4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Cholinephosphate cytidylyltransferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
1KH3A 4NZPA 3P0HA 4MUFA 1TFUA 3P0JA 5KWVA 3Q10A 3SEZA 3N05A 1IH8A 4KPUA 1NP7A 1JIIA 2D54A 1R6UA 1N77A 4JXXA 1OWNA 3K9WA 3NV7A 1MAUA 2Z08A 4K03A 1NUQA 3MUEA 1XJQA 3FOCA 3G5AA 4J76A 3S3TA 1VBMA 3ND6A 3RHSA 4UZEA 3X1JA 4X0EA 1EFPA 2DUMA 3RJZA 3SEQA 1WKBA 2CFOA 2PXHA 2X1MA 1I6MA 1MC1A 1OWLA 2QJTA 2DETA 3SZ3A 4MW2A 2TS1A 2YWCA 1VLHA 2J07A 1NSYA 4MWDA 5TGTA 2AZXA 2DLCX 1TYCA 1F4LA 3N8HA 1N2GA 1WXIA 1H3EA 4ZT7A 1MJHA 4EG5A 3FIUA 4RPIA 4NAHA 3UY4A 5FO0A 4PBTA 3A05A 3X1KA 1T6XA 1ZH6A 3SP1A 3COWA 1OBCA 2A1UB 1WQ3A 2PG3A 4CQNA 4KPUB 4PBSA 3E27A 3L93A 4GRIA 5KHAA 4ZCSA 1Q11A 1QNFA 4AQ7A 3IDFA 1O94C 2A84A 1JILA 3AG6A 1ZH0A 1H1TA 2CUZA 3FETA 2QJOA 5HG0A 1K4MA 1J70A 1MRZA 5H16A 3HFJA 4JFAA 2QUIA 4YP7A 3SZGA 1K92A 5JBNA 3VRHA 4EG3A 3P52A 4MW9A 3BL5A 4P2BA 1V47A 1WY5A 1GLNA 4S1OA 4F4HA 4MW5A 2CSXA 3IODA 3ELBA 5DEOA 3QE4A 2QUHA 3IMCA 1IFXA 2HGZA 4MUGA 1EJ2A 5DK4A 3ILVA 1TYDE 3FH0A 3H99A 4ZT6A 4JYZA 1GAXA 2Z3VA 2PFSA 3A04A 1WXEA 4KR6A 1U7XA 1DNPA 2VXOA 2GOYA 5J5AA 1JIJA 2XRYA 3GMIA 4L2IA 2A1TR 1BS2A 1G59A 2IELA 3AG5A 2NSYA 1WXFA 4DDMA 3CLSD 3CVYA 3IH5A 4Q16A 1J20A 4EF6A 1ZUNA 4UZFA 3GLVA 1FYDA 2PZ8A 4DE5A 3IUBA 2R5WA 1GPMA 1Q77A 4MVYA 2QUJA 1XNJA 5KCMA 3ZUGA 3KFLA 3MMXA 4I6GA 1OD6A 1JEDA 1T6YA 3PRHA 3U1VA 2DEUA 1HYBA 1EFVA 1RQGA 3P0IA 1B6TA 1WXGA 1R6TA 3CLTC 1PFWA 1ZJWA 2A1UA 4R2MA 1YIDA 3MLBA 2QJFA 3IUEA 1TEZA 1MAWA 5TEVA 4MWBA 2OV4A 4XSVA 4HJRA 1KR2A 1LI5A 3CLRD 2J08A 3INNA 5FO1A 1LW7A 4HJXA 1K4KA 2GKSA 1H3FA 5TS2A 5IHXA 1T9GS 1M8PA 3HGMA 4EGAA 3CLSC 3DPIA 4I6EA 3AL0C 1M8GA 1CT9A 1XNGA 4FZJA 1EFPB 3FY4A 1EUYA 1IQUA 1N2HA 2YWBA 1R6XA 3ZGZA 3OP1A 3H97A 1OWMA 2H2AA 2C5SA 4OUDB 1JEEA 2X1LA 3K32A 4CDNA 1MB2A 5AHWA 2HMAA 1Y42X 1H3NA 1I6LA 1OWOA 3CVWA 3PNBA 4U8HA 3RK1A 1U0BB 3DV2A 2XRZA 1U3CA 1KAQA 4EG6A 1TYAE 1KKUA 3FG9A 2WQ7A 3Q4GA 3FHJA 1NYLA 3HV0A 1WQ4A 4JZYA 4PY2A 4OUDA 4HPWA 4YMIA 1O95D 1TQ8A 3ZIUA 4MW0A 3D6UA 1F9AA 3DO8A 5F23A 1N2EA 2I1LA 2A1TS 3FI0A 1NUUA 3KT8A 4YBRA 3Q12A 3H9CA 1M8JA 2IJGX 1QRTA 1PFUA 4ZT2A 1NUSA 3AIIA 4R0NA 4EFKA 1K97A 1IRXA 3G6KA 3MXTA 4WNYA 5H7XA 5HUJA 1KH1A 5BNZA 4U7JA 3A4IA 3FDXA 1I2DA 1X8XA 1YUNA 2H29A 1G8GA 3PXUA 1KAMA 1OWPA 2NZ2A 3N2YA 1GTSA 1ULHA 1XNHA 1YIAA 1F7VA 2WB2A 1KQPA 3JXEA 1N2OA 1Q15A 3AKZA 4J75A 4MUJA 3UC5A 4GU5A 4EG1A 4ARIA 2D5BA 2CT8A 3PNVA 3UK2A 3KT6A 4WSOA 3D6VA 1YULA 3X1MA 1FFYA 5DB4A 5J58A 3A2KA 4ARCA 1MB9A 1JGTA 3RK0A 3F3MA 3IOCA 1N2IA 3ZXSA 2EL7A 2ZP1A 1KP3A 1U7DA 4MQ6A 4I6JA 4HK4A 1O96A 2J4DA 1YI8A 3UMVA 1IQ0A 1G8HA 4R2LA 1KORA 2DXIA 4CT0A 3TS1A 3ZJVA 1NI5A 1JHDA 1VBNA 3HMQA 4MVWA 2E0IA 3IOEA 2X0KA 4G5YA 2CYAA 3ISJA 4QREA 3CLUC 1SURA 5FNZA 3N9IA 1M8KA 4DLPA 1N78A 3CA8A 3CR8A 2WQ6A 1LI7A 1KQOA 1O96B 2Z09A 1O97D 2E18A 4E1AA 3RBAA 4BWVA 2PZAA 5HUHA 1QJCA 2J09A 2QTRA 1JECA 3NBKA 4QRDA 2DERA 5LFAA 1EE1A 