4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cholinephosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
2IP1A 1DNPA 1IRXA 2WSIA 2DUMA 4MW0A 3HZRA 2Z09A 1K4MA 2PG3A 1NUPA 3IVXA 3TZLA 1F7VA 4FZJA 1FFYA 3MUEA 5H16A 4MW4A 5HUHA 2A1TS 1KQNA 4MW5A 2CYAA 2CV1A 4A91A 5FO0A 4ZCRA 1B6TA 1OBCA 4GRIA 4EF6A 2BTEA 3UOWA 1IQUA 1WZ2A 2DXIA 3IODA 4MWBA 4ARIA 4GU5A 2JANA 2E18A 3S3TA 4L2IA 1HYBA 3ZXSA 3KT0A 1IVSA 1J20A 4YP7A 2YY5A 4ND6A 4MW7A 1KP3A 3ND5A 1TFUA 5H7XA 1WXGA 1EFVB 4JZYA 1NI5A 3QTBA 1TYAE 2CYCA 3SYTA 2X0KA 3RBAA 1MB9A 4MVYA 1JIIA 3SEQA 2QUHA 2CUZA 2PIDA 4J76A 2WQ7A 4HPWA 1JHDA 3AIIA 2X1LA 3HFJA 1F9AA 1EE1A 4S1OA 3ZUGA 1H3FA 1U3DA 4OUDB 4NAUA 3DV2A 1NYLA 1U3CA 4JXXA 3VGJA 2E89A 1GZUA 5K0TA 1X6VA 4MW9A 3FOCA 1EFPB 4MWDA 3RK0A 3PXUA 3CVWA 3FI0A 4AQ7A 1QRSA 3ZXIA 2DERA 5K0SA 3LCJA 1M8FA 1QQTA 1IFXA 1KH1A 4UZFA 4ZT3A 4JFAA 2BYTA 2GOYA 1EXDA 1K92A 1O6BA 1TQ8A 3P0HA 2DEUA 3UMVA 1EFVA 3PNVA 3ZIUA 1JGTA 2J08A 1V8FA 4EG8A 1S4MA 4R2MA 2Z08A 4YMIA 3OP1A 3G59A 3P0IA 1OBHA 5KHAA 4ZT4A 2PZ8A 1U7XA 4OUDA 3KT6A 2RE8A 1N75A 1IQ0A 2QJOA 3RJZA 1MBZA 1WY5A 1NZJA 4NX2A 4CT0A 1I6LA 1WJGA 4I6GA 1QRUA 1EFPA 3IH5A 4F4HA 3QTTA 1O0CA 1GTRA 3IOCA 2OV4A 4DDMA 3AG6A 1G8GA 1ILEA 3ZJTA 1M8KA 4ZT7A 4MW6A 1QTQA 3H9BA 2A84A 1F4LA 1GTSA 1N3LA 4TS1A 5AHWA 2A7XA 1O94C 3CLRD 3MXTA 3BL5A 1KH2A 1EJ2A 4ZCQA 1JEEA 2VXOA 1KORA 4NATA 4ZCPA 1JMVA 4ZCSA 1IQRA 3FWKA 4JYZA 2A1TR 3NV7A 2DETA 1WXFA 3KT3A 5KWVA 3MLBA 1LI5A 2CFOA 2J09A 5DK4A 2H29A 4XFJA 1N77A 3GLVA 3ILVA 1NP7A 5TEVA 2V0GA 3IMGA 4OJMX 3CVUA 3CLTC 1T6XA 3UK2A 2CYBA 1PFWA 1N2OA 2A88A 3CA8A 3PRHA 1NUSA 1MAUA 4MUFA 1YULA 1PG0A 1CT9A 1J70A 1NUUA 3H05A 3IUBA 3IUEA 4RUKA 4MULA 4EG7A 2XRZA 4MUGA 1M8PA 1WXIA 3FETA 4G5FA 1OWMA 4P2BA 2WB2A 4KR6A 3HMQA 4MW2A 1VBKA 4CDNA 1KAQA 1JILA 4RPIA 3IMEA 1T6ZA 1WOYA 3CLSD 3GUZA 5BNZA 4MVCA 2JAXA 4YP6A 4MVWA 4EG4A 3TS1A 5KCMA 1LW7A 1N78A 3CLUD 4I6EA 2D54A 3COYA 3U1VA 2RD2A 1X8XA 4ZCTA 3X1KA 2NZ2A 1OWOA 2PXHA 2YWCA 2QTMA 3H97A 2IELA 5LFAA 3CVXA 3SDBA 4CQNA 3FDXA 1WXEA 3CLRC 3CVYA 1FYDA 1QU3A 1H1TA 3IVCA 1O97D 2G36A 4NDAA 3H9CA 3LOQA 1YIDA 3AFHA 3MMXA 3INNA 3AL0C 4PBRA 3C8ZA 3N2YA 2O5RA 4MUHA 2AKEA 3PNYA 1YIAA 4XSVA 4KKVA 2XRYA 3N8HA 3IOEA 3VU8A 5TGTA 3X1MA 1VL2A 4DLPA 1M1ZA 1M83A 1Q15A 1QJCA 2J5BA 3TNJA 1COZA 1N1DA 2YWBA 4R0NA 4DDKA 1G59A 3RFFA 4KR7A 1IH8A 2WQ6A 2EL7A 3A05A 3D6VA 1PFVA 4MUKA 2HGZA 3COWA 2A86A 1IHOA 4MLPA 2O8VA 3L92A 2A4MA 2QTNA 4UZEA 4MUJA 1ZUNA 4K0RA 3G6KA 5HUJA 1NURA 1O96B 1H3NA 2NSYA 3COVA 1EUQA 1G8FA 3SP1A 1I2DA 2YXNA 1KP2A 3Q4GA 3FY4A 1V47A 3CLSC 4MUNA 1VBNA 1PFUA 1XJQA 4CDMA 1Q77A 1N2JA 4G6ZA 1YUNA 4MWCA 1O95D 2A1UB 3I05A 1KR2A 3P52A 1VBMA 3E27A 1I6MA 1NUTA 1GAXA 1JZQA 2ZUEA 1O5TA 3DLAA 4U63A 3FH0A 1J1UA 1Q19A 1ZH6A 3AG5A 1EUYA 4QBTA 3X1JA 3ELBA 4YP5A 1Y42X 3SZ3A 1G8HA 1PFYA 2QUJA 1WXHA 1KQPA 4G5YA 2CT8A 3QE4A 3F3MA 2CSXA 3L93A 3KFLA 3FHJA 5TEWA 1T9GS 1R6XA 4KPUB 1BS2A 1QNFA 4MVXA 5TS2A 2Z3VA 4Q93A 4NZPA 4NAHA 1KQOA 1T6YA 4JXZA 3G5AA 2HMAA 4PY2A 3A2KA 2EJCA 1JECA 1VLHA 2OQ2A 2PFSA 5FNZA 1PG2A 3SEZA 4E1AA 2QJFA 3HL4A 3ISJA 1KKUA 5DEOA 3N9IA 4MAFA 3TQIA 2VTBB 1J1ZA 5IHXA 3NBKA 1JZSA 2DPLA 2J07A 3IMCA 1GLNA 3D6UA 4HJXA 4ZT5A 2X3FA 1O0BA 3ZJVA 1OWNA 3TZEA 3AKZA 2A1UA 1XNJA 2ZUFA 4HK4A 5DB4A 3SZGA 3LE8A 4EG5A 3JXEA 1ULHA 1MOPA 3UY4A 1O95C 2H2AA 2AZXA 3KT8A 1K97A 1MB2A 1ZH0A 1N2EA 3GMIA 1MRZA 1XNGA 1D2RA 4QRDA 1WQ3A 2DR2A 1LI7A 3IVGA 5DASA 5EKDA 2E0IA 5F23A 4KPUA 1K4KA 1TYBE 3A04A 4Q16A 1JIJA 3ND6A 1SURA 2TS1A 3TQOA 3A4IA 1N2HA 4MQ6A 2C5SA 3DO8A 4ZT6A 3ZJUA 4PBSA 3COZA 2J4DA 4I6JA 3FIUA 1WQ4A 1N2BA 3IDFA 2DLCX 2VTBA 1TEZA 4F3RA 1MAWA 3FG9A 4BWVA 2QUIA 4DNXA 4XFDA 2CV0A 2AG6A 2D13A 2CV2A 2IJGX 3UC5A 4EG1A 1MC1A 2HZ7A 5J5AA 1JIKA 1UFVA 5J58A 3OTWA 1Q11A 3PNBA 5HG0A 4EG6A 4WNYA 1J09A 3M5WA 5FO1A 4U7JA 4WSOA 5J59A 4AS1A 4EG3A 2QJTA 1P7PA 2GKSA 3DPIA 3P0JA 1GPMA 5IJXA 1N2GA 2GM3A 3HGMA 3K9WA 4PBTA 3CVVA 1M8JA 1O94D 3Q12A 1U0BB 3H99A 1I6KA 1QU2A 1QRTA 4DJAA 4DE5A 4MUIA 1OD6A 4YBRA 1NUQA 1YUMA 3MLAA 4HJRA 4ND7A 3IOBA 4MUEA 1NSYA 1MJHA 1YI8A 5JBNA 3NBAA 4EGAA 4ARCA 5LM3A 2PZBA 3CLUC 4MW1A 2B7LA 4R2LA 3ZGZA 1ZJWA 3CR8A 2D5BA 3CLTD 4U8HA 4H3SA 1T9GR 1XNHA 2ZP1A 4X0EA 1U7DA 3VRHA 1R6UA 1JEDA 1M8GA 1O97C 2X1MA 1GN8A 3K32A 4KR9A 2JA2A 1R6TA 3RK1A 1H3EA 2E21A 2PZAA 2QUKA 1TYCA 3N05A 4DDHA 2R5WA 3HV0A 2QTRA 1OWPA 1OWLA 1KH3A 1A8HA 4L2IB 4ZT2A 3FNRA 4QREA 3Q10A 1N2IA 4J75A 2V0CA 1KAMA 1O96A 3ND7A 4EFKA 1WKBA 1RQGA 3RHSA 1J21A 5LLTA 1F7UA 4K03A 1TYDE 4MWEA 2I1LA
chains in the Genus database with same CATH superfamily
