4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Cholinephosphate cytidylyltransferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
4MUKA 1PG0A 2A7XA 1KQPA 3K9WA 2AG6A 5LFAA 1U3DA 1XNJA 1ILEA 1JHDA 4MVWA 1H1TA 5DASA 5F23A 3HZRA 1YIDA 2CT8A 4Q16A 3FETA 3IODA 4BWVA 1YIAA 1EFPB 1K4KA 1U7XA 4OUDB 1NUUA 1GN8A 5JBNA 1NUSA 2IELA 3K32A 1ULHA 1YUNA 1ZH0A 3PNVA 3CVXA 3X1KA 3AG6A 4MW7A 1DNPA 1TQ8A 5TS2A 1NSYA 4NATA 3G59A 5HUJA 1QU2A 3A4IA 4DDHA 1O94D 2DEUA 1J70A 1JZQA 2A1TS 1M1ZA 4PBTA 1O95C 4ZT6A 3FY4A 4MWBA 4E1AA 3F3MA 4H3SA 3IVCA 3ELBA 1MBZA 3CVUA 5LLTA 2TS1A 3MLAA 2QUHA 1XNGA 2AKEA 4J75A 2J09A 1KORA 5DK4A 4ND7A 2AZXA 3CLUD 3LOQA 3VRHA 2RE8A 2D5BA 3HFJA 1N2BA 3GLVA 3H97A 4P2BA 3UC5A 1WJGA 3PXUA 4EG5A 3GUZA 2CSXA 1H3FA 1LI5A 4MWCA 2E18A 3KT3A 4YP6A 4ZCQA 3ZJVA 3ISJA 3HV0A 1LI7A 4YMIA 1H3EA 2X1MA 1JGTA 3ND6A 1U7DA 4GRIA 1NUQA 3SEZA 1BS2A 4KPUA 2DUMA 1Q11A 1J1UA 2CUZA 1TYCA 1WXGA 1JILA 2QUKA 3IMEA 4ARIA 2O8VA 3DPIA 1N2JA 3FG9A 4MQ6A 4R0NA 1J09A 1KKUA 2QTRA 3OP1A 1T9GR 4GU5A 4KPUB 1G59A 4HPWA 4L2IB 1J21A 1VBNA 1MB9A 4ZT7A 2HZ7A 2CYBA 3G5AA 3HMQA 4I6EA 4EFKA 5KWVA 1J1ZA 3MMXA 1JIKA 4U63A 4ARCA 3ND7A 1T6XA 3CLSC 2ZUEA 1O6BA 1Q15A 2IJGX 3COWA 3HGMA 1R6UA 3P0JA 4KKVA 4FZJA 4UZFA 4NX2A 4RUKA 2CYCA 2R5WA 1KAQA 1WXEA 3MLBA 3TNJA 4MWDA 4EG3A 1N77A 1F7UA 2J5BA 3CLUC 1KH2A 3VGJA 4MVCA 4QREA 4PBSA 3CVVA 1WQ3A 4MUNA 1OWNA 1N75A 4MUHA 3P52A 1ZUNA 1KP2A 4PY2A 3P0HA 3ZXIA 4G6ZA 4MVXA 1S4MA 2JAXA 4G5FA 4MW0A 3RK1A 1G8FA 1SURA 3COYA 2DETA 1EFVA 3ZJUA 3I05A 5FO1A 1O96B 2JA2A 4MW2A 3N2YA 1WXIA 4S1OA 1OBHA 4UZEA 4CDMA 2YWCA 3UY4A 2V0GA 3ZUGA 2BYTA 1KQOA 3VU8A 1N2IA 5TEWA 3H05A 3IOEA 1U3CA 1N2HA 2E89A 3CA8A 2A1TR 1K92A 2DXIA 3L92A 1EE1A 2E21A 2QUJA 5EKDA 4EG8A 3N9IA 4EG1A 1M83A 1I6KA 4OUDA 3TS1A 3FH0A 2BTEA 2HMAA 4Q93A 3FI0A 1EFPA 3D6VA 4EG4A 2XRZA 3D6UA 4ZCSA 2WSIA 1X8XA 1K4MA 2QTMA 3G6KA 4OJMX 4ZCTA 3ILVA 2JANA 3TQOA 3IOBA 1KP3A 1M8KA 5K0TA 3RHSA 1H3NA 2QJTA 3X1MA 4EF6A 4MW9A 2J08A 3CLSD 2D54A 1COZA 2ZP1A 2QJOA 1TYAE 1X6VA 2A86A 1JMVA 1IH8A 3S3TA 1YUMA 1VL2A 1TYBE 5BNZA 3ZXSA 1IQUA 1CT9A 4RPIA 1Q19A 2Z3VA 4JYZA 2VTBA 3MUEA 1IHOA 3LE8A 3FWKA 1KQNA 2Z09A 5LM3A 5J58A 3IMGA 5H16A 1XNHA 4MUGA 1IFXA 5HUHA 1V8FA 3M5WA 3MXTA 4J76A 2WQ6A 1YI8A 2OV4A 3H9BA 1PFYA 2QTNA 2VTBB 3IH5A 3SEQA 3FOCA 2A1UA 1G8HA 1A8HA 1MB2A 2A84A 1VLHA 3A05A 1N1DA 2GOYA 1I6MA 2QUIA 3Q4GA 1EUQA 3DV2A 1NURA 4DJAA 1HYBA 4JZYA 1GTRA 1OWOA 3C8ZA 1OWPA 4ZT2A 4DE5A 3SDBA 1IQRA 2J07A 5DB4A 3RFFA 4AQ7A 3BL5A 1N2EA 3IOCA 1VBMA 5HG0A 1NP7A 1N2OA 1WY5A 1N3LA 3KT6A 3N05A 5J59A 3ZIUA 4JXZA 2PG3A 1VBKA 3JXEA 4TS1A 1OWLA 5TEVA 1I2DA 2IP1A 2X0KA 3U1VA 2XRYA 1JIIA 3ZJTA 3CVWA 3FHJA 2WQ7A 1MC1A 1O95D 2PIDA 4U8HA 1WXFA 4ZT5A 4DLPA 3AL0C 1O5TA 2G36A 1NZJA 3KT0A 2C5SA 4WNYA 2YXNA 3AKZA 3CLRD 4MUIA 4JXXA 4MUJA 1J20A 1O94C 4NDAA 4NZPA 3QE4A 4JFAA 1Y42X 1F9AA 1TEZA 1EXDA 4MAFA 3AFHA 1T6ZA 1R6XA 4HJXA 3QTBA 3ZGZA 1LW7A 1JIJA 3UK2A 5FO0A 1KH3A 1OD6A 1O96A 4F3RA 3Q12A 4K0RA 4MUFA 4KR9A 1P7PA 2HGZA 3TZEA 2RD2A 2H2AA 1JECA 4I6GA 3GMIA 1QJCA 3A2KA 4QBTA 3IDFA 3X1JA 1EJ2A 4CT0A 2PFSA 1NUPA 2GKSA 1PFVA 1Q77A 2O5RA 1ZH6A 3INNA 1FYDA 1M8FA 3PRHA 4DDMA 1O97D 2PZ8A 4MW1A 3L93A 4XFDA 1TFUA 5IJXA 5KHAA 4WSOA 1OWMA 1XJQA 1QRSA 3ND5A 4MWEA 1MAUA 1JEEA 1WXHA 1T9GS 2I1LA 3SYTA 4YBRA 4X0EA 4NAHA 3TQIA 1QU3A 1RQGA 1NYLA 4U7JA 2CV1A 2CFOA 1YULA 2V0CA 4DNXA 2CV2A 2D13A 4EG6A 2B7LA 2ZUFA 4PBRA 3IVGA 1F7VA 2X3FA 1IVSA 3CR8A 1T6YA 1EUYA 3H99A 4CQNA 2PZBA 4MW4A 4KR7A 1O97C 1GZUA 4HK4A 1JEDA 4F4HA 1O0BA 1R6TA 4EGAA 5H7XA 3LCJA 1O0CA 3FIUA 4XFJA 2A4MA 4ZCRA 2YWBA 4CDNA 2YY5A 3UMVA 3DO8A 3IMCA 4XSVA 1GAXA 4MLPA 1MJHA 5IHXA 1M8JA 1TYDE 1KH1A 2CYAA 1K97A 3N8HA 3COVA 4AS1A 1NI5A 4MW6A 2DR2A 1U0BB 4G5YA 1UFVA 1GTSA 5J5AA 2E0IA 3RJZA 1GLNA 3RK0A 3P0IA 3A04A 1QRUA 1GPMA 3TZLA 2PXHA 4I6JA 3DLAA 2DERA 1PFWA 1QRTA 3HL4A 3KFLA 1D2RA 1MRZA 4ZT4A 3CVYA 4K03A 1ZJWA 1JZSA 2WB2A 1G8GA 3CLRC 3FDXA 5KCMA 4MVYA 3IVXA 3FNRA 3OTWA 2X1LA 3NBKA 2VXOA 2A88A 4DDKA 1WOYA 1PFUA 1MOPA 2EL7A 2J4DA 1N2GA 5DEOA 1IQ0A 1EFVB 2Z08A 4YP5A 1WZ2A 1F4LA 3PNYA 4R2LA 2CV0A 1QNFA 2DLCX 3NBAA 2PZAA 1PG2A 5K0SA 3UOWA 4ND6A 2NZ2A 1MAWA 3AG5A 1OBCA 1WKBA 2GM3A 2H29A 1IRXA 2A1UB 4HJRA 1N78A 4MULA 3SZ3A 1KAMA 1NUTA 1WQ4A 4L2IA 3CLTD 4KR6A 3IUBA 3KT8A 1I6LA 4EG7A 4ZCPA 2QJFA 4MUEA 1B6TA 3RBAA 4R2MA 4A91A 1M8PA 5TGTA 4ZT3A 1KR2A 3COZA 3Q10A 3NV7A 2EJCA 3AIIA 3IUEA 2OQ2A 5FNZA 3QTTA 4MW5A 4NAUA 1V47A 3PNBA 4QRDA 1M8GA 2DPLA 4YP7A 3SZGA 1FFYA 3E27A 1QTQA 3H9CA 5AHWA 2NSYA 1QQTA 3SP1A 3CLTC
chains in the Genus database with same CATH superfamily
