 3DVRX 3QVOA 4NBSA 3IA2A 1JI3A 2WJIA 3F78A 4F60A 2XH8A 2DY1A 1GTRA 1Y7HA 1J23A 2Q0HA 2PVCA 3OCUA 3K72B 4R2KA 2B3DA 3NHRA 2J0QA 1P7PA 4J94A 2WIJA 3AUYA 2CL0X 3T3EA 3ZV4A 4AMYA 3GD5A 4B4KA 4NJMA 5KTOA 3ZZNA 1U2RA 5AMXA 5TMBA 4ZQGA 4B3FX 2RH8A 2G7MC 3TXXA 3VUEA 5FPQA 5U9CA 3I9V1 5DH9A 1P4RA 4YIKA 4CF3A 1WTCA 5HOEA 3G7SA 1UDWA 3BCSA 4YUVA 1UQUA 3P2JA 2A2ZA 2BLNA 2XE7A 3FCAA 1FMLA 3GNTA 1LNQA 4RFLA 2O0HA 1GR0A 3NGMA 1VYHA 5AKZA 5T4BA 1DFGA 3T7IA 2EERA 2YFHA 2IY9A 3BC1A 4MWZA 4MVJE 4R3NA 3THYA 5BSHA 2XIQA 1D9ZA 2IELA 3CNNA 4BWFB 4DQVA 1GPYA 1E6LA 2MSEB 1CVIA 3AHIA 4LOLA 4JC8A 4F97A 1GTSA 2ST1A 5DBOA 3L7JA 1V8DA 3HMKA 4LK2A 2P2SA 4JP5A 2VJBA 2VF5X 1P33A 4C30A 3CVWA 4FE4A 3RC1A 2G5GX 1XMQB 3G9XA 3LY7A 3NAZA 1QRTA 2XMSA 3CNQS 4HVAA 2QR2A 5D3MB 3W6ZA 5TLSA 1LDMA 3KNZA 2VIIA 4G37A 4YO7A 1Y4DE 2AHRA 3M89A 4Z9FA 4PQYA 3AQIA 4MWEA 1J5PA 2EX1A 1QIDA 4YQZA 5EY5B 4ER5A 2C96A 2IYFA 2W4IA 5ITVA 3HNOA 4HATA 2AJBA 3AU8A 4EGFA 5B12A 4CUZA 2JGMA 1L4MA 4R8LA 5KBYA 3IXLA 4Q3EA 4R8MA 2PXCA 4IIJB 1MQAA 4X41A 4JI0B 2H3HA 2CVOA 1Z8DA 5DX8A 3RYIA 4REQB 2NADA 2ADFA 3WA7A 1D2EA 1VE5A 1GN8A 1ZIYA 4FQ7A 4O4JF 1G8YA 5G0WA 1P7ZA 2Y1LA 3KZ1E 1DL5A 2NIPA 4GKVA 1PT6A 3U7JA 1HT1E 4IV8A 3ASVA 5JNVA 4RTRA 1GKUB 5GGXA 2BF4A 4ITRC 3D8RA 4JLVA 5E3JA 3KAKA 3GGGA 4HJRA 3SC2B 5AW1A 1YIAA 2WHEA 2IH5A 2PKCA 3ND5A 3BRSA 3QKRA 4E5KA 3H4TA 4ISBA 4EECA 1E3LA 2D54A 2IW1A 3VKUA 1OKKA 1FFGA 1OBCA 3B53X 1I2ZA 4WERA 4UFNA 1UC8A 1XTIA 3IDSA 3L8HA 1XMJA 3PHCA 1XEXB 1W46A 4J0FA 4DYDA 1G8GA 5DPMA 1GXSA 2OM6A 3QY9A 4LXIA 1RW4A 5BW6B 3U09A 2OBYA 4HBZA 2D1FA 2YJGA 4YJ3F 2FW1A 1MCZA 1LBTA 1WO8A 2ZAYA 2VP5A 3IUQA 3MWFA 3NS7A 3Q6NA 5EPEA 1AA6A 2BFWA 1W94A 2WTUA 1IJKA 3NGLA 4S1VA 1XDWA 1UZNA 1IVNA 1ESCA 3EUFA 2E0IA 3OZ7A 4X54A 2Q0QA 3TLAA 2VN8A 1ZM4A 4ER3A 5JNRA 4F5WA 1TYBE 2O3TA 4B3HA 3JCZA 1F8YA 1LF5A 4CKEA 2J6HA 1OH7A 1GNVA 3P94A 4TV9B 1RRGA 3AI2A 3OA0A 5BV8A 4MW1A 4XFJA 3JRNA 4TTVA 1ZR4A 3DBRA 3MMPA 3SDBA 1VBMA 3T5TA 3CB2A 3TLMA 1O0CA 4HFRA 1RKVA 1ACMA 2QN6A 4L57A 1FS5A 3EDYA 5KNCH 4L7QA 4ZVKA 4MNTA 1OZAA 2C2ZA 3C5VA 4LCBA 4TS9A 5HZHA 1NUQA 2IHJA 2QX6A 3GDOA 5ESDA 4P9NA 2PKQP 2AD1A 1P3DA 1DJOA 2OV1A 3A1DA 3OZGA 3PC6A 4TT3A 3HSYA 3TTWA 6REQA 1XG5A 3KJIA 1JJVA 2OB2A 1SCUB 1CQIA 2CD7A 1LF0A 2P67A 2IYTA 2Z95A 3L6CA 3QPUA 2WYVA 4OJYA 5JHHB 2GHQA 1ODLA 2R66A 3L06A 4ZTBA 2XVYA 3CLRD 2REXB 3PPVA 2GAJA 4RH3A 2FPRA 3VMMA 4TSFD 3D6TB 4GC9A 2IVZA 3DQPA 4IZ6A 5D87A 3OAAD 2AOXA 2EF0A 3QVMA 5KOJB 5KVAA 3LG2A 1GUAA 4ES6A 4HLNA 3RTEA 4LTDA 4MQFA 5T6BA 2PFSA 3HRHA 4JBXA 2JPDA 1U9ZA 3KXPA 4CVNA 2JANA 3SKYA 3GLSA 2DWPA 5HMMA 1P5HA 1U8TA 5KVQA 3T5CA 4EPXA 3CG0A 3QF4A 3THXA 3TQSA 5JAIA 5JSHA 3RC3A 3SHTA 2V9CA 2ACKA 1BS1A 3R0ZA 5PGMA 4M8SA 2ZR0A 2ZZKA 3DBLB 4HXEB 5AQEA 2I76A 4HF7A 4QXPA 5FUMA 1OW3B 3WGTA 3K2QA 4F5YA 1Y8RB 3KD2A 4QEZA 1J0DA 4IV5A 2WKRA 3NUZA 3V8PA 2AF4C 3ZWAA 4KYTA 1YOBA 3DYBA 5JZVA 1JHVA 2CF5A 2IV7A 3WK8A 3B6ZA 3MILA 1FSZA 3KKKA 3W2IA 3HV2A 3DOUA 4G41A 3ET4A 4NBUA 3EPJA 1EK0A 4ENRA 3AF1A 4TKVB 1N2JA 4DJEC 3P4XA 1RXEA 2OHIA 3C3XA 4KRYA 2GPYA 4O59O 4U02A 1FP7A 5F5XA 3UEOA 2NVBA 2NYRA 3V1YA 1EZZA 1Z6XA 2QNBA 1A4UA 2KM1A 3DE4X 4L6IA 3ZNPA 3ICWA 4CR6A 3EY9A 5CB4A 4LF9B 1E6EA 4FCVA 5JQWA 2IFTA 1UF9A 2Q29A 2QYTA 5H82A 1WG8A 1I1OA 3UK0A 4C0XA 3U1BA 2V3CC 3FDXA 1OI3A 5SZHB 3U56A 1OLXB 3FFTA 5HS4A 4JBNA 4IDGA 4GE0A 3AR6A 2C0QA 1S2IA 3NH6A 5EQJB 3Q6IA 3DE2X 5EA2A 4UXIA 3JWJA 2O5VA 2W7TA 4GOOD 4HNAB 4JJGA 2IE8A 2Y3IA 5FX2A 2C2KA 4ZGGA 2X23A 4H15A 4JVOA 1CNFA 1CXZA 3UJAA 3OF2A 4FDLA 4Q9NA 1XLTA 3KE9A 1V45E 5KNBH 1XEWX 5A06A 4ESEA 4A6PA 4TUYA 3GVCA 4OBXA 1KDYA 4G09A 1GGMA 4CNBA 1K89A 2V59A 1MJGM 1U3CA 2GN2A 1ZNZA 5B7NA 1J42A 3GLFA 4MO2A 3WHIA 2YQZA 4LC9A 4YFVA 2YIJA 1Q22A 5B5SA 1UP4A 4E46A 3D7NA 4PYJA 3RIEA 5AVYA 4EKIA 1W87A 4PXAA 3OKAA 2D0DA 4WXYB 5CAEB 4N7RA 4D6PA 4EFNA 4YUAA 5IC6A 5BSVA 3HV0A 3OJCA 5LP6A 5ELXA 1WPQA 2ZJFA 2RGGA 1BU5A 4X66B 1M0SA 2AR7A 4LOAA 4R2WA 5HX7A 5I9SA 1TO2E 4V03A 4WBNA 3E35A 2NYUA 1RRPA 4RMJA 4ZAXA 2W37A 3VU9B 3ZDQA 4EUNA 4ZRDA 4F85A 4CM8A 4Z0PA 1U0LA 1FFSA 2I66A 3QBEA 4YRTA 2YWFA 2YYSA 5EZYB 4RY9A 2VJLA 4PC1A 3O2NA 4U7JA 3CRNA 1Q0QA 2JS7A 3MSXA 2FDCA 1I6WA 4UM9D 2PH5A 1MVNA 1T3TA 4GBJA 3E8SA 3FFWA 5H16A 1GZ3A 1LRJA 1QDUA 4K8RB 1GZ7A 2WHQA 1U1IA 3H04A 4B2LA 5KWSA 3FVQA 2HNBA 4BNNA 2JD0A 3DFIA 2WT9A 2ZUFA 1SXJB 3DT8A 2C3UA 