1J21A 3ND7A 5J59A 3GUZA 3PNYA 3QTBA 3CVXA 2YXNA 1KH2A 2V0CA 3TNJA 1JZQA 1G8FA 1MOPA 3UOWA 4EG4A 1O95C 4MVCA 2BTEA 2VTBB 1PG0A 3L92A 1EXDA 1M8FA 4DDKA 2AG6A 1PFYA 4ZCRA 4Q93A 4DNXA 2CV0A 4ZCQA 1COZA 4EG7A 1EFVB 1QRUA 3ZJUA 4MUEA 2RD2A 5K0SA 4KKVA 3VGJA 1JIKA 3RFFA 2VTBA 1O0BA 4RUKA 4MW6A 1A8HA 2O8VA 2PIDA 2GM3A 4KR9A 3LE8A 1J1ZA 3COZA 3TQIA 2JAXA 4ZT3A 2E21A 2CYCA 4KR7A 3LCJA 2ZUEA 2X3FA 1GTRA 1M83A 4MUNA 4ZCPA 3TZEA 3DLAA 1GN8A 2CYBA 2OQ2A 2QTMA 2A7XA 1V8FA 1O6BA 1J1UA 5K0TA 1O94D 2JA2A 1M1ZA 3COVA 3ND5A 4MVXA 4MUKA 1VBKA 4A91A 1NUTA 1NZJA 1T9GR 3H9BA 3MLAA 2V0GA 4AS1A 1ILEA 1O0CA 3G59A 4NAUA 2CV2A 2A86A 4MLPA 1N1DA 3ZXIA 1J09A 4PBRA 4ZT5A 4OJMX 4H3SA 2A4MA 4L2IB 2DPLA 4XFDA 1U3DA 1D2RA 3QTTA 4TS1A 4MUHA 2ZUFA 2YY5A 3CLTD 1MBZA 1WOYA 3FNRA 1IVSA 1IQRA 4XFJA 2JANA 5TEWA 1I6KA 3CLUD 3ZJTA 4G5FA 1UFVA 1JMVA 1N2BA 3H05A 4JXZA 5DASA 3HZRA 1GZUA 1S4MA 2CV1A 5LM3A 3I05A 1QRSA 1QTQA 3SYTA 4MW7A 3IMEA 1VL2A 4K0RA 1F7UA 4ZT4A 3M5WA 5EKDA 4EG8A 5LLTA 2A88A 1NURA 3IVGA 4DDHA 4ND7A 1YUMA 3COYA 2DR2A 4NDAA 3FWKA 1EUQA 2RE8A 3IVCA 4YP6A 2HZ7A 3C8ZA 1JZSA 4QBTA 2IP1A 3SDBA 2QUKA 1X6VA 4MAFA 2B7LA 1KQNA 3TZLA 3TQOA 1PFVA 1TYBE 4MW4A 4G6ZA 3CLRC 4U63A 1Q19A 2E89A 2D13A 1N2JA 1WZ2A 1O5TA 4CDMA 3IVXA 4MW1A 1OBHA 2WSIA 4DJAA 4ND6A 3CVUA 2J5BA 2PZBA 4MUIA 2AKEA 1WJGA 3HL4A 4MULA 4NX2A 1P7PA 1O97C 3IOBA 4MWCA 3NBAA 4NATA 4YP5A 1N3LA 1NUPA 3OTWA 2O5RA 3IMGA 3VU8A 1N75A 3AFHA 1QQTA 3LOQA 2QTNA 3KT3A 1QU3A 1T6ZA 3KT0A 2G36A 1IHOA 5IJXA 3CVVA 1WXHA 1QU2A 1KP2A 1PG2A 4ZCTA 4MWEA 4F3RA 2BYTA 2EJCA
chains in the Genus database with same CATH superfamily
3QF7A 2IW1A 4FKZA 5FBLB 2Q0XA 1LSJA 2OHIA 3R5TA 3SFTA 3VJKA 5C18A 4Y6PA 1T3ZA 4GT1A 3RROA 2V03A 4N47A 4BU0A 2I4LA 4PLGA 4WEOA 2PL9A 4HS9A 5IDVA 4G8DA 5JTTA 3IQDB 2CY0A 4Y1EA 1U0FA 1IXZA 5CVJA 5D86A 4NU6A 2VNKA 1NWHA 3MG9A 3GFOA 3ZV5A 4UOEA 4CM7A 3K9WA 1HFWA 1YQUA 2C2GA 2FPGB 4M86A 4XVHA 3ZQ6A 1X8JA 1MCZA 4TSFA 1FDOA 4U7TB 4EKYA 3L6RA 3MWEA 4DIEA 1W96A 1YL5A 3FOCA 1IN1A 1S7CA 1ZGBA 3MSXA 3OOYA 1M34A 1I7DA 5CT9A 3LK6A 3ZU2A 2ZI9A 1GSIA 2IYTA 3R8FA 1KC1A 3WKCA 1S2DA 3BFJA 1TOAA 2RKWA 3D0KA 4KGXA 4J07A 4ONEA 3GLGB 3E5NA 3FTDA 1CULC 3MJSA 3OFND 4PTLA 4BX9A 3IP6A 3ED1A 3NW9A 4Q02A 3VKFA 4LAFA 4MGIR 1TYCA 2FKAA 2UU9B 4IQ4A 3GLHE 2XB2A 1FRQA 1ESDA 2Y71A 5ICGA 2HOQA 1FK8A 4MV0A 5HUQA 1P31A 3UY4A 3IAEA 4LXYA 3DDNA 1LDYA 1PWEA 3ZDBA 1E3LA 4L27A 3SP1A 5C4IA 4B3GA 1D1SA 2FZ5A 3S28A 2FPGA 3AF1A 1UDRA 3AESA 3ANSA 1QP0A 2LNDA 1US8B 1XZAA 1JA0A 3FAZA 3L7IA 3O8DA 4GBED 4R40A 1MKYA 4NMHA 3MGGA 1JMYA 2H6EA 2NT3A 4NZ9A 3W6ZA 1OLSA 4BJ5A 1M0EA 1PSZA 4BJ6A 2FNAA 4DDTA 1C7IA 3R6LA 5ALDA 2Q9AA 2QVCA 3ZY4A 1GM5A 1CEXA 1RLJA 1JSLA 1G5FA 1Y4UA 3K6JA 3RANA 1MGOA 4EQ6A 2PXXA 5DO9A 1AKYA 1UEIA 3Q6NA 3QWIA 3GP3A 2AIRA 1NXOA 4MV4A 1WPGA 3NX4A 4PFQA 2FZLA 2HA2A 4WZBE 3FKSD 1NV9A 3JZIA 4PGMA 1LQUA 2JK1A 1V35A 2X0DA 4OLAA 2RHWA 2ZYDA 1V5IA 3E5RA 3ZZTA 4ZVOA 4RHXA 5KNDH 1ZK1A 