4QTXA 1VIDA 5F76A 2HTEA 1HETA 4G09A 1QVRA 4JWKA 2GHTA 1INLA 3FPLA 3U4DA 1FW8A 5JSUA 3UK0A 4H1TA 1Z5PA 3UGJA 4QLAA 1ZO8A 3HZRA 5A02A 2QL6A 1HZZC 1N9KA 2DFNA 2YDYA 3IYLW 1O5OA 4FZJA 1FFYA 2QNBA 4LJKA 1KMHA 2AR9A 4NJMA 3M83A 2VJBA 4OVKA 1CUSA 3M2TA 1BJTA 3PQ5A 1SVOA 1DV1A 1B1AA 3FUUA 5DHUA 3WGYA 1QAMA 1DKNA 1XZQA 3EIOA 4BFVA 3QOFA 4XUCA 1GNQA 4OHCA 4D25A 4OHOA 3QOXA 4Y1RB 1IU9A 3KLOA 4BNZA 5KJ1A 2HQRA 3ESDA 1UBGA 2YXLA 2PGAA 1Y9AA 3BWVA 5CA0B 2IE8A 2O20A 3W1WA 5CPBA 3I6IA 2CXHA 6REQB 4GZMA 1YJQA 2AJCA 3BSYA 4P5EA 2C3YA 3K8QA 3OFJA 3RVKA 2AH5A 3PICA 4A5OA 2RGNC 1SZDA 3M5DA 5B3JA 4MEJA 1OH7A 4KO3S 1TRHA 3S44A 5C32A 3KSMA 3DAPA 4D3ZA 5CD9A 4IGFA 5FA6A 3MS7A 2XCSB 4I1RA 4J3FA 4UUPA 1PR5A 2ZK7A 3PNPA 4PYQA 3NHWA 4H7IA 1L7DA 1AE1A 2E87A 4BAUA 3IKMB 3VA7A 3L7KA 3EFHA 4BBPA 3PKIA 1XGKA 3LP5A 1K75A 4ZQGA 4AKHA 2WQ7A 1SVWA 3ANLA 3NCHA 1G7SA 5EIHA 5JSFA 2IS4A 1RYNA 1E1QD 1T5SA 1WPGA 1XFDA 1Z8HA 3AIIA 4DNFA 2BM8A 1U3DA 1ZVKA 2I8AA 3MW8A 3BRWD 3OQ6A 3L8YA 4INAA 3DV2A 4A9AA 1IVNA 1PNOA 1P1JA 2QRJA 2ZUDA 5GADl 2POQX 1QFXA 3ESYA 2WQZA 2EKDA 4URVR 3EZ9A 3UJAA 1XKTA 2QVBA 3CMCO 3HACA 1Y5MA 4YUWA 3ILHA 1GL6A 1W0CA 1YCGA 3ABQB 3CEPB 3QU7A 1L7MA 2AFIE 2PD4A 3ENNA 4PSUA 4TMFA 2GILA 3P1JA 5AKLA 1U1EA 4DG9A 4NBLA 4UOQA 2IOHA 3FSEA 2IOYA 5JEEA 3DE2X 4M1QA 3HB0A 1DFGA 2Z8XA 5DISB 1SD5A 2EZ4A 4LPSA 1XLWA 4QHTA 4F97A 3B9QA 3DF7A 2R0QC 3DAOA 1KEVA 3K31A 2IEGA 3CPEA 4M1KA 4OCZA 4XTCS 3ZG6A 4KXVA 1OOEA 3NHYA 2VP4A 4BO3A 1V25A 4LZZA 5ILOA 3VDMA 2YX1A 3PI7A 3CJTA 4G9BA 5EWLB 3D6JA 1FSPA 5BT9A 2ZBUA 1OFIA 3MTBA 4YLEA 4HOYA 1YA4A 4JELA 1IBMB 1TM5E 1TTPB 3GZTB 3H5OA 4O4IB 4D46A 2X1HA 5IWCA 1VPEA 3LOUA 4JKIA 2LWIA 4CU2A 5HFAA 5BMVA 3GN1A 4X6XA 2FW6A 3U3KA 4V1CA 2LR0A 3PPVA 2EHJA 2X0DA 5F73A 4KO2S 3W9UA 1BW9B 1JUDA 1VPTA 1F3LA 3HBFA 3IA7A 1IAVA 2PZ8A 5BWCA 3RVRA 2XCOA 5TRTA 2EFCB 3QYFA 1U81A 1HYQA 1XDBA 1VTKA 2VYQA 3GH1A 4JYMA 2NNWB 2QXTA 3H42B 3REQA 5D3MA 4AY4A 5CCEA 1YNSA 3LJKA 3UWSA 4AIRA 3A36A 4AWAA 9ABPA 2IUTA 1ETHA 5CFLA 4FKZA 5AKJA 4WK0B 3N53A 5IYZF 1ILEA 1T13A 2H9IA 2WV7A 3KU1A 3M6UA 2I99A 4PGAA 1PJ4A 2O8BA 3AXSA 3WLIA 1QHYA 2VT7A 4DW8A 4TKVA 5A9SA 3GRCA 2PL5A 5E4YA 4BGIA 1ND6A 3A6KA 1PNQA 4MMXB 4XSGA 1V4NA 3NBXX 4L4ZA 4QLOA 4WVLA 2ZWIA 4U6NA 4NU0A 2A5DA 1E5LA 2ZZKA 4K6GA 1B76A 4YCDA 1J0DA 1Q1QA 5JNLA 3TG2A 3RASA 3PNLA 4FVTA 2X7JA 3KEGA 1PEDA 2GJAA 1SBHA 1S8AA 2RI0A 2HEGA 2QRZA 4JJKA 4MSUA 2XV1A 3K2EA 1PR0A 1KIMA 1S01A 2M2IA 2QLLA 3GUUA 1HEIA 2W6ZA 1AKUA 3NRCA 1VYTA 1FL9A 1PJQA 1X0XA 1O9HA 3HA2A 4IQFA 2FKNA 3WKBA 7GPBA 1SHJA 1NKSA 4TSKA 5E6UA 4ZI7A 5EZ6B 2R6AA 3KL4A 3V1LA 1O4VA 4E4TA 3DBRA 1GZ6A 5KQLA 1R0CA 2A0WA 1TMYA 3U16A 1V1RB 5C2JB 4FZVA 3SZOA 2VXYA 2WZQA 2PQ0A 3QKSA 2X8WA 1CJBA 4TPKA 2G5CA 1MAUA 3A31A 1YULA 5EMKA 1FJ2A 3BZBA 1M2OA 1A9PA 4S1NA 4HWOA 1NQVA 4MKHA 4EF4A 1O5IA 5J5VA 2TSYB 5ALNA 4EF5A 2WB2A 3DEKA 5HRUA 2A57A 2GPSA 3UT0A 4BO4A 3EZ2A 1Y9JA 4C4XA 3EODA 1LGYA 5AVYA 3FDFA 2HXSA 3BD9A 3QX8A 2OMKA 1A8PA 1C80A 1RZRD 4MVCA 4D8XA 1SD2A 1T8SA 1WKCA 1OXSC 3RVJA 1WBDA 2BHTA 3QUSA 2FLKA 3JATB 1I4DD 1X1BA 2PVSA 3DNMA 3MSXA 4CN8A 5EE1A 1P60A 4RFVA 4WXHA 2PPLA 4YAJA 1JP7A 5LA6A 1KK2A 4CQMB 4CGZA 2IHZA 4ZDWA 4C1NA 4BV8A 4H1HA 3BG5A 1GTMA 4DIFA 4C7OB 3JZFA 3BMQB 4JC4A 3CLRC 2HCRA 2PO5A 4ND5A 1V39A 1T8PA 3I28A 3AY3A 3H84A 2IUUA 1A76A 2YWJA 4IZHA 1OB5A 4L8WB 4NDAA 4MGZR 3TN7A 1U2DA 4Q1EA 5H83A 4CNQA 5A04A 4PF1A 4BJ3A 1PT8A 4RIGA 4G1MB 4ZEMA 1QFSA 5JD3A 1V48A 1MNAA 1M6VA 1RE0A 3IC5A 1Z5VA 3U3XA 3MUFA 3UMRA 5L40A 2PLWA 3GRYA 2JZOA 4HGQA 1K5PA 3RFTA 3T5GA 3WQRA 4Q4AB 2HT6A 4M37A 1PEYA 2E4YA 1OROA 2X9QA 3G2HA 4BQFA 1T5TA 4HDMB 3D59A 4A6DA 3EGXB 4BO6A 2BL4A 1HTWA 4AU1A 1IQPA 3M6LA 5IANA 5LLDA 4R0NA 2I03A 5LQAA 3RYFA 3PT5A 3HK2A 5JCOA 1IH8A 3E3LA 4FKMA 2C2HA 4QU5A 3JY6A 4WLUA 1JDBB 2H0AA 4AF7A 2HQ1A 3R3HA 3ZK7A 5JJIA 2XRMA 1DINA 5ESWA 3WAGA 4P6VF 3WLMA 1E77A 1YB2A 3GQBA 3I6QA 3MNFA 3W9YA 3PFIA 1Z4NA 3WLPA 3PQEA 2WTBA 1Y37A 2YXNA 3DDWA 3EZGA 3Q4GA 4LTMA 3PQDA 3OPYA 1ND5A 1ZD9A 4WFQA 4A2QA 5KAPA 4GBJA 4UULA 3ZDDA 1X9IA 2OORC 1NBMA 3X2FA 4ZAWA 1KR2A 1ZH4A 2FSVC 3OTGA 4HUJA 2OXEA 3SQXA 3WLLA 3HCNA 1I0ZA 2XTMA 3P9KA 1GGFA 1O5TA 5JAPA 1T9HA 2QD4A 2ZUTA 5AJUA 3DC7A 3HNOA 3R5TA 4O1HA 4AJ2A 1BD4A 1SPXA 1YJCA 3KJQA 4JL8A 4LFAB 1VXRA 3GQVA 4P4TA 5E7JA 4JITA 2W2OA 1S2DA 1E2BA 3EG9B 3KZ1E 3THRA 1M1NA 5JRDS 3S1SA 1BWRA 1G21A 1X9GA 4Y7CA 4OD0A 3ILXA 1B42A 4CMBA 5C0OE 2BKUA 1XMSA 1Z82A 1ULSA 4YNBA 4B85A 4DRXB 4G1FA 4R8SA 3KFLA 4L3OA 4R1UA 5FUQA 3H4VA 3M9XA 4P53A 2X8JB 4DM3A 4RQBA 3T9AA 2M1XA 2WHXA 2FB9A 3JYOA 4IF4A 4LYAA 4AJHA 2OAGA 5JFOA 4GBED 4JBWA 3JQGB 1YB4A 1MIOA 3ZWYA 3DBLA 3DTTA 3NAGA 1P5ZB 3DWGA 4A2WA 3LUKA 3WLOA 3OPVA 3HUFA 4IIJB 4G8BA 1O1YA 1XEFA 3HL4A 3E7DA 3CO0S 3AO0B 4JH0A 1YJ5A 4BVGA 4KIGA 4CFSA 4PLYA 4TM8A 1ZINA 4K46A 1P29A 1VCIA 3ADPA 1GL7A 4OQDA 4JDUA 1EX1A 1GADO 1NVXQ 2CK3D 3IIMA 3QRWA 4IQGA 4P3XA 1PD0A 3D6UA 4OJKA 5LQKA 3SQMA 1UIMA 1ZK0A 3NBMA 1GOTA 2G5PA 4D99A 2CGEA 2WVGA 5TMEA 5KOIA 3D6NB 1DQPA 3ODGA 4MS3A 1GZ7A 1L4HA 4NBSA 3ZIDA 3T7JA 3QVGA 3AR5A 4RKYA 3JR7A 3QLTA 2PK3A 4WZBB 3F46A 1W4RA 3EYWA 4RJTA 3MHPA 2WJWA 2XZDA 3IHTA 2ZI7A 2DCMA 3LE8A 1U0LA 2HQSA 3SHTA 3OQHA 3V8RA 2ZROA 7ADHA 1QBKC 3HP4A 1KXZA 1ULHA 1UAYA 3H0EA 4AMZA 3PR2B 1Z34A 1C1XB 3O8LA 1T1RA 3GVHA 1DDOA 5BN3B 1I7PA 4DT1B 3DC2A 3TRFA 1KL7A 1WQ3A 1SOMA 1E69A 2VPZA 3QG5A 3RUAA 4IIFA 1UK7A 2P5YA 2DR2A 4NK5A 1FTQA 2QG6A 1ZX1A 4MP8A 4PYIA 5EKDA 1DO8A 3OT5A 4MJXA 3VBCA 1AA6A 1MGPA 1HMYA 1UPAA 