4B83A 1HFEL 1S7GA 5A7FA 3Q9LA 1JB1A 1B0UA 1XBTA 1YV9A 1C3XA 4QASA 6Q21A 1KMMA 2Z6AA 4PC6A 1Q6ZA 2WMNB 1X80B 1H22A 5HILA 4B7ZA 4PXAA 5BSMA 3WJ2A 2GO1A 1YZGA 2Z4TA 1I3NA 4PNEA 5EJ2A 4URUR 3R4VA 2FQWA 4BRUA 1XGKA 5LXTF 2CMGA 3ORHA 3G82C 4A92A 5IJZA 1QFJA 4RE5A 1IEVA 4OI0A 5DX0A 2FG5A 2P11A 3E5MA 2RMKA 1CS0A 1UJCA 3ZIDA 1WS6A 2M6LA 2BFCA 2JEYA 2FP4A 2JK1A 4J0IA 3IUMA 3LWNA 3WRXA 4PQEA 1Y0BA 1RD4A 1EDOA 4LYDA 4DHWA 5HM8A 3LWDA 4TWIA 4A36A 3QJGA 4Q05A 1D5WA 1R3DA 2I8AA 4I55F 3SQWA 3E4CA 3UO8B 4X6LA 2G9QA 3RSOA 4TUYA 1BFDA 3PR1A 3ADPA 3JR7A 1QVVA 3R6WA 2AJDA 4KQ9A 4P2GA 2HM7A 4Y2YA 4LTDA 2EKQA 5KIAA 2Q28A 2N0SA 2OGSA 3KPUA 4N6OA 2AR9A 521PA 2ZVPX 3F98A 3RQSA 2HLNA 2O3SA 1J4AA 2DH6A 2WJ3A 3AEYA 3LX5A 4JB8A 3SEFA 5EQDA 2YHIB 5B57C 1V4BA 3H11A 2JBHA 1GR0A 4JKYA 1HDGO 3I9MA 1QHYA 2EWWA 3B1FA 2AFRA 3UWOA 3VUFA 1F6BA 2Y66A 3NW9A 1RRKA 3GLHB 4A26A 1N7JA 4IKPA 4CVNA 4TPKA 4UVIA 4V3CA 5AP9A 1M2KA 3O8LA 2G28A 2C96A 4K6OA 4RFSA 1XXHB 3G8DA 3LUKA 5DK4A 2AZXA 2YIDA 2A0UA 2BT4A 3DEFA 5FWXA 3AONB 3LL7A 1RI1A 1BEUB 2WIFA 5E0OA 1XZAA 1ZW6A 2ECOA 2OD7A 4CN8A 3LPDA 3G2QA 2ZSBA 3N2NA 1PW5A 3A7EA 3U9TA 3UC5A 1Y1PA 2UV8A 4S0XA 1RI3A 1YQ9A 2BSXA 1I0IA 1D03A 1W6UA 2ID8A 3H9UA 4FI3C 2CSXA 3HR7A 5I8PA 4OMCA 3UJ6A 3ZDXB 1H1LB 4EABA 4ZCQA 4YMIA 3HDTA 3GZNA 3WS7A 3QZUA 1UQTA 1J8QA 4XFKA 2XAAA 4L6AA 2GTIA 3SEZA 2JGRA 3G7UA 1S2IA 4ZMBA 2VSYA 2R6AA 4QHTA 3UHFA 4B80A 1D3AA 2F64A 3BILA 4I46A 5CFMA 2WP8J 3K1ZA 1I9GA 2OBYA 1BE0A 3EWIA 2NACA 3EWNA 4ARIA 3DGFC 1XZPA 1ECJA 3GLHE 5KTYA 1GDDA 1PQUA 2ZTLA 1T36B 4IUYA 4LJSA 3HFGA 4AJOA 2BGTA 1L7OA 3JD2A 5ICGA 4O2BF 4U2DA 1UBRS 4LI3X 2FH5B 3K5PA 3WLAA 2H17A 3EPHA 2ZJOA 1XMQB 1KEUA 2CDCA 2R84A 1LPMA 1MB9A 1VBNA 3PD0A 3OA2A 1Q0TA 4PGFA 2FW9A 1EVKA 2Q6TA 4D0NA 4UUMA 2DWPA 5E6UB 3GO4A 3EGVA 3B6MA 1QS0B 3PD1A 1YE3A 2COKA 5CXUA 1J9GA 4QKQA 2YC2C 4RTPA 3DBLA 4Q01A 3VYRB 5ALJA 2OKCA 3P9YA 4EJ2A 3FSGA 3FFWA 1D6JA 4IUCS 3HP1A 1QCCA 3QBDA 3R7BA 5DF1A 2VH2A 1CUSA 2QSJA 1Z2AA 3PT5A 4UUNA 1PJLA 3B51X 3ZK7A 1MT0A 1WUIS 2W2VA 1D8AA 1Y6RA 2I66A 2ZIWB 4E70A 4ENWA 3WGIA 2CVQA 1WCWA 2IY8A 1YZVA 4LJKA 1F2UB 1L7PA 2NWQA 5AJUA 2XT0A 3H5OA 4G65A 1NT4A 1AUPA 1QIFA 4OB6A 3JYQA 3TZCA 3WB9A 5M5BA 1ZUNA 2W6JA 3QU7A 4HAZA 4B3FX 3HKBB 3DXXA 1Y33E 2X76A 3U4AA 2V4UA 5I8ZA 1JALA 2J1LA 4MVXA 4P5DA 1BCSB 1ZMTA 4MLZA 2IV3A 1E9AA 3NWPA 1FPMA 3S28A 1AQIA 3AR3A 1DX6A 2DBZA 1IN6A 2Q62A 4I1IA 4UBOA 4IPTA 4HLUA 1DPFA 2P9CA 2C94A 1ZH8A 4Z9YA 4JLDA 2QRZA 4NCNA 4UZEA 4CDMA 2WFLB 3KG2A 4IVPA 4PAWA 3T4EA 4IHKA 4CMCA 2UYYA 5D86A 4A6DA 1X19A 5FBKA 1WTCA 3K5IA 4HDNA 1MV5A 3AYZB 2ZYTX 2ILTA 1TKAA 2IZ1A 1SELA 2WJHA 1IDN1 2WHEA 1U0FA 1G9XA 3L92A 4Q9KA 3I0NA 3NBZC 3W4IA 4RLFA 5CAEA 1D6MA 1RZVA 1B3BA 4H7FA 5EHZA 3KYIB 4KO2S 1AQYA 2NPFA 1CZLA 3ICPA 3CU5A 3LYHA 4FC7A 4TWAA 4XJXA 5HIIA 4BNLA 4NZYA 2MYUA 4B48A 4C4XA 3T3IA 1D9ZA 5A3VA 4ATNA 4RSRA 3HCBA 4ZI5A 5J23A 2EVWX 2QIOA 1U0RA 5HQJA 5IW8A 3SZRA 3M83A 3TRKA 4L22A 3FOZA 2W8BB 1SKMA 2GJKA 3IS3A 1JN0A 4RPGA 4ZCSA 4EJSC 4LJ5A 1X8XA 4V0MA 1IIRA 2WTNA 2EIHA 1Q0UA 1XD2B 2XKJE 4ID3A 5CJ2A 4A82A 4F6CA 5JXJA 5A6SA 2I29A 3SIXA 3DTVA 3JATA 4G5XA 3C3WA 3PKZA 2VP9A 1HORA 1RCFA 2VT2A 4GMKA 4C21A 4WJZA 1A9RA 1E5QA 2XB6A 3BJMA 3C0KA 4MW9A 3TCKA 1RXSA 2J08A 5LNK1 4GAEA 4BUJA 1AGPA 1NXTA 4KQ2A 1EMDA 3GEIA 3DKKA 3LWBA 1I33A 3O2QB 5JTUA 3STTA 4GPD1 3QUTA 2QNBA 3NYWA 3SJZA 5LYJB 1C4OA 4C5AA 1L0BA 5BNZA 3VC2A 1Y9ZA 4KIWA 1CU1A 3DQPA 3N2KB 2R6CA 2VO1A 4HX9A 2NO6A 3PC8C 4B17A 4JYZA 2GESA 3H18A 4F60A 5CB0A 2E6KA 4EP1A 3D7NA 2XXAB 3GEMA 2I4TA 1QGAA 1KJWA 2BKVA 3NC4A 4QNRA 1PI3A 1FDUA 4LRYA 1OLXA 1OLXB 3L1UA 1LK7A 4PQGA 3U60B 2JHAA 1E7WA 1W19A 1U8EA 3WR5A 4BUZA 3K72B 4YAWA 3T8YA 2XXAA 1G8MA 3L8DA 3IBTA 3GP3A 1GGHA 2H7VA 4IUBS 3AM4A 3PC4A 4WBXC 2CVPA 5H3LA 1MQ9A 4EAAA 3AJAA 1Z2CA 2FJUA 3D8RA 2BHSA 1L5RA 2V6MA 2H0QA 1G16A 1VLHA 4UU1A 4E5VA 1WKCA 3OEWA 2VR1A 4YRGA 4DJEC 4QG7A 2ESRA 5CVEA 3DEHA 3L4BC 4J29A 4ROTA 4XIFA 2AXPA 3EGIA 5CM2Z 3SQOA 1ZGHA 3X1DA 1SC6A 1XELA 3HUFA 4IIGA 1BWSA 2CW5A 4MKGA 5HFNA 2VIIA 2CZGA 2I4OA 3BL5A 1BXGB 5FI0B 1NY6A 1Q6YA 4G07A 4WZAB 2I2WA 2VHVA 3A6PC 2W0MA 1N2OA 1MO5A 3O8DA 4IQFA 4EX6A 3CE6A 3KQLA 1QGDA 1X15A 2CXRA 5IYZA 5L9AA 2JVIA 5CNJA 3UH1A 5I9LA 5DVZA 4RHYA 5EFZA 1CIVA 3DBIA 5FLKA 3CRMA 3FWNA 5DIZA 2WJ6A 2A9KA 2WZBA 3NH6A 4JJAA 2ZVQX 4UC0A 5FI3A 3RHFA 4B4DA 5C8DA 3U5ZB 1T2FA 4QGAA 3A3YA 3W05A 4URWR 3UF0A 3KKMA 1W36B 1A9SA 1O5TA 3RS2A 3KAPA 2N75A 2QNRA 3IDAA 4YWHA 5CPFA 4JX8A 4LTNA 3LM8A 1OIWA 1I6WA 1WDMA 4RKFA 3KWMA 1EXWA 2D00A 3OO1A 1J20A 2ZRAA 1YDWA 3BBLA 2P5TB 4MQ6A 3TLEA 1QVZA 3LLMA 3QMVA 3S29A 4EJ0A 3FN4A 4Q7KA 4DV2B 4FSHA 3NBFA 4ZI2A 1VSBA 1DX4A 3WB0A 4C0KA 4A1FA 5KNDD 3G17A 4PR0A 1E3LA 2FPIB 2G5GX 3PEWA 4L8VA 4CEHB 5A7GA 5CB4B 1GLGA 1B2LA 3B2QA 3OT5A 3SHVA 5AVUA 1I0ZA 3VVBA 2RHBA 1Z56C 2BHTA 2V58A 2LVBA 2G07A 5KKCA 5IAGA 2GKOA 5EQJB 4F5EA 1BQ4A 2HRZA 2JW5A 1G3MA 3GLKA 3FFBA 1E89A 1BMFD 2H2AA 3GAFA 2EQ5A 5E6SB 3MSCA 5FBQB 2NO9A 2Q29A 4DLAA 1ZAKA 3G0BA 1FYWA 1GNQA 3PUHA 1UPBA 4V0LA 1NUPA 3VOBA 4AD8A 3MW8A 2RGRA 3TGLA 1ZH6A 1TIKA 1JHRA 5KS2A 4QWWA 4QOHA 1DQRA 4YH1A 5AJTA 3A10A 2PX6A 5E6RA 3AM1A 2JFOA 1A2BA 1JIVA 5J4KA 4U7PB 2V6IA 3KB6A 4EAQA 3FAKA 1CUGA 1M2OB 2CXNA 2HPZA 3AZPA 4WSOA 5JSYA 3WQSB 3QIAA 2OB1A 3NHPA 5CVDA 2OMEA 1BMTA 4A8HA 2GILA 3TDKA 3MCTA 4LOHA 2ZRCA 4KO8A 3DPSA 4BP8A 3PD7A 2UVPB 3KXDA 1O6CA 1FYVA 2ZI4A 4FDLA 4RF2A 3BK2A 1DG3A 3WDLA 1NYLA 4JI2B 1LH0A 3PRJA 3HCWA 3LDHA 3PQDA 3UCXA 