4BQQA 1H6CA 2X41A 3WDLA 4IPTA 3RSSA 3FX2A 3LC7O 1G98A 3A1UA 2PS9A 1GZDA 3TZ6A 2FRDC 1VE3A 2BBWA 3AY3A 2W83A 5JMOA 5JS7A 3EIXA 3VNQA 4U63A 5IM5A 1LA2A 3D6FA 1K92A 1KIFA 2A33A 2PKWA 2XMRA 4LF4B 4E14A 2GZ1A 3O8NA 4R1SA 4BE7B 3RJTA 2CK3D 2A4KA 3LT4A 1HDYA 1SC4A 1UPUA 3DZBA 4J0HA 4O5AA 5DO9A 5E1MA 2J0UB 3WBKA 4NENA 4XLZA 2GJKA 5FR1A 2CXXA 3OPYI 3VZPA 4UDNA 2ZKLA 1DJMA 1GPLA 1JVSA 2D62A 3KOYA 5FF9A 4HD8A 2JARA 4JR1A 3PXCX 3HWX1 4LZWA 5PNTA 4QBHA 7ADHA 1L6IA 1TT5B 2CZCA 2GNPA 4P93A 3P52A 4HUQA 1RE0A 1XEWY 1U7HA 4E2WA 5BSUA 2NUTB 1YHYA 3OUTA 5KJ6A 4HX2A 2QTAA 1DNPA 4DG9A 2DH5A 4OIFA 4CKZA 2WJJA 4OREX 1X77A 4AN1A 2QS9A 2IC5A 1E5TA 3I73A 2ZRPA 5A4MS 5KOYA 3R20A 4DMFA 2HXGA 5J2TA 1UBRS 1B2RA 4WOJA 4JQOA 5EVCA 3DBHB 3HYTA 2P9YA 5EMNA 3SC3A 4QL3A 1IOVA 4WCFC 4XIFA 2HSGA 5DT2A 3BHNA 2ZJ0A 4BFXA 2FWBA 4Y0VA 2BDEA 4RMGA 1I51A 2I3GA 3PB3A 4ENSA 4D79A 1YI0A 4RPHA 1OY1A 3HB4X 4JIGA 2EGGA 3GUZA 3PWZA 3TEMA 4D74A 4ICIA 4Y9TA 2GWHA 1GAJA 1E5VA 3D6AA 4WXMA 3IUMA 2BN4A 3RI3A 4DM3A 1KJ8A 3N0XA 4FOSA 4E21A 2BDTA 4V0QA 4D9CA 4O4JB 3UPTA 4MQ6A 3TO5A 3I01A 1M8KA 3FPCA 4RLHA 4TKUA 3HVHA 3M3DA 3N87A 4NU8X 3WBJA 3GW8A 3IALA 3IP5A 4ZVQA 3OQVA 2C4VA 1NP6A 2MDTA 3HCFA 4EJ2A 3LUAA 2PSFA 3EYAA 1CS4C 1Y3DE 2LDBA 4BMXA 2QW8A 2XUPA 1YQTA 5AUPB 4NNJA 2NYAA 4HO1X 4XCVA 4W7SA 4BU1A 2FUCA 2HSZA 2WFAA 4ZHQA 5I7RA 5BMOA 3ID6C 3ZCSA 1E9SA 3C1UA 3JD4A 1P6QA 3C3CA 1DAOA 4HFMA 5EKTA 4M8LA 4ZVTA 4W82A 3B3FA 1G20B 4UATA 4IXMA 4DEXA 1M6VA 3BKXA 5U1PA 3BK2A 4FEAA 3WQBA 2W6PA 3CLRC 1Z06A 3A37A 4H2DA 4YJ3B 2EBFX 4RGQA 4W5HA 2SCUA 3UYLA 3ZY2A 3LNCA 5BQFA 1FTNA 4EPTA 2YXBA 2OPHA 1RU3A 3EZXA 2GGSA 4K81B 2HI0A 4RF4A 1MOSA 3CCBA 5EE3A 1DOAA 2GD1O 2BI7A 2C78A 2R9VA 1RQRA 3MJ4A 5AD1A 4J3NA 1Z16A 1ZJZA 5KDOA 3COYA 2X9VA 2B20A 3S5UA 5AVRA 3W5VA 4TVOA 2HDHA 3G0GA 3JVVA 4MQ4A 3Q8WA 4M7WA 4ZC1A 4XRRA 1ZIPA 2CHGA 1GYQA 4QYIA 2FK7A 2OXIA 4BASA 3UAOA 5JY6A 4QT0A 2PGIA 2C00A 1SZJG 4RDHA 3CX6A 4P5PA 5KYUA 5LJLA 4FCCA 2P1DA 1FU4A 4LJ8A 4EYSA 1NNUA 2M6RA 3GLHB 3BXGA 4EW6A 1XD2B 3QEJA 4KSBA 5DTRA 1KEUA 2HK6A 1SEVA 2Z58A 1B14A 3OX1A 3Q1LA 4RYLA 3RVPA 1V6SA 4JLAA 3CW8X 1Y4SA 3DWEX 4IVRA 1QTQA 3F4LA 1X1EA 3QOYA 4ISCA 3LUKA 3UOGA 2DP4E 3GO4A 2BM1A 1KOFA 1QK5A 3W8FA 4LJSA 3VO9A 1ZNXA 2PUWA 1LSOA 2Z4TA 3KT6A 1WSBA 3FGPA 3MJFA 5HRCA 3GMSA 1SC6A 5FTWA 1LRKA 3G7UA 1WQ4A 1DIAA 1O94D 2QMOA 1T2FA 3BIWA 3CHYA 3EVFA 3K0KA 2BLLA 3PV0A 1E89A 2QLMA 3PIRA 3QITA 4FDUA 5T4HA 3T1YB 5K3OA 3BGVA 1Q50A 2OZLA 1M0TA 4ZJPA 5A5DA 1O95D 2ZSKA 4CXMA 3IEVA 1E2FA 2ORWA 3SKXA 3STWA 1WUIS 4AECA 4GZ3A 4HWOA 4PG8A 4YRMA 2NU6A 2RHRA 3E05A 5IEJA 3UMSA 5J40A 3WDMA 3O75A 1THTA 4QUHA 5CXXA 3BYZA 3N2YA 3RCBA 2V03A 1H2RS 2NVWA 1FU7A 1RFLA 1JFVA 1K0FA 3D31A 4MMXB 3IIEA 2ICAA 2HJWA 1ZR2A 4OLHA 3WLQA 5CVDA 3KQOA 1USGA 1RRFA 4KXXA 4P3OA 3AVUA 3EIUA 4GD3Q 3FCSB 3G2IA 4H1TA 1IM2A 4R2XA 2DPGA 5ER6A 1GKIA 1IH8A 1A7UA 3ENZA 2OP1A 4L51A 1SWVA 3ABOB 1QNLA 5CBKA 2AG5A 4PLHA 1E6WA 3H1PA 2EQBA 3PDJA 1SUDA 3L01A 4OOEA 1WKVA 5IYZF 2XA2A 3D8UA 4R68A 5KYKA 5LMNB 5DBHX 3MTEA 4Q18A 3EPKA 3Q7PA 1V7PC 1XJQA 1K8ZB 2JHFA 6ADHA 4FN4A 4NK4A 4OHUA 3M9WA 3I5MA 4BCCA 1XZBA 3WMXA 3CW2A 5BMVF 1Q74A 4MEJA 3IBCA 3SJZA 3TVTA 3V4ZA 4HZGA 3W8DA 4X1OA 3UMJA 5L6MB 3NDJA 5KNBA 4PINA 2O05A 4PZUA 3TAHA 1YT5A 2Q3FA 3EXG2 1VMDA 4P33A 3QHAA 1RM3A 3F9RA 4PRZA 5AI8A 4GL2A 1L5YA 1UPTA 2P8JA 2QUAA 4MA0A 4CG0A 3OQBA 3SM3A 3B1ZA 4KL8S 1IEWA 3SBEA 3DAGA 3U7QB 2X0JA 1T34A 2FQ1A 4AB1A 5JZOA 1Y6GA 1DQPA 1YGYA 5E7JA 1MIHA 1U81A 1X7XB 4H3HB 4G4IA 3E9EA 1FDRA 1IZ0A 1M2FA 3LW8A 1VB3A 1TYAE 3BQMB 3DMTC 3T3IA 4JUDX 4Z3DA 2XGJA 3UT5A 3GJ4A 2IXBA 3H9UA 4FYIA 4UUOA 4PWYA 4YAKA 5BR4A 3TG2A 1YAJA 2VDPB 4MV7A 5LZ2A 2ECFA 4G36A 2PM8A 3PR3A 4XFKA 4EIWA 5DLEA 3TD6A 3ONNA 4LC1A 1BS9A 1K06A 1L5RA 3U1VA 3BRWD 4JJEA 4OHOA 2O1SA 2R00A 3S2YA 2CC2A 2C84A 4NIMA 4G9GA 4ZVNA 2OC4A 4ZJUA 3EGOA 3DZKA 3I5AA 1N2CB 5K05A 4BX2A 4YY3B 2OK8A 5EXSA 2HW8A 4FYHA 3C3MA 3OC6A 4MLDA 4UM5A 4QYMA 5FEUA 1QS0A 1V95A 1YOVB 2YZNA 3I92A 1SCAA 2BBTA 1L5OA 4HYTA 4L9RA 4UOQA 2NT3A 3DMFA 3KKEA 4BCBA 1NURA 1KJJA 3G2NA 1Q0UA 3V4FA 3FMOB 4IV0A 5CDFA 1IZ7A 4R5HA 1GARA 1QRUA 4YPOA 1T9GS 1SOUA 2ZYGA 4ZT5A 4B73A 4D42A 2IEAA 3TCXB 1PFUA 2W6OA 5TPWA 4CKBB 4AU1A 2O5RA 1ONPA 3ACDA 1EBBA 3C1OA 4Q6BA 2P40A 1LVHA 2X19A 5AO9A 3GPLA 1GWNA 1QP0A 2MMCA 5DYWA 5DHRA 2C0CA 1CUWA 2JFXA 1U99A 3GQBA 