2IYOA 3S0JA 1P17A 4FFVA 4LY6A 3W8FA 1LS6A 1O89A 4KPEC 4YJ2F 2CZQA 5LOVB 1SOUA 3BGWA 4G84A 5FTNA 2MSEB 5BYBA 5LP6B 4ESVA 1AS3A 5JXWA 2FPIA 4KJXA 4OHPA 5ER9A 5FNVF 2D7DA 1UT5A 2BEVA 3AOEA 4F5WA 1T9ZA 5BSWA 5BVHA 1ZW1A 2BT4A 1Z36A 2B8WA 3KQVA 4Q4CA 3AQIA 2JLYA 2QUIA 2ZRAA 4G81A 3F6BX 4HFNA 3X1WA 4AJIA 5C7OO 3E70C 1JLLB 3WMEA 4C0KA 4J0GA 2J0UA 2XYHA 2ZIWB 3NT4A 4A73A 4GX2A 3NXSA 4LF5B 2WT9A 2DR3A 4N76A 3NYRA 5ECDA 3SLRA 4N8SA 1UFVA 4EKNB 1K5DA 3Q72A 3RQIA 2P27A 2ZRNA 1MPTA 1XR3A 4Q15A 1CE8A 4Q9KA 3ZVKA 1XPUA 1KYTA 4P5DA 3D3WA 3TIIA 2I66A 2WIFA 4RJLA 3HJRA 1KZGB 1E89A 5FAKA 1JIVA 3ASVA 1KOFA 3MT0A 4IIGA 1QZUA 2FP4A 2V6MA 3T8YA 1XZNA 3T35A 3UMYA 4WA8A 1W4LA 2O7VA 5CVDA 4RA6B 4JI3B 4GZ3A 4YR7A 1U2DC 2JAUA 2J33A 2J5RA 2V55B 4TL9A 3PQ2A 4HX2A 4A6XA 2FFHA 3P20A 1X7DA 3Q1KA 3WYGA 5J63A 1JFSA 3FZEA 3KYCA 1YC2A 2AFIA 5AIBA 1KEEA 1SXIA 1NUQA 5AT1A 3X2SA 3G2PA 4UBLA 1A7JA 2DHEA 3J80A 3WLKX 1MJHA 3VDRA 2H1CA 3JQ6A 1O58A 1FZQA 1SVUA 1UM9A 3H8WA 1E2GA 4NEHB 2WFMA 2LBPA 3EA4A 5BWNA 1GZ3A 1CJKC 5DW3A 2JCBA 1SPBS 3ZZNA 2H1VA 2GVZC 4MV9A 4R8MA 1JR4A 4B45A 4EPRA 5B55A 4G63A 1R9JA 3ZZ0A 4AS3A 1GRVA 5MHTA 1RW4A 3BKXA 1NYTA 3ZGYA 2PMEA 1UODA 4YYZA 4TS9A 1QC5B 4BRWA 3BICA 3IURA 1QIDA 1YAHA 5DVZA 3RK1A 2W2XA 2LZ0A 2Z1NA 2BGWA 1FE8A 1MH1A 3I9V1 1J25A 1XCPA 1TO6A 3DOJA 1C8VB 3MJVA 4XGRA 3GXOA 2OHGA 3F7TA 3PEEA 4PXYA 1CF4A 5K3AA 2GLUA 4YAIA 3OX3A 2HNBA 2Q1TA 4HZIA 4KX3A 3HV0A 4QQ8A 4P80A 2I6QA 2GJKA 3REGA 2H54A 2CNWA 1LK5A 3F49S 5DX8A 4LPKA 2QT9A 1UBKS 4ZAGA 1HGXA 2VYVA 4AJLA 2R1TB 3EY9A 2XQKA 2ECKA 3C3YA 4L28A 3KHTA 1XQVA 4IFEA 1DG9A 5A2GA 1XYVA 4UEJA 4WLVA 5DI3A 5G0UA 4W8OA 4L5YA 5IVDA 3OQMA 4I1SA 3Q8WA 4RHTA 3QKIA 4Z7OB 4GVPA 1SCAA 1GL9B 3ACBA 3DOUA 4QUAA 4YCAA 1AQ6A 1ZMBA 2A9JA 2VPIA 4RU1A 5E38A 1NXOA 4HXYA 1EP1B 5C18A 1QF6A 4CDRA 1N5KA 2HU2A 1DDIA 1NFQA 4YCBA 3OCVA 3EXIB 1NPDA 1SOWA 3AF2A 3KNZA 4ENWA 2R6R1 5DYNA 2JGJA 3TNLA 4E22A 5KJFA 1M66A 3G13A 4RKEA 1EUCA 3OG9A 2G80A 4XGQA 3L7DA 2LVBA 3T9EA 1L5HB 3OQIA 5IDQA 4TWAA 1FJXA 2H4YA 3DM5A 1YZGA 1W5TA 4PHGA 3ZVNA 3GCXA 1DEHA 2R6ZA 3VR5H 3DTYA 1US8A 2W00A 3LLCA 2QZ9A 4H7FA 2ZI5A 3DL7A 3OF3A 3P45A 2E37A 2OHXA 1CEXA 2VNSA 1D0SA 5SV2A 3V8MA 3E1SA 3VSDA 3GEGA 4J16C 4A8JB 4AKTA 4BRSA 2JEYA 5C1BA 5FDFA 3GP8A 2IHNA 1MA0A 1ORTA 1QOPB 4GBMA 4BKOA 3EXHB 2FE1A 3FUTA 5EKSA 3H0KA 3QVXA 2FV8A 4ZOQI 4CWAA 5J1SB 1ZWKA 4RF5A 3GRVA 5M5BA 4FNGA 1PYGA 4PNEA 13PKA 1GTL1 1E2JA 1KP3A 3QY0A 5D5HA 5IT5A 2R2GA 2FEWB 4WZBE 3GROA 3S2UA 3CY6A 3OSUA 1PK7A 1V11B 1LXCA 2JDIA 5AKHA 2X0KA 3SYTA 5KX5F 3PFWO 1NULA 1DRKA 1VJTA 3LO8A 4IDEA 3RS9A 1AB5A 2JAOA 3EVBA 1XQ9A 2NPIA 2QORA 3A14A 3TW8B 5A4KA 4YYEA 1L9XA 4N7BA 1AZLA 1EP9A 1Q84A 2WWRA 1SGWA 3A37A 3AEZA 3KB8A 4HPWA 4DAEA 4DWJA 3V34A 3T5AA 1HKUA 4HLNA 2Q2NA 3O8OB 1TCAA 4DOMA 1JQAA 1ZK4A 5HCUA 3EYAA 4EAAA 2ZYGA 1CK4A 3SYNA 4LRXA 2IOQA 1YU6A 1X7XB 2GYWA 2Z2ZA 3O31A 3P32A 3EN0A 4ZVVA 4HVCA 1KI6B 2PGDA 4IGIA 3VSBA 5K9ZA 4MO9A 4UEWA 3PE3A 2XHEA 1I51A 1NR7A 1TJNA 2C98A 4CLHA 1T26A 3K2BA 1BEUB 1QYVA 1ZRNA 1FYVA 5DHPA 5ALFA 3OM0A 4Y1RA 4FYXA 2ZYHA 5EP2A 3WIUA 4IH1A 3BAFA 3HU3A 3KEFA 2YJ3A 2EKQA 3HO8A 3OBBA 4TV8B 2ID4A 1PL0A 5CVCA 5CA0A 2QP3A 6REQA 1DX4A 5IU6A 1GZ4A 1NRIA 1NW4A 1SUAA 4G8JA 1G8PA 1QR6A 1HO3A 2ZPAA 3EARA 4L0DA 4E1BA 4KAAA 4YALA 4F06A 3MJCA 3TIGA 1F17A 2WSLA 2B3TA 4LYEA 4MYHA 3W2HA 1CZLA 3LVFO 2HF8A 1JG3A 4YMGA 2JGMA 2OLEA 4EG8A 4J2OA 1HLPA 3AWDA 5AM2A 5FP0A 4G1CA 2W2NA 1ZIDA 4Q1DA 3HKEB 5HCIA 1FFSA 5CFQA 2HBYA 1W5EA 3OP1A 2Z56A 2PJZA 3BJMA 4M6WB 4MUAA 4RETA 1UANA 3KQLA 5KHAA 4XVRA 2YXDA 4FSHA 4BV9A 3FCSB 5DX1A 3WA7A 2Y05A 4KR0A 1EHCA 4QJBA 3VPBA 4E03A 2RE8A 3QHAA 5JUWA 4F96A 1RWWA 2WHQA 3ACCA 4V2IA 1RI2A 3E7PA 3PCRB 3KALA 4IQ0A 3WGUA 3KX2A 1WG8A 3VR6D 1XXHB 5KVSA 1QRUA 4HLCA 2Q5QA 2WP8J 1YR3A 1T4CB 5AHKA 3FCYA 1ZI8A 4X3CA 3ONVA 4Q0MA 4QELA 4YJGB 2ZOSA 2I4MA 3M4YA 1OJLA 2BGMA 4YQEA 2GS9A 3FB4A 3NM4A 4JQYA 5ICMA 3IPXA 2BMVA 4EY8A 4U8GA 2GEUA 1WCWA 2XE7A 2BBOA 3IO5A 4MCJA 4PZLA 3DUWA 3CLRD 1ZIPA 4TS4A 3U31A 1BMDA 1LVUA 1YIOA 4H18A 4PO9A 1ZUHA 3CX4A 3MTDA 3KEMA 4YRQA 5EWLA 3HH8A 3ROTA 4EG0A 4EW3A 4HX9A 3SVLA 5FV7A 4ZRMA 3NHFA 4NE9A 2AK3A 2HU7A 1AKTA 4I2NA 4JLMA 4O4IA 5F2EA 3T6KA 3ENZA 1YDMA 3I83A 3HCWA 4B83A 2HA6A 3CZAA 2L17A 3GLVA 2MU1A 3WYAA 1C9EA 3UAXA 4AMYA 3LPLA 5EJEA 3E9ZA 1HDRA 1KFCB 3GYBA 1IMJA 3OJFA 3Q2KA 2GHQA 4DPKA 4IWXA 4QDTA 1ZRMA 1BW9A 4O25A 4HPXB 5CLGA 3ZV4A 3IEUA 4C5AA 2GTIA 1PZXA 3C6QA 1ZVMA 3L0PA 3MMZA 1D8AA 2WAXA 1Q95A 1DQSA 3QWFA 5ISMA 3LWDA 3OJCA 3OZWA 4B43A 5KYNA 2ZE8A 4EG7A 3ZDXB 2NV0A 2BDUA 4HATA 1MFPA 4P4LA 1YQQA 1ZD2P 1SULA 3PUYA 1SC6A 3ROEA 1GNSA 4RV9A 4POOA 4FD3A 5JAUA 3Q0EA 3VR4D 2ZS7A 1WOYA 1KEZA 2RI6A 3GUZA 3PL5A 4YT5A 1M33A 1II8A 5HIIA 4BATA 1FVFA 1LW7A 1MVNA 2B6NA 4XYBA 4HD8A 5EJ9A 3AU9A 1JQJC 3HCCA 4XB2A 1ZJZA 4J07A 5HS4A 1OWOA 5F1PA 5CVEA 4C7XA 1RI1A 2CDCA 5H5JA 3II6X 3VKGA 4EO4A 2NOAA 4OMUA 3ANXA 4HRVA 4XX0B 5DM4A 3L0DA 5DSXA 5LFAA 5LZ4A 3IL2A 4GYKA 1BU8A 4M9SA 2XMQA 4BWYA 1YQTA 4QPNA 3PRKE 1CRWG 1UC5B 1XTSA 