3TL6A 1SU7A 2BV3A 3LLSA 3ZE2B 4BZZA 1FLDA 1Y5IA 3IURA 1W4ZA 3OU2A 4FFOA 4IV0A 1W0KD 1AURA 1I5OA 7YASA 1ZEMA 1MHPA 3DEJA 4Y2HA 5H02A 1P8JA 5THKA 1E6KA 1NOIA 4DLKA 2C2WA 4HR7A 3DC2A 4MOWA 5K8TA 1JAYA 1W5SA 5H59A 3TTWA 2LW7A 1GRNA 1E3QA 4H1VA 1ZQ1A 2O8EA 4K9RA 1JF8A 1XKXA 4BO8A 3C7KA 4Z0PA 3U0BA 1DUSA 1ENYA 4LX8A 5BQPA 5B3LA 5C1PA 2DAPA 5K0JA 3KQQA 3T41A 3L7AA 5FNVB 1D4OA 5C3MA 1NBHA 3CF4A 5L8VA 3AEUA 4OQFA 4ZCRA 2EFHB 5EGNA 5B2ZA 4KV9A 4MCHA 4CDNA 1EP2B 5KTRA 5A4KA 5B6JA 3MWGA 1MEOA 2IYWA 2Z5FA 3NUGA 4D9NA 3VDXA 3IT2A 4MLPA 1R4NA 1QYCA 5IRCD 5G0VA 2R8EA 3QNWA 1TGYA 2DTEA 2PQ6A 3DO5A 3EG9B 1SU4A 2V7WA 5KYVA 3ROGA 5KVAA 2VDVE 3N8HA 3COVA 4OTZA 4EITA 1NF3A 4QZVA 2BFFB 5F2EA 3U4DA 3ZGOA 3V55A 3HA2A 3QBVA 3TRIA 1LPOA 3L7YA 2VOJA 3BH0A 3Q3EA 1QOZA 2PZGA 3GVIA 3T5GA 1GL7A 2VDLB 1E1YA 3RK0A 3W8NA 1CUJA 3TQSA 4W9MC 2UUCB 2Q9UA 1QRUA 2IF2A 1PBNA 2HF7A 3OH8A 5L4LA 4C0BA 1OKKA 3OX1A 4AMVA 4BB5A 1XU9A 4FKZA 1G19A 2WFLA 1D2RA 4P7GA 1DAEA 4ASUD 1BX3A 4ID9A 3K0AA 4L8WB 1FPQA 1U1FA 5DNDA 4I1SA 4IAOA 4E94A 1MEJA 3MELA 1OLSA 2XMRA 2I7DA 1ZGCA 2JVKA 1SJ9A 4NWIA 1AA9A 4L15A 4Q9IA 1C1XA 1PIWA 7ABPA 3G9QA 4KGXA 4U0JA 1CS4C 4AY2A 3HYTA 4PYOA 4I8DA 1H69A 1N2GA 5DEOA 1EFVB 3ZWMA 2DT5A 1EBUA 3F2IA 4YAFA 2ZI6A 2YS6A 3BSYA 2XUKA 3HA7A 1ADBA 1VGVA 5HIKA 4EB8A 5FA5A 3CVOA 1NXVA 3KV1A 4OMDA 1U9CA 1M0EA 3TTXA 1KKMA 3IO3A 3KWFA 5E4JA 3V46A 3DAYA 3SR3A 1PE0A 3ZU4A 5C8XA 1AK1A 3U44A 1WKBA 2GM3A 4MGZR 5GQSA 1X7YB 4E2FA 1TMGE 1UBLS 3URMA 1Q57A 3E1SA 4MULA 2RGYA 2WDZA 4B85A 1X9GA 4BNIA 2GVNA 4LMAA 2HXGA 2FPGB 4GHWA 3QUCA 1V16B 2VDMB 1EVYA 1QFXA 1K06A 2HSWA 3KJHA 1VKHA 3T94A 2P4SA 5KJCA 5AM1A 4H1TA 4FXPA 3SHOA 3Q87B 4MPTA 2FF5A 3ECAA 4KX3A 4X5OA 3RVDA 3OZUA 4EW1A 1KSFX 3CMMA 1QE3A 5JZVA 2AWOA 3H1PA 3PQ6A 2F1HA 2W2KB 4AF8A 1W73A 1NKSA 1IL0A 4XD7A 3K9BA 3MWFA 1OILA 5IX8A 1T15A 2RKBA 2JIOA 1E9DA 2BCEA 3DR5A 4D8VA 1Z08A 4Y6RA 4MDEA 1NNLA 3PEYA 2XGOA 4DLVA 1JBQA 4TSFA 1AHPA 4ZU6X 1E9VA 1THMA 2JC3A 1H8HD 1NW6A 1PWEA 5BWMA 2ZYSA 4C1NA 5JQGA 3Q2OA 1CY4A 4BKMA 3E22B 4G0ZA 2GK7A 4XIYA 1MXHA 1JHXA 3OCVA 4MQ4A 3V8QA 5IJ9A 4ARAA 2PJRA 5JNRA 1DJMA 3OCCA 4UFPA 1LLCA 1QMPA 2Y92A 1PJBA 4B44A 1VOTA 1J06A 2VZLA 3JASA 3LK7A 3IAM6 1JEQB 1P2FA 3PJDA 3NV9A 4FBGA 4YQYA 4E2WA 4XM0A 4UUOA 2AZ4A 5F23A 1FMLA 1JG1A 1KZ4A 1KJNA 1V2HE 2J5RA 4TRMA 1YIDA 1V6SA 2I67A 4Q00A 3FETA 4QAJA 1G3RA 1XTTA 2ZIEA 3IODA 3KJEA 4M8IA 3TIFA 1JG2A 1F5NA 3N7UA 4DDUA 1WV0A 1DAOA 4BO7A 1W52X 1U7XA 1YVUA 5T7BA 1X1CA 1PQPA 1UT6A 3PYMA 4X7MA 1HDCA 2EFEB 2PMKA 2Z3ZA 3A0UA 3NTQA 2GTHA 3L4EA 1XEWY 4TWZA 1J2JA 3PUVA 4MCAA 3I12A 3MN1A 4LVCA 4DZRA 3GT3A 2P68A 4J0FA 5AKKA 1S7CA 3EN0A 4M87A 1O5OA 3FWYA 3UENA 4CUJA 5JEEA 3CVXA 1E9FA 1WB6A 4FYXA 3MHTA 2GBGA 1L6IA 2WVAA 2CLSA 4BQIA 1M2FA 2REOA 2KM1A 4RPKA 4LY6A 3FSRA 3QI7A 2IX9A 3WK9A 3G59A 2UKDA 2AR0A 3DFFA 5BR7A 4DS3A 5HUJA 1QV6A 2FY8A 3D7LA 1T4DA 5FFFA 2P8SA 1K2VN 3QP9A 4PSKA 4MLCA 2HD4A 1PEDA 2NLOA 1DBPA 4OHFA 4ITVA 1C30A 4N8DA 4UTZA 4DARA 3F90A 3RANA 4EH1A 5EJ4A 1XZCA 1ZONA 2DPHA 3IRVA 4O63O 4GZ6A 1Q0SA 4O25A 3TM5A 2CCJA 3VZCA 1AKMA 1P7CA 1WMDA 2GAIA 4QXMA 3ZWPA 1BNCA 1RNLA 1SN7A 1CQJA 4MI6A 2QE7A 3LCCA 4HEA6 2D1TA 4MVJA 4ZAGA 4OKNA 3KJZA 1JU4A 3BICA 1TC1A 3P2IA 2QUHA 4MI1A 4QELA 3RYIA 3MINB 1FW8A 1W88B 3AVYA 4M1OA 4OMFG 2XVXA 2J09A 2GX6A 3D1JA 2Q8QA 3B3FA 4MWTA 1OH6A 4HNHA 2LPMA 2R44A 5DISB 1LRJA 2D5BA 4O4IB 16PKA 1N2BA 3C3EA 3ZWQA 4F3YA 4U2GA 3PXAA 2KYRA 2ZJ2A 4M0UA 1W2WB 3MRTA 4KWCA 4QPCA 5FUWA 4BLOA 1YR9A 2CF5A 4H59A 3WHPA 5C52B 1UDRA 4ZGGA 3GGDA 2PCJA 4P3PA 4LTMA 5TV2A 1TCBA 1OTYA 4DTCA 1R9GA 4V39A 3SBDA 2FZLA 3WBKA 1XALA 1KS9A 3DP7A 3IQGX 3NORA 3L46A 3OZCA 5E6UA 1Z6XA 1ECBA 1LTHR 4ZMSA 4E5PA 4QNMA 2WICA 3QVSA 3QWIA 1QFSA 1BS2A 2CJPA 1J56A 2HA6A 2ORVA 5C53B 4GWKA 5HQ3A 1NQAO 4JBHA 5J4LA 3KZNA 1W6RA 2FXVA 1HEUA 3TBHA 1HDXA 4RDXA 1UK8A 1H2BA 3SQDA 2WPDD 1ZGAA 1AE1A 1BE6A 2I1VB 3T12A 4PSDA 3KV3O 5L3QA 1H94A 3OHPA 1XRPA 3A70A 2QT1A 1ZVMA 4MHSA 5HTKA 3M1IA 5ADHA 6ADHA 2G6TA 7MHTA 3KJXA 4URVR 5DZSA 3E1KA 3GNLA 1CY1A 1H6BA 4X85A 4LVUA 1ZLYA 1JDBC 3TKYA 4DMCA 3ZW8A 1M75A 4CM4B 2AJBA 4Q4DA 1P9LA 3I5UA 2PRZA 1R66A 5F3DA 2NPIA 2QL7A 4AL4A 3CLSC 3FYTA 2QZZA 3HJAA 4D3YA 2YR0A 2O3QA 4L3OA 2HXYA 2Y6VA 5ALXA 3TEMA 4UZFA 2P0EA 2IOYA 1FVXA 3PFHA 2Q7DA 4PLGA 1YZNA 4JT4A 2AF3C 1X7YA 3WGOA 2VEDA 4EG3A 1UK7A 3AI1A 4K88A 1ATIA 2I2CA 1K8XB 4YROA 3V2HA 3BMQA 2PUGA 3D7MA 4Z4FA 5KJFA 3CB2A 4HYEA 2HRDA 5HR5A 3MCAA 4JBIA 3T9DA 1XWFA 4GYYA 4Y6QA 3RVKA 1DAHA 3RU9A 1Z0FA 2OLEA 1C7JA 3DE3X 4HQKA 5BWLA 3VPBA 3UG7A 3E03A 2PFKA 4HYQA 1H4TA 5K5EA 5A0TA 2XT6A 4CMHA 1R0KA 1G8FA 5B4VA 1EFVA 4GE0A 1UEIA 3A3KA 2FMKA 1V1JA 4W6QA 5IXYA 4F5WA 1TYEB 3FPLA 1WSAA 3USES 5A62A 4FZVA 3JPWA 2WWFA 5INTA 4Z4GA 4IDEA 3DTVD 1UK6A 4XUGB 4MB2A 3UFXA 3VTFA 1A5TA 2R751 2WJ4A 1LCIA 3EGCA 1PJZA 4YJ2B 5EIBD 2FRVA 5E2BA 5JALA 2AV6A 2HSZA 2IOFK 1LDEA 1SXJB 3OCYA 2H1VA 3ZWKA 2P1DA 4ARSA 1DXYA 1E3WB 3GOQA 2LV8A 1EE1A 2YZKA 5EIHA 2O07A 1ZICA 3DBOB 3I6MA 4P54A 3ZD7A 4DQLA 4JKIA 4DUPA 3IXLA 4MWSA 4DLXA 