4FHDA 1N6LA 3S2EA 4KXYA 2GO1A 3I1FA 5AJVB 2W6NA 2CDAA 2CHFA 2Y1EA 3EXEB 3GP3A 5FB3A 4G5XA 2G06A 1DCKA 4MVYA 2XEXA 1VIDA 2WFLA 3A4VA 3OWXA 4MUMA 2IP4A 3RC7A 4Q3BA 2JFFA 3QYJA 4KLAA 4RD2A 5JJKA 1MHPA 3DULA 5AW8A 1CP2A 2X1LA 4ZC8A 5AICA 2O5CA 5GWXA 3H5NA 3PR1A 4NBWA 5EUQB 3SN6A 2BR5A 4GW3A 1XDUA 2Q07A 1AB5A 3LYLA 4HZUB 4M98A 3X2SA 2C92A 4V0ME 1JEEA 4KDEA 3QJYA 5EE1A 5DXFA 2V98A 2CUTA 5FNVF 1N92A 3C4VA 1HTTA 3KXKA 3EXHC 1M83A 2HJ9A 2I8LA 2YTZA 3K96A 3KQSA 1QRSA 2GD2A 3L7DA 3I37X 4YRRA 1U90A 1O6BA 1NATA 4OLJA 2QYSA 2YS6A 3QV1A 1ZGZA 2VF4X 3L18A 1ESZA 1KFBB 3ZIAD 2V54A 1Q2UA 1Q95A 3VJMA 1PP4A 2WTNA 4QDTA 1E79A 2I55A 2JRCA 1YVDA 3K6JA 4UD6A 4PCLA 1NF2A 2Y0CA 4KAFA 1RQXA 2PUTA 1ZA1A 4PFKA 4KZPA 4YB8A 5TJHA 3V4OA 1G6KA 3OKCA 3DO5A 2VBFA 4H3VA 4TROA 5ITZA 5CJ2A 1KAMA 4QUKA 2DWUA 1RPAA 5COAA 2J5RA 4DQKA 2Y76A 1G38A 4JJFA 4GR5A 2IUEA 4CEIA 3F74A 3HA7A 2YASA 3U7RA 4S12A 1XTVA 2GRAA 2Q27A 3DR5A 5KYYB 1XHEA 1NOKA 3D6VA 3MINB 1NKTA 2P62A 1YVEI 2BKAA 3MB8A 4MYTA 5AVKA 4ZEVA 2QJWA 1G7TA 2ZZNA 1L7MA 5TMDA 3ZJUA 1W8DA 3E4DA 3AH8A 4IDNA 1CF2O 1RJFA 1WB9A 5K01A 4NBRA 1Y9DA 2OC9A 5C8DA 4NCIA 1JG2A 4NFSA 1MB2A 4KDRA 4DIEA 2Y66A 3BFVA 4K9MA 1KRXA 3QPDA 4Z2YA 4P7JA 5HM6A 2OQVA 1YFKA 2I6FA 3FWKA 5LA6A 4RHFA 5A7FA 2AX3A 4CDNA 1XDDA 2XCQA 5JZ9A 1OB2A 3E9RA 4BDSA 3ESRA 4G2NA 1IM5A 4QLOA 4IUBS 3RLFA 2IDJA 2EZTA 4CV3A 2Z2IA 4CLEA 1M2OA 5C0OE 3VR2A 3F96A 4P84A 1HE2A 1VBNA 1GRVA 1O94C 2C9BA 4OB8A 3RK4A 1EWQA 5DX1A 4K9QA 5DXAA 2QN8A 4X85A 3AY6A 2I8CA 4DLWA 3I01M 4PFQA 2V7UA 5DIFA 1BH6A 1KDPA 1VCNA 1GV1A 1UMDA 3P9XA 3RRJA 2Q5QA 4RD1A 3IKVA 2CFTA 4LJ4A 4X45A 1ZUWA 3GJ5A 4OB6A 3RB8A 3PJDA 3Q72A 1WQ1R 3EQ9A 4EP1A 4MP6A 4GI3A 4WY5A 1Z0UA 4E2XA 3RUEA 3NM4A 3TXAA 1LNSA 2C99A 4F3KA 4JBHA 2ZJ7A 5ALFA 5EZ6B 4C4OA 2XKBA 2Q2OA 1FU8A 3LX4A 3RAPR 4KXQA 1FVXA 1ZJYA 3MWEB 1X13A 2SECE 2IPMA 4HTFA 4CTNA 3SJAA 4H4DA 3D4IA 5L3SA 3T4XA 4OB7A 2DUNA 2XT0A 2GN9A 1V16B 3RBAA 2O2ZA 3G7NA 3ORRA 1BRTA 4LQCA 2JLUA 1WSAA 1TIPA 2C88A 1HRDA 2ODEA 2NO6A 2Z5VA 4MB2A 3F8SA 1TD9A 1V1MA 1T9GR 3E9ZA 5D2CA 3WLPA 4C76A 4M1QA 4CT4B 1RAEA 2BFOA 2P65A 2QTTA 3WC4A 2ZI7A 3HH8A 1T6BY 2L82A 3P8ZA 3QXGA 4ZANA 4BFYA 3GP8A 2HF8A 5LYJA 2VJKA 3I5UA 1WMSA 2HLDD 1SUIA 4O8CA 4UMVA 5JUWA 1T1EA 2AZMA 5T8KC 4GOND 1IZ8A 1G16A 1TD1A 3VH2A 4KWCA 4D8YA 4DW8A 1YMQA 3ETNA 2EFDB 4MWCA 4OMCA 4ARBA 4DA4A 3I6QA 1JSCA 2CJFA 1DKOA 2J7PA 5IK2A 3UAVA 4D2IA 3IIIA 3FNQA 3MW8A 5DCYA 1C9YA 3AW8A 1VRCA 2JA1A 2HEIA 1U98A 3DKIA 3FH0A 1U2EA 3MSCA 1NYQA 4L2IA 3JD1A 2IPLA 3SQLA 4KFRA 4N65A 5JDIA 4B84A 5LQAA 3FRHA 2NU9A 1ZN2A 4DC9A 4LJRA 3DFKA 4BAUA 2XKJE 5EYPB 2G1PA 4L16A 1M1NB 2MSCB 3KHUA 3M6XA 3HCNA 4YAFA 1HT2E 3OCXA 4FX2A 4F6LA 4DBVO 2X8LA 3CNEA 3KKMA 1J8YF 5BNIA 4M8KA 2QL5A 1E9EA 3FDZB 4KFCA 3HB1A 4KBFA 3JW8A 3ON5A 4FJ0A 5FWXA 1Y1PA 1JBEA 3E5RA 2VP2A 5L51A 3B38A 2H6EA 3DZCA 1CR4A 3IIJA 1O0BA 2V74B 2ZTVA 4JOSA 4V38A 2PY6A 1MXFA 3BG5A 1WEKA 1PJ4A 3S7TA 5K0FA 3KZOA 2AE2A 1NXQA 1GLVA 2FPGA 1HK7A 2W4QA 3IQXA 2CXQA 3KQWA 3LL4A 1EINA 5BQPA 3GN2A 1C0PA 2UZ3A 4JA0A 5ESXA 4ID3A 4ZDWA 3ZV7A 1UKVY 4B8ZA 4F86A 5JXJA 1B15A 1A9PA 2YFQA 2GRJA 5FA8A 3UFXB 4EJ6A 1I2MA 2Q6IA 4ZO6A 3K4QA 1TAQA 4CHGA 1D0VA 2K7ZA 4KCGA 1UJ6A 1T3GA 4UVGA 1QO0A 1ZK4A 3C39A 3I23A 3L5KA 1TCVA 4NE7A 4NYMQ 1X87A 3BERA 4PO1A 4RQTA 3RG2A 2B83A 3AGPA 5BSKA 4LXHA 2YY6A 3H2YA 2Q45A 3T7CA 1ZGAA 2J31A 4PGAA 3DC2A 2G28A 3SQDA 4B6OA 1DU4A 4ZYVA 2PZFA 4NZYA 3CY6A 4CMIA 4A73A 3K0HA 5K4HA 2ES4A 1NKSA 1PR5A 1KEWA 1MB0A 4BJ6A 3AHDA 4UPVA 5LM3A 2JI4A 4R9RA 4GBGA 5CH3A 1YBHA 1COWD 3CWZA 2FFHA 1RRCA 1NMXA 5K3FB 5CDYA 4AUKA 3C97A 1BW9A 1VQ1A 4X62B 4AX4A 3T1HB 5FFMA 4X44A 5IDYA 5H1YA 3DXZA 2Z6AA 4QHSA 3C7AA 4FCWA 2HTFA 3DV0B 1NC1A 5F35A 1VM6A 2QRPA 3I2GA 3V00A 2Q5JA 4EG7A 3I04A 3KAQA 1HQDA 1P0QA 3F1LA 2D1SA 4HPJB 4UVEA 3LRTA 2BKEA 1BJKA 3G79A 1CY0A 3JZMA 1LCIA 3VSBA 1ECLA 2HH9A 2QI9C 3AONB 3GV0A 4D9GA 4DABA 2XWJI 1TUBB 5BUZA 1EWRA 4E5DA 4Q1EA 2JGDA 1E0AA 2GF0A 1ZAYA 4GMXA 1VKZA 3H1AA 1Z4IA 3IXQA 3UBMA 1P9OA 4NBLA 3C14C 3Q9SA 2WPDA 1ORIA 2WTAA 1ECCA 1UXGA 1V6AA 2H65A 2PR2A 4GR9A 5JCOA 1AKYA 2RCNA 1GV0A 1RABA 2C1EA 1WXQA 4DR2B 3PXUA 3UMVA 2QGZA 1H0KA 2H1RA 3HDQA 4ZVLA 4LDPA 1NOJA 3QHPA 1TK9A 4WN9A 3ZBQA 2B36A 2FAXA 1QC5B 4O5OA 5DM0A 4CL2A 4HRAA 4E5MA 4PRLA 3TTXA 3Q1KA 3RRFA 1P3JA 1I13A 2CLEB 2BFFB 2HV8A 3VOSA 4P5EA 3E3LA 4BBJA 5CDHA 2NO9A 