2CSXA 1CVRA 4LJYA 1ZICA 1CUGA 1TKCA 1U2EA 3K71B 5K51A 1M0TA 1EFLA 1VIMA 2FXIA 3DV0B 5BN4A 2YFKA 2PX8A 5MDHA 2I4TA 5EJIA 3K4HA 3UH1A 5KSYA 2HGZA 2AN1A 4A8PA 3MM4A 5JSZA 4K9LA 2FZCA 3AM3A 5CVTA 3ILVA 3DUFA 2AOVA 4P86A 1MZPA 2F4VB 3C8HA 2O0JA 3OOEA 1WCIA 1DNPA 3WICA 3PC3A 5AO9A 1Y4SA 1KJ8A 1G5RA 3SXPA 2P9CA 5EZ5A 3TIFA 5KX5A 3G1TA 1Q12A 4GECA 4QJ4A 1XMJA 4YMUA 3NI2A 4L74A 1JQ5A 2QR2A 2BH9A 2BM1A 3C6QA 1NVXQ 5LQNA 1TVEA 3RC3A 3AR6A 3OOJA 1XU9A 4HFJA 4QFBA 5AW6A 1M2NA 4MVJE 1SXHA 3L05A 5KI6A 2YFHA 1R8JA 5IVPA 1BKSB 3AY6A 2ZM5A 3FYSA 3KDAA 4PVDA 4TLAA 3PFWO 4YXFA 4EHAA 3D6FA 4I6GA 3KEOA 5DWQA 5H5JA 5IUKC 1RCTE 2EIXA 1RBQA 5SICE 4HVAA 3CUYA 1W2HA 3CRW1 3SHWA 5CDHA 2IKQA 1PTJC 4GR5A 5KOYA 4HNAA 1Y9DA 2ZRQA 1OZFA 3F6CA 4UDNA 5AW1A 5E3JA 1RQNA 1O5OA 1R6TA 4IYJA 1Q57A 4FFBA 4PLYA 1NVTA 4X20A 1Y1SA 1ZK4A 2XGJA 2O8FB 5BV8A 1ZI6A 3AEYA 1TZBA 3AF3A 2V6FA 4JBWA 3HVUA 4XSVA 4A73A 4AF6A 1UODA 3CLRD 4CIDA 1X13A 1UOPA 4GRDA 5G1OA 3H2HA 2Y2UA 3V7WA 1A8PA 1ZCJA 2ILVA 3C3XA 1GUDA 1M8PA 2C59A 3GCGA 2G9ZA 2V7UA 3FBWA 4JOSA 3CLSC 3GP8A 3FGNA 3WLRA 5E9AA 1QIMA 4BUZA 3CT6A 4ITRC 1CT9A 2AN5A 3GG9A 4OHXA 1EUYA 2J3QA 4DLXA 3CYFA 1JKIA 3IKMB 3K4QA 4KNVA 5IVHA 1ELOA 4UBKA 5DYNA 3WRYC 2HNKA 4LDJA 1L4MA 3ROGA 1XZHA 3TB4A 4BB5A 4CDNA 5GZ3A 5AP9A 5A2GA 2IOHA 3RVOA 3VNQA 1TJ3A 4A92A 3L9XA 1MT0A 4C2BA 4RL6A 4RVCA 5G4LA 1AA6A 1OVMA 5I7HA 2I8CA 3VHXB 3Q5EA 3KJQA 3CW2A 4HMQA 4PSAA 4NU0A 2YHSA 1D4FA 4N03A 4NC9A 5K01A 3DHYA 1XEXA 2BFNA 2BHSA 4IY1A 5HOEA 3JX9A 5KQPA 1P6XA 3AOGA 3QELA 4R3NA 1XDSA 5EGSA 5GVRA 3GFSA 1PEDA 4S0XA 1PD0A 4BNKA 1SO8A 4FDVA 3LUBA 3I04M 3JARB 2VCYA 3PDIB 4GP7A 4A15A 4KR3A 4P58A 1NVVQ 2E85A 3B8HA 1W35A 3C24A 4RGBA 4D6YA 2JJYA 1COWA 5KYXA 2QVZX 2DH5A 4E08A 1Y1RA 1DAMA 3G8BA 4M76B 1UT6A 5JI3E 1I24A 2TMYA 1F9AA 4OLFA 4XJSA 3RABA 1N2EA 1BVYF 3OX4A 4TWIA 2JLUA 3WK7A 3T3OA 3HL0A 3C7AA 1NQWA 4TS4A 4UHJA 4C14A 1P17A 1DEHA 5DHFA 2IJGX 5CH8A 1U3UA 1KTVA 5DWVA 4R0NA 4Z86A 4INPA 1ACLA 1KC3A 1TM7E 2LPMA 2JH8A 2P41A 2QZZA 1HTWA 3MXTA 4WFKA 4YACA 2VKTA 5CHYA 2H00A 3VKUA 5JYBA 1HT1E 2I8AA 3ZGXA 1JIUA 3W8RA 4ARZA 1YCFA 3H6KA 1LZKA 4HAOA 1L1RA 4GLLA 1VE3A 1J6UA 4N82A 4K7JA 2OBXA 1FPMA 3BMOB 4BIIA 1G8JA 1RU3A 3S2FA 4DCTA 1G6Q1 1TRKA 3PFGA 3PNLA 3KB2A 3FPAA 3L6UA 1QKIA 2XXBA 5G02A 1HOXA 1FFEA 3CG4A 5KDOA 2Q07A 3ROMA 2B25A 3HCBA 1CW2B 1Z5UA 2JF0A 5LQCA 2EERA 3JYHA 4P5DA 1NDUA 2QN8A 5GZ6A 3DKVA 5EIAA 3QEMA 1Q44A 3ZLVA 5HMMA 5KQSA 3A31A 2Q4RA 4RYLA 1CQJA 1MAVA 1BDJA 2YQZA 4QLBA 2QYTA 4DXDA 1BXRB 4EA9A 4H3VA 3RRZA 1CY0A 4ZQEA 3WLNA 1F5SA 4FZVA 2IH2A 1U5BA 3QVKA 2XH8A 5ITZA 3O8NA 4UU1A 3FCSB 3I76A 3CVOA 3A2KA 1XFAA 4B2PA 3QJ5A 2JIBA 1IL0A 2QWXA 2R4UA 3DHEA 3HLTA 4LE2A 4WW0A 4C2TA 5KWIA 5D1NA 2X40A 3A11A 1XU7A 3ILHA 2H9AA 2D3WA 2JEOA 3UW1A 3VYSB 1OJ7A 3NTXA 1O96A 4JWKA 4GYWA 3DHNA 5COQA 3UMVA 4MS1B 3CF6R 5JHGB 1B8VA 2XEXA 4IDNA 1YZUA 1V43A 2I29A 3EN0A 5CEJA 4WOJA 1YDGA 2XCQA 1AF7A 3RREA 2C00A 5TPZD 2ECPA 4GWKA 1TK2A 