4QPDA 3UGTA 1HTWA 1KP9A 3U3JA 1R37A 1YD7A 2K4MA 3TDNA 3H7IA 3PDCA 2NU6A 5AK4A 1DUIA 3GCDA 1L5HA 1NLMA 1Y6QA 5M34A 2QAIA 2VQ6A 3NM4A 1YOVA 4EPTA 1P77A 2VYQA 2XCLA 3AM5A 3BHNA 3QW2A 1CY2A 3ORFA 4LA4A 4QO8A 1ZRSA 4X8LA 3RS3A 4LWQA 3UMJA 4Z8YA 1FNSA 4BE4A 4D41A 1IXSB 2NVOA 4OJMX 1NW7A 2GA9A 7MDHA 5DGTA 3ZE7A 2Y1OA 3CX8A 4AN1A 2QAGC 3DV0B 2JCVA 1R12A 1P2VA 1C7IA 2AOUB 3A6KA 4M8SA 4U9HS 2BFPA 3O9MA 1O87A 1U81A 1HURA 3AHDA 2PXXA 3BB4A 2IEYA 3H6HA 3TUJC 5IKMA 3WA7A 4GOLD 3FZNA 4K05A 3S40A 3AFGA 1VIDA 1M5UA 4B6GA 1A8QA 3L1IA 3MMPA 3P0EA 5AKGA 4GEKA 2EJBA 3S3TA 4YT8A 2E5WA 3W5VA 1O54A 1V9LA 2QX6A 2YZMA 2D1QA 1HG0A 2O57A 1JJAA 3GRUA 4J94A 2FMTA 2B61A 4R2JA 3D4NA 1AHNA 1ZQ9A 1B6GA 1TQ2A 2OFFA 4EZEA 1O6FA 3GG2A 1NY5A 1XR3A 2V55B 2ZYWX 5DK6A 3GLFE 2Q6LA 2ZAMA 3MWKA 4FNGA 3R44A 3RW9A 4BMVA 4YUZA 1EGHA 3GD5A 2PGDA 1IRIA 2INGX 3JYOA 2N1MA 3AFOA 2WHYA 1Q20A 3IEKA 4FX5A 4QTUB 5KEIA 3BD9A 3HO8A 1I9CA 4XJTA 4NOKA 4ON9A 3M5WA 3I2KA 4Y2VA 1XQWA 4JI5B 2XYVA 1W7AA 3EDYA 4G01B 4Q21A 2QVCA 1TCAA 3IHWA 1KAGA 2JFQA 4G5RA 5JNVA 2D5LA 2O2ZA 4O2RA 1GPUA 3L5KA 1JQDA 1AK9A 1PZFA 3GR6A 1RE1A 4JQYA 3L6DA 1EUQA 1CUZA 3VBCA 4C4PA 1L6RA 1Q83A 1MNQA 4PYNA 4V0RA 3SCZA 4EGCB 1M2EA 5ES3A 4B4VA 4JZYA 5JQGF 3SR0A 5FR1A 3KSBC 4DE5A 3GLGB 1BU5A 4BNJA 3DOEA 3WZMA 1HE3A 5JTTA 1JYSA 3GZJA 3U9SA 3UPUA 1TJ4A 1LRKA 1VBMA 5LUAA 1DFGA 3VPFA 4IDPA 1FIUA 1IBSA 2ZJ8A 5EJFA 1R6VA 3EZXA 3MWJA 1KI2A 6PFKA 2ZSIA 3O94A 5IUJC 2WUEA 3C97A 4LBYA 3EVFA 4LJLA 3BWVA 5DX1A 4FB4A 3JQEA 3HMKA 1VTKA 2HMSA 2GQ0A 4KBYA 1NW5A 1FQWA 5KHOC 3WP0A 1Z9BA 3L4SO 5LBTA 3CX3A 5M7EA 2EZ9A 3COJA 2HJGA 1EINA 4H6PA 5GVSA 4DQUA 5ALOA 2BUCA 1GPBA 5LZ5A 3T5TA 2E87A 1O94A 1LXCA 3GJ6A 5FWYB 2C42A 1KDTA 4I4TA 2WVGA 3VPAA 4PWYA 1Q0ZA 1MPTA 4EA7A 2C9CA 4R41A 2Z6VA 2YDYA 2EXXA 3FBTA 2A35A 5CR9A 3JQ9C 3RM3A 4FNOA 4RA6A 4Z5XA 2DY0A 1PR6A 3PNKA 1RM3A 5AUPB 4UOQA 1ZIOA 5DOVA 2GSDA 3BWEA 4J1TC 2ZIVB 1GSAA 2R65A 1TFRA 4OLHA 2UZ0A 2ZWMA 4JL6A 1S5PA 3PNLA 2J9YB 2X77A 1RI5A 1UOEA 2C92A 2YOFA 4MAFA 4D43A 4N76A 3EXEA 1A77A 1IHDA 2JGIA 4IHJA 3A4VA 2QPAA 3F1LA 2HQSA 1KMIY 2J4FA 2XQIA 3LP8A 2Q3BA 1NNEA 1FDTA 2OZEA 2EKLA 4F3RA 3FDJA 1CUDA 3JZAA 2J3JA 2ZRMA 3P2MA 4JI8B 4BKUA 1P7PA 3E8SA 1CYEA 3N59A 4MVJF 4C0QC 1KY5A 1II8A 1W25A 1TK3A 4K9NA 2C59A 1Q21A 4WD3A 5AOVA 3V4OA 5HX7A 3ITKA 2MT9A 5ALRA 5TDHA 3QE2A 1YJ5A 2KQUA 4TMFA 5COBA 1JR2A 1E1RA 4LGVA 3RH0A 3TYXA 3BN3A 4Q7JB 3OFJA 1HDRA 4INAA 5I01A 3FJYA 4CIYA 5IABA 2ZYGA 3SLGA 1XZDA 3L7DA 3DAHA 1TFUA 5IJXA 4Z4QA 1OWMA 1YONA 3KTFA 4ZHQA 1E2MA 4Z7JA 4LF8B 2FWAA 5DNVA 4UTNA 1QRSA 3UAWA 1TRKA 4PGHA 5DDIP 1MAUA 4WJLA 5CXQA 4LE0A 4FFSA 2WJAA 4PM4A 3VSEA 5HRCA 3RD5A 1SU8A 2L0XA 3B6ZA 1Q1GA 2XZLA 4Q4AA 3QVXA 4HKTA 1SPXA 1UZLA 1WAMA 3PVCA 4DV3B 1RJDA 3L7NA 4S1VA 3I28A 2QRMA 1LBTA 3HVUA 4AP6A 2BDUA 4A7PA 3NASA 5ALMA 4CW7A 2ID4A 4R71A 4CCSA 5BWCA 4W5TA 2WTEA 4DR2B 4D4KA 3ME5A 1UJMA 3IFSA 4AJLA 5IWCA 1UMDA 1FMFA 3CPJB 4XQ0A 5B1IA 3G2OA 3O7WA 2OR3A 4GF5A 4PBRA 4OIMA 4PC7A 5LXTA 3PPWA 3K2IA 5F5NA 1P80A 2CVZA 1J2UA 3NXSA 5EOVA 2J33A 3GXBA 1EBBA 1Y82A 3N2KA 3RVRA 1AU9A 3S2UA 4MDYA 2WILA 1O97C 1ZY2A 2XUFA 1SC3A 2P3QA 1DQYA 4IQ4A 1L5NA 3WLKX 1BS1A 4RKRA 3WMWA 2O8FB 4XOIA 1IVNA 2R6FA 1Z16A 2G04A 1N34B 6REQB 4DV5B 2Q5IA 3NHAA 2O54A 2VQFB 4OIFA 9MHTA 3G79A 2YJTD 2YWBA 4UNNA 3TG2A 3ETNA 3T35A 1QGYA 3TLJA 1YBMA 3O4VA 3JU3A 3TLCA 3WDSA 3TQRA 3ELUA 1Y1TA 3FTQA 4R51A 1RYFA 3OU6A 2YWEA 1KBQA 3ODGA 4HATA 2XITA 3GFGA 2PZLA 5EYPB 5ICCA 2X13A 1Z5NA 5I7HA 1KVQA 3K4PA 3O73A 5LN1A 4AS1A 5F21A 3GP5A 4XH9B 1VE9A 1HKUA 4IS3A 3B1KA 3ZCQA 1YB7A 4F4CA 5AW0A 1RPNA 5KU1A 3RJZA 1QHIA 2PPVA 1QRDA 2UYQA 2V6GA 3IHKA 3GLQA 4AM8A 1U8TA 2V9ZA 1G7RA 1OAOC 1YJXA 2KBEA 5B53A 3RREA 5K0CA 3L0IB 3UICA 5AESA 2B7CA 1MVLA 2CHFA 3C6XA 2HK8A 4UREA 1R0BA 2JAPA 4LQ4A 4PXSA 5EJIA 3VAZA 4OLAA 2A9JA 4BVEA 2W2MA 2WB2A 1A7JA 3K6RA 1UBGA 1JJVA 4D96A 2V0NA 5JH7B 3CSUA 3ZE6A 2XMDA 2PS1A 2IPLA 4NRDA 2C54A 3L8FA 2WEKA 3NBKA 1YVDA 2IYOA 4YT5A 3ZDRA 3FRHA 2LIPA 3K7EA 1G63A 1OXKB 3PCTA 4AJHA 5KVVA 4JIGA 4M21A 4ZRNA 3ZWVA 3IAUA 2J4DA 4P7KA 2P9EA 4YO7A 3T5MA 1WO8A 1F4LA 3JARA 2FZ5A 3IIMA 3VR2A 3K5HA 4R2LA 3U3RA 4RKQA 1YBFA 2FEWB 3KTOA 2QMYA 4ZOQI 2D1RA 1XHLA 2ADOA 3BDIA 3QELB 5DNEA 4EM6A 2DLCX 4X63A 2BHLA 1GNSA 4PRZA 2VNAA 5HCIA 2IH5A 2AR7A 3BE5A 4JYCA 4U7GA 3BMQB 4YC7A 3AG5A 1OBCA 5JECA 4K9PA 5IEJA 4NF2A 5JAHA 5SV2A 2BP7B 5FTJA 3LT2A 5LD2C 2AMFA 1QRAA 1DOHA 1V5IA 1KVTA 4JJZA 4CTJA 4DLLA 2DCUA 1L1QA 3SM3A 1BMDA 2Q49A 3EYWA 3R0XA 2GERA 4JY7A 1PVDA 2XLCA 3LDGA 4RHCA 3U0VA 3QI2A 4AB1A 2W43A 4LZJA 2YJ6A 2ASVA 3JWEA 2GUGA 3FI9A 1Y34E 3COZA 1FCJA 2GZRA 1YNOA 4BP1A 1WSBA 4D4IA 4GPBA 3PL5A 4R2XA 1NUAA 1RS0A 3KQPA 5CCBA 3GJZA 2Z8ZA 3DDZX 5A3RA 2QTVA 3CX4A 3GMTA 2XH8A 4I2NA 1ZM3A 5JFGA 4F4FA 1KO4A 1GUYA 4ZODA 1PTJA 3GJ5A 5DEIA 1M7HA 2ZFUA 1O0SA 4MW5A 3EZLA 3DMFA 1UPUA 3CCFA 1XJ0A 2NO1A 5KQGA 1NQTA 2OCXA 2GFHA 1E2PA 3RABA 4Q12A 4YP7A 4XQ9A 1BFUA 1QHNA 4IWXA 2UZIR 3S5UA 1YE8A 3H9CA 3AKEA 4HH3C 4B6JA 1JPVA 5B3JC 4DR1B 4J7AA 5ECGC 3UEOA 1OLOA 4LOIA 