5K7SA 5CFPA 3DHNA 1RXYA 4F1WA 4ZV4A 2RGDA 3TLJA 4BQPA 2J3JA 2JAQA 4Q4JA 3W7BA 4EOGA 4J4TA 1TIKA 2KBFA 1E4VA 2I1LA 4EA9A 3K6SA 2R2AA 4DMGA 5T57A 3PQ7A 4UMEA 2VDKB 3FNGA 4CLHA 1JAXA 5LZ5A 4C7XA 1PO7A 2B69A 2HPHA 4NS4A 2ID7A 5DGTA 5D00A 1JPNA 2DTXA 1Y5IA 2GCEA 2XE8A 1R0RE 2BUBA 2QOEA 5E95A 4UMDA 5AXBA 4YDQA 3ZD7A 4RETA 4D4HA 2XCOA 3FGZA 3H8WA 1ZNYA 4IWNA 3SJUA 3PUXA 2ESRA 2ZUWA 2W6IA 4OHWA 4ZDJA 2O8EB 5HQTA 4B79A 1DCMA 4HWTA 2OV6A 2ZAGA 3DAYA 3BE6A 3EG5A 1G5RA 2VDLB 2WFZA 1EG7A 1JJ7A 4ZEOA 2OLJA 2PRSA 5IKOA 4EPWA 2O3SA 4IIBA 2FDRA 4OJMX 1E2EA 1TVCA 1KJIA 1V8PA 5DASA 3UMRA 4F9TA 1X70A 4AK9A 3DFFA 1T91A 1H9BA 3TDMA 2BMVA 2YZMA 4I6JA 4KR9A 2PU5A 1DKQA 1JDVA 3VU0A 1P62B 4DKJA 4MVJP 1QKKA 3AR3A 3EVEA 5FV4A 1L6RA 2HQOA 3HQ4O 2N75A 3WYDA 2AGVA 5DBEX 2VPXA 1H1LA 3EH1A 2AC7A 2PFGA 4S1TA 4C78A 4EEKA 3KD3A 3P9ZA 4B3XA 4Z54A 1PQPA 2D5BA 3C3AA 1MGPA 4MS3A 3U9LA 1N2EA 3V6LA 1GGVA 2B9VA 4DLPA 1JG1A 3OJLA 4MYUA 4AZ0A 3B70A 4F11A 3GDWA 1PT5A 3H8SA 3V7YA 1J24A 1V26A 3SZOA 1FFYA 1KC1A 2VC2B 3I34X 3LUHA 4IQFA 2CLFB 4NAUA 1R9MA 1PJRA 2WP8J 4L8YA 5BP7A 4Q16A 2VTDA 3H2SA 2FRXA 2GRUA 3C7DB 5GP1A 1E2LA 4YCNA 1VGRA 1VMEA 3HKCB 4B7UA 1Q7EA 3GZTB 1SY7A 4MJ7A 4E12A 4IIVA 3IUJA 1UFQA 3B1WA 3QLUA 5I7VA 4WNYA 1J70A 3LY9A 2IHBA 5H3LA 2FPMA 1TZBA 3GCWA 5JCPA 1J2YA 4M0PA 2GEKA 3MT7A 1K1EA 1Z2CA 4HN4B 3UCXA 1JQ5A 1T36B 3M5CA 1UM9B 3PP8A 4AYXA 4BTEA 2VWHA 1QLJA 1UXHA 4H3SA 1U65A 2BY4A 5K1ZA 3ZW9A 2XKKA 1ZD4A 3UUWA 3FVTA 3W79A 1QQ5A 2PZMA 1ZN7A 5CFQA 3X2FA 3PFBA 1OVMA 2I7TA 2NAPA 4MS4B 2GI4A 4NQZA 4WD3A 1NM5C 1G5TA 5ED0A 5EJMA 4F4HA 4GL4A 4FSHA 4OI4A 4OYHA 4MUJA 5NLLA 2OFFA 2P5TB 5CFRA 4AJNA 1NYTA 4G23A 2B8TA 2QZ9A 3I64A 3J81k 2R44A 1Y7TA 1VP9A 2I2DA 4YR9A 1KNQA 3IC5A 3KSRA 1LBIA 3O1LA 3TTYA 4XYGA 4Y7DA 2AR0A 2IYYA 4DJDC 1J33A 2GPSA 1BCSB 1PDOA 3PG5A 5ALIA 2NUPA 3GCDA 1JG4A 2BT4A 1S89A 1WXIA 5EN4A 5JSYA 3UCEA 1UWVA 1UXKA 2ETVA 2LKCA 2VSQA 4HEHA 5BW5A 2XNDA 4CV0A 2G09A 2QY6A 2WNHA 3ADOA 4OKNA 2FHSA 4EGCB 4GOXA 5JTUA 4O3MA 3CEHA 3PD1A 1RPZA 3UF0A 2JFBA 3V5NA 2VK8A 2QB5A 3L5OA 3N5CA 1YS9A 1X2BA 2IZ7A 5F12A 3F97A 3Q3JB 1JKJA 4PYQA 1WLSA 1JVBA 3HI6A 1U2PA 1H8ED 3ZE7A 1W1UA 4CCYB 5GVSA 1X3LA 4CLOB 2O7RA 2AOUA 2QLFA 4QYXA 5ALPA 3RUPA 3ETLA 5B2ZA 1JAHA 1B6GA 2HA6A 2RKOA 4NF2A 4P4UA 4P81A 3STVA 4OQXA 3RC9A 4EQZA 2O1WA 1FXWA 3FOEC 1ATZA 5TEWA 1L5ZA 2XUFA 1I3CA 1A2OA 1ZG3A 2O3UA 3I9LA 4IFBA 1P8JA 4QFBA 5DEOA 1DBPA 5K3CA 5BWBA 1Q20A 1T0UA 2BMDA 2K7FA 4ZJYA 8ATCA 4JJZA 3BSSA 1YZKA 4ESVA 3JQQA 4R1NA 4K9OA 5F5NA 4B6RA 2NV0A 1O5IA 3PFHA 1DXYA 5IMBA 3PQ3A 4JJAA 1XZKA 4RTLA 2GHTA 1QHHA 3M5DA 1DBIA 2P6UA 2QPTA 3BICA 4MKXA 1M1YE 4D3YA 5HJ7A 2ZITA 5KQRA 3CT6A 2O7VA 1FEZA 2RC6A 4FJ2A 5FPYA 2ECOA 5CR9A 2ILVA 3KVVA 4LC0A 3A1NA 2OZVA 4WUTA 3HJUA 2AHOA 3DDSA 3OT1B 5FRDA 4LQDA 4Q15A 3X1WA 5CT5A 1KOGA 3S1SA 4LGMA 1DJQA 3EBLA 1EJBA 3BXEA 4UCQA 5LDHA 4GKAA 2IV2X 3BBPA 5C81A 5F7ZA 1J2EA 4WW0A 3FKQA 4D5GA 3B12A 5H83A 2VHVA 4KQMA 4TMTA 4B3BA 3IV9A 5A5EA 4FKBA 2LVBA 1NMSA 5DKFA 3U0VA 5JRJA 1FXUA 2WWWA 1JL3A 3WLIA 2R6FA 1JAZA 1E61A 2R62A 3TQQA 3K09A 4HDNB 1SB8A 2OHFA 4A36A 2BBOA 1Q6YA 3MXTA 3AUJB 5FYDA 3OO0A 2I3DA 4Z5XA 1KQOA 1XZEA 3GWGA 1QRDA 4HWSA 4RPGA 3VYVA 5KTTA 1XQXA 3SSAA 5L4NA 2PRYA 4FYXA 4FD2A 4W5NA 3QVWA 3FZNA 4NKRA 2X8JB 1TOAA 1NVXQ 4V0LA 1ABFA 3ORFA 1BDIA 1C81A 3PFWO 3AR8A 4DB4A 5D85A 5JXIA 3I1IA 1NULA 3VZQA 5JNUA 2OO5A 2E5LB 1QE5A 1JAYA 4D46A 4DR4B 2QE7A 5HTKA 1ZRMA 3MGAA 4EI2A 4RIGA 1UKZA 2A6PA 3WP1B 4HS9A 3UA4A 4QOEA 1B8NA 1Q14A 1NP3A 3MOSA 3E9MA 3AY7A 3M6AA 4U9IS 5CG1A 5JVDF 1J2UA 4DSTA 5KOHB 3U81A 4EVQA 3OCCA 1KH3A 1X7ZB 3C74A 5FBLB 1XKTA 2AT1A 3HVKA 4HAZA 4FR0A 2B4RO 5AW9A 3SICE 3H7AA 3OEED 3QUCA 3JQBA 3C7KA 4MRMA 4W9NC 5COQA 4DCJA 1N32B 3V80A 4EHLA 3WK5A 4H17A 2YNMD 4BMSA 1TK2A 4I2VA 4Q93A 2QW0X 4DC1A 1U0HC 4HLUA 8OHMA 2X5XA 2RHBA 5K6AC 4CMEA 3H8JA 1XZHA 5K0ZA 3IAHA 3CPSA 2A57A 1JVNA 3NUQA 1YF3A 1PYGA 4WDRA 4JJ7A 2VDWB 4BBPA 1F7UA 3PK0A 4QQRA 4W63A 5SYAA 3NHYA 2XGOA 3Q88A 5ADWA 2W2OA 3B9RA 2W42A 3DPSA 2WUEA 2ZSIA 2W71A 4PHTA 4HG2A 2LIVA 1T2AA 4GC5A 4B4VA 1E5QA 3DLPX 5BY2A 1UL1X 4D3FA 3ZWPA 5A6SA 1SK8A 3TMKA 3GFSA 4I6EA 5FL3A 1MV5A 1P31A 3BHIA 3E27A 3W4JA 1UP7A 3UBTA 1DRVA 1KFCB 1U8EA 2EKQA 4LNUB 3PC3A 3CGWA 4Q9LA 3BZWA 1QJCA 4OBWA 3VHXA 2IU3A 3S68A 3HKDA 4AD8A 1F0KA 2V3WA 1I3LA 1KVRA 2CJPA 3AF5A 3O31A 3R6LA 4EVIA 3B3GA 