2D00A 5K3OA 5AOAA 3TDKA 1U2GC 3ZR4B 5FJJA 4JC5A 3DUWA 3RVBA 2NYRA 3B9QA 4HB3A 4IDQA 1HDXA 4NFLA 2RHCA 1ZCAA 1PVVA 1N78A 2IWHA 3JWJA 4L85A 1F1JA 1LD3A 1T8RA 4XGNA 3O8CA 1VSTA 2WE7A 4QDKA 4GMKA 3TOCA 4IGIA 4U6QA 3RBAA 4P33A 3QMPA 1JA9A 4IR7A 3VNBA 3KKOA 1DARA 2QTRA 4M6WA 1DSSG 2J9FA 2YYAA 3EIWA 3H2YA 2AF4C 4NXMB 1JEJA 4BJ3A 2HU2A 3JQ8A 5TPZA 2JAPA 2OYCA 1J0EA 1F0NA 1RM3A 4B84A 2VZ0A 2VWQA 2V0CA 4FYVA 1Y3AA 1JZQA 2ZSKA 4P4SA 3IAS1 3RJTA 3IP7A 2A0WA 2R87A 3ZW8A 2FN9A 1WULS 1MC8A 4JI6B 2YN2A 3A2LA 4MKXA 3RVQA 3EC1A 3OZSA 5EKXA 5B2EA 3EBLA 2FW6A 1N9ZA 1M8FA 1RHRA 3LGSA 1TCAA 4DDKA 2TMDA 3P2YA 1VDZA 1PFYA 2OCKA 3H42B 2PYDA 1ZOOA 4UARA 4XLLA 3KAQA 3COSA 5JV5A 5CYPA 1LQTA 4N0DA 1YVRA 4Q4DA 4LJRA 4KKVA 4NPAA 3U4QB 3DDSA 3OZWA 4P7FA 2A8YA 2A0YA 4PPYA 1X15A 1GPUA 4YAFA 3SG0A 3RSZA 1F12A 4DXAA 4K0KB 2HBZA 2JGIA 3BM5A 3L5OA 5F52A 2GM3A 1WPQA 3PGLA 5A7HA 2AR0A 3HBAA 4KR9A 621PA 1BCSB 4RVUA 4TV8F 4UAUA 4I8IA 1DELA 1BEEA 1KFJB 2VUTA 1RBMA 4IIDA 4AT1A 1KO5A 4DZRA 4MDHA 5IVIA 4W5RA 1CTQA 1IY1A 1EWTA 3AUKA 2UUOA 3L6BA 3NP7A 4P31A 3QP9A 1SQ5A 2IY9A 2NM0A 2ZUEA 2GYYA 1P5HA 1VXRA 2ATCA 4BO1A 4BX0A 3B48A 5BPFA 3I01A 3FYCA 4MUNA 4NZMA 3W5DA 5FPQA 5LZ2A 1PV4A 1S3GA 5CYGA 4BNXA 4D0RA 1T5SA 1CJCA 1ZXBA 1O08A 3HEMA 4BNMA 2H1HA 4IEFB 1VE6A 3DMPA 3ZBTA 4OHBA 4B32A 1CG6A 1UIRA 1U81A 2VDQB 1FYEA 1T0BA 3WJ2A 2WKWA 1EHYA 1DUIA 2WZQA 4LFAB 2O7QA 3A2NA 4P4GA 5G3YA 1YA6A 4Z8XA 2JATA 5D3MA 2Q4BA 3F67A 4BYMA 3OZXA 3M6IA 1C3VA 3T1QA 3UHPA 1PJ4A 4QVGA 4JVMA 4OHYA 1Z0ZA 4LFBB 5A4AA 4MYTA 1N5IA 1SBTA 3M9WA 3EMKA 4ESEA 3TGLA 1G3QA 1XTQA 2J41A 2Q3DA 3BSSA 4K3VA 2W6OA 3RV3A 1NU8A 1RLMA 3LK7A 2Q7XA 1T9KA 4DUPA 2IRWA 4BMPB 4RXMA 2OFFA 3U3MA 3PXCX 4QXMA 3UMJA 3CKYA 4CDGA 5KYWA 2YY5A 3WAJA 2WC1A 2QQ5A 5FBKA 4H7PA 1K0UA 1GPBA 5EZQA 5F5LA 3D5EA 3PA8A 1KEKA 2CGEA 3MINA 1KQFA 2C54A 3TMAA 2JFVA 4F12A 2P9EA 2PUCA 2YWGA 3VUEA 5JFGA 1E6WA 1CUUA 1ETUA 2M6LA 1DAOA 1GO2A 2G09A 2HO4A 3O03A 1M2OB 4TT8A 4MW7A 4UVHA 2QSUA 1BGVA 3FYHA 3H1AA 4NBNA 4QSHA 4YUAA 2QTHA 1CDEA 3UMFA 3J80A 1EE2A 1NWCA 1Y1TA 5DGDA 1F7UA 1XEWY 4JCOA 4QODA 3ZVNA 2VZ8A 2A30A 2JGLA 1J25A 1NURA 4JBHA 3L46A 5ARBA 4KUGA 4Z4EA 3V1LA 2HCFA 4KYVA 4NDAA 3L6OO 4CETA 1J2TA 5EQJB 4KIWA 1QGUB 1VRWA 4ZICA 3ZDXB 2OK7A 1AZLA 3AIKA 3VH1A 4BMXA 3OWHA 2QUKA 1D6NA 1X6VA 3GUHA 3N70A 4HAVA 3T4UA 1GL6A 2GZDA 3T9AA 3UPTA 2IYLD 1NQTA 4L07A 3AR9A 4WERA 3TZLA 3G9QA 1BTOA 221PA 4IDCA 2XKJE 3GFGA 3B2NA 4DTIA 5LA6A 2FH5B 3G68A 5H59A 2QMZA 3LZCA 1QIIA 4MV6A 5E2IA 4D9MA 2YV3A 4DMFA 2QTLA 1FNSA 1ZL0A 3R3UA 4HH1A 4Q9KA 4BLPA 1M7BA 3TBFA 2XTMA 3Q98A 3ESCA 4IIYA 4L0MA 5FBZA 1ONNA 3VNVA 3KX2A 3BCSA 3E9QA 3V7UA 4E2YA 1IIBA 3TNFA 3BSYA 1TM2A 4INJA 2JFFA 2UV8A 4PZDA 2ZLBA 5AVSA 1PT9A 2R97A 3NBUA 3TJRA 4YV7A 3PXXA 2GEDA 3N3AC 1CHDA 4EH1A 2YIVX 3B5EA 3BORA 4NR0A 4EFDA 3O93A 4X45A 4D02A 3KKQA 3H6GA 1USVA 4YA6A 4EL0A 1DXYA 4Y7CA 2NGRA 2W2NA 1QH1B 4QDJA 3U9TA 1JDBB 4PTYA 1P39A 1J8VA 3RRFA 5TMPA 3M1LA 