1QMGA 1V8ZA 4AC9A 4HFRA 2IQIA 4RVUA 1TXGA 1DIOB 2XWQA 3K70D 4B4UA 4OH7A 4P58A 3QGMA 4MJLA 2G4VA 3SLKA 2YKGA 3OSZA 5G1NA 2IUSA 3V4VB 3R5SA 1I4LD 5EP2A 1LDBA 4PX2A 1SC1A 4U6NA 1IMJA 2CT8A 2Z5LA 4F91B 1NM5A 1NTOA 3WTCA 3UAYA 1GARA 2LRHA 3G8BA 4MRMA 3I6BA 3GC6A 2OCIA 3JWHA 1NFFA 1XTJA 1GTG1 2VJPA 3P5SA 4US0R 3VO9A 3AUFA 1Z26A 2NIPA 1NV8A 1EYZA 5ED4A 5A03A 1UWKA 2V7PA 1JIUA 3BULA 2VC2B 2C04A 4GECA 3RVSA 1NUSA 2Y8EA 3CEMA 2MCFA 2W42A 3HJRA 3MWDB 1AS2A 1R4MB 3B7GA 1RWPA 1JA1A 4WKOA 5EWJB 2FOXA 1QQBA 1C1DB 4F38A 3F6PA 2H6EA 2W7TA 4Z6KA 1T0UA 3ID6C 1PWXA 2KE5A 5AM4A 1EZ4A 5CA1A 5CA1B 1LU9A 2TMYA 2BFAA 2HA2A 1C1DA 3Q7QA 4RM3A 1SG0A 5FHRA 1DZIA 3VJMA 2YC4C 1Z5PA 1Z22A 2D7CA 5HBRA 5LA6F 1D9XA 1U7TA 3A1FA 5GJBA 3HU2A 2F59A 3CMCO 4WNIA 4YI3A 4DM7A 2N42A 3EXAA 5FOQA 1ESMA 1OJLA 2R66A 4AYWA 5K99A 2QT9A 3DVQX 4RKWA 3CVUA 4OL9A 1ORDA 2VDRB 2IEBA 2R4UA 2SCUA 4DSNA 1Z0SA 4I0WB 4MYSA 3EUAA 1J0BA 1WBJB 4NE9A 1CJTC 5HFAA 2VHTA 1HDZA 2WYVA 5T4HA 2HBZA 3I0MA 4U2BA 5J2TF 4EEZA 1N4AA 2P4HX 4S12A 5GGYA 2PRSA 2W6JD 1O89A 4J4HA 5JXIA 3PXUA 5LVAA 2CE2X 3C6QA 3WWZA 3CWZA 2X2OA 4TMXA 2WWGA 1WEKA 4BHTA 5I6DA 3AP2A 4GO1A 3FYDA 3JR3A 1JEQA 2IIVA 2MIIA 4IMPA 2BMAA 4ZOEA 2XA1A 1GGVA 5ALQA 1I5RA 2XKKA 1QUFA 1QQAA 2ZUWA 1TEHA 2JAOA 5BRNA 3ZD6A 1WVMA 1KJQA 1GKUB 3R0QA 3D1VA 4FMDB 5IAOA 3UUWA 1YBAA 2PA3A 3UHOA 2LCIA 4PG4A 4C7XA 3GMDA 5EE1A 7REQA 3DNFA 4Q7EA 3QKWA 2JFYA 3OE7A 4O4HF 4AYXA 1N2JA 2MSLA 2PS9A 2REBA 1N92A 2BUAA 1SUPA 1AIPA 2O20A 2FFRA 2HO4A 2QDKA 2YVKA 3PLRA 4BL5A 3O93A 2PNJA 2VBGA 5DTRA 1BE1A 1Q3KA 4UU7A 5HQTA 2ZREA 4FOOA 4LJ6A 1YU9A 3BIOA 3H2HA 5JAUA 3CWCA 1A9XA 1H8HA 5IU6A 3SE0A 2I6TA 3VH2A 3FJ1A 4J0EA 4BASA 4BP9A 4P0TA 3NO4A 1EVEA 3TMYA 4MV0A 4FLEA 1N7GA 1KYQA 2HY7A 4GC5A 1I8TA 4IRMA 3V34A 4D4GA 4DC1A 2B6NA 4R0MA 1L7QA 3K0FA 4D8WA 3ILSA 4AO7A 5BVGA 1C0PA 5T4BA 5FX2A 4F85A 2JGNA 4NABA 3USCS 4G86A 3VZPA 5AVWA 4MQEA 3W2TA 4F3TA 3ZJ5A 1D4ZA 2D06A 3LY8A 4PLFA 2HU7A 2AIRA 1R7RA 2BKUA 1Z4KA 3MFYA 3JALA 1H9AA 4W5HA 2I03A 3KWLA 2JATA 4PHHA 3AKDA 5DM0A 3N5KA 1R6DA 1T1IA 2AFHE 2F43A 1YR6A 2OZLB 3MS7A 4RO0A 3FMPB 3NR2A 1CFJA 1GA6A 2IHZA 4XQCA 5HYVA 3G5LA 3NHWA 3TXAA 1E66A 4KU4A 3QPAA 4U2EA 4BN0A 3I5YA 2PUVA 2Q9BA 2XXBA 3O2NA 5JD5A 1XOIA 2BKXA 3OAAD 1BDHA 1IULA 3COYA 3UQYS 3TGWA 4FW8A 5K8UA 2PKCA 4KSYA 2J8ZA 3KEFA 3U9LA 1FNNA 2BJVA 2GZHA 3C3DA 1P7ZA 4F6LA 5CIYA 5FQNA 4MW2A 3WK8A 1VXRA 4HWRA 1B41A 4CUKA 1P1HA 4S1OA 3QKSB 1SULA 3LVFO 1XD8A 3A25A 2GPNA 2R85A 1X1QA 3GA0A 3HCDA 4HSGA 1CUUA 1GA4A 2OGWA 2QXTA 4P4GA 4RFVA 3W7BA 3HCCA 5EINA 5IUKC 1Z3CA 5TEWA 5JV5A 4MIEA 1F2TB 5KKNB 1OROA 2P90A 1QPZA 4JBXA 4KNWA 3N70A 2IEZA 3PIRA 5M3BA 4HNRA 3QFHA 4RIHA 4EUFA 2I6XA 1ETHA 3I2HA 3PZBA 1JUDA 4HWPA 5IAKA 4BBZA 3UXMA 4Q4CA 3FPAA 4UQOA 3FKSA 2FPOA 4FIZA 1ZNYA 4I50A 3WYAA 3QYFA 4RY0A 1W5FA 1FP4A 3WWCA 3OZEA 3ZHRA 3Q8XB 2GBCA 1D1QA 3I73A 4IQ8A 3F7NA 4WCFB 3UA3A 4B6SA 2EFCB 3O8QB 3C3CA 3DZJA 2ZZMA 4ARZA 5IEBA 3KSRA 4OXIA 4EA6A 3KLNA 2JANA 3E05A 4FLMA 4HOYA 2I1WA 3IOBA 4BCDA 4DZTA 1WSDA 4MUYA 3OHMA 4M9QA 1KQ3A 3INTA 2AKAB 1DFHA 4XJVA 4AIIA 1G1MA 4QICA 4INZA 2RHDA 4A8JC 4NH0A 2JFPA 4CF4A 4DPLA 3MJTA 4HPJB 4UUBA 2JGFA 2EZ8A 1W1WA 3PR2B 1B7GO 1P2UA 1VRWA 2C00A 1O77A 4TM8A 5CNIA 5GV7A 4DRXB 2A5FA 2A86A 1F8FA 2HQBA 5EXSA 4EHFA 4DA0A 4GEGA 2WT9A 1RC8A 4FNAA 1G8KA 1PDVA 3SF8A 1F38A 1XO1A 3L40A 3SIRA 4LOAA 1T3ZA 3ONEA 2G63A 1NJ6A 4MWGA 4TSKA 1N6OA 1KIMA 1A3CA 2BFDB 3D4IA 4L1KA 2YDXA 1UXOA 2IPOA 3JWJA 4OM8A 4CV1A 1JPNA 2ZJFA 2GRAA 2FRDA 3EGDA 3OETA 4IIXA 5EXXA 2CXHA 3R76A 1OT5A 3O90A 3VOAA 5CK4A 1UBOS 3KSUA 2PSFA 4ZU3A 3V9PA 4D82A 6GPBA 1Y7LA 3L6UA 2AJCA 4MKFA 3MIIA 1NXSA 1G5IA 2M1ZA 1E2BA 2P75A 4EELA 2C95A 3F7OA 3K3PA 2D3TA 3P5BA 3SEQA 1XN4A 5DHFA 1WPRA 4DSZA 2C4WA 2D5AA 1IZYA 3W2EA 4A0GA 1MB2A 2OCGA 5F5LA 3VNQA 2C2YA 4LOJA 4GPIB 2GOYA 2QUIA 3LX8A 1QF7A 3TOXA 3V48A 1RU3A 1R0YA 4P86A 2JIDA 4C88A 1BDMA 1PJTA 1Q0HA 1SD5A 4TKLA 3EPLA 1R64A 3N8KA 4NZOA 4AQ7A 4BJ3A 4US2R 4HUJA 4IDCA 4QJIA 2H08A 2ZJ3A 2NUAB 5ER9A 2V1UA 3UJCA 3EULA 4JXZA 1N3LA 1D2MA 3ZHBA 3ZIUA 1J0EA 2XDQA 5K8VA 3DZKA 5AMXA 1K5HA 1NBMA 5DWVA 2JH9A 1PO7A 2ZJ4A 4GPEA 4PLZA 5DNUA 1A95A 4HMQA 1P0IA 3DYVA 4YCMA 3PHGA 4YP0A 2QPTA 3LUDA 4WN3A 3CS3A 3H65A 1MC1A 3UAXA 3TBFA 3N76A 1NG9A 4Y2XA 1OYWA 1XZBA 4HDSB 2ZRLA 1G18A 1V5GA 1Z62A 2OL4A 2JGAA 3NBUA 2R2GA 4AKIA 4LF4B 4GMHA 2FQ1A 3BRQA 1OFIA 1WMSA 3EZYA 3GVCA 2PSJA 3BCRA 4YRCA 1MFPA 2I99A 2R1ZA 4QDXA 1G21A 1G21B 2IBMA 1M74A 4NU0A 2XB4A 3EXHC 2I3AA 1EA7A 2H51A 2SKDA 3MHPA 4PG5A 4QJ5A 1Z2OX 4I1PA 2KX7A 2OCDA 4QODA 1M1NA 5DHTA 5IK2D 1G3UA 3HB9A 1Q7EA 1XTVA 5I9IA 2REXB 1PS0A 3I9KA 5LP1A 1CV2A 1JSZA 2XUZA 4OK3A 4DUGA 3CH4B 4ENQA 4JNCA 1HKHA 1Z88A 3N74A 4UHEA 1M0WA 9LDTA 5GIOE 4RTOA 1D2NA 2XE8A 3OTHA 1FFXB 3AU8A 5P8WA 3QYJA 1WABA 1ZLXA 4MVJP 1TDJA 1LTKA 2OY0A 5NULA 1GPH1 1P1CA 1FJ2A 1V9CA 3K0KA 2VXYA 1W581 4K0RA 4N40A 1QOPB 4CQMD 3CEAA 3A7DA 1M2NA 2QM0A 3C14C 4K87A 3KELA 4RDHA 4RHXA 5J9FA 3LIPA 1U3TA 3WLTA 1PGJA 3DAFA 4JLOA 3X1JA 4ED9A 4UDXX 1U0JA 5A4DA 1OBOA 