1E7WA 5DYIA 5EWMB 4H6VA 1YR9A 1QFXA 3H5AA 3MGBA 3OO1A 4HFJA 1VLVA 5HF8A 4BYMA 5J23A 2C2XA 4KQHA 1C8BA 1Z47A 3QELA 4EJ0A 3IOYA 4ONEA 2OCYC 4CBVA 5GONF 3F67A 3ZWDA 4R9VA 2O8BA 5BSTA 1KJYA 4LBVA 4RZQA 4UHEA 3RIMA 3SYNA 3LBAA 4LMBA 5LQKA 3WA6A 4HNTA 1N0IA 4DV0B 3B20A 4M9SA 4G1FA 4RPCA 1ZK0A 3L7OA 4P7FA 2QTLA 2W98A 2PZEA 2ERXA 3PDUA 1T8RA 3N0TA 5F77A 1E3MA 2IOHA 2WSSD 2FN7A 5DRTA 1E20A 1NRWA 3GOQA 4F46A 1GL7A 2WF6A 2AEJA 3ZWCA 3R6GA 4EMUA 2WWYA 2AFIE 2BISA 3OZDA 3NRJA 4F71A 1JBKA 3QNMA 1IN8A 4FFBA 3SIPA 4E5VA 3VSEA 4HDQB 3OJFA 5T5QA 4AP9A 1P2VA 5E3HA 4QUBA 3NV9A 4PNZA 2OGSA 2IDZA 4FC7A 3BL8A 1EMDA 2P9TA 3FBWA 1A4XA 2IHUA 1ZSNA 1CJKC 3BJZA 3O3NB 4C08A 2PKYX 3MCVA 5TX7A 2Y1CA 4EZIA 4YMTA 2PIAA 4L6AA 2I3AA 3I39X 4N40A 3ZW7A 1ZJ5A 2F1JA 1Z5VA 1KYIA 1Q1NA 2IU6A 1XRSB 3D8HA 3EEIA 3QXCA 4CM9A 4YJFB 4FOTA 4UBIA 5FUXA 4HNUA 1YDWA 4DIDA 1KVSA 2C0PA 2FFJA 3IUEA 3U13A 3V8MA 1IZ9A 4ODIA 4LW8A 1OXTA 2X77A 4UD2A 1S02A 1AQLA 1AXRA 2ZWAA 5EKXA 4KPYA 2C98A 1YJCA 1ESMA 4X1KB 2QLBA 1XU7A 3O9ZA 2HK8A 2V4UA 4OQLA 1SUSA 3EQZA 1ZH0A 3QFTA 4NOLA 2J9YB 1IIRA 5F78A 3AHEA 2IX3A 1L5SA 4M6WB 2AWNA 4IFIA 1XXHE 1KK2A 4LYHA 4Z9XA 3SQNA 2FEPA 3RRYA 2HJSA 3PRJA 4MKIA 2Q28A 2PZKA 2XB4A 4GWLA 2LUOA 1NVEA 4D81A 4LZJA 3VOBA 2W58A 1VBFA 5DM1A 1C30B 1LFDB 1VGVA 4JBLA 4JR2A 4UREA 1TK3A 3CJRA 5REQA 4EO4A 2V1UA 3GBPA 2VUIB 2AOVA 2OILA 5ALDA 1CYDA 1QGED 1MW8X 2HDWA 2Y1GA 3CZCA 2ODWA 3KR2A 3W2TA 3UJPA 5BSFA 3I42A 4GP9A 1YUBA 1KRHA 2ZT6A 5AK0A 1MOZA 3P2IA 4G3XA 2RAVA 4Q1DA 1ZD9A 2A0YA 2ZAMA 5AVJA 4F91B 4MDEA 3TBHA 4Y0AA 2ISSD 1GQFA 3S2SA 1IBMB 5BRJA 3LPMA 4H16A 3DWIA 1DJPA 3QOWA 1PR9A 5TPZA 4NCKA 1JLMA 4IUDS 2VS1A 2WLTA 3Q2KA 4X6XA 4ZOEA 2ZI9A 5JSZA 4WK4B 3H9GA 5IPFA 2QRLA 3AJ9A 1PJLA 3Q0IA 4KAXA 2FSHA 2FN8A 1NJ1A 2HRCA 4MWOA 1C8VB 2B61A 1BHSA 1YL7A 4NYJQ 2J3MA 3KO8A 1Y81A 2B8WA 3HBAA 3AW9A 3LDHA 2C4UA 3NDPA 1MO4A 4PPYA 4Y2VA 5TEVA 4MVJF 4CIDA 2XCRB 4EAQA 1R0SA 3JWEA 2XNSA 3WGQA 1Z4NA 2PS3A 2FMKA 3MTQA 3R9IA 3PGLA 3C48A 4RU1A 1OHHD 5EHXA 3ZGVA 4IOMA 1USKA 4NSNA 1W76A 2YJNA 1KY5A 3ENQA 3HZOA 2HMSA 2R6AA 4O2BA 5C8YA 3UK1A 3DMPA 3VYTB 3ZX5A 1DQYA 5EWJB 3KSUA 3ROMA 1C0EA 3EIHA 3PNMA 5F51A 2MSWA 1QMPA 1WCXA 3VU3A 1Z39A 2EEZA 2VAXA 4TLMB 3KQUA 1K88A 1UOEA 4OQDA 3NQ41 3R6TA 4EJMA 1WDLA 1Y5LA 3GK3A 1DKNA 5HRUA 2YY7A 2H4JA 2D2IA 1CS0B 1U7UA 4L95C 3UC9A 3A31A 1V5WA 3K0CC 3PNQA 1Z13A 4R9NA 3PXGA 4LISA 4H35A 4QLAA 1XXLA 5BR1A 2F55A 2YHUA 3SX4A 3JY6A 2EKBA 1R4ZA 3FNIA 3M81A 1L4HA 1IEQA 1R74A 2IGTA 3KT8A 1EFRA 3Q41A 1PDWA 3JVEA 2JLWA 4B7AA 2GCNA 2IZOA 3M2PA 1P1BA 4WZ6A 4XX0B 3VISA 4EATA 1XQ1A 1FA9A 3KQYA 1WU8A 2VAMA 1DELA 1VKOA 4TN5A 3T9BA 1XZQA 4FXPA 2EQAA 1H94A 5G2OA 3HXOA 3NRCA 3BA1A 4KRXA 3LGAA 1RXUA 2O9JA 1FP1D 1KJQA 4PV7A 4XYLA 1SUFA 3UWOA 4IRXA 1SFRA 3O90A 1W5AA 1NPTO 1NVKA 2O8VA 2HUPA 1Z6GA 4LI0A 3VKHA 4S1WA 2BMFA 2GBLA 3NIBA 1VG9B 3ZJVA 4DF3A 5JISA 2SKEA 3SYTA 2IU0A 3VX3A 5JXWA 4ER7A 4XPIB 5TF0A 4YRFA 1PX2A 1RJWA 4E6EA 1SOAA 3EC1A 3K0BA 1C9DB 4FI3F 4HWRA 1YZFA 2RH4A 4GZ6A 5CVEA 4E33A 2I7CA 4ZI7A 1ZITA 4KYIB 1V25A 1AOXA 2NT4A 3VR1A 1UMKA 4RVSA 2Q8QA 3R76A 5I4IA 3LHIA 4D9HA 2ZWVA 3MG9A 1NLUA 4JBWA 5SYNA 2EG5A 2CLIB 5T4FA 2YJ3A 4XRGA 2M98A 4BCDA 2WJYA 1Q1QA 1IQUA 2AXNA 4IW3B 4PWZA 2VWGA 1Z8NA 5K3SA 5CCBA 3NWOA 4LJ9A 4OSPA 4E5PA 4DV3B 1M67A 5BVHB 2BFBB 1R18A 2XTNA 4G89A 1U0GA 3ITDA 5ESWA 3T1VA 621PA 3A6PC 3FJ1A 5JVDB 1N3IA 4KX5A 2CMGA 1XTKA 2PTHA 2SHKA 3D6UA 3BWCA 3ZE0B 4O1IA 3BFPA 5DM4A 2PLRA 1PG5A 1OLSA 1YACA 1Z17A 3E9YA 2PD4A 1IRIA 3EGXA 3MJSA 3W90A 2JLBA 1QPBA 4ENQA 5DFAA 4F3NA 2CN1A 1RMYA 2Y05A 3NDBB 3VR5A 3URKA 2D1RA 2DOKA 4NTZA 2Y93A 4CLRB 5AKXA 4QREA 3K70D 3CKKA 4UM9B 3L6OO 3S2GA 3JASA 1GTMA 3ZKWA 2MJLA 4P4SA 1UDRA 1K4YA 1WP9A 2HUNA 3BGSA 4BLTA 4ZK6A 3PFCA 2QX4A 3PPYA 4EY7A 3N28A 3NU1A 1K5DA 4Y6LA 2ABWA 1HZZA 3FN4A 5FULA 3OQNA 2XOKA 2IUSA 1SUBA 4RHEA 3MQ4A 4Q02A 3L6EA 4KHPB 1C1DB 3PFFA 3DHVA 3NX4A 3DEYX 1HY3A 1OFIA 3V6MA 3V34A 1IE3A 2FR0A 2N1MA 3NBZC 3OF5A 2XYHA 4UXJA 4KTVE 4BU0A 2XBMA 3GPCA 4NAHA 3PX7A 3FCCA 5LMCA 1N2ZA 2BI8A 4G4SP 4YRNA 2LWIA 3WHLA 6NULA 2DX7A 3LT5A 1SHTX 1F2DA 1FC0A 3GH1A 4B0PA 5JATA 1YIOA 3DDWA 3EBOA 4JB0A 5IABA 5KHAA 2EFGA 3KALA 1YR8A 3MBIA 2D5LA 4WNAA 5GONB 4BHTA 3RH0A 5H7XA 3T8YA 2JNWA 2Y68A 3C8UA 1PQYA 1NBHA 5FADA 2KMLA 4I9NA 4RJLA 5BNZA 3UMYA 4IO0A 2VHUA 1Y33E 1D2CA 1LQ2A 4MUGA 1U28A 5CLLA 