2IA5A 1Y89A 5D7NA 2K7ZA 3BHJA 4N82A 3GRZA 4OI1A 4F71A 2F67A 3GGOA 5EPUA 1ZN8A 1WUYA 4DA7A 4CG3A 3T5MA 4D43A 1CD5A 2CLIB 3PNQA 2G67A 3GFBA 1P4GA 2ZJ1A 1X8KA 4Z7NB 1S8NA 1XK7A 1V1RA 5DNUA 2VLBA 3N8HA 2PAFA 4ARZB 1QPGA 3JD2A 1M1YB 5TGTA 3VNRA 4E1VA 1L4LA 2V98A 3NKVA 3PCXA 2ZVQX 2QE7D 4TUYA 4PHTA 4S12A 2AUNA 4B73A 4IY1A 1UZLA 3H0CA 2P9TA 3N5KA 2EHDA 5BW8A 5EXEA 4QA9A 5CH5A 5A4DA 4ZVRA 5LXTB 1RLIA 4A5SA 2PX4A 3VYSB 4O1MA 2F3UA 1RWBA 2GMWA 5KNCD 3ECCA 4TSFD 1CY6A 1DLJA 4CM1A 1OAOC 3LRPA 3BWCA 1P2DA 1NJ8A 3KR1A 2FAXA 1NBAA 1MJGA 2HBQA 2WUWE 3DE4X 2ZU6A 3B5EA 4W5HA 3JATA 4ZEWA 1D6SA 2I1WA 4DC9A 1Y6RA 3BMCB 5L45A 3I6ZA 1Z5OA 2JIDA 3BQNB 4CQMA 1PE0A 7ABPA 4P36A 4GKJB 4GE3A 1UBMS 2PSSA 2JAWA 3LLVA 5EPEA 1GQOA 2CLMB 3SS8A 4C7OA 3BMQA 3WWYA 4L5AA 3WV5A 3WB1A 1G7TA 2FEKA 3Q9SA 1Q22A 3LU1A 4HS9A 2R86A 1P2SA 2ZAOA 1QZ3A 4DY6A 2RAVA 1THZA 2V03A 2P9FA 3F3YA 2X1VA 2C88A 4G4SP 4M1EA 5AOVA 5EIWA 5ETJA 4YAWA 1I0LA 3G8DA 3D4IA 3ZX5A 1I5OA 1GKKA 1M7BA 4KJZA 1XEWY 2HA3A 1YDEA 4Q4AA 4WEOA 5DBGA 5LQRA 5M7EA 4C4OA 3SZLA 5KO2A 1L4GA 2R00A 4JYCA 3F3MA 2PKRA 5ALTA 4B6EA 4RDXA 3EGXA 4PXSA 5KVAA 1XVUA 3WGOA 4PO1A 4J0DA 3AVXA 2PZGA 3LLSA 4KBYA 1ZVVA 1AH2A 1E8NA 2Z43A 1G8KA 4DLYA 4K1LA 4UW9A 4OHXA 1IN5A 1B8VA 1BOFA 2N9UA 4QDXA 4ZAXA 4OQQA 2HV9A 2WAAA 2C5FA 5ITVA 2RK6A 3GPBA 2MYNA 2BSAA 2JZNA 2QYHA 3FTPA 4RVDA 2BM9A 3VOBA 3ZU6A 4P0PB 1UINA 4HYYA 2CL0X 2RKOA 2ZAIA 2C7QA 2AGVA 4HH1A 2XA1A 5DW0A 3NBKA 3TVTA 3G8CA 4EARA 2J07A 1I3CA 1Z88A 1MV8A 3IXLA 2B37A 4M1OA 1JQDA 3QVKA 4PLPA 3L04A 1C0PA 1PRYA 4M98A 4OK5A 4KODA 4LK2A 2NXJA 1BHJA 1I4WA 1J22A 2CXTA 2W42A 4UM9D 5BMVF 1E1RD 4X66B 1JW9B 4N65A 1DL5A 4EB6B 5K2OA 1XXHE 2XB9A 2QG4A 4QUDA 4QXAA 2GYVA 1MQ8B 2WVAA 3WGVA 5JFGA 5LN1A 3K9LA 3DBIA 3N2KB 4DV2B 4IJ6A 3LGSA 3VV2A 1XYGA 3BC1A 4UCQA 5THQA 2H92A 2IYNA 3FA2A 2IXDA 5HRAA 5JAHA 2FW0A 4RO0A 3V4OA 2GGSA 4G65A 3KKOA 5AOAA 4DRXA 1G4HA 2KLBA 4DCSA 5IM4A 1R8JA 5TMPA 1XLTC 4R31A 4S2UA 4ZQIA 3CH7A 3P9PA 2X8JA 2V7GA 5TXGA 1Q0ZA 1L8AA 1MX5A 1GPUA 4DZRA 4R1NA 1GA6A 2H1SA 3TGWA 2XNCA 3ND6A 4LY0A 5H70A 4EGFA 4PYJA 5EKTA 1T24A 1VCOA 2ZRJA 4Q9HA 4JQOA 3FIUA 3JD3A 5C8DA 1RYHA 3I64A 2XMRA 4PCAA 3D0OA 3IDFA 2ZSFA 2ATVA 4Y67A 5B4UA 3I45A 4EGJA 3OURA 3DSRA 4F9TA 2HA2A 1MAWA 2J5KA 2FGJA 4J1QA 1PGQA 3K0CA 4XFDA 5H0IA 4KWHA 3K9FC 5JJKA 2ZU0C 2VJLA 4NBUA 1K08A 4DEYA 2VRNA 1MC1A 2HZ7A 5KYVA 4JZKA 2IYZA 3AW9A 4WZBA 4QSHA 3WGNA 2XQJA 2JKVA 2VSFA 1RZRA 4GOJA 1PWZA 2QQEA 5TARA 4ZI7F 4LVOA 3C7CB 4KGVA 1I5RA 1AS2A 3A1TA 5FO1A 1ZMRA 3ENVA 5DGXA 2PZEA 4E12A 3R24A 3AF4A 1A7AA 1C1XA 1K7SN 1C9JA 1WW8A 3LY8A 3PC7A 4QXMA 3AETB 2Y0EA 3EZXA 3OJEA 2XB2A 4PC2A 3P94A 4L0CA 4JI5B 5BN3A 3OZGA 4QTUB 1QPBA 2YVAA 1UXKA 3O4GA 3PPWA 4DT1A 2YRXA 3BT7A 1E59A 3EBOA 1VRCA 3M1AA 1GWNA 5JDIA 5D3QA 1TZKA 2H4HA 2GX6A 1N8SA 2ZS8A 5AW7A 1I6KA 3IEVA 1QRTA 1XZHA 4GX5A 3G5TA 3SLGA 1WE2A 1OU4A 1THTA 1OD6A 1POWA 4E7PA 1YUMA 4R0VA 3T1VA 4E13A 2J8ZA 2QTFA 5FWNA 2IKQA 1CVIA 2OCKA 5JEDA 1NWHA 1U90A 1PT6A 3FKJA 3GUYA 4YPOA 4Z7JA 3HVRA 3DNPA 2Y4NA 3FNBA 1D5CA 1IIBA 3URMA 3L02A 3L05A 4ZOBA 2XTNA 3OZUA 5CAEA 1I5EA 2YUIA 4CCYB 1AV6A 3OIWA 4LZNA 3OE7A 4N3NA 1BYUA 1E2KA 3QPAA 3TAXA 2D2EA 1L5FA 3EQ8A 3PQ4A 2KQUA 4EQ6B 3ISTA 5LA6F 1OFUA 2ZXFA 4OB7A 4ZKDA 5AD1A 2YINC 3EQZA 5E4FA 4IG9A 1A7UA 3Q9UA 621PA 5KYUA 3F9RA 2XMCA 1F4VA 3OZTA 4N9QA 2OO3A 1TTTA 5KYTA 2OCXA 1M1YE 1XJ0A 1Q21A 4ENQA 2B4RO 4A27A 3RT9A 1Z6YA 1JTVA 3KSZO 1U98A 3KOMA 4I36A 4NS4A 4DVGA 1FX0B 3D6TB 3V8BA 2O8EB 3QHQA 1ZN7A 2GKGA 3QOWA 5DP2A 2EDCA 4LHSA 4X95A 2IWHA 2IEDA 3R6LA 1A8QA 3WNDA 5EJ6A 3NEAA 1NL3A 3JVIA 3AK4A 4QYSA 2B2CA 4J7CA 2OOSA 5KVCA 3T1HB 2DCUA 4LQLA 4AO6A 4A0HA 4YJ2A 2IKSA 3R9WA 2QEQA 1HQKA 1F8YA 2WKSA 3GW8A 3O4FA 3Q10A 1U7TA 3KHSA 4RA6A 4YDHB 5DBOA 5CB0A 3ZHXA 3ZLJA 2WINI 4UTXA 1PZEA 2ERXA 3KSBC 5KS2A 4IX9A 5IC6A 3GDHA 4IDCA 3CCCA 3UH0A 1U6IA 2QB5A 2IHUA 4MTLA 4ZO7A 1UWLA 3LUHA 3MBOA 4FFBB 5H9VA 3ZTWA 2Z2KA 4YMUA 4DB4A 2HPZA 3WO1A 1WB6A 5LZ5A 2X4DA 4ZA2A 1ZLXA 1I13A 4FYJA 1F8UA 1W87A 3DEHA 4RKWA 2VJPA 1VJCA 1NM5A 1FLAA 3K35A 1GUFA 2Y27A 3GLFA 4QULA 2EJTA 2VPQA 1ZGCA 1V9CA 4H0NA 1EX7A 1K4MA 2PG3A 2QP9X 3IPLA 3WHKA 2VT6A 2FW7A 3KFXA 2R8EA 2QT0A 1UBOS 1CS0B 3AFOA 4C14A 2FPGB 4F2DA 4URUR 5BRAA 3I9OA 1QC5A 2YR0A 1H0KA 5A1JA 4MW5A 2WFZA 3UT6A 1ZD3A 4A91A 2OGZA 2C5AA 4W6QA 1B6GA 2ZGVA 2QD3A 2R6DA 1BX1A 1CZOA 2QI9C 4RD3A 2Y0PA 2VQFB 4F11A 1R0YA 2QX8A 4KPGA 4CM9D 3EG5A 2YRWA 4G2TA 4J6FA 3HJFA 3UTCA 2DXIA 1AGPA 2CC2A 3CBGA 3WSTA 5A06A 3A0RB 3OHSX 4FIDA 2PA3A 1KNQA 2IS2A 3WNBA 5ENZA 2R8XA 2BCGY 2R1TA 2OYRA 4A10A 3Q6MA 1NNSA 3KAPA 4UM8B 2H08A 2HLPA 2YVQA 1J20A 3N70A 5DV9A 4DSTA 1VJ1A 4BO7A 2JCVA 3CEAA 3ZDEA 4NFHA 1ULBA 4QYWA 3R7DA 1NG9A 5TIIA 2QNIA 1ISMA 3B2NA 1G6HA 2FPRA 3DVRX 1S0UA 3DT9A 1U65A 3NRBA 3E58A 1DXHA 4H27A 2XOEA 1USGA 2N3ZA 1POXA 2W2TA 3HJHA 4XWTA 1X15A 4TRNA 4TWRA 4X1YB 1VHTA 2BHSA 3R3SA 4WK4B 4XE5A 4TXNA 3SF0A 2I6XA 3AR3A 2Y0CA 3DDHA 1S8OA 4M0KA 1NRXA 1RJEA 1B16A 3IE2A 3EXIA 4B3BA 3VDNB 3LRTA 1G3QA 1OZAA 3LLUA 1E1CB 1Z07A 2ONZA 