3DJFA 4CNQA 4MS3B 1UBMS 3TR5A 1M8FA 5F2OA 3HXPA 4QBHA 1OLUB 2EBHX 1SHKA 1G17A 2OXCA 3PTZA 4R9RA 4XQGA 3BGOS 4E4TA 3K71B 1JDBB 5TQJA 5BQFA 2EW8A 2P41A 2H9YA 1SXIA 3L6RA 1N32B 4GI7A 2D8AA 2GPSA 3L7LA 4Z4EA 1WXHA 1WU7A 4MP8A 3H16A 3QK7A 4GM1A 4KOEC 3BAZA 3MUFA 4O2BB 3EAFA 3YASA 1VB5A 5LR6A 3F6RA 4LXIA 1NXPA 4WESA 1VLQA 4RX1A 2C84A 2CFOA 1PX0A 3FSGD 5KSOA 3SM9A 1V37A 1YULA 3PDWA 1OA0A 5KCZA 1WCIA 1AGYA 2BLLA 5HJ7A 3I9V1 1WZIA 1PGNA 3CO5A 3R0VA 4PN7A 2AHRA 2IC5A 4M8NE 5EE3A 3U1BA 2WKWA 3PNOA 1GUZA 2A5DA 3U3ZA 4QT4A 1I7PA 3HNRA 5B6IA 4AX8A 3CR8A 5FOXA 3LQRA 2C5LA 4XM1A 5IK2A 4J43A 3UA4A 1QVRA 2XKBA 2GKGA 5AQ1A 4QPPA 3Q88A 3DBHA 1JQKA 1NW4A 3A26A 1R5BA 3CO0S 3F3SA 1XDSA 5JEDA 5GOTA 3TVTA 1V6CA 4CM8A 3EGOA 2PSSA 3H17A 3GDOA 3QOWA 3AEZA 2A92A 5L3SB 3WJ1A 4L3WA 1ADCA 4C4AA 2C4HA 3TLGA 2Q5JA 4S1TA 1UH5A 3LY7A 1QE0A 5IF9A 2J6CA 4BV8A 4XSVA 3FFAA 1N2CE 3HLTA 5FEMA 5BW6B 4DR7B 4QFCA 1SBNE 4H1HA 3T38A 1Z29A 2Y1XA 1IYZA 2AN4A 3QMWA 3QVWA 5HRAA 4R54A 1MHTA 2VBIA 4JP3A 5KNCD 5KTOA 3RS9A 1U0BB 2EP5A 1L5QA 4QBKA 1MX3A 2FPLA 4JYMA 4BFXA 3GT0A 2FE1A 2IZZA 4Y7CA 4QPZA 3NWBA 3IKVA 2JBWA 2X3YA 5CYFA 2F67A 2QVZX 5I4IA 2EERA 1NXOA 5A3JA 5K05A 3UUFA 1YZ3A 2J6BA 4HZGA 2GHIA 4HGOA 4K03A 3ODPA 1JZSA 1ZJWA 2FR8A 5DYIA 3UT6A 5IXSA 3J81A 1T8WA 1RZRA 3OZDA 2QG9A 1DQPA 2NV6A 4P36A 4WTOA 5E7MA 1W29A 3OTWA 3ASVA 3QTLA 2IPAB 4JUCA 2Y71A 2ZXFA 4KK4A 2HB6A 1MT3A 2ZYHA 1POWA 4TS4A 1L7BA 3EPRA 1B8UA 1NA5A 4GUDA 4TLBA 3VZSA 3M4NA 1T4GA 3W7VA 4N5DA 2R5NA 3GEEA 4BAGA 4F6RB 1FJGB 4H0NA 3HKBA 2ADMA 4QQRA 1XTBA 4X1KB 2VJCA 4DA8A 1R1DA 2ZBDA 1EJ6A 2HV9A 2RK6A 3EK2A 3L82B 2XUDA 1Z7BA 4G63A 3S2IA 2VP4A 5AI8A 3GEHA 3VPXA 4ZI7A 10MHA 2PKQO 4ND6A 2F43B 1MR3F 4RCVA 1LJLA 1E2GA 2H29A 1IRXA 4U3JA 1V1RB 2LUOA 1PR2A 3DZIA 3GJQA 3AR4A 5LZ4A 1KY3A 1LQUA 4LHYA 3QHPA 3TUZC 2QTCA 3IQIX 3OM8A 2CL5A 2EFYA 5SZKB 3IUBA 5FBRB 1AB5A 1SUWA 1U6IA 1GWNA 2H63A 2IYQA 3FBGA 3I5AA 5CJPA 4YRLA 4YS6A 3RS0A 4HAUA 3UGJA 4KFCA 1FYEA 2FFBA 2YFKA 4XASA 5ALEA 5TGTA 5AKYA 4D6YA 1AK2A 1UKVY 4WBSA 4DWJA 1DGQA 4NMLA 2BJWA 4M99A 4Y2JA 3BE8A 5EP1A 2HU5A 4L02A 3DMYA 1EX7A 2ZSKA 4HZIA 5DFAA 1B6RA 4O08A 2QX8A 2VT7A 3A1SA 4YI5A 3ZXXA 5HQ3B 4HDMB 2QTVB 1XHEA 4HAIA 5F51A 3IVMA 1RP7A 3QU2A 5JAQA 3DDWA 1VJDA 3B1JA 3TVDA 2XUJA 4AMUA 4JJ8A 1I14A 3EEFA 1PKEA 4DLNA 3L8MA 4F9TA 1D04A 1TK9A 1HZJA 1SQ5A 1XZQA 3C16C 4W1PA 3E27A 2D2EA 3SZGA 2QY6A 3R2JA 1PLJA 5TS2A 1VE1A 1AMOA 4DGSA 3THWB 4BVBA 3ZE8A 3ONFA 2ZETA 5ITVA 4TQAA 5EIEA 3SBEA 3HKCA 4FQ8A 1I2BA 1J7KA 2R7KA 1U3DA 4Z54A 4URXR 1ILEA 3FUWA 4OHXA 5E8RA 1W30A 3IGFA 2AG5A 2ZOSA 4BQPA 3THYB 2NPOA 1X70A 5CU7A 4ZVMA 2OO3A 3PLAE 3D5QA 2CZQA 5A5VA 2Q1TA 2QLBA 3DOOA 3RAFC 3OIGA 1LB1B 2P5SA 3ENZA 3W3ZB 1H5NA 4Q1FA 1QV9A 2L2QA 1KQGA 2AW3A 4JASB 5GGXA 4PR3A 1UBJS 2OORC 5TF4A 4ZV4A 1CR4A 1HQDA 1YU6A 4CL3A 1G291 4AJJA 1O08A 3FHTA 2UUAB 3WYCA 4FHCA 2YFHA 3LLUA 3RG2A 4JI3B 3GAMA 1FU7A 3PNVA 4WLUA 3D1LA 3EBLA 5ADWA 2DZDA 4EKNB 4BWFB 3GPLA 4R1NA 4FFVA 3NTRA 1I36A 1HF3A 4EEXA 2C1EA 2PUEA 3FX2A 4NATA 2E7ZA 2R7AA 3A4MA 2G0NA 1U31A 1U1GA 1DTEA 1ZI6A 2WJJA 3A4IA 3RRMA 3QKSA 2WYHA 1O94D 2Q0HA 3GUCA 4DDHA 2MOKA 4DMRA 4ND8A 4RQTA 3HDHA 1JZQA 4YRDA 4AG3A 2PH3A 4QOEA 3SSAA 3B7PA 3RSQA 2VDWA 1YS9A 2GN9A 3L4JA 1J39A 4KAJA 5F1YA 5B58C 3D8NA 4MJXA 2BRUC 1RWQA 1SHJA 2XR1A 1T43A 4REQA 4UE6A 3RBXA 1PLLA 1ZN9A 1NPYA 3OEEA 3FUVA 4FFMA 3O91A 3HY4A 1J97A 2YJNA 3LCVB 1M1YB 3BZUA 5D01A 2MR5A 2PBLA 1ZYUA 5JCOA 1CS0B 4M38A 4QUGA 5LQRA 1O9GA 5E4YA 3R8CA 3S44A 1AQNA 2GZAA 4DR6B 1MG0A 2NZWA 2HA4A 2RCNA 2ZB3A 1PFGA 2FLWA 1UKEA 4S1NA 4WLVA 2I2XB 2OFXA 3DE4X 5IULC 1E77A 1L8AA 2EW1A 2JNWA 5HKOA 5JAPA 1VKNA 1AKUA 2J5KA 4GC9A 3GROA 4HS4A 4BPRA 3G89A 2XUIA 2E18A 3EXIB 3K2EA 1FYXA 3KT3A 1JT2A 1JZTA 2HSEA 2BMWA 3DDUA 3ISJA 1ZXLA 3KYCA 3LHDA 4RSMA 5JC8A 2OILA 3Q0TA 4XX0B 1TNDA 2R48A 1RAAA 2GJAA 1M6YA 3A06A 3QU5A 1OU0A 4XIIA 3SSMA 4R1MA 5BVHB 1LPSA 3TG8A 1WXGA 2R1UA 1B43A 3TI7A 1Y3CE 2I87A 3ZHQA 4Q3LA 3WMGA 1AA6A 3LDAA 2ZUBA 3LGSA 2GWHA 4P4SB 1JQAA 4YJDA 1NYQA 4MV5A 4O4LB 2QM3A 2R1VA 1JEOA 2A9VA 2FZWA 3DZCA 2JVJA 1J6UA 4FBLA 3UG6A 3WGQA 1I1QB 2NZ8A 4DA9A 1UBUS 2H00A 3CW2A 1PF7E 3IJ5A 3EWAA 4ZYYA 1J5PA 3OICA 2IEIA 4I6EA 3GGCA 4R9NA 1T3GA 2ZJAA 3KKNA 2WUVA 5KWVA 2D2VA 3FUCA 2WJWA 3G1UA 3NOXA 1Z4NA 5CM8B 3S1AA 5AUQA 3WGUA 1J0CA 4CKXA 2OHHA 5C1IA 3AKCA 4XWAA 4EEKA 3GJ3A 2W93A 5DI9A 3FOBA 3P8ZA 2CYCA 3RK4A 3W3AA 5KWSA 2VEOA 3K9QO 3H9GA 3PUXA 1OFTA 4N7JA 2P9FA 1EGQA 2QMQA 5L6LB 2WAOA 4QPNA 4D56A 4JEUA 3VNVA 3KAKA 4B35A 4ZVKA 3ZWDA 2I3GA 1L7XA 3Q15C 1G98A 4MUHA 2BZ0A 4O3FA 4UUPA 3O4FA 3RIMA 4DNFA 1CVIA 1XKLA 1FFBA 1N9ZA 2IUEA 3AM3A 3IESA 3QUAA 5DRYA 4MW0A 4NQZA 4XKJA 5C34B 3T4UA 1QUEA 1XQVA 3WJAA 3OQHA 2GF2A 4KQFA 4C2BA 3PHLA 3WLIA 1CC1S 1U11A 3D6TB 4ENPA 3M2TA 5E3IA 2VH1A 1NXQA 5I7VA 2JIZA 4EI7A 1NN3A 4CKWB 2MSKA 5FLXA 2BYTA 2WP0A 3OEHD 4EA9A 5HDBB 3LHFA 2AC4A 3QLVA 1KDRA 5ITSA 3CA8A 3F5QA 3PTLA 4ZJUA 3MWDA 3PGA1 4AO8A 4QU5A 3MFQA 3KQWA 2WF8A 5LQJA 3STUA 2JASA 2CGEA 3RSZA 3IUYA 5H3CA 3HC7A 3RCBA 4BE9A 4ZEWA 