5B3JA 2ODPA 4MICA 2Q9AA 4PR0A 2K2WA 1SCQA 2X40A 3A6DA 5GINE 3AEKB 4LHYA 1MABA 5TV2A 3CLSD 2E1RA 4OUDB 3U4IA 1YBFA 4AICA 1B3RA 2ADMA 2LP4Y 2D2EA 1JMYA 1GCIA 1H9AA 5HE9A 4QLBA 1WCV1 1YJBA 4AIRA 1HL7A 1YS4A 3NCTA 3WLLA 5C5DA 2XUDA 3R5JA 2XMQA 4CL0A 2DUWA 1EFAA 4O0LA 5BN4A 2P27A 3V2HA 3C24A 1CUJA 4ZAVA 1U2DC 3T5MA 4MS1A 1DCTA 1P75A 2NU7A 3W2EA 1SIWA 3DFMA 1EK2A 3CEMA 1XZNA 3MVEA 3B51X 4WESA 3TZQA 3FYUB 3USCS 1ZZGA 2PMWB 2ZJ2A 4OYRA 2UXBB 2PGJA 5GGYA 4EF6A 3T0FA 1IJBA 1ZKDA 3QWAA 3U3DA 3ND6A 2P79A 4ZQBA 3FUWA 3WLFA 3KPJA 1T8WA 3ICPA 2KLBA 4KPEC 1TIBA 1EFVA 2F9MA 5EGNA 1NUHA 4QECA 1JN0A 3N2GB 1W85A 2LD4A 3IIKA 5FDFA 1J4AA 2A5LA 4PQGA 2OY0A 4CTJA 1G5HA 2ZAIA 3C3KA 3V55A 3I1JA 2C5SA 3B1XA 5FOWA 3BRCA 4HGZA 1L2TA 4M37A 1PLKA 4P4GA 3ZWMA 1O57A 3L0PA 1VL6A 3JQAA 1VSVA 2MSDB 4CTKA 4ZMSA 3PKJA 1MAWA 4JB3A 5EMMA 1KTVA 1ZMTA 4CKYA 1J1UA 1SAYA 1LQUA 1P9NA 4D56A 1YGPA 4C0KA 4LF8B 2Q4EA 5HR5A 4Z9BA 1FJGB 3MEQA 2RJ3A 1NUTA 2P9BA 3RJZA 2LTAA 2CVFA 5KDLA 3WIVA 2CMHA 1EDBA 4Z6KA 4N8EA 1UK9A 4JP3A 4N6GA 3T9EA 1BAPA 4JUCA 1GPAA 1WEHA 2FK8A 4BV8A 1ZRNA 1GNSA 2C20A 3I2IA 1WXGA 2YXLA 2Q3EA 1BWRA 2QQ0A 4JFAA 4JASB 5CGZA 1LK7A 3SMVA 5LQNA 3TOCA 1MPXA 1OXMA 1SO8A 4HZIA 3OE7D 3R3VA 4F96A 1CIJA 1GPH1 3NANA 4J2OA 4LSWA 3JYQA 4X71A 3RS9A 1TF7A 4FGLA 1YS7A 2G1UA 3HDJA 5JAUA 2ZTMA 3KLBA 1H1TA 1YVUA 1I7LA 4DCUA 3NOVA 4Z99A 1V3VA 3GY0A 3AV3A 3K9HA 4P83A 1LPMA 2DHDA 4K28A 3TLZA 2IS2A 3L8DA 4M0MA 1QF7A 3SZMA 3TW8B 4EF5A 4BKOA 1A8PA 2VTBB 1U7XA 4MV8A 3I3SR 2WKSA 2HCBA 2Z2JA 3R7FA 2B5VA 3R7WA 3UICA 5L95A 3OMXA 4OP1A 3KAJA 5JD3A 3WL4A 1UBLS 1D09A 2PLAA 1QHGA 4QNNA 3SX2A 3UUFA 1DTSA 1FLDA 1FFBA 3DE0X 1Z2DA 2GLXA 3BTUA 3HKEA 4FSDA 2H11A 4N5DA 3SEAA 1GM5A 1L3CA 2DBVO 2FLVA 3BAFA 3LHDA 5E6SB 3AYXB 1Y1KE 2G8LA 4EO7A 2MYNA 3ABZA 1VE9A 2QZPA 1Q7BA 3M9LA 4A8JB 4IIFA 3GLFB 5FO0A 5IT4A 4LHSA 3AUTA 1Q11A 1RVV1 4EZBA 3AB7A 2H8KA 4NH0A 2Y1XA 3UJNA 1BE0A 2WVGA 1EB8A 2P5SA 4MDYA 3VTAA 1MQ8B 3VR4D 4C29A 4G0QA 4ZT2A 1PSZA 3AY0A 4H60A 2OT3B 3SJCA 3U4HA 5LU9A 1CUEA 1VHJA 3AIKA 1JU9A 1NVTA 2X5OA 3H6HA 3PXBA 4MW5A 1HT3A 4ZXFA 5IZ4A 3SYKA 5DE3A 5DM2A 2W48A 2V7WA 3VO2A 2H59A 4RK0A 3RFXA 3RTDA 3TOXA 5IT5A 1PFVA 3GLFE 3H5LA 4BNFA 1ZZEA 1L3IA 3I9V6 4MPDA 2OOKA 3HZZA 5EMLA 4F84A 2BFEB 2WJZB 2P2DA 1PLJA 5DHTA 5LJIA 2OAQ1 3TL6A 3TEJA 3UOAB 1IOZA 2G07A 3CINA 1AKQA 2B2XA 2CY0A 2AH5A 4O8ZA 2BEUB 2PNJA 1K7FB 4QHTA 3SF0A 4CFZA 5KQMA 3LP5A 1Y63A 3NB0A 1CG6A 1HYEA 1NYRA 1T25A 5DCWA 2XEDA 4MR8A 5KC9A 2YIVX 4DV6B 2INGX 2PANA 2OKGA 4CEHA 1XO1A 4Q6WA 3S2UA 3FMVA 2GPNA 1IK4A 2C61A 2Q9BA 3GBSA 4TLDA 1L7AA 3KU1A 5K3DA 4RDXA 5I7WA 2B99A 4MRRA 1WS6A 1W8IA 1CY2A 2YL2A 4TWAA 2OV2A 2W6JD 4HRVA 2B1GA 3NBUA 1YRBA 1E9FA 4ZYXA 2APJA 2FTKE 3Q5DA 4MINA 3OQ1A 1C0LA 1PTJA 1RR6A 2XQJA 4ZHSA 1YC2A 1NY5A 2HREA 4V1CB 5LUAA 4BNTA 3ADKA 4WRRA 2Z0MA 1AQIA 4LQ4A 4M1SA 5LLTA 1MT0A 2CCKA 1R0ZA 2WAOA 4X3CA 4M49A 5TQVA 1QBKC 1RXSA 5I7UA 2EKLA 1D1QA 2JVJA 5AW0A 1WSWA 1E63A 1FLVA 2Q1SA 2Y1OA 3IX7A 4RQUA 3AOGA 3M4NA 3WLOA 5A04A 5JO0A 3U62A 4AJJA 1T8YA 2X13A 3O3CA 2RD2A 1I2DA 2IRWA 4B3JA 2W43A 3IS3A 4Y1RA 2HY7A 1OVGA 2G5TA 4OH1A 5A4KA 3H5WA 3C1TA 3GQVA 3K94A 4GYJA 3IMGA 2WJAA 3TDNA 1IUOA 4H4EA 3WGMA 3VPBA 5FOVA 2QX8A 1H4QA 1J6UA 4W1QA 1NR7A 3DVLA 3K9NA 1BMQA 3B9QA 3IVGA 3UJDA 2A0WA 5HMLA 4C6RA 5CLFA 3LCRA 1R8SA 4P58A 2HCFA 5CHEA 4AKEA 1G63A 3BMCB 2ANCA 3WMWA 1DWOA 2J0VA 3HBFA 3LX8A 4HQNA 3V1UA 3EZYA 2VOEA 1BYIA 3RANA 2ZROA 2H4ZA 4TPKA 2JRLA 4R7TA 1F8XA 3PGA1 4B31A 3S29A 2GPAA 5JAZA 1W88A 1C7RA 2YH2A 1ZONA 2OL4A 1VDZA 1REQB 2B35A 3Q9NA 3EA5A 1VMIA 2F48A 4CI9A 1Z4KA 4RMNA 4DRXB 1O08A 4GXNA 3G8YA 4L5IA 3U40A 4BO1A 3OQOA 3SM9A 1C7QA 4I5FA 4KQXA 1M6YA 5JIBA 2A5GA 5JBQA 1VMKA 3QMWA 5E6RA 1PS8A 2J0SA 1UT6A 1Y34E 3N2ZB 1T2VA 4FS8A 1QP4A 1GU1A 1M2GA 3UAZA 1KI2A 4QTUB 1MD9A 3GJ8A 3FMPB 5B6IA 3SZLA 3FOWA 2XYQA 3I61A 4AJ2A 2QIOA 1HDCA 1VYTA 1CB7A 2AUNA 3FSGD 3GDGA 5JJLA 4W99A 4DCCA 5BVGB 5AXCA 1Y5MA 3CLSC 5G4LA 1MO3A 2HEGA 1PGQA 4RWEA 1ODKA 2R7KA 1CJMA 4GBED 1SUWA 5EIEA 3QUBA 1FDUA 3EA0A 5TNXA 4F72A 5SZKB 3ZOZA 1DRJA 2JH9A 3GFQA 4G85A 5M2QA 3W0LB 5FTMA 1W9MA 2HQRA 4G8CA 4Z2AA 6PFKA 3MELA 4B8YA 2ACEA 4PO9A 4AZWA 4UHFA 4DLUA 5THXA 3GLGE 2DE0X 3ANMA 4F04A 4LCJA 3P0EA 4WH0A 3HJTA 4FR5A 2GKGA 3LKBA 2FHPA 2OV3A 3TECE 4ZOLB 1PV2A 2ZRKA 3M1YA 3IR6A 3QXHA 1UFOA 4MR7A 2DH6A 2GT1A 5HZKA 1FUEA 