3T38A 5FV4A 3DKRA 1ZRHA 4IGAA 4BFZA 1UDAA 3NVKI 4DA6A 2P30A 1JHAA 1HE2A 2AI3A 4C2AA 4REQB 4XGNA 5FA8A 3UXEA 2PRKA 1L5HA 5IRCD 4C9BA 3SR4A 1C3LA 3H11B 4PLZA 4WBSA 1KDVA 4KDEA 4WXPA 2W7TA 4K9PA 1ZHOA 3AGQA 3JR3A 4AKIA 2JFXA 3OTHA 3FUVA 3O84A 2V7VA 4L1KA 3KSUA 3UWDA 4CV2A 1XROA 2EFYA 1A82A 2E5WA 1DFIA 2F1RA 3PX3A 1QVWA 1VSUA 3KDAA 3RV3A 1KHTA 2R6GA 4DCJA 4R84A 5AXAA 1YXMA 3FYDA 3O2SB 3D64A 1PR3A 4A8JA 4X1KB 2WNIA 1GPDG 4XOIA 4CETA 2GUGA 3CS3A 2FQ1A 3O21A 4DR6B 3EGDB 3MWYW 2UVPB 1Y1RA 5LU8A 2B92A 1PJ8A 2Z9CA 3EXHA 3BXEA 2DH5A 3A4LA 3NG1A 1N5OX 2DTXA 2AG0A 4UFPA 3DR5A 5EFZA 1RXYA 2D4AA 3K15A 4DMRA 4S24A 1V26A 1WCIB 2R2AA 3KQTA 3KZNA 3NATA 2KSQA 3P0HA 2X0RA 4HADA 1TZJA 4TWZA 4XCXA 3W5HA 2XSZD 2V3VA 1RYBA 3JAKB 4W1RA 2PH1A 1V11A 3G5LA 5FUWA 2B4YA 1MR3F 3G2NA 2MMGA 3R3JA 4IOJA 4WECA 3WGIA 2JLUA 4YMIA 2J48A 3B1VA 1VE3A 3TW8A 3EPHA 4R9VA 4CM3A 3GT3A 2WWWA 2BD0A 1Q3TA 1Z38A 3GP3A 3A1SA 3GU3A 3HXPA 3TD2A 3TOVA 3G59A 3P0IA 5J9FA 1Y9EA 3C7TA 3O8OA 4A16A 4PZYA 2R5FA 2AR0A 4ARAA 4PRYA 1ZQ9A 3OF5A 1XKQA 2W43A 3JQFA 4M0EA 5HF9A 3ZHVA 2E49A 3NTXA 5LP6C 4DNQA 1X38A 5TJ9A 1DC7A 3V7FA 1TMOA 1X7XA 4FOLA 3R3YA 5L3VA 3NYIA 1KU0A 1KI6A 1ZDMA 2BF4A 1RHRA 3GMTA 1TYEB 3K0SA 4EO7A 5LYJB 1M8KA 1XA0A 4FE4A 1FSSA 4F3NA 2PMFA 2WM2A 4OM7A 1U3TA 2ZCJA 4HQFA 4RZXA 1ADJA 4E5DA 4UJ3A 3RODA 1LUAA 2KW5A 1KOGA 3GJ8A 1TCCA 4TV8A 5HMMA 1UPXA 3BL5A 3AR8A 2Y9PB 1KH2A 4PS0A 5EQFA 4IDGA 3QV1A 1H6AA 4RSRA 5FPYA 4AY2A 5D6OA 1WNFA 4JI1B 1E1KA 1KYZA 2OG2A 4FW9A 4XYGA 1JMVA 2AK2A 2CFRA 3SM3A 4CR6A 2UYOA 2QN6A 1PP4A 4WFJA 1H6DA 3Q3IA 2WY2D 2EQAA 2W6QA 1P7YA 2DHCA 1T0BA 3GCZA 3OJOA 4BQNA 3MJSA 5JG7A 1TUBB 1TZ2A 2Q9UA 4XFJA 1YKFA 4ZMSA 5JARA 3BCSA 5ALQA 5KNDH 3KXPA 1HRDA 1L8LA 4FP9A 3PVCA 1IWPB 5TV2A 3HKEA 2Z2JA 1NVGA 4HZUB 1JDSA 1EUDB 2N75A 3FMPB 4LCBA 1NN1A 4M6WA 4TQAA 2OA0A 4E30A 5I8PA 1LBEA 1NYQA 2H00A 3PRHA 4KE6A 3RM3A 5FFFA 4CUKA 3MQ2A 3ZVLA 4XIJA 3NEYA 1YASA 2GNOA 3AL2A 5FRDA 1R0LA 1PG0A 4DCTA 5I7VA 2XUFA 1Q1EA 1EM6A 4NMXB 5CLQA 3NH6A 2X9NA 3QUBA 1XXHA 1OWMA 4YAEA 1T4CA 1ZQ1A 2W2LD 1JILA 1ODIA 2PY6A 1NLUA 1E3JA 1FMLA 2ZRLA 4FFLA 4HMOA 4BEWA 1TMKA 4E0BA 4JQZA 4LJSA 1X9HA 5DNAA 3TTTA 1YHYA 4D4HA 4JGGA 1GA4A 4OHBA 2M6LA 1W0JA 3VC1A 3VKVA 4B46A 3AUXA 1SOAA 3U6BA 4TYQA 4LMRA 5IW8A 3EVZA 4R3WA 5EINA 4I6EA 4F60A 3A1FA 3FMOB 2I9KA 2ZBGA 1IWBB 4JJIA 2D1RA 4Q1VA 4RTJA 3VSCA 4BNFA 5JASA 3W7VA 3FMFA 5J23A 3THXB 3L8DA 2C3PA 4F21A 1NFRA 5AVKA 4EKDA 1SQSA 5J2UB 3KCNA 3ER6A 2A3RA 4GUDA 1PWEA 1SN7A 1T5LA 2XDAA 2BI8A 5ALMA 1N2CB 3BH0A 1BHSA 1RPTA 4W6ZA 3JQQA 1JKJA 3O7WA 3WYDA 3AH8A 4L27A 4IJUA 5DTMA 2ZRBA 3HRKA 3PVZA 3GLQA 1T0HB 3QF4B 1COWD 3C15C 3SFVA 1FNBA 3SSAA 2F1KA 4P9NA 4KG7A 5AOBA 4CMHA 1KIAA 3DMTC 4MUHA 4HSEA 3JQEA 4MZXA 2H5LA 4R3UC 5IVKA 4YR9A 2VP3A 3DL4A 1MENA 3OOHA 4XM1A 5C9ZA 3AZQA 1QRAA 3UB2A 1EI9A 3CW9A 3LY7A 3KV3O 3LSTA 2P5TB 3UMGA 2YWDA 3CVJA 3RVQA 3Q0TA 1PHRA 2WYOA 5KTOA 2EL7A 3AW8A 2ODWA 2W0MA 1YRWA 4MYSA 4FGWA 3DV9A 3UHPA 1UQTA 1Z08A 1AQNA 2PGXA 5AVOA 2DGDA 1ZCJA 2O8VA 5ECWA 1OFGA 1FDVA 4Y2XA 5DCYA 3IV9A 4GWLA 3H13A 2JK0A 4ZALA 4FMDF 1EUQA 1XE3A 2P7HA 3R20A 4RH0A 4PW0A 3N75A 1JB1A 5ALDA 2GPNA 4MUNA 4RVOA 1M75A 1Q77A 5K0BA 4G6ZA 3LCUA 1YUNA 4H59A 1OFTA 1K1EA 4L0QA 4WTOA 3S81A 4LXXA 4XX0A 3IQFA 1BEEA 1ZHHA 5IS2A 4BFSA 1PQ4A 2QD2A 2RCYA 1IB6A 1JZQA 2F3PA 4XB1A 2XLCA 4ALMA 1U7WA 4PGHA 3FH0A 4JA0A 3UAYA 3WVNA 4A3SA 1UOQA 4KR2A 3LBFA 5BSFA 2AW3A 1CUYA 2FR1A 1M2EA 2NAFA 4LNUB 1Y42X 3DCYA 4JASB 2LCIA 2FMFA 2BUAA 3Q8KA 4GVXA 3WSVA 1DHRA 1FS6A 3B12A 4C4PA 2X2EA 1ZGGA 3DOCA 4CKBB 2CSXA 1H93A 2Y76A 4ARZA 2BFWA 1YB7A 1M1YA 3N8IA 2PIAA 3VU1A 5H4HA 5IJZA 4IF6A 1A4IA 1T8WA 3LF2A 4NZPA 2HQBA 1VRWA 2VHWA 4GHWA 2OL4A 2QGZA 4TSRA 3KIPA 4I8XA 4D57A 3BGVA 2JBAB 5EKXA 1NMSA 5K3BA 5DYTA 1YU9A 4FT2A 5LXTA 1KY3A 3HB1A 4RM2A 1LWOA 2AD5A 1R18A 2WPDD 1KO8A 1FQWA 5CA0F 3A2NA 5C1IA 2QRPA 2V7QD 4ZI3A 2PL9A 3C6KA 1M34B 1NR1A 1Z4QA 4FSXA 1LBHA 2X0FA 2IBSA 1USIA 1T5IA 1KIFA 4QO8A 4FEGA 1XRRA 4PSDA 3SQDA 2HLNA 1C7FA 3OCJA 4HWTA 1XOIA 2AHOA 4C0AC 3PQCA 1UJCA 3BMCA 3N76A 4MKGA 4UMEA 2OUKA 2WIJA 4ND4A 1JJFA 1OA0A 5L3RA 1JPVA 2VZ8A 4ER7A 4V3CA 4NZYA 4F4JA 2X86A 4KN6A 4O02B 4ACBA 1DAKA 3JRNA 5E0KB 1SZCA 1QIJA 4LWZA 3L6UA 3Q6NA 2R8PA 3RU7A 4ZZIA 4C08A 5DEIA 3BULA 3IKJA 3WL8A 3TQCA 3ORHA 4AZVA 3DOHA 4G0VA 1N6OA 5AVJA 1EE9A 2F3SA 2AZXA 4OHFA 4IV0A 3GLHB 3PYMA 3V7WA 4UHEA 5AUQA 3GVPA 4LFBB 2E4XA 2G1UA 1ODSA 2ZWPA 1A7KA 3DO6A 4TRJA 2ZYAA 3SDSA 4EECA 1CEYA 1FIUA 5C52B 1E64A 3ZNPA 4BNIA 2FSUA 3AWIA 4R6XA 3ZYZA 2F1JA 4N12A 2BTOA 3N8GA 1UDXA 5ADWA 2FEOA 3JQPA 2V5AA 1XK6A 5EHIA 3C98A 3IQDB 3VTAA 4CLEA 5COBA 1PUIA 4MWTA 2C99A 3DXYA 2Q1SA 3CRZA 4OSPA 3DAHA 2XITA 5EZYB 3PUKA 1CETA 1F2DA 2IF2A 4WDQA 1BKDR 3B7WA 4LWQA 4H77A 5SY9A 1U2PA 2Q0HA 4DV3B 2ZAMA 4IUBS 3I2GA 4IXMA 2BBTA 1PX0A 3WB9A 4KRFA 3BFVA 1PLLA 1X13A 2HCTA 4DFDA 5LQNA 4GECA 4EB8A 4Z0TA 2GO1A 2RHOA 3R7NA 1CUUA 4DNXA 4HV4A 1Z9BA 2RHTA 4LSWA 4OFXA 5IBPA 4R8RA 2BZGA 5CH8A 1SK8A 2WU3A 3ME5A 2OBNA 4R83A 5ERGB 4IDOA 2NN3C 3VR4A 4AJNA 