3BILA 2QU7A 4UEJA 1ZOPA 3KT0A 4PWYA 5SYMA 5HXAA 2XUQA 2ZWIA 4JHXA 3RJ9A 4B2IA 5I6DA 5BRAA 2OLJA 2Y68A 1WXHA 3JZMA 1HORA 4KNWA 4YYZA 3U7EB 2O2DA 2QN7A 3WNCA 5AJZA 1AB6A 1PR2A 1C4WA 1F48A 1RHMA 3EVNA 5GJVC 2R1UA 1A72A 2ZG6A 4DIFA 3QXXA 5JY6A 1WDWB 1YAJA 1RWQA 2X6TA 1R4AA 4D4IA 4J0IA 1IBKB 2V1UA 4GPZA 3TNDA 4KRXA 3UA4A 4BZPA 2KJQA 5JDCA 1M76A 1ZBQA 1IUOA 1ECFA 5L3RA 1I0ZA 2XQFA 2QTBA 2AX4A 1ZSNA 3QU7A 4TUYF 1AKMA 1H6BA 5D87A 2VXCA 4KU4A 1R5OA 3AINA 5REQB 1NUQA 3MUEA 3NC1C 3TLAA 5DTEA 3ZEAA 4AMZA 2B8EA 4N8EA 3HH8A 5F2OA 1V8PA 2VK4A 4EDHA 3ZHCA 1P1CA 1QLJA 5DHUA 3PQ4A 3IYLW 3OQVA 5KOHA 5CA0A 3IEVA 3KE9A 2HPAA 1GPKA 3RJMA 1GIAA 3IUSA 2R6HA 5DNDA 5TPWB 2IKSA 2DBQA 4RV4A 1GHTA 2OFWA 3O84A 3QUSA 3PCTA 4PSDA 3U26A 3VAAA 4B74A 1E5TA 3FIUA 2XCTB 1RKXA 2WLSA 4R1TA 4F6LA 1X70A 3CKMA 2BFWA 2ZUVA 3MGCA 3R0ZA 1ZH6A 2WRZA 3JQGB 3LDUA 4QNRA 5FPSA 3IEUA 4ZK2A 2XUHA 4NZZA 3W2TA 1E7QA 2ZYAA 1AX9A 3HJTA 3K1YA 3OIFA 1LSSA 4KZKA 1JR2A 4KXQA 1A2BA 1ZSYA 2I3BA 1SC4A 1Z28A 5KHAA 3B82A 2VJQA 2UYCA 3RG8A 3GLIE 4QGHA 3AFNA 1H1TA 2CUZA 3DOIA 4DCNA 3B9PA 3U3ZA 1Z6GA 3HV2A 4RTNA 4HPJB 3P26A 3IP9A 4RAOA 5BN3B 2H1OA 1E2BA 4TS3A 3SJZA 4RGYA 3DEYX 1O2DA 1O0SA 1Z0IA 2ZYRA 3H7AA 4H7DA 3ADDA 2QTVA 1Y82A 1WY5A 2NU9A 2BR5A 4MW5A 2P9JA 2G8NA 4RQBA 2MINA 1K06A 4LMPA 3S2YA 2D8MA 4DMKA 1XLUA 1HY3A 2N0SA 1UAYA 3PGKA 4WVFA 4A8HA 3HDTA 1UBTS 4JBXA 3IAUA 3W5HA 4AYTA 4I36A 1KZGB 2VT3A 5DK4A 4LECA 3PKIA 2J0VA 4HZUB 3U49A 4B82A 3RYFB 1OE0A 2WFZA 2W71A 3D8NA 3L40A 3TQRA 2V6MA 4BVBA 3I61A 4AYWA 4TLDA 1XFDA 1SHZA 2A1TR 4FEGA 3E7FA 5CIWA 4G4SP 4BCBA 2IBSA 1S5PA 1PQWA 1GZ6A 2FAXA 2ZDQA 2JFUA 2W6JD 1T4BA 4J9VA 1B14A 5AESA 2QD2A 3MRTA 2Q5FA 1J20A 4C0XA 4N9QA 3CTPA 2C84A 1A9PA 3IQZA 3NNDA 3T4XA 5DM1A 2VNJA 1GQOA 1JTEA 3IUBA 4D98A 4RYDA 4LE1A 1Q77A 5KVSA 5TY0A 1B8PA 4P35A 3H13A 1Z18A 3PRYA 3QNUA 3ZK7A 2JFGA 4QBGB 2B5WA 1ZINA 5L4SA 1TX4B 3KFLA 2HIGA 3EQZA 2WBLC 3MGBA 5KSOA 1ISSA 3R3SA 2WV9A 4PLTA 1HX7A 2YJ3A 3C3PA 1C1DB 2JI4A 3G17A 3P9XA 1GN9A 4G4SO 4PX2A 2TSYB 2Q50A 4LC9A 3FZEA 5LXTA 4F9EA 3PEUA 1L4HA 5L40A 3D7RA 3V1NA 1QG6A 1TLTA 4UHFA 2FA9A 4EPTA 3BMOA 2QJFA 1Z4NA 2JW5A 1YR2A 4QEZA 5JAQA 1IZ7A 5E9JA 2FRDC 2XF2A 4FI3F 1QKKA 5I9MA 4Z1MD 4B3FX 1NR1A 5FO1A 2EQ5A 4BX2A 2NACA 4JUIA 4O4LA 1WTAA 2R1ZA 2NVUB 1H3FA 4UMDA 4FCWA 5TS2A 1Z16A 3VNUA 2O8CB 1DXOA 5PNTA 5IM4A 3KSBC 3KZVA 2JGMA 1BE1A 3A58B 4QG3A 5EXEA 4WJLA 3BGOS 5BW4A 2BE7A 4ZO8A 1UKAA 1N9GB 1YA4A 4M89A 3PXBA 3TQCA 3FHTA 3LOUA 3LRTA 3UAGA 1L5OA 4KUEA 3NWEA 4JC0A 1QGZA 1N2HA 4FWBA 4WXYB 2HSEA 1G21B 5LVAA 1R6XA 2UVPA 1RD4A 2B6HA 3BMNB 3D3QA 4ZO9A 5HJ5A 3ZGZA 3OZVA 2GCGA 1R15A 2GSDA 5BVGA 2LD4A 4UATA 1HYGA 1WUIS 1ZD1A 2X86A 4YREA 3PEYA 1C7FA 3W06A 4LSWA 2VFAA 4E33A 4O02B 4QULA 1X7XA 3RBXA 1TXGA 1XEXB 2EKBA 2J6HA 4C5BA 2OOKA 1PTKA 4J3JA 2IV2X 3TEFA 2H4FA 3U1TA 1U3CA 1Z5PA 2R6FA 3FUUA 2C5EA 3BPSA 4Y2JA 3Q3EA 2Z2KA 4KAXA 4XJXA 2X7HA 1SZCA 2WHRA 3Q4GA 1KJZA 4KBGA 2D1SA 4X8OA 1Z9BA 