3G13A 4D3XA 5KQPA 3U44B 1JEYA 1CJSA 2W4MA 5C3UA 1U8CB 2QP3A 3TRFA 3U4QB 3QVUA 2QV7A 5BNWA 1KMCA 1NMEA 1MC4A 2XPCA 3E0QA 1EDZA 1ZJJA 3RVOA 1F9EA 2GTIA 1BXGB 1B1AA 4CPDA 5DNVA 1FNSA 2O8NA 3WLRA 1RVDA 1M6EX 1YRAA 3PD7A 3BUSA 1RZRA 4KK3A 1EXVA 3KOMA 4OMUA 2B25A 2HSWA 5J4YA 2VXYA 4X8LA 5TARA 1L4EA 2IHTA 1AKRA 2PZAA 2R4TA 4QVGA 4A9AA 3KQHA 2YWCA 1SUEA 4GQIA 4Y2JA 3VH4A 3BGOS 3PD0A 3PU6A 4GH5A 3ZS9A 4EGAA 5DGIA 3KQQA 2Y0EA 4H77A 4IWYA 5TC4A 1QJ4A 3IT1A 5KWEA 2P6RA 2CNWD 2FPIB 2OSBA 3HG7A 3ZYCA 5BV0A 2JBAA 3ABSB 4DMLA 2ZRQA 1FQJA 2BW0A 3ETCA 5DIZA 1M73E 3I3OA 5AKGA 1ADGA 2JGNA 3JWIA 4ZQEA 4BLQA 5IAOA 1VRVA 2OGUA 1Z28A 4KYVA 2OV4A 4GLFA 1YHZA 3TRJA 1H5NA 3JVDA 1OFUX 1G3QA 1GYRA 4JJ4A 3QLVC 3SF8B 1LPBB 3V7WA 2O5EA 4BEBA 1WWKA 3K0AB 4U7WA 3H2IA 3KYDA 3PE4A 1FP6A 1NZFA 1DIBA 5KSYA 3DOCA 4M9XA 1R37A 3BDAA 5BV7A 4F3RA 5K0SA 3KYJB 4BNYA 4BN0A 4IGIA 4A91A 1F1JA 1R4AA 2IY8A 1R4MB 2J3LA 4HDMA 4OI2A 1RHUA 5A3SA 4BNDA 4RSRA 3TCNA 4WOCA 1DOZA 2V7EA 3WIEA 4F0JA 3VNVA 4IVNA 4JDPA 4TMZA 1B43A 2QVXX 1GZHB 2CE2X 3FJOA 3HU2A 5DP1A 3IAXA 2CDCA 4A10A 1ZHHA 2WU1A 3E61A 4TV8A 1CE8B 1LBSA 4CRWB 2C31A 4V02A 1Q83A 3WXMA 3ZU4A 1EFKA 1Z0JA 3IRUA 5BQ3A 3U7HB 3R0XA 1DQNA 2Y9PB 4OGKA 4DDMA 5K0NA 4PS1A 2PLFA 3CRQA 3DFUA 2P9FA 3FETA 1HTBA 5CVCA 4EH1A 3AVVA 2XDQA 1R0YA 1SGWA 1Z7BA 2P78A 5A1JA 1ZVJA 3PUYA 4DL9A 2JASA 2XHZA 2AFHB 4MGHA 3MWDA 3QH4A 2JGIA 3PGKA 2BGIA 3IGFA 1E3TA 2P2ZA 4UU0A 1OI2A 4DY6A 2JATA 1W4LA 3IVMA 2IXEA 4JODA 4GX2A 3QUSA 2WHPB 4KO4S 1SRRA 1UC4B 3SSNA 4JT8A 4BWYA 2YZKA 4PRKA 2EXXA 4UNQA 5KYWB 4F3TA 2ZB4A 4R40A 1A9ZA 4DLLA 4Q37A 2EV9A 3C5CA 5JMPA 5LD2C 2ORIA 1E6UA 3ZBPA 1ODTC 2BP7B 1JXQA 2J85A 4UASA 1SXHA 2P9JA 4FC6A 1QONA 1TQ2A 1XK6A 4RANA 3KIPA 5CVUA 2HF7A 2H54A 5LCXA 4HKTA 1UIMA 1IHDA 4EHJA 2D74A 1LNZA 1Q7RA 1Z82A 3DBIA 5CA1F 3CZ5A 4WV3A 3VYWA 1COZA 3WRVA 1EE1A 3L4EA 3NFYA 4D26A 3FOBA 1G21B 1M75A 1K8QA 1OPXA 3QXSA 4R31A 3LZDA 1F06A 3AFIA 4OXNA 3RSGA 6Q21A 1OKKD 4PX2A 1QGYA 2FR8C 4FZ5A 4F06A 3N2EA 2GF2A 3H5TA 2IYXA 2XJ4A 2XB2A 2ZJ8A 5KKAA 1I30A 1GPWB 4DWVA 3T34A 2JHGA 3JAKA 4D9JA 4Q1BA 4BB6A 4LF5B 2IBSA 3Q5GA 1EFCA 4X20A 5KYXA 2V1XA 1MJHA 5BWMA 1WB4A 1JR2A 3AILA 4JJIA 4MROA 3A6JA 1LZLA 3M82A 1UBKS 4A4DA 4DLKA 3BWBA 3FUTA 2HT1A 1TB4A 2R65A 2CDBA 2WHYA 2HA0A 3T4PA 4X1IB 4DXDA 5KQGA 3N8HA 2H07A 3H5IA 3OTIA 5EP4A 4EHIA 1DTWB 1TJ5A 3EC2A 1EHIA 2LZ0A 4RL6A 2VZEA 5HIMA 1WXEA 3RTCA 5CTAA 4ZPJA 5FPKA 3LIIA 4IGAA 4MCAA 3SXJA 5L45A 3WRXC 3GJ0A 2JFWA 4X60A 3R3SA 4MCIA 3A11A 1EQUA 1CRQA 1WW2A 3DWGA 3OZEA 1QYCA 4YCAA 1W9HA 5ALQA 5DTQA 5EG5A 1E32A 2QYOA 3Q8XB 3MK31 4BJ1A 3ZDCA 2I5PO 2H52A 1AHNA 3ICOA 3MTDA 4JUIA 1T9KA 3D1JA 4RPIA 1EYZA 4K3UA 2Z83A 2P11A 4D8UA 2G04A 2PT9A 2ZYVX 1OREA 4Y2RA 4QJIA 3ZLBA 1LD3A 3GN1A 4Q1FA 5ALGA 4ZICA 2M6KA 2OXRA 3TTUA 4KP7A 4TXNA 4RVNA 4TMXA 4W1PA 3U4MA 3CLHA 2K2QB 4FYWA 2RONA 4TT3D 1N34B 3VNUA 3FXAA 3BSWA 1XCOA 1ECBA 1KY4A 1RI1A 3FFAA 1CIPA 2WKPA 2PA0A 3N70A 1PD0A 2RFLA 3O6VA 2KSQA 1US8A 4R2HA 1WAMA 3O26A 3FPLA 2LRHA 1L1FA 2D5IA 5IXJA 3KQKA 1ARZA 1N6NA 1N0HA 2WTMA 3DF7A 4HQFA 4XLTA 1X94A 5G4KB 5GQSA 4GGMX 4FZ3A 5D84A 3UN1A 4A6XA 4CQLA 1N25A 4M1EA 3KCNA 1E7MA 1J9ZA 3O5AA 4YUWA 5AVQA 4IGFA 1QIIA 3B60A 3ZJYA 5TY0A 1E60A 2GDZA 1R6VA 4JBYA 1MLDA 4CUJA 4CDRA 4OHKA 4BFUA 3GLIA 4L6CA 1A82A 1P60A 3P27A 5IXYA 1U5BA 1S7CA 3QWIA 1ZVKA 3WWEA 1RI3A 3R9KA 5C5EA 1H8HA 1RZUA 1YQGA 4RD6A 4EKEA 4PCUA 1FTSA 4R9UC 4TGLA 4EBBA 4PHGA 2VHWA 1EWVA 4KSCA 3MIZA 2PSEA 5HFJA 2QX9A 2I8AA 4PPNA 5EESA 4YTEA 2OVBA 2CB9A 4IICA 4PYLA 5EHGA 5EHIA 4MGKR 4BVLA 5ICFA 4F5EA 2YIDA 1NW4A 2IIPA 3F7NA 2GYYA 4KBYA 4YJKA 2C97A 5DLDA 1VFNA 2BFPA 4JVMA 3B5IA 3RS2A 1T29A 1J99A 1NVMB 3W5JA 4BLOA 2HLHA 1OWLA 1R6UA 2GBFA 3RU9A 4CQJA 3ZHUA 4NE9A 4JK3A 4OXKA 1GPJA 1AKEA 3IEPA 3WYNA 4XCXA 4JN6B 3W6NA 3OG9A 4WLEA 3G2PA 3KEOA 3AHFA 3BXXA 1S8AA 3D7LA 2GYVA 1B8OA 3CKYA 3KQMA 3SOPA 3UUGA 4DCNA 1LI7A 4QVKA 2CFIA 1HGXA 1H65A 3AESB 3BSYA 1ZXLA 3DZ8A 3PYLA 5IW8A 1E3WA 3KJNA 4P0TA 4BMPB 2A88A 3L4JA 4I55F 2AL7A 5F98A 2R86A 4RIHA 4Z49A 1RMTA 4UXHA 4PHFA 2G76A 2G9VA 4QYSA 1GG2A 1XNJA 2XCLA 1YB6A 4PC3A 5SZJA 4D9NA 2UDPA 3LPNA 5TGZA 4I8XA 1WF6A 3YASA 5KDDA 1A8QA 1PHRA 1WVGA 1SKUA 2UKDA 3RT9A 1EM8B 1JQAA 2J46A 2NV6A 2XADA 4EI8A 8MHTA 1E3IA 1OCEA 1VPEA 4O08A 2ZULA 3BD9A 2G0AA 3OPVA 4Q4AB 3U1TA 3VU8A 4LJLA 2ZIXA 3LX5A 2Y27A 3T7RA 1J8DA 4YAUA 