4M54A 4O4IF 5B5SA 5MN6A 4LKOA 1WCXA 3PRYA 2YRFA 5F3WB 2OXRA 2OP1A 1JKIA 2VK2A 4EB6A 1JEJA 4EG6A 3PNBA 3TGLA 1J09A 4Q05A 5EESA 3WV4A 2A3NA 5FL7D 3AUKA 4C6HA 1GKIA 4OAQA 5JNVA 3U5ZB 1ZBQA 3GRPA 3GFTA 3ZV7A 5EP4A 2GKSA 5EXPA 3N2KA 4IGKA 1EESA 1A9ZA 4IQ8A 4JT4A 3KOZA 1H9CA 5C51B 3EQ7A 3F1KA 2NIPA 1T5HX 4ZXPA 5KU1A 1C9MA 2OCYC 3DZCA 3HCDA 1Z39A 4WXYB 2WTUA 1RXCA 3WWDA 4B2YA 1NUHA 2Q5CA 3S5UA 2H1RA 3OTQA 1RU3A 4HYTA 5GP1A 3U40A 3BRCA 3K0HA 3KPWA 1GUYA 1NU6A 3QVJA 4CL3A 5JIBA 1ULTA 2WUEA 2GN9A 3I3OA 2AN1A 5COQA 3RUHA 4F4FA 2P1RA 5JANA 4DIOA 5J4YA 1N2CE 4EMTA 5BR4A 2W70A 4GVLA 4D92A 5KOHB 2BZ0A 1SCKA 3ESQA 3WIOA 3E9DA 2OR3A 3RFXA 1RKXA 4QEKA 1YDFA 3NS7A 4E46A 3H1PA 3HC7A 2QE7A 2TMDA 1GDDA 1L1RA 3Q5EA 3T5CA 4B75A 4RHYA 1P91A 3NMUF 2YHBA 1QIHA 3V2HA 1DGQA 5G0VA 3UKOA 3B85A 4OJYA 2QTLA 2BGIA 1FSGA 2QVZX 2PYZA 2QRUA 2QQ5A 2VZ9A 3CUTA 4R54A 4DDUA 5KNCA 1YBVA 4ZQFA 1X8JA 2FZ4A 1CNMA 3O92A 4K7JA 2WAMA 1RLTA 1VGRA 3CSUA 3WMXA 1U7PA 4HC4A 4ZYWA 2GLTA 3FTQA 3OMXA 4RTNA 3O8RA 1TGVA 3D8TA 5HK9A 3JWIA 1VSTA 2ZREA 4KWIA 2XMPA 2XCUA 3D1LA 4JT9A 4N54A 2GO7A 3DEZA 2J7PA 3NPMA 1Z12A 5DFAA 3T4EA 1G2OA 4FYKA 2ZT8A 3AETA 2XE6A 2GI4A 2Y1FA 3NTRA 5U9CA 3TW0A 2QTVB 1FU4A 1VKNA 3LA8A 3Q7PA 4QQRA 3AERB 3K09C 2B5OA 2QZZA 4G24A 4TUYF 2XNJA 2D74A 4DV4B 2G4CA 2IPMA 4RC9A 3OETA 2RGXA 5IXJA 4I3HA 4ZICA 3DKVA 3EASA 4FCTA 1O96A 2W6ID 2I6UA 2VQDA 2NUBA 5YASA 3QPUA 4OU4A 1SD1A 4DEXA 2ROQA 1XTIA 2J0SA 2D8MA 1B74A 3K5PA 3CRVA 3MRXA 1CUAA 2YDXA 4DC0A 2JI4A 4O0LA 4RSMA 5LUBA 1VE9A 2AIRA 3CMMA 1T2AA 3JQ7B 4AN1A 3LNTA 4BE7B 4DQUA 1MAAA 3OQPA 1RQNA 3KLPX 4QNRA 1E5QA 3QFCA 3GNTA 3ABOB 1QO7A 4MW0A 3F97A 2AWOA 4OQMA 4RK4A 3CUWA 4HEA6 4CCYA 1A2QA 4YPVA 2PEZA 3CVOA 3JWGA 4EQ6A 5H3CA 1XNRB 4QKQA 2QR3A 3I12A 3IVXA 2KYRA 4OMCA 4Q9NA 2J1LA 2C0PA 1VLQA 1QP0A 5AO9A 3BVPA 4C4RA 4BAZA 3ZCQA 1QGDA 3U09A 2CDAA 3IP6A 2L42A 2VYND 4TMYA 4UBIA 5E7MA 2D1YA 1FX0A 1RCTE 2JI9A 1Y7PA 3CEJA 2F8SA 2O8EA 3KPYA 2I4OA 2D06A 2ZJ6A 3C3KA 5GQSA 4YREA 5FI5A 4CFZA 3UOWA 3SHQA 4K6KA 2V5VA 2I1VB 3JSAA 2PGJA 5IKMA 3PX7A 2GHRA 2SHKA 5D1HA 4LSZA 4O3MA 1DEOA 2I8CA 1M34E 2F8TA 2H5JA 5HE8A 1NONA 3I04M 3FF4A 3ZBUA 4DXDA 3DE0X 1C7EA 2J6BA 1WMFA 2OBLA 3IPAA 1E1RA 1B41A 5CMLA 1G16A 1KFBB 4JB2A 2JGNA 3IDAA 3KUXA 2ZRFA 3QBDA 5JSYA 3WZMA 1XDUA 3UJDA 1QK4A 3H9UA 1TFUA 4FHCA 5AI8A 1ZAYA 5BSHA 1KTIA 3ZI0A 5JJBA 2PUEA 4RMHA 4XVCA 2CYCA 1P72A 1Y1PA 2TYSB 2V65A 1DKRA 2QRVB 4FFBA 2QROA 1FU8A 3SICE 4C3OB 1EVEA 3PFHA 4N3GA 2XOKD 1MB9A 3L8EA 2G83A 3AKCA 4KGXA 2B1IA 3NGXA 3B7GA 4OIFA 2FZGA 2H16A 4WOKA 5AW1A 1HNWB 1L5OA 4KTVE 3SJZA 3SSOA 3GLHE 5FPHA 2C00A 1Q83A 4DCVA 3AVWA 2GCGA 1QIFA 2GA8A 3AP3A 4KN9S 2OZLB 4MB2A 4RENA 3VJMA 2W83A 4UKDA 3RRZA 1VG8A 2VPTA 3HI6A 3BJIC 3AI2A 5ESRA 1CS0A 1U8UA 3H2YA 2FPGA 3OUUA 3A7DA 4OX9B 1XCOA 1K0FA 1T9BA 2HFKA 2LV8A 4HN2A 2VQ6A 1TVKB 4MW9A 4E51A 4X00A 4CTMA 1RPNA 2UZIR 4NMWA 4DBLE 5HKKD 1E2PA 1ISGA 4BPBA 3FROA 3PYXA 4JVNA 2Y4OA 5CVUA 3RUEA 3WHLA 1H65A 3OM8A 4AC9A 3WIDA 1VP3A 3I2KA 5KZMB 1FRVA 3FZNA 3ZWKA 2IEBA 2AZ4A 3S68A 1UJ6A 2O2CA 1QNLA 5IM4F 1KH1A 4URZR 3D3JA 4I3FA 1VDZA 5KC9A 4MDYA 4UUQA 3FFXA 3BE8A 3QKUA 3ZS8A 2O54A 1PKEA 3VC3A 1Z7EA 2ATXA 1V6SA 1XHLA 2X3UA 1Y5IA 3PGKA 4P81A 4G0MA 5KNLA 2JLWA 3G68A 2IQIA 3Q98A 4OSOA 2EZTA 2O0HA 1IG0A 5G41A 1J1IA 3T3IA 1T4BA 4KK4A 4DHEA 5B2FA 1R50A 1S4MA 4RYLA 4KMSA 2HK6A 1GGKA 4GEGA 4XJTA 2ZETA 3I42A 4RNCA 3ZQUA 3ZK8A 1SUPA 3SM9A 1I1HA 4X1YA 4I08A 1UEIA 3HLYA 3OO0A 3K6KA 3EGEA 1A4XA 1QE5A 1M73E 1QP8A 1B14A 3LDFA 3OCXA 1YJBA 3OM9A 5CNMA 3DEIA 2D5CA 1NLMA 4QUHA 1EFTA 1RBMA 2IY8A 2CFSA 5DTRA 4FBGA 5HDQA 5DBFA 1E1CA 3BGDA 4GZ5A 3PV0A 1NZJA 4MKZA 2W5UA 2RHDA 1NPTO 1MH9A 4BQIA 4LBVA 2ADFA 4IDNA 5AK0A 2B0CA 4REQA 4CT0A 3ELWA 1RQPA 3GR6A 5LCXA 3H11A 1JV2B 3MJ4A 4Y2UA 3GT4A 5KSZA 4LHYA 5BV1A 3ZKWB 1M7HA 5BT8A 2EF1A 2XODA 1LV7A 5EIBC 2A84A 3B2QA 5A0TA 3DHWC 3HLKA 5AVTA 2WJVA 3C1TA 4PYRA 2Q7XA 1SC9A 1JAZA 5DBEX 1AO0A 1IVSA 2QQGA 4WFIA 1ISPA 4UNNA 5K6AC 1U02A 3M7IA 1LDBA 4X1KA 3IBSA 3FNQA 5FTWA 3G49A 3R9KA 4BEBA 4YLYA 1XLVA 4AZSA 3EGDA 4W5TA 2UVPA 3COJA 2HSZA 4WGFA 1SHUX 3DZJA 3QX7A 4LF8B 1JHOA 1XAIA 4JT8A 2JL1A 2AOTA 3G88A 5CUQA 1J0AA 4P83A 1PL6A 1M1UA 3FTNA 1Q7RA 3NV7A 3PE4A 1M6HA 2WYHA 4LRUA 3UV3A 3V6MA 2V58A 1WCIA 2XWPA 4G8DA 4HAWA 4I1UA 1C29B 2C3OA 3EB9A 5J5CA 1A5AB 1JJBA 3CUVA 1BFKA 2J09A 1BMQA 2AN9A 3JAKA 2GJ9A 4MPRA 4BVJA 2AUMA 7MDHA 1Z2PX 1JYEA 1R4ZA 1YVUA 5C4IA 5JRJA 1N5IA 4ATNA 5IUJC 1UMKA 1P1RA 3R6DA 4V0ME 1ACLA 1XT6A 2DFKB 4MUXA 1PCXA 1HUQA 3G5MA 1F8FA 1TLFA 1U9IA 1ENYA 3DOEA 1XTBA 2L18A 4URYR 3RKUA 1WMSA 2BH9A 4RPLA 3RRNA 1P4AA 2AC4A 1G5FA 1N2OA 4KACA 3AY0A 4EL0A 3M3PA 4QATA 3IAHA 3OIDA 2EEZA 4P7GA 3JARB 2X6RA 4MULA 3VR5A 4HP8A 4UZSA 1F06A 4MUGA 2R7LA 4FHFA 5FBZA 3IBGA 4KR6A 2WT8A 1ECLA 2XVZA 5B6JA 3OZXA 4WESB 3C3JA 1TD1A 4Z51A 1HH4A 2GPWA 1ZUNB 1HOXA 4MP6A 4ZJPA 4OGLA 3GPCA 1I0IA 1UBHS 2FWAA 1TEHA 1TZBA 2O2XA 3E5RA 3MTJA 1ZM9A 1ORIA 1PVDA 5BN5B 4C0BA 5ALYA 4TYNA 4FKBA 4IOLA 4P08A 1FF9A 3VOTA 4G0PA 2IFTA 2VRCA 1EG7A 2YV4A 