4PPNA 2I6QA 3ZGOA 1TAUA 3HYLA 4OKIA 1U7WA 2C7VA 1CUDA 3OC0A 4TVOA 1DIBA 4YR9A 1JQAA 2BBTA 4D92A 4DARA 4TVBA 1RLIA 1SKUA 4G09A 4HYYA 3EIXA 2IWRA 4M9SA 4B73A 3TLGB 4CMHA 1COWD 3SOPA 1NZDA 1AKRA 2OWDA 3C3MA 2JFYA 4PR3A 1Q0QA 2ZRNA 4X7PA 3SR3A 3T12A 3WGTA 5FIUA 4BNFA 1QS0B 2CDAA 1Y4AE 1PHPA 2RHGB 4OCZA 4MV9A 3OQJA 3H2ZA 2BD0A 2IIPA 4WDRA 1GCGA 1NUSA 4ZT2A 4ARSA 4J7CA 4F6RA 3D6TB 3P8ZA 1K97A 2BPOA 2WM8A 1IRXA 2QN3A 4LTNA 4BVJA 5IFLA 3C3DA 1P8JA 3R41A 4OXYA 2QL6A 5FR1A 1OXBB 3CPEA 1I7PA 3GW8A 4IFEA 1D04A 2ZJBA 2R2AA 3DAOA 3FDXA 1LNQA 4BVEA 3UJCA 3ST7A 1M2VA 3H3XA 3A1EA 4XQGA 4FTWA 3RWOA 2Z8YM 4XPIB 5AD1A 2EFJA 2GK4A 2PH5A 3S55A 1I0LA 4IP0A 1U9YA 4IDEA 2EC5A 1LF5A 1NU6A 3EBPA 2QX6A 4HQFA 1KSFX 3LFUA 3MF4A 1IY9A 3HU1A 4Z3KA 5KCZA 1FA9A 2CJWB 1E0JA 1PJZA 1FS4A 3PHBE 3GDFA 4FC7A 4XM2A 1SCQA 4BTEA 1F7VA 1EESA 1HKHA 2AS0A 3OMWA 2YHIA 4NCKA 2XI4A 4JBNA 4AB1A 4IHQA 3AKZA 2PIAA 1D2CA 4L9AA 4ZHQF 4ND1A 3G79A 4MUJA 1S2GA 1XXHA 2O20A 2Q1XA 3FWYA 4H1HA 1L4NA 5EQFA 4EG1A 1CJUC 4OQYA 4OYYA 4WWHA 3HCEA 3HKDA 3FWPA 1P2FA 4FQ7A 1IPHA 1YULA 3T0FA 3TIXB 1VHLA 4AF7A 4EEZA 3WMRA 4DNOA 3PGXA 1K27A 1YZGA 1BROA 3MHPA 3TINA 4E5NA 3GH3A 1FXWF 1WUTA 1CJBA 4XXHA 4JI2B 3BYZA 1FTGA 2PUTA 4MPDA 2AYXA 1JBQA 1UK7A 3E9RA 1N0HA 3B1XA 3GVCA 3J7TA 5P21A 3ZW9A 4LUCA 3RRMA 2ZRCA 3HB5X 2HV9A 4AJ9A 4XJVA 1XR3A 4WASA 4PZ9A 3X1XA 2O2CA 3F8WA 3ESZA 1TTHA 1B2RA 3P1JA 4RGQA 5A06A 2DBZA 3Q15C 1TTTA 1GQRA 1G8PA 3D3NA 1Y6RA 4MVWA 3CONA 4MRAA 2C0PA 5C8YB 2Z3ZA 2WHQA 4RF2A 3G2LA 1CDDA 1WDTA 3PXDA 4IIUA 1B76A 4LJKA 4OBBA 5ARCA 4GVXA 3W5AA 1N6KA 1EDBA 2R79A 1SURA 3JRNA 1EWVA 4YPFA 4MPRA 4GGOA 4JI5B 2VPWA 4DA6A 1ID1A 4YAEA 1SWVA 2BGJA 5JR3A 2PUGA 1O97D 1UBGA 4MITA 4ZZ0A 4WXEA 3CISA 4OI0A 2X1HA 2WICA 1W0KD 4N39A 1VGRA 4KX5A 4O08A 5E1OA 1KI7A 1UJCA 2HT6A 2JJQA 3T5DA 3AW9A 4EQ6B 3UBTA 3SXJA 4D9FA 2D8AA 1G8YA 1QAQA 2HLPA 2P8JA 1KMHA 3TTSA 2BJVA 3GUZA 4EJ6A 3CVXA 2O8DA 2GJAA 3OIVA 4ZHQA 3DAFA 4EHBA 4M1QA 5JAHA 2K87A 3LA6A 1SBCA 3DV9A 3CKKA 5C8DA 1ZLYA 4IH1A 1J22A 1NKTA 2X0JA 2EZTA 2YJTD 1CJVC 4AP9A 2QORA 3HKEA 4PLVA 5J1TB 5JXWA 2B34A 2ZI7A 3ISVA 5D2CA 4BQSA 5EINA 4RK6A 4EZBA 4EI2A 1VPWA 1HQCA 3IGFA 1JUDA 2BZ1A 1A9RA 3KHSA 4HRVA 1XP5A 2XEDA 5M29A 5KPJA 1KYIA 3C6YA 2PAAA 4ZCQA 4E1VA 4NESA 1DEAA 3H3FA 2E87A 4JDPA 5T6MA 1Z5OA 1BHQ1 2V3VA 4WXPA 3MTJA 5AI5A 4E6EA 2NNLD 3G49A 4RVHA 3SM9A 1ZW6A 3M3DA 1LW6E 3RC1A 1MPTA 3PHCA 3Q2KA 3PCXA 4L0DA 4Q4LA 2OGWA 3RF7A 2AOWA 3VU0A 3GLQA 5FV4A 2D7DA 4F3TA 3RJ5A 5AW3A 1JEOA 3RS2A 4I8DA 1J1ZA 1T1RA 3TQIA 3U61B 4UMEA 5J4VA 1ZPDA 1RWMA 1MX9A 2W4QA 1AC5A 1A9SA 1U2ZA 1VRCA 4DNPA 4XM0A 4IX1A 3B70A 4DHWA 2A1IA 2Q9CA 4UBLA 1SIOA 1BAPA 4YLGA 3PI6A 3PXGA 3NDIA 3ME5A 4GM1A 3H9QA 4I1VA 2OZVA 4CLRA 5K8LA 2H18A 3W8FA 2TRSB 2MJLA 1J2RA 2OQ2A 3LC0A 1HNXB 3ZWXA 4JBIA 3GIDA 4NTZA 2BGRA 6REQB 2GX6A 3P9PA 4QBFA 4F71A 2W93A 2PX2A 4UPVA 521PA 2J3KA 2MR5A 3IVRA 1JE1A 3ZX4A 3GDWA 5JAZA 1NW6A 2GSWA 2ZRKA 1TF2A 3GRAA 3BWCA 