2ZEJA 4HXYA 4I4TB 2HZBA 3CNOA 3HB1A 1RWBA 1CE8B 1WZCA 2IYLD 1NW9B 4G97A 2JFGA 3ZDZB 2IRWA 1EFPA 2XCTB 4FQ7A 4QDKA 1PR1A 1DS6A 1YRWA 1VZ3A 3LIIA 5ESRA 2H2GA 5DCUA 4EYEA 3F2VA 4N0DA 2JGDB 1D6SA 3DH0A 1M2VB 4F12A 2BI8A 1CW2B 5BW5A 3H1AA 4GGOA 1NVDA 3EGEA 5K2MA 1TK2A 3CVJA 3U7QA 4ZCTA 2XZOA 4JMPA 2H7YA 3TQOA 3VZRA 3VSAA 1L1FA 3M4ZA 4LCBA 4PS1A 3T9FA 1H3NA 1KDVA 3TKAA 5JSZA 2VZ0A 5JVDB 4HEHA 4R8VA 1N1MA 4Y30A 2MJLA 3IDSA 1MQAA 4IWNA 2J32A 2R6DA 3ZGXA 1BS9A 1YKGA 2PU5A 4UPVA 2JLUA 5F98A 1BH6A 3WYNA 2VDJA 3FR7A 1VSVA 1NPTO 2ZRPA 1TYAE 4QJBA 4RAOA 4GOMD 4DUYB 1M6EX 1GN9A 1TT5A 2I33A 3PQ3A 2F4VB 2XUHA 2CY0A 3BX1A 3H5RA 1DCKA 1NBAA 4OEHA 3RF7A 1BFKA 3I4CA 4W5QA 2XRZA 3K6JA 3MTDA 1VC2A 4GKAA 1NE2A 3QEKA 1HFJA 5CA0A 1U0TA 3QPCA 3NTXA 5TXGA 3LQKA 2WQZA 1BU8A 4JYAB 4WNAB 1PJQA 1KQNA 3V5NA 5DTMA 1RFLA 4LBVA 4XVRA 2QP3A 3P4YA 1IFXA 5BV8A 3OJWA 5I45A 4N0QA 4B6OA 1V8FA 2ASEA 3W6UA 1ZGBA 1ZOSA 2OBBA 2JF0A 5JJCA 3OLXA 4M8LA 3SD7A 5EMMA 3EWSA 5IARA 1E9BA 3C85A 2ZSFA 1H9CA 3ETEA 3ONNA 3C3KA 2GLTA 4Q4AB 1RM4A 2AVDA 2A1UA 3BGSA 4D79A 3JZMA 1TB4A 1YC2A 2NU8B 4F46A 1IOZA 5KWIA 3NALA 3TB6A 2XQJA 1X87A 4MB0A 1JYFA 4M1QA 1RKVA 1CXZA 4G5OA 4KWHA 4C3VA 5CH5A 1DIGA 1UQUA 2PZMA 3QELA 4I5DA 4COOA 1YQGA 5C5EA 5AW7A 2DHQA 1N2EA 2ODWA 1W9MA 4GXNA 4FFNA 1NP7A 5HRUA 2MINA 5KYUB 4ZIRB 3HK2A 2QZ4A 3ND9A 1K3TA 2HDHA 3FNHA 2FK7A 2VTDA 5K3AA 3V2GA 3DC7A 2DUJA 3TUIC 1J8YF 4N18A 3C45A 2OEPA 4MKRA 2Y67A 3K6SA 4EVSA 1EZZA 3OZTA 4GP6A 4EL0A 2WQ7A 1J5EB 4FGLA 4LSZA 3V1KA 4BNMA 1EUDB 3VYVA 3MF4A 3U4MA 3ENKA 1P5HA 3S2YA 1ZZGA 2CCKA 3NANA 2QYOA 4GH5A 3DW3X 2BSAA 1NZJA 4QULA 5HIJA 3ROEA 4DIUA 3DYBA 4L0MA 2DWOA 4Y9SA 5D7NA 5DV9A 2Z57A 5GONA 4WNYA 2XF8A 2X5JO 4FCCA 1C1YA 1X2EA 4UCXA 3TCNA 1AM4D 2J3HA 2OXFA 2QD4A 2IT1A 3OM0A 3RTDA 2C7PA 1EFAA 3B38A 3O6VA 5D84A 2O3TA 2GM9A 3DW1X 4EW2A 4GI3A 1TZKA 4L5JA 2BE7A 3L9XA 3IEMA 4HDRB 1OU4A 1C8VB 2AZTA 4MNTA 5FV4A 2FZCA 2JJ2D 2PR7A 1L4YA 2V98A 2JAWA 4IIUA 4JVNA 4GVPA 5BWNA 1EU1A 2X9GA 3ZWYA 4LNHA 4EF4A 3OX2A 1P3JA 4MUFA 4D25A 3KOMA 4ILKA 2AC2A 1UAGA 3RFVA 4IILA 1J25A 4N47A 3T9EA 4BATA 3Q8KA 4RDIA 2XRMA 4QO7A 4UU0A 3DYIA 3A2KA 1NNI1 2MSEB 3HJNA 4FGJA 2GAOA 4R16A 5TF0A 5D87A 1OI2A 3G2NA 2JLWA 4PRKA 1WF6A 1G8PA 2RHJA 4U2CA 3GLGA 5CUQA 1FYDA 2MR6A 3E6AA 1ZK0A 3CZAA 5GY7A 4ZOLA 1H05A 1GKKA 2QVBA 1LC0A 1SRQA 4XFDA 2EKDA 4DIFA 2H54A 4RZHA 3EVGA 4BZWA 4OXYA 1PR0A 1W48A 4FR2A 4K2AA 4MVJE 2WZCA 4TYWA 2EF1A 5D3ZA 2E37A 4PE5B 4I08A 4P3XA 4YAGA 4NKRA 4DBZA 4LBWA 4WA8A 2A9RA 4UHJA 4DCSA 1TTTA 1MCZA 1N8NA 2X22A 4NYMR 1MRSA 2PVPA 3L07A 1ZKDA 1MX1A 2AH5A 5TB5A 2MSDB 2C2OA 5LKRA 5BYBA 4R9VA 3RAJA 3RT7A 3FCEA 4RACA 4Z4CA 4Q4HB 3K9NA 3JPYA 3U61B 2O9JA 4HO1X 2CMDA 2CNBA 2HHJA 2V4MA 3R5HA 4GI5A 1UJ2A 2CNDA 1XCOA 4UBNA 1NQOA 2B7LA 5BN4A 2BFDA 3M8KA 4ML3A 3O0DA 4MPPA 1KL7A 4BEVA 4ISCA 3WYFA 2F7SA 2PUWA 2X0RA 1SOMA 5ICFA 4YUVA 1YRLA 3H99A 4F2DA 5CBKA 2VJAA 4ADSG 2WF9A 2R00A 2WFZA 5GAJA 1JDNA 4JJGA 3SS7X 1J9EA 3LQ1A 3GNSA 5H70A 1J0AA 1PGQA 4J16C 5FPKA 5LMNB 2HU2A 5K3BA 2YV1A 3NJ4A 5GTDA 1FB5A 3OZXA 4MO9A 5AKIA 5EWLA 1UAYA 2ERXA 4RULA 5TPWA 1O0CA 2JJQA 3QE3A 3UWMA 1QE5A 1II8B 1T2NA 4P4LA 2J6HA 2ERYA 2X5KO 3S7TA 3W5IA 3LZCA 4JJFA 3KD3A 5AKZA 3REGA 2JLVA 4DB2A 3WIVA 3AYXB 4C3ZA 1EDZA 1ZESA 3ZIAD 2W98A 5C7OO 3ORSA 1KWKA 1MJHA 1PSWA 1X94A 2LCFA 1DQSA 4E32A 2WF7A 1VPWA 2VK8A 4MIOA 3SHFA 4PPQA 3G0IA 3FCUB 1GZVA 5L51A 3A1WA 3JQAD 3QU9A 1E3WA 1UFVA 2GK4A 3HYSA 1HE4A 4NS4A 4BBJA 1GTSA 4OI2A 3GCGA 1BKYA 4ND5A 3C5WP 1PSZA 5CIQA 1B15A 1K0FA 3TZLA 4QJ3A 3M4XA 4YCSA 5DGDA 1I2CA 1X8LA 5DHUA 3SQLA 3OUUA 3OTOB 4J8PA 5AW9A 3ICVA 2PZKA 3AGQA 3EXHA 4TV8A 2Z58A 3O8OB 4ZDIA 1TF2A 4KE7A 2FW6A 3NRJA 3O3NB 3WNDA 2R8ZA 2BZ1A 4AICA 2WG0A 4RCYA 3LX4A 1DOAA 3IVXA 3AHCA 3KVYA 3OLYA 4B3DA 2VVTA 3UCEA 4O5OA 2LXNA 1N3YA 2J0UB 4I3GA 4B7XA 2X6RA 4RGVA 4BO1A 5HZKA 1ZD2P 3DD5A 2DFTA 3V6LA 3RC2A 2FFHA 5FIUA 1O6GA 2EEPA 3B6EA 3I2JA 3DCIA 4YAOA 2XA9A 3UMFA 3MJCA 5EZ5A 3ZBUA 4G1FA 3WL6A 5JASA 4ZMRA 2JJYA 1F2UA 5IVIA 2D1SA 4DG8A 2EKBA 3OPMA 1ANKA 1XEXB 1M33A 2XTJA 2EZUA 4RMNA 1KO5A 3A31A 2PL9A 3CIFA 2PNFA 2R60A 1USVA 1SR8A 5F9MA 1MZPA 3BMXA 3OOYA 3IKMB 3D02A 4WVFA 3IQXA 1JQ3A 3GGOA 4TV9B 3R0JA 1SOUA 4KFRA 1PK7A 4GX1A 1I7SB 2GTPA 4WZZA 4JP8A 4G0OA 3GT4A 1X7WA 4JB2A 5GZ1A 1OOEA 1VHLA 4I55A 3KHTA 2O7VA 3OZ7A 1QYDA 3JV7A 1RJWA 4EG7A 1P62B 4PHTA 3REQA 1NOKA 2VZ8A 4U6SA 3FVVA 2Y9MB 5EUCA 3HU1A 3ST7A 3SBOA 1KO7A 1U98A 4KLCA 2V96A 1RFGE 3EY9A 4C4ZA 2HRRA 2K5UA 1AO3A 3QOFA 1PYDA 3J7TA 3U3MA 3RUDA 2BFWA 1UAAA 4NAUA 3EIXA 5IM4F 1V47A 2DUWA 3PYXA 3VNUA 1KO8A 1T0JB 3E5RA 3O1LA 3QUSA 4QAQA 1C5KA 4QLOA 4ETIA 4GPTA 5JD6A 4RNCA 1MQ8B 1UDWA 4PPFA 4EWLA 2B1IA 1TOAA 3BZWA 1GRQA 1W49A 1K6MA 3B1ZA 3N75A 4KZPA 4QL3A 4D9CA 1W47A 1Q0PA 1YDGA 4D5GA 3F96A 2NSYA 3H13A 5CDUA 1GU1A 3O4HA 4IH9A 4N7BA 4OFXA 1AQ6A 4KNVA 3WMFA 4A0HA 2R4TA 1NBWB 4UBMA 2P78A 3OIVA 1LPNA 1NKVA 2V1XA 4LDNA 4LRXA 1FJXA 1DKUA 4YAJA 3GEPA 2DB3A 2W37A 4AZWA 1NJ2A 4B2IA 1MB3A 3D3WA 1MG5A 1WQ1R 3A1NA 5ARBA 2D2FA 3FOFC 1W8DA 1Z0JA 