1BFKA 1P18A 4IIDA 3LTEA 3CPEA 3REFA 1I4OA 1TCAA 5BSRA 5TE9A 2MWMA 3ZWNA 8ABPA 3RSZA 1IG0A 4D9IA 4PZDA 2RIPA 1L5FA 2I03A 5D3QA 4D9KA 1YS6A 4I66A 2X0KA 1WZNA 1P6UA 3R9XB 4D4LA 3HO6A 1Z62A 4HH0A 4Q24A 2BGNA 1Y9JA 3I2YX 4NJEA 3OHMA 5EKDA 4EITA 4RVFA 1HLGA 5KSPA 4DNQA 1NX9A 2IH2A 3A1WA 1H2FA 1P73A 1M2EA 3OIUA 1AO0A 2VDQB 3DG9A 2WA2A 4TVBA 3ZUGA 5ER9A 1DPGA 3O84A 2FUNB 4DAOA 1IG3A 4X84A 3R77A 1O6CA 2K87A 1GRCA 2KPOA 2XVXA 3QZUA 4QYWA 4QDUA 4O4IF 1FPQA 5K0LA 3EOAI 3ES9A 4NESA 1AN0A 2F2TA 4QTXA 4C22A 3D1LA 5A4FS 3VH3A 4JWTA 3PC8C 1E0JA 4JLJA 2FWIA 4F5DA 1Q3TA 1B6SA 1W34A 2ZYWX 5K0EA 4ARIA 5JI2E 1R0CA 1PR2A 3DEFA 3FTNA 4A8TA 3NM5A 1W73A 3AL2A 3I76A 4ABYA 2CNBA 3DNPA 2XLBA 5ALZA 4WT7A 3RG8A 2Q21A 1QGUA 4P4NA 4AUNA 1M2VB 4TZ6A 2NOAA 3B1FA 3EPPA 4BB0A 3K53A 4URZR 3UPDA 5CEJA 1NPYA 2FZLA 3GFTA 4UAVA 4WFJA 4DRZA 4W1SA 4WJZA 2Z9DA 3EYWA 1FDWA 3OU2A 4JU9A 5A0FA 2QM8A 3B3QA 1HYGA 1C4OA 3OZAA 4QXAA 2BSXA 2VUUA 4UFOA 2PGXA 5EUCA 4OBBA 3W8EA 2OYSA 4NH4A 5TVGA 5CX1B 5DMHA 1PL6A 1KI7A 1Z5OA 3D3NA 3QEKA 1GR1A 3RS7A 4MCHA 1ZI9A 1U80A 2HFKA 1O03A 2YV1A 4RX1A 4PAMA 2BZGA 2I3ZA 3PJGA 4R81A 2Q7DA 1J0CA 4AW9A 1OAAA 4QGAA 3OTOB 3D8TA 1HL3A 1XTBA 3AETB 4AZ3A 1CNEA 3O8RA 1PZXA 2BH9A 4PO8A 5KQLA 5DGXA 5GV8A 4LJ6A 1NHWA 3LUPA 1ULUA 2OORA 3ZD9A 2O0LA 3CLVA 4H0CA 2WYWA 4ZCLA 2WVJA 1M34A 3V32A 1QKIA 1IBLB 1QYVA 1WUJS 2Q8PA 1TUEA 3VI4B 5FD8A 1TZCA 1Q19A 2R84A 1IBRA 3U7IA 3ZNOA 1K68A 5BN3A 3VSAA 3SE7A 4INPA 2G0TA 3EEYA 3U39A 3QNWA 4DCOA 1VL0A 2PSDA 1XNQB 2WU8A 4NHEA 4RMIA 4X0EA 4EDHA 3EGEA 2X7JA 2R4QA 2VDMB 3KLPX 4PQFA 3SC4A 3ZWXA 2XRMA 1XRRA 4DM4A 2NNWB 3ZHVA 3EVNA 1I0LA 4UW9A 4E2ZA 1FMJA 3IPXA 2XF8A 4ZODA 4JITA 2VCHA 3ADPA 5ANRB 5TJ9A 4ZCIA 3B8EA 2DHCA 3K9FC 2GPTA 1YU6A 1A2BA 2OAGA 2QRGA 1OU0A 2VP9A 2YVQA 4FGKA 1AGRA 5J5VA 3V48A 2PUEA 1W47A 3OETA 4C20A 4KQ6A 5DK4A 4TTPA 4DADA 4B4UA 1ZCJA 2QAGC 3AUSA 1ZH4A 3HYNA 1HFEL 3W8RA 2BIFA 1ZIDA 1RD4A 3AXTA 4KHZA 3UJHA 4JCOA 4RVHA 4FGWA 1C14A 4DAEA 1THGA 4BVGA 5CA1B 2O8CB 2NZXA 2VTEA 1IOWA 1E0DA 3GUVA 4FD3A 4LOKA 1M74A 1YQXA 3GJ6A 1XDSA 4RDIA 4MSUA 3KLMX 2XWPA 3B1YA 4QIHA 5HFAA 4YRLA 3KT3A 5DCLA 2FZGA 3G5TA 4NC9A 2PZGA 4KIWA 1N75A 3FJYA 2D2FA 3H9BA 4IKPA 2W2TA 2JB9A 3WFIA 5H4GA 4IEEA 4HQOA 2FZWA 4I36A 1Z2OX 1UJBA 3L79A 3ZXIA 3ROGA 3K3PA 3A3PA 2OCLA 3DE6X 2A7QA 1TE2A 4O1HA 5DHPA 5DSTA 1WZCA 4G5FA 1DC3A 4JUAA 2H31A 4BWGA 3Q4GA 4XGKA 4PGMA 1ZOIA 3NJ8A 4W5RA 1R5BA 3CEJA 4U8HA 1P2BA 5TS3A 1JJFA 4NMHA 5MDHA 3FZYA 3E22B 3KFLA 4FFRA 2VEOA 2PLWA 1PE0A 4ND8A 3AUKA 2C59A 2DUUA 5KJFA 2Z6QA 2ZW9A 1YSCA 2OPBA 5E6UA 4MVJD 5FA5A 5B1DA 2VYND 2OG1A 3O8OB 2Z5GA 1NVUQ 1X7WA 3ZU5A 2FWAA 3K9CA 1KMHA 4ENWA 5B37A 3RFFA 4S05A 2ATXA 5L7YA 1GL6A 2PBLA 2WWIA 3EWNA 1OUMA 3VC1A 5KPDA 3DMHA 3GZNB 4YPFA 5KJ1A 2AF3C 3OKFA 3BMQA 2CVHA 3AFOA 3RU2A 3GOHA 3LH5A 2KE5A 3JD2A 4C5CA 3LWBA 2XUJA 1FDSA 3G8BA 4XQ0A 5FUWA 1FZQA 4MZDA 4INZA 4K05A 4PQRA 1RPNA 2BM9A 1PR3A 2H2HA 3R24A 1N0WA 4DJFC 3C6BA 4UTZA 4BGUA 4E7PA 4PW0A 1GU7A 1ZXBA 4LYGA 2ZUBA 1WSDA 1HM5A 2WPNA 3OLWA 4FT4A 1ZOLA 4LA4A 5G0UA 2DFVA 3V3KA 5L4LA 2CDNA 1YCHA 2H9YA 1CK4A 1PEYA 2AD5A 2JCXA 3E03A 1IXRC 1XNHA 3DDNA 4G1MB 3NV7A 4ZOAA 4Z8XA 2B34A 2EKPA 3IBSA 3O0TA 4OKIA 2QRVA 4MQEB 1ZGHA 3ZDBA 3H2ZA 4KUGA 3DT9A 2NYVA 4OJNA 3EWIA 3ACBA 1ZOOA 2VRBA 4JB8A 1V1RA 3UK6A 3ZZTA 4B74A 3CX3A 2F4VB 1MRSA 1FSGA 2DY0A 4PO3X 2WZCA 3FBTA 3OPYB 1CFJA 1JLRA 1NAHA 2CNDA 1Y1QA 5IF3A 1MENA 1P2SA 2YXDA 2ZIEA 1U1FA 3PJRA 4M54A 1X80A 1HLPA 3NYRA 1EUCB 3GGOA 5DP2A 2VAPA 2PWAA 3AUAA 5DHAA 4ID9A 5D3KA 3TZHA 3Q8MA 5AYVA 4R0MA 3RVLA 1PRYA 1URPA 4FFLA 4W5WA 2O8DA 4D3SA 1F6DA 4G5OA 1FS4A 3IPCA 4DNPA 4ME6A 4Z4HA 1NDHA 2F3PA 1QG4A 1GEGA 2RKWA 2NSJA 2H57A 1RJDA 2ORVA 1JBQA 3FPHA 4UQPA 4YR7A 5AESA 1T8UA 5IX8A 4AYWA 1EX6A 2DT5A 4UZFA 3OQIA 2MHCA 5A3QA 1M1UA 2XUGA 2RARA 5A3VA 2PKEA 3M6FA 1EWKA 3IUPA 5HKKA 3TWOA 1R50A 1T2EA 4A27A 3GEBA 3BGIA 2X8WA 2MINA 2VRWA 5KKCA 1QTRA 3BJMA 1S8OA 1M2HA 1Z8HA 1G3IA 1GZSA 2PRIA 3CX7A 2KQUA 2WOJA 1OV6A 3D0RA 3KEQA 2JEOA 2FPPA 4II3A 1CX9B 4I55B 2B9EA 1T4CA 4EK9A 4IZIA 3O8QA 4LFAB 2HWXA 4PONA 3QIVA 3MGGA 2FWRA 2QKYA 3JU3A 5HRAA 1KJNA 2GVNA 3AKDA 2P6PA 1NIJA 3H11A 1G9TA 1VI5A 1ISRA 3A25A 3HZHA 3ORHA 4UCFA 2QX7A 1NN0A 2QMEA 3AP1A 4K46A 1X74A 1E2QA 2GHRA 3F6YA 1XTPA 4CE6A 5KMGB 1O2DA 2YMMA 4NNOA 4RPKA 3REQA 3ABRB 1D4AA 2IEGA 3GJ7A 4G0ZA 2IOFK 4HDCA 4X94A