3VPCA 3PJDA 4WZAE 4F8EA 5LR6A 4XSHA 3NT4A 1VECA 2OHVA 4GBGA 2P79A 2WJGA 2FPOA 2YYYA 4JLJA 4UCQA 3WRWA 1X1RA 4P3PA 4PRYA 5AJYA 1EGAA 1B0AA 5T5QA 4KK3A 1AKUA 2FMUA 4MO9A 1V7CA 4JLOA 5BN3A 3FF1A 2D2EA 3DAPA 4UQLA 4CLOA 2BL4A 2QJWA 3H8JA 4CKWA 2FMKA 3EZNA 1ISRA 1DBIA 3QPCA 3VFDA 4BPRA 2IOFK 2RONA 4HXYA 3FFXA 4BNDA 3CLTD 1QP4A 4ENUA 1ICEA 1IVSA 1NMQA 2PS0A 5CVUA 3E9ZA 1EM8B 2XMCA 5CPFA 1TGYA 4OFWA 2B5VA 1P1IA 5HJ2A 2J6BA 2AJBA 1IZ8A 1MA0A 3IE2A 1YKGA 3BWYA 3ZDFA 1QHIA 2P3LA 1KQGA 2V7XA 4RPJA 3A37A 1S1MA 1TFRA 4KXYA 2RG1A 3I05A 5IDWA 3OC6A 3KXKA 4M8IA 4XQ9A 3IMEA 3ZCUA 2V3WA 4PO9A 2QT0A 2O14A 3OPVA 1M2EA 1X77A 3FMVA 4UEWA 2UUAB 1FP1D 4L4UA 3O73A 1HTTA 1ABFA 1FX0A 4WXHA 4Q7JB 3I5YA 1N5JA 1SU6A 4QJBA 3S1AB 5COAA 3JPYA 2XLBA 2IDMA 3BTOA 2WKSA 1CEYA 4ZI3A 2XUFA 5IW8A 1JQEA 1MEOA 4REOA 1CY1A 1PR0A 4N5IX 1D2NA 1ODJA 3GGGA 1UAGA 2JI6A 2E4XA 4IQGA 2VUHB 4KDEA 2ZSIA 1FUEA 4OGKA 4QGAA 3TSYA 4L75A 1QGAA 1XAHA 2G70A 1E7YA 4KYTA 1E66A 3FHOA 1Z4IA 3LYUA 4EF4A 1IUKA 5G0VA 1E1NA 1NLMA 3S81A 1FP6A 2O8NA 2H2HA 2N3ZA 5HPYB 2IPLA 2I4NA 2Z4SA 3I04A 4O4HA 2V5VA 3BEOA 5CA1B 4EJMA 1W6UA 2E9SA 3MS4A 4DMMA 5B3JC 2XB8A 3QLVA 1Z39A 2HSGA 2A9RA 4RA9A 1HURA 1QV6A 2C5BA 2YZ7A 3HGTA 2VK2A 3GJ4A 1V16B 3AIOA 4Y2QA 5GIOE 1MO4A 4YUWA 4QVIA 4W5OA 2DUWA 2E1RA 4M0LA 4BMZA 4NF2A 1G3RA 4R01A 2E5LB 3LUKA 3WTBA 4EHHA 3ZDYB 5CNIA 2C1EA 4LHVA 2RGUA 2M98A 4WESB 4WCFB 3V4ZA 3HL4A 2NPIA 3OQ6A 4PC3A 3S70A 5HM6A 5C52B 1H6AA 3F74A 2XE8A 4R3WA 2GH1A 2CJPA 2GTHA 4I5FA 4RY0A 3OM1A 5K8CA 1F2UB 1VGVA 2YRWA 1RWVA 2DF8A 3A6KA 1L7RA 2I7TA 2NG1A 4ZVVA 3E2MA 4N8DA 1GFZA 4BV3A 1I1QB 3C74A 4DA7A 2E82A 5IYZB 3RSOA 1LBEA 1MP0A 2YN0A 5CEFA 1P80A 4JEHA 2Y1KA 1XRJA 1YS4A 1M6YA 1LNSA 3DUFB 4ZVMA 1DAIA 1B8UA 1YQTA 4GD3Q 5HE8A 5JSZB 5NULA 1N9GA 1B3RA 1U28C 2LKCA 3Q7PA 4XOIA 1DKLA 2R6GA 3WA6A 3NTVA 3WJ1A 2ATVA 3MAAC 5JPIA 2O3SA 3BDAA 3NH9A 4DVJA 3AVVA 3I72A 2DCMA 4O2AA 3M3HA 1ISFA 4RSGA 3VJLA 2H4WA 2ZEJA 3UENA 1XRMA 4MWSA 3UHOA 5TQ0B 3X44A 3CXUA 3JQQA 3GLFA 1DKMA 1G5TA 3G5MA 3IPCA 3O91A 1C3OB 3ZIAD 5LUAA 4JXXA 4IFIA 4E5VA 3DBRB 4KFCA 3AHEA 3CWQA 4I9GA 1GTJ1 1JH8A 1Q74A 2BKAA 1L5HB 4M1SA 4D42A 1IJBA 2ZYIA 3EXG1 3EZ9A 1NNEA 1CP3A 2HSJA 1KI3A 2ZAMA 4WQMA 3EULA 5TLSA 1ABBA 1E3EA 2W6QA 4NQRA 3KVVA 4MTCA 3W7BA 1DKNA 4ZO6A 1KPIA 1J42A 4FX5A 2FVXA 4PXYA 1MJFA 2W6JA 3BRSA 4L0QA 4D81A 1PI3A 2ZVJA 2XTNA 4OQZA 3VSCA 4ZEMA 3VPBA 1R6VA 1YRYE 2GM5A 3NVAA 3PC7A 1I4TD 2AWNA 1N0IA 1KA9H 3ESAA 4J2TA 4LNUB 1ARZA 4X93A 3FTEA 1JHZA 1AIPA 1MJHA 1Z7BA 3E9CA 4BTLA 1R9NA 3QW2A 2OORA 3PSAA 2VHUA 3ITDA 2F67A 2NN3C 5EE3A 3Q0TA 3SQLA 2HK6A 2OHGA 2YV2A 1I5RA 1NONA 1OKKD 2CLCX 2QG4A 2ZAGA 4DT1B 4E03A 1F0KA 1F2TB 2QB5A 5F78A 2RI0A 4P7JA 5EKUA 4YRAA 2G6BA 1T13A 4XPIA 1DMRA 4JNCA 1U1EA 4KPUB 1GVNB 2F62A 1CR6A 2HF7A 1BVUA 3QX8A 3WDKA 3ZHSA 5A3RA 2GJ9A 4C3OB 2I6GA 3BMCA 1DV1A 2B5OA 1G2QA 4G67A 4NOLA 2FSFA 1KRWA 1YZLA 3QVJA 2Y1FA 1ZH0A 1FRNA 2I2XB 2FMHA 2WF9A 3FDZA 2ONCA 3QEKA 4PEVA 