3UIEA 3O75A 1KMQA 1ONNA 1VP3A 2WF5A 1AQUA 4IFTA 4PCUA 4UHDA 1RC0A 1FP7A 1P2BA 4QUJA 4UCQA 2VDOB 4ZYZA 5DNCA 1TM1E 3M81A 1QDEA 4RV4A 5FBLB 4E3ZA 1NVEA 2AEMA 3NVMB 4EI2A 5EFOA 1TPYA 1HYHA 1CQJB 5AI5A 1YUNA 2WRZA 3H5AA 1T0IA 3AG6A 2O1WA 4K0KB 4L7QA 3KO8A 1PUIA 4OMUA 4AJPA 4ZD6A 3SX2A 4C07A 3AVVA 1W75A 1MMFB 1STOA 4M1MA 4X00A 2ATVA 1IZ9A 2C7OA 1Q7GA 5D5HA 4LXTA 4PCVA 2XUOA 1DMSA 3GFPA 2XUGA 4UAJA 4WMLA 2ZYRA 3ABZA 4TWRA 3H9QA 4MJ3A 3TRJA 3V00A 3I1JA 3UJDA 4PBTA 5MN4A 1T5HX 4ZT6A 4BEJA 4CJXA 3A4LA 4H3SA 3AJDA 3MQFA 4QGSA 4YQEA 4YCCA 3H19A 2XD9A 4RMIA 3ZI0A 3PUKA 4HVAA 2VHEA 4COKA 3BDAA 4M0MA 1YB5A 4FGUA 3MUOA 1IJKA 3KVOA 1E2UA 3K31A 3P32A 3T06B 5ALKA 1MOZA 1EE2A 2CDBA 3FOEC 3G85A 3RTGA 5EJAA 3BTVA 1GCAA 2R6ZA 3T4PA 2GCEA 2RE8A 3PDHA 3FWHA 2P91A 3FNGA 1T8RA 2JHCA 2LGJA 3NDJA 4FDAA 4RY2A 3LFUA 4BBAA 1F48A 2HJRA 2P2GA 5HVNA 3HYCA 5DT9A 3F78A 1LI4A 2IOFA 1TX4B 3THWA 3RSGA 4RW0A 1GADO 4EX7A 5JADA 3PNMA 3HHEA 1Y5RA 4MRRA 4OX9Y 3FPBA 5BQOA 1SZPA 1T4CA 2YJ3A 4YP6A 3RR2A 4LE1A 4G36A 3ZJVA 2OE2A 3AK4A 1CEYA 3HR8A 2YXLA 2X1MA 4G56A 3E9EA 2CLIB 4UAVA 2UZ1B 3H04A 1U7DA 4GRIA 3E22A 4EZBA 5D3MA 1BWPA 1P4AA 4LOKA 3AY3A 1JA9A 1F2VA 4BVKA 3OCWA 2F3UA 5D5PA 3RRFA 5G4KB 1JBKA 2QQFA 2IYPA 3NPMA 3PQEA 5HIMA 1DHTA 4BVHA 3D7KA 4IF4A 1JR3E 2QUBA 4N39A 4UHFA 5EZSA 5KI6A 1EFTA 3ADOA 3H5LA 3OZIA 1QZ3A 1K8QA 3B3JA 4K5QA 3A2LA 2DHRA 4F0JA 2G1KA 3WSWA 4Z7QB 4UDNA 4KPUB 1JEYA 2AQHA 4HPWA 4IM7A 4KHZA 1V16A 3BREA 4OFBA 2I62A 5DM70 4PG6A 3HMQA 2XE6A 4F5YA 2YN4A 5EGSA 3ZLTA 2ACVA 3HVRA 3D0QA 3FNQA 4BNHA 3W77A 1T6XA 2X5NA 4GUAA 3BRWD 1HR0B 2IXFA 2CWWA 4LW8A 1AN9A 2GN8A 4HFMA 5KAPA 3IEXA 4JV5B 2AI2A 3A6LA 3NWOA 1KAQA 5C5IA 1HNXB 1IN5A 1RYHA 4B2LA 1OHHA 3E3NA 1TYZA 1DKQA 2WUDA 4I5EA 4QHSA 4MQLA 3DMHA 1Q3HA 2RJOA 2DQKA 3OVMA 4I81A 4KAAA 4B3BA 3ON5A 2YCLA 5UKDA 4FYVA 1BWRA 1ML3A 1T0HB 3C24A 3D6NB 1AUQA 1UC5B 5DM4A 2WJZB 4OB7A 1E3JA 1W44A 2AK3A 1WP4A 2IYXA 2PKEA 4QT0A 1SXQA 2W9XA 2VYVD 3CZPA 3RIXA 1JP7A 3K09A 4PICA 2IDZA 3DT8A 2OHIA 4M4SA 3WL5A 2OORA 2HTFA 2GD6A 1R2QA 3L84A 4X1YB 5BT9A 1OPXA 2BE9A 4M55A 2WTMA 4OAOA 2YWCA 1L4GA 3IV7A 3R7FA 2FZEA 3ROTA 4B46A 4WW0A 3WKDA 4Q18A 1GNTA 1LX6A 4YRZA 4IV5A 2C98A 5FTLA 2ORED 5TS3A 4C7MA 1Z2NX 4LHVA 3NJRA 4AJ1A 3BWXA 1OBVA 2LBPA 3DCJA 4OXNA 2QUJA 4JZKA 2JLXA 3MRXA 2RGNC 3W90A 2Q1UA 2BKEA 1RYNA 4ZKDA 3ROMA 3HN7A 3I3OA 1NRJB 4KXFB 1VKRA 3PJFA 1CIPA 2BVNA 3RNOA 1K63A 2Y1CA 1ICIA 2R2AA 4JUBA 1CLUA 1HT1E 4MHTA 4OHMA 3LDFA 4GDFA 3T7KA 1GYRA 3ZGLA 1Z0DA 3AX6A 2VDNB 4TKZA 1B8OA 4EKYA 1HC7A 3EDQA 5DLYA 2XGJA 3M3HA 3LUPA 3M9XA 2ZSAA 5TPWB 4DKJA 5HKLA 2WHPA 4QUBA 3OT1A 5H9VA 4EJSB 3R5TA 3BE6A 3M6IA 4C7BA 4RWEA 1O4WA 2QJTA 1SBIA 3IQHX 3I39X 1U4SA 1Y1KE 1QHSA 2JJMA 3CUUA 1IZ7A 2R8RA 2WSBA 4JT2A 1BXGA 1YA8A 4GOND 2ZP1A 2VLBA 3HKEB 3ZQ4A 1ZSVA 4DV6B 1OXTA 4HAXA 1I80A 4H31A 4HRAA 3P0FA 4I7EA 1YUMA 3BWMA 4OQPA 3DLBA 4F8JA 4QXOA 2NVUB 5G0UA 1W85A 3NNNA 4FHZA 3DE2X 1SVSA 1UXGA 1M5TA 3RGWS 5KOHB 4DWVA 2FVYA 4FFLA 3BFJA 4HEA1 4AQDA 1VFPA 4C5CA 2ZUUA 4HGQA 1COWA 1SBTA 2FAXA 2EATA 1ZU4A 1SEPA 1N5MA 2C2ZA 3QXGA 2PX4A 4NBRA 3UJPA 4BNGA 1TUBB 2JJ8A 5K6TA 3S4YA 2UVPA 2L19A 4DWWA 2ZRIA 1W2GA 1Z5WA 2XZPA 3QVTA 4JU9A 4OY3A 5PNTA 2OV4A 3ZTTA 2XSZA 3I01A 1JVSA 1CUAA 1S8AA 1V39A 2VAXA 2V97A 4FT4A 1NNSA 4H2DA 5I9SA 2WSYB 5KYWA 1XZ8A 4S2EA 2H1OA 1I24A 3HCOA 2VZ9A 1JTFA 4X20B 2X23A 3OPXA 2HIMA 2QW1A 1C9NA 4L57A 4WAUA 4F7WA 1N2ZA 2QBYA 1HYBA 2CNWD 3NRCA 1TQ6A 2NQ8A 4EHNA 4Z3KA 4AZ3A 1N2XA 2A4KA 3RFFA 5DM1A 3IOCA 4DIDA 1JQBA 3AH8A 1HPLA 5C9ZA 4PZAA 1ESDA 4Y2QA 5BNIA 2N9UA 1I3KA 5LP6B 1LTQA 1UWLA 3TQFA 1HMYA 5FL7D 3VV2A 4B87A 5EJ9A 1XTIA 3GN1A 1P1FA 1XZKA 3DM9B 1V4NA 3C1TA 5FL7A 1V1MA 1P5JA 2QKYA 3VJKA 1CB0A 3A6HA 3CF6R 1TT7A 4NBLA 4R83A 2FHPA 3M0EA 3CR7A 4QQFA 4XR4A 2B9VA 1QANA 3AERB 3HCNA 1ST2A 4GPAA 4FN4A 2ZBEA 4Q4LA 3MJDA 4KN6A 4CIDA 2G36A 2CL7X 4NHEA 4DMFA 1PV2A 3IAEA 2ZRNA 3BRSA 4BLWA 1WTAA 2GNAA 3I83A 4WZBB 1NX9A 2JH3A 1WHSB 1H0KA 4BZPA 4WCVA 1CEXA 4RJKA 2QVYX 4J3NA 1XC7A 5HW0A 1BC5A 1YL6A 2WIAA 4FEAA 1MJGM 3BC1A 4JXJA 1EEHA 1WF3A 2GT1A 2YV3A 5ELMA 1MGOA 2C5BA 4UASA 2AI3A 4HDNB 5DXAA 3MGAA 1YKFA 1FYFA 4NXNB 3ZNPA 3QTBA 1NRWA 2G7ZA 4MS4B 3ZGZA 3FGNA 3TW8A 2R8BA 3T7AA 4M2LA 5JS7A 1QRTA 3NTLA 1RYZA 5IDYA 3SC2B 1FY2A 4E4YA 1TCVA 2Z56A 3LNCA 1RLOA 1DO8A 3LC1O 4B82A 3L8EA 2RD2A 4V0NA 5EP3A 5FI1B 4XGNA 4NIMA 2O23A 4L4SA 3OZAA 3O4GA 5ALTA 1W76A 4M76B 3W3AD 4ZZ3A 4A10A 3HN2A 1E2EA 1LQ2A 4O4JF 3ZHTA 4BO5A 2DFDA 2PFSA 1RAEA 2PZEA 3HN6A 4GQIA 4LQDA 4WOKA 3DDNA 1BVYF 5AOCA 2GF0A 3EG5A 1YNSA 3NAQA 4IDGA 1XZMA 3WG9A 1O97D 2QE7D 5KDOA 4BDTA 1Z38A 2DPMA 1ADJA 3CNLA 3CUKA 3QU4A 3RARA 3B60A 4Q37A 2A33A 1DQZA 2BI7A 2WT8A 1CVRA 3HCAA 1J2RA 2YYSA 3NM5A 4DEVA 3IA7A 4Y2UA 5EMJA 1OB2A 2V6JA 5I7SA 1QO7A 3QH4A 2A9FA 4RZIA 3U56A 4KRXA 3KCQA 1EWQA 1XMJA 2LE0A 4RABA 5BUCA 5AKHA 3W3AH 3HADA 1JDJA 1SD2A 1NGSA 1H5UA 5B1HA 3K9GA 5IDQA 4GLJA 3L9WA 1GZ4A 1YJ8A 3HB7A 1TAHA 1XQXA 2JCSA 1OZHA 5IMBA 3GLFA 1XRMA 3EVCA 1SCNE 4XARA 2FZKA 2HCRA 2XGGA 3E81A 4K1LA 4OKSA 2FMH