4X8HA 2JHAA 3ET5A 1Z17A 1NTRA 1FYDA 4WA7A 2NO6A 5F52A 1N2XA 3SJ7A 4LXYA 2K2WA 3CNLA 3RAEC 1TUBA 3QV2A 2RGCA 4OXYA 1GZHB 3AVYA 4UM5A 1D2HA 1I3MA 2W93A 3MB8A 4V0RA 2VQ3A 5ALSA 2OHVA 3TTVA 1J8DA 4LYHA 2GPYA 4HZUA 3CW2A 2Z5GA 1EUDA 4R8LA 2JJ1D 3X1XA 1NXQA 2BMJA 1JF8A 3A6DA 3M5PA 2R5NA 1T4DA 2YXBA 4JI8B 1EH5A 2HWKA 3EDYA 4EKEA 3IOEA 1X86B 3BMXA 3SF8B 1BEZA 4YRBA 3SIXA 2AE1A 2EVWX 2PWAA 4RZHA 3STVA 2H7VA 2H5IA 4IHKA 4BRUA 1ZM3A 2EJUA 1F12A 4QQNA 1E2QA 1G59A 1IM2A 1RZVA 3JQ8A 3IAM6 3ZEIA 4DANA 2BGJA 5B36A 4S2EA 2GWHA 4E15A 3ER8A 2I55A 2O1WA 4A6PA 2AJLI 4Q6BA 2P8JA 4KQCA 2W58A 1OXKB 3QU5A 4UU1A 1U1GA 2XZPA 3UEOA 3PTAA 4KNYA 3NWJA 3WLQA 1U11A 3L1HA 1G8JA 2IPAB 5G0SA 5LBTA 3LTEA 4FR2A 4QEDA 1HG1A 3KLNA 3GDFA 3K0BA 3LXRA 1XZIA 4IILA 3C87A 4K0RA 2EBFX 4RY0A 5IMSA 1HEYA 2EZUA 3UPTA 5CD1A 3MCUA 1JFLA 4HFJA 3UK7A 2XQIA 3BB4A 1HBJA 1V47A 4PYLA 1PFUA 1TJ4A 1N2JA 3DEAA 3RRFA 3THXA 2YIJA 1EWTA 5WRFA 5IDVA 2JS7A 4H7JA 5JDCC 2OZVA 5J2UA 1O8CA 3OIYA 1YR9A 4CL8A 1N2CA 5EVCA 2HREA 4X7MA 4KVZA 4Y6GB 2APJA 3VTZA 1Q17A 4IEFB 5DPMA 3RYTC 4KXYA 3NVMB 1N92A 2MSDB 2AN4A 3QF4A 1WUKS 1FVOA 1GCAA 1UJNA 2HKIA 4Y0AA 4LJ9A 1WP9A 3N39C 1U9JA 3ONFA 5FJIA 1KHHA 1ITZA 1MFZA 1MO2A 5FF9A 3V2IA 4BIMA 3QE4A 4F86A 1SUBA 3CF6R 5TEWA 4X90A 3B1KA 5ADVA 1QNFA 4EBFA 3D1JA 3D8BA 3PSAA 4YXFA 3BF8A 5TMDA 4JOQA 1KVQA 1LFAA 1MA3A 1AUOA 5KWEA 2ZW9A 3TMYA 3ES9A 3LC1O 4NE2A 3TQSA 3WQHA 3EEOA 5BQ5A 4C07A 1JJVA 4DJTA 1P1FA 1GO2A 2LPMA 3KZOA 5ALLA 5DEOA 4D0NA 2VP2A 3N9IA 2P9JA 4Z8XA 1IN6A 3AUUA 1MQSA 2HXGA 3NIBA 5KQGA 4XCQA 5L4NA 1YF3A 2HA4A 1XPJA 2D2VA 2VPXA 3GC6A 1MX9A 2JGLA 3MWGA 4JDPA 5CEJA 1E96A 4JJ8A 4ZT5A 3GLRA 5BYKA 4F38A 4ZVKA 1B0ZA 2HRZA 4M7OA 3VU9B 3WC4A 1W6RA 2YH2A 1PK9A 4L16A 2OGWA 1H6BA 1RQ2A 2VYFA 4WN3A 1GGVA 2ZUFA 4UCFA 1XF9A 4DARA 5GZ3A 3SZGA 2YXPX 3VBEA 4EX7A 3HUTA 3SGLA 3W77A 3JXEA 5HKAA 1NRJB 1U8CB 4RZQA 1ZNQO 4UHFA 5K5EA 1K27A 1DXYA 1PTJC 4FLEA 3YASA 2WILA 4E5VA 1F2TB 5AW4A 1OXVA 1JAYA 4L74A 4LNUA 3KR2A 3PVSA 4DQVA 5B64A 2JB9A 1J9EA 1XO1A 1UKYA 3GA5A 5DYYA 5AJYA 3P0EA 4CIDA 2AMYA 3T0FA 4IH9A 3V00A 1ISFA 2QQFA 4EVIA 2NAPA 2WUFA 1E6WA 3D2CA 3DBVO 2Q4BA 2VHTA 4Q3BA 4LCEA 1F6WA 3MRVA 4NLLA 4R41A 1O87A 1MV5A 2GAFA 3KJGA 3WMFA 1JXAA 2NU7B 3G2OA 3CXRA 2EP8A 2JBAA 4PCUA 5JZBA 3O8BA 3NC0C 1NHGA 3L8GA 4MVJH 4LK3A 4E5YA 5A4FS 2Z8YM 1WQ4A 1CFJA 5I9MA 3ROGA 4TV8F 1I3KA 4CM7A 2WB4A 5C7LO 3BL8A 1W6UA 1M34A 4M46A 3T7TA 3HWSA 3LMKA 1R8SA 4B7ZA 5L53A 4AQYB 4EPVA 2VOJA 4J9UE 5DIZA 1FUEA 3EVEA 4BLRA 5D87A 2P91A 2OO5C 4MPTA 1WEHA 4DPMA 3ZHCA 3G8AA 1A50B 1Y3FE 3B6ZA 2W2LA 4ER0A 4ZFNA 4J4TA 1Y1TA 3OH8A 4PFSA 4Q1CA 2RDMA 4BCCA 3OF2A 4L6CA 2PJRA 3D4NA 4PSKA 3MILA 4FYWA 2M6SA 1HA3A 2QM0A 1JMYA 1Q11A 2POCA 3F8SA 1G5HA 1L6RA 3LP6A 3T3DA 3CQ9A 3IUNA 4DCNA 3BD6A 4TYYA 4U7JA 4AS1A 2JA1A 3PA6A 4MGKR 1CIPA 2D4HA 3BSSA 2IYQA 2RSLA 3GLHA 4NBNA 4WPGA 3FOEC 1TA0A 1E5TA 3SG0A 5IJXA 2GM3A 4X91A 5CDSA 3BHNA 4EDHA 4PBTA 1Y3BE 3A1WA 1R00A 1O94D 2YZ7A 2H0RA 5JS1A 2IY7A 4FTWA 1X1DA 3RYCB 1KDYA 3TJZA 5L95A 2DRIA 1XKXA 1QU2A 2AZDA 2BR5A 2VSNA 3P2JA 2A5YB 1NAHA 1ESMA 4E6PA 1HRKA 3U19A 1U6KA 5IKEA 5IAKA 2F55A 1COWA 2V7UA 2JKYA 5EZYA 4FONA 3OQNA 2H85A 2OVBA 1DTWB 4XH9B 1OTXA 5T41A 3P2YA 1D04A 1YZUA 3I76A 3UGQA 4RY8A 3OM1A 3AF6A 1UAGA 1UJBA 3HLTA 2XH8A 4I4LA 4RZ3A 1TLLA 4R9RA 1MGOA 1PR9A 3PL1A 4MQ4A 4OBBA 4X85A 2Z5FA 3UYKA 4RESA 4DGSA 5K45A 2Y1LA 2PT6A 1GAEO 2I6GA 2XECA 4C6TB 4FFMA 3QVSA 1X1SA 1IONA 4KKXB 1CB7A 3DZGA 2ZYIA 3NLLA 4FJ1A 2I6SA 2WJ4A 3LO5A 4FD2A 4UQPA 3E0QA 2PFGA 2VHUA 5INTA 2YOFA 1WW2A 3NBZC 4N5HX 3FLMA 5H1YA 1MHPA 3QF7A 3B60A 5B1YA 1O97C 3GT7A 4L8FA 3CNBA 4KR9A 2C2KA 2AD1A 4GM0A 3UOGA 1QWSA 2CLHB 1PTKA 2NSDA 3RFCA 1QQ6A 2JA2A 1ZJJA 2PWBA 1UAAA 4N3CA 1TAUA 1YD7A 3CG4A 2P0EA 3TTYA 1SCIA 1R0RE 2J9RA 3O8DA 1YTLA 2JBWA 1EIWA 2YWRA 4HYQA 3R40A 1S2GA 4JQCA 2X40A 3KQYA 3H86A 3P9ZA 4DUGA 1NF2A 1I4LD 2YICA 5EG5A 1GFWA 4O5OA 5IAOA 2H7YA 3AHDA 3E2PA 3CF2A 1I2BA 4BX3A 3WGHA 2QSZA 3FPAA 5JAQA 4D0GA 2O0MA 4H1UA 1QGOA 1T5BA 2IXFA 3NDPA 3RSFA 1RYYA 1TX4B 5DOZA 3UMCA 1MG0A 1AHPA 3HQ4O 4BN4A 4K03A 1SBYA 2V7PA 3FN4A 5A62A 3K9QO 4MWEA 1W1IA 5JS7A 2YIDA 3HCFA 1FEZA 3UAVA 3ORFA 1XEAA 1NOKA 2GNAA 2JIMA 3F2VA 3FUXA 1GRQA 3G1UA 2DUMA 4GP9A 1QX4A 3G2KA 4MUMA 1W46A 3DLIA 5G4KB 3GVXA 3CWZA 4LISA 3EXEB 1HDXA 3F6CA 4BNJA 1I2AA 3DVQX 1XVAA 1Y3HA 3LH5A 2Z09A 3LT2A 4XJXA 1SXQA 2HNKA 3ZGLA 2B2XA 1IIRA 3RSSA 4FM9A 4IGEA 2XCTB 3U4IA 5EWJB 2E6KA 1U5CA 3F98A 4KE9A 4WUVA 4CF5A 2ADMA 1FSZA 2UXBB 5EUQB 1KQNA 1H85A 4YRDA 2VP5A 1JU3A 4GSLA 1M3SA 5AW6A 1GQQA 5JYEA 5LLSA 1H9BA 4UDOA 4WZ6A 1J39A 4ALJA 4P7FA 1C2TA 1YR6A 3K2QA 4V0MA 3Q2OA 2O5CA 3DO5A 2QQ0A 4PZZA 3Q8MA 4MV1A 3BE5A 3OIFA 4UATA 4DDTA 2X4LA 4EY6A 4YCSA 3VH2A 3QLVC 1Y9DA 2QTVA 1CUVA 3MCVA 2YTZA 1RI3A 4KWTA 4XIGS 3AERA 2WHPB 4G1VA 2UXDB 1V71A 3FLEA 5LQUA 3VVBA 3WR5A 2OEPA 5L7TA 1G41A 2WZCA 2ZIEA 4C43A 3DF9A 1EGQA 5LXTF 1EFVB 1E0DA 1NI5A 2ZJ7A 2FF7A 3DQQA 3GEHA 3JQCA 3VOSA 4H0FA 1QGZA 4KLZA 4BO9A 1FLVA 1ZIYA 3C5HA 4KWCA 3CGWA 1FDIA 4YRJA 2OCLA 2VZ0A 