2G07A 2O0LA 5DNEA 3JQFC 1XD2B 4XB6B 4EY3A 2O8BB 3G0BA 1KERA 4CIVA 5JBNA 1YGYA 2ZBGA 3FPEA 3O6VA 3OTGA 3Q8MA 1EG7A 1U31A 3C5EA 3NVMB 3R9XA 4MZDA 1UJ5A 1W6RA 3RG2A 1GLNA 2MDTA 1OILA 3Q5DA 4M36A 1N36B 1WPXA 1J00A 2BH2A 1F51E 1CR4A 1VYUA 4H18A 4IDBA 1C30B 1IXKA 1AQNA 3OPMA 1IEVA 2CC2A 4M1YA 4EPXA 3GCWA 4B6RA 4RX1A 3IAM1 4B87A 1LRKA 2NZYA 3OFSA 2QROA 2X5JO 3SYNA 4BO7A 5L6LB 4MQUA 1S4QA 5I4CA 1TYDE 4ZT6A 1Q1ZA 1GFSA 3E8MA 4HQ6A 2A58A 5CUQA 1B7GO 1X7WB 1H23A 2I6FA 3H5RA 1M33A 2DFTA 3PVCA 1KSJA 1P7YA 4G97A 2P4SA 4BLVA 4N6NA 2QIPA 3AG5A 4MR9B 4CF5A 2JI9A 3GEEA 1SM4A 5E4YA 3CVYA 2R47A 1WHTB 2H2IA 2R1TB 3FR8A 3KWLA 5B3JA 2R48A 4EF6A 5KINB 2FX5A 2NO1A 1UXHA 1CD5A 2GLUA 3B1VA 3EC2A 1YTUA 3PTAA 4MVYA 3N3BC 1JLSA 5JSFA 2O6HA 3W1WA 5AI6A 4E15A 4I5EA 4EPWA 3THYA 1XZKA 3I37X 4JAVC 1PYOA 2NMVA 1M72A 4HDRA 3GRYA 3HYNA 4UPDA 1AKVA 5TT0A 2NZXA 1W4ZA 3NJ4A 3S4YA 5GJBA 5HG0A 3WQSB 1DWQA 5G3ZA 1K7FB 2GF2A 3LC2O 4IIBA 7MDHA 3F5MA 3FPGA 2GD2A 2IVZA 2X9GA 1QIDA 4MLCA 3MLBA 4EW6A 1PF7E 3NC4A 2PGOA 4Y1RA 5KKNB 5F1YA 5K3CA 3V1UA 5FLKA 3RSSA 4Q3NA 3L6EA 5EKSA 5GM2A 1TUBA 2ZJ0A 3HN6A 4ZU6X 2CLIB 3KIPA 1G0NA 4L8GA 5TQ0A 5H4GA 1AKTA 4OHCA 3BXFA 3ZJ4A 2BLLA 3AFMA 1IHXA 1U9IA 1YZFA 1J9EA 3R7DA 1H4QA 3GO4A 3B13B 2AFIE 5FUWA 4I6EA 3OSUA 4ALJA 3AL0C 4OQFA 1HV8A 1SQGA 1K6EA 4Q4CA 4JNKA 2ODPA 5FFNA 3WK4A 2Q27A 1ML4A 4DCPA 1XZNA 1CRWG 3ETGA 1C9NA 2WVHA 3DEAA 1QYRA 3ESXA 3QPVA 4PYIA 3A6FA 1E59A 1I4LD 3I9MA 3HB7A 5TC4A 3V42A 4M7OA 3F5QA 1G8MA 1N6NA 1M6VB 1MB2A 2H54A 4D4LA 1FMCA 1AUOA 1F0YA 2EDAA 2B2NA 1Y42X 4RJLA 4WH0A 1M7HA 2GTPA 4KDCA 2WOJA 2I6UA 1C5KA 3NHAA 4P22A 5KWEA 1U0BB 4EJFA 4A5SA 2HMTA 1YKSA 5IDXA 4KBYA 3IAS6 1QO0D 4AF8A 1V7QA 5JCPA 3TIGA 4B7XA 3L6CA 5AW0A 1T4DA 2E4UA 3R09A 3GT7A 3MELA 4N3GA 3H5AA 4MWOA 3I4FA 1NQUA 4MVJP 4OOFA 1T9BA 4EKNB 4I55F 1LUAA 4NRDA 4IG4A 3I9FA 2DECA 4CT5A 5JZVA 2JAHA 2A3RA 3JS5A 3D6AA 4HZIA 4ICIA 1P9OA 2DPHA 3R6GA 4RFSA 4GLFA 1E2IA 4GVLA 2V6JA 4DDWA 2ZRGA 5ENZA 2R8XA 2QRUA 1IPEA 4EGQA 2YJZA 2DH6A 1BNCA 4A4DA 1UPFA 3A3YA 2IZ7A 4Z7OB 2BCEA 4JYCA 3K70C 2R5FA 2ZCJA 1LDGA 3Q7IA 4KSBA 5H7XA 1RRKA 1QF9A 2R25B 3OIGA 1UT5A 3L1IA 5AUOB 1F4VA 1FSZA 1R0CA 2CNKA 3M49A 2C2HA 5F1OA 1K7YA 2VP9A 3TX2A 3UANA 5IU6A 1KEPA 3ZK9A 5KU7A 1RXCA 2H29A 5CFOA 5K05A 3K53A 1FX1A 3ONNA 1H1LA 2HSZA 2C9CA 2GESA 1YHYA 3T7TA 2GVNA 1JXMA 2RGBA 5FWDA 3AXSA 5C3UA 3VM6A 4DAEA 2ZROA 1MENA 1RS0A 2PBFA 1N2OA 3G88A 4U00A 1L8LA 4GSLA 1L4UA 2C98A 2G04A 3BK2A 3GRCA 4DSOA 1TK9A 4U7WA 5JMWA 1SUAA 5A1TA 3KEGA 3RRNA 2D4AA 3LRPA 1SUIA 4AZWA 4WLNA 2AUNA 1FFYA 3D4BA 4OIMA 1KEEA 1B2LA 1YGPA 4CTJA 1SCDA 3AR7A 1BFDA 1E2NA 4BDTA 3MCAA 4MROA 5KOHB 4YTEA 2IGBA 2FOXA 4LYHA 1SBIA 3UICA 5ECDA 3VAZA 4ZDWA 2M1XA 5JYEA 1JGTA 1CIJA 1FB5A 2WJHA 3F7OA 2B37A 4PZPA 2ID8A 3BIOA 5ES3A 4D0GA 4EI9A 1K75A 5KYXB 2B36A 4WBNF 1JFSA 2OPBA 4J6EA 2NVBA 3PDIA 1M2VB 2J4CA 5TJHA 1CYDA 2WVJA 2FR1A 4FP9A 4EIWA 4UTNA 5FUQA 4NOKA 3GRVA 4FM9A 3KPVA 3Q7SA 3AUSA 