5FH9A 1JPJA 2X77A 4X44A 4QGAA 4UXHA 4F7DA 2Q5OA 3CWCA 4I0WB 3GO4A 1Z6AA 3FVVA 2C42A 4DR4B 2PIDA 2YMPA 3JQ7A 2NXNA 2D1SA 4UHKA 4XUGB 5FBHA 5HRCA 1KBQA 1SQ6A 3N86A 1VDMA 2WT4A 4NONA 4TRMA 4S1OA 4M0MA 1H4QA 4M86A 3SI7A 3TGPA 9ATCA 2DE0X 4OMFG 1HZJA 1ZITA 4KQJA 4X92A 1L4KA 3QPVA 3VTKA 2BKEA 4RMNA 1LDNA 2X8LA 5AK3A 3D8NA 4YUZA 1A27A 3MQFA 3AESB 1SMKA 4LXGA 5D3KA 2WFAA 4IR7A 4NKRA 3L0OA 3UJHA 4AJ9A 1PJTA 2J4FA 1NMZA 2B8NA 2P6PA 3JQRA 1JAHA 3V7UA 3ZEAA 4PX9A 5GMOA 2UUCB 2Z5LA 3KO8A 2GHIA 2LP4Y 3DZIA 4FK8A 4J1TC 3WRWA 4UOZA 3IEKA 5JTUA 1PZGA 1XZEA 3MAJA 5HF5A 2VQSA 1B00A 2ZWOA 1OH8A 3T5TA 4KXMA 2HBZA 3NHMA 4XWYA 1XNQB 2BGKA 3EDOA 4NOLA 3K05A 2WM3A 2P1ZA 2ZI6A 2ZSHA 4ZT3A 1IXSB 1L4NA 3NP7A 5ALEA 1B0AA 1RRVA 2PVCA 2FX3A 4QOIA 4OHYA 3A2LA 4PO8A 1EWRA 2PBZA 4CE6A 2XUKA 2NUPB 4XUDA 1ZM4A 4EH1A 4ZJZA 5BWOA 3ICWA 1ZN2A 3UMVA 4TQUS 5BV7A 1U7ZA 1JHYA 1WCYA 1X1EA 2C5HA 3NC1C 5LDDC 3HCBA 5CDUA 1SG0A 2QRVA 1VJDA 2CXRA 1W47A 2VNKA 2A6PA 3IDZA 3PPYA 3N7UA 4NOJA 4RPCA 4A2PA 1OZ0A 2B8EA 3I04A 1W7AA 3OA0A 3V8EA 3X1ZA 1R4AA 3UM9A 4UDXX 3FZQA 4C0XA 4F3CA 1XL1A 2ENUA 1CPYA 4A2CA 1DUIA 3WYCA 4D4JA 4MK4A 4IHAA 4WZZA 1JQBA 1Y8ZA 3G7UA 2J87A 3IKVA 1WOMA 2OZLA 2WIGA 1P6XA 2ON6A 1DJLA 2YFHA 1ZL2A 4DR5B 2JIRA 1WY5A 1V3VA 1EHIA 1QO0D 4BC0A 2QVYX 3C24A 1WTCA 3DDCA 3DMHA 1TQ4A 1KZHA 1A1VA 4UVGA 1DT3A 4Z4EA 1WJGA 1A9QA 3QI2A 1TVKA 3U9TA 3RVOA 2XAUA 4KXLA 4A82A 1QO9A 4B6FA 3B53X 4TV9B 2O5EA 3T3NA 2Y9MB 4Z3OA 5BPFA 3OC6A 4EVRA 4R9SA 4EHNA 3BIFA 4FFOA 2H2DA 4IJMA 4QYTA 3SFTA 3LPAA 1OIXA 1PVOA 2WA1A 1E3EA 1H2ZA 4IRUB 3ELUA 4ZCQA 4GRAA 1KORA 3UQZA 4YMTA 3ZXYA 4M8IA 2GH1A 4INOA 4ESEA 5CB4B 4KO4S 3EUEA 4WXMA 3WADA 1WL8A 1Y4DE 1LLFA 1OC4A 2CDBA 3N2LA 2CF6A 4UMFA 3LYHA 1D3AA 4M3NA 1UKCA 4YMVA 1KI1A 4B3DA 4EW1A 2OCBA 3FFTA 1E62A 3LECA 2GCOB 4C22A 4BFXA 1G0OA 3ZWXA 3GFVA 3BXFA 4Q7JB 4NCKA 5CCBA 2XT6A 1ZD8A 2P9GA 4OK3A 3A9WA 5D51S 4BFCA 2A5FA 4PYKA 3RS8A 4BC1A 4UARA 4EY3A 4FDTA 3CLTC 1T6XA 4HQLA 4Y1FA 5JBQA 4W5OA 3I1YA 3NYWA 3DFFA 4HWPA 2I6TA 2BMFA 3TSOA 3LW8A 3PITA 5ED0A 1TQHA 2OXTA 2AMJA 3VPHA 4ESOA 4RPKA 1TD9A 4ZQBA 3EY4A 1CUEA 1V5IA 4WBNB 3LCVB 4IJWA 1KPHA 3W5BA 5ER6A 4E5MA 1NUUA 4M9ZA 4QVGA 1NZFA 1Z4JA 3OZSA 5B3LA 2XRZA 2VSYA 2FR8A 2NZWA 3B1YA 2WR8A 4MW2A 2OXCA 4YEDA 1SQ0A 5CLLA 1NN5A 1KAQA 2AVDA 3HKDB 5F35A 2WLSA 3JQAB 1WSBA 1FP6A 2ZSBA 3OZRA 3QKRB 4IDDA 3ZKWA 3W6NA 4BMXA 1V95A 3LHSA 4W5WA 3NH9A 2JAXA 1WXQA 1IY2A 5I51A 4UU0A 3LUAA 4O6VA 4G0YA 2WJPA 4PWYA 4G56A 4TOIA 3RBVA 2I3DA 4TTAA 2WJIA 4V0NA 1BS1A 3ROKA 3BXXA 5IVHA 2QRKA 1RXVA 3GRRA 3X1KA 2Q07A 2C7GA 3FYTA 3WGMA 4AQDA 2VYNA 5F33A 5C35A 3V4FA 1KWKA 3SDBA 3AVPA 5CFOA 4B4VA 3FDXA 5HUQA 2P6RA 4XPIB 3NASA 1QTRA 4LUCA 1JNYA 3UAZA 1H1TA 2C82A 2HPVA 2C7BA 4WASA 1BAPA 3F6SA 4G1UC 3VSAA 3LOQA 1QOQB 1FFHA 4M8NE 5ICFA 1OC2A 1MEJA 5HNKA 1TKAA 3JYLA 2X22A 4KBFA 1WMBA 2DQSA 2I2CA 3HDHA 4RD0A 4TLBA 5DCLA 3RTBA 4B3JA 4CW7A 4F5ZA 2WLTA 4YIKA 1KY5A 1ODJA 1CIJA 1DKLA 2XXJA 5E9QA 4NFLA 1TU3A 1T2UA 3A1CA 3R74A 4AZWA 4EL5A 2GK4A 2XVXA 3DHNA 2GYUA 4QUIA 1KAHA 3JARA 5F5LA 4JLSA 1II9A 4CMJA 4PLWA 3OU6A 1FBTA 3JTMA 5DOVA 4TVSA 1GGMA 1N0WA 2DU8A 2FSHA 5KQRA 4JJFA 5LQDA 5AVSA 4A8HA 1GG9A 2PUHA 3G0DA 5TT0A 5KYKA 4R8VA 2PV7A 2C78A 3H5TA 4WESA 1J24A 2IRWA 4AB1A 1FDWA 3GWZA 3CUKA 4UZEA 1Y6FA 3EDMA 1ZUNA 1ZNXA 4HPJB 3R1IA 1SOVA 2H1IA 4D9MA 2A14A 3IT3A 4C7BA 4BKRA 2X41A 4LYGA 4PAGA 3SP1A 4DYDA 1VA4A 2PUJA 5TY0A 4E11A 3V46A 2A5JA 1QUEA 1Z18A 5HKKA 3TXYA 2VQEB 1NIJA 2RAFA 2X5JO 2YFQA 3TLJA 1I3LA 1AKMA 1KOLA 4ZK2A 4Y2PA 3RF6A 3PJFA 3H18A 4DSOA 4MCHA 5B12A 2QD1A 4DYHA 2FJUA 3DFMA 3DLAA 3EDQA 1BVRA 1KY2A 2ST1A 4JU8A 5DMHA 3W7BA 3O83A 1V96A 5DM1A 2D0DA 2P3QA 5EFOA 5SICE 1IE3A 4ICIA 2WP0A 3RSGA 1BA2A 3KLMX 1NVKA 3R0ZA 3CE6A 5I48A 3WK7A 1GG2A 2BY4A 3AJRA 4OBXA 3U1BA 3I0NA 4P0QB 2QUJA 3EMKA 4M21A 4GIBA 4QO7A 1Z73A 4M0FA 5EHGA 3NM5A 2VNAA 4JNCA 4YA6A 2DBZA 3PFNA 2BSXA 3L93A 3SF8A 4JI2B 1R6XA 2ZSJA 3EEBA 3B1XA 5KTNA 1KFJB 2E5FA 4QWMA 4LDRA 2HCBA 5IFLA 1DIOB 1JA0A 1IBRA 4Q9AA 2IEYA 1OVGA 1P9WA 3HY6A 3RJTA 1EB9A 2EJCA 4II2A 1SU4A 2EF0A 2IV3A 1Z16A 5MFPA 3E6AA 2ZTLA 1AMOA 2QJFA 2IZOA 3OP4A 4H7DA 1Q7CA 4NHEA 4U9IS 3RSLA 1ABBA 4MKIA 3DCJA 5AQ1A 1GSOA 1DG3A 1KDOA 2YJ6A 5K20A 4RS3A 5CR9A 2KM1A 5E95A 1A9OA 2GDZA 1NXWA 4QE3A 1AX9A 3WBFA 5IDYA 2WOJA 1MVOA 2F17A 5T67A 5IFKA 4HJXA 2IY9A 2GSDA 1E6UA 1DWQA 5E8RA 9GPBA 4PRZA 5FEUA 3IQHX 2LRHA 5ELMA 4IIDA 1OAKA 2HRCA 1ADBA 3PGXA 3WLHA 4MRAA 4BLOA 4HK4A 5TB5A 2PR2A 1G7RA 1UZAA 2FJ0A 3JS5A 1V5FA 2Q9AA 3EK2A 5TQ2B 4DUYB 4DY4A 2VATA 3ZUPA 5EZ5A 1Q2XA 3GGSA 3PNKA 4G0XA 3EOBI 3SIPA 3KT8A 4KIWA 1KYWA 2EWMA 2IIPA 4RH1A 4BEVA 3NIFB 2IS6A 4KFCA 1RYMA 4QX6A 1T34A 1A98A 3WFJA 2JC3A 2EV9A 4AXBA 3S40A 3HEAA 4ZQHA 2O3TA 2KHZA 1CC1S 1M1XB 4QUEA 1SH7A 1Z28A 1CQWA 2CXNA 5LYYA 1LK0A 3HUEA 4ALIA 4D26A 1G66A 1DDGA 1MLDA 1PW5A 3VHXB 4WKCA 2B83A 5CT9A 5LSAA 3CRRA 3IP9A 4GMHA 3W2IA 4OYYA 1Y8AA 3C5WP 5FKJA 3PCTA 1SURA 3TQOA 4M7PA 3I8XA 3ZBTA 3A4IA 2PU7A 1FDOA 5KHLB 3JWHA 2C2GA 1XHEA 1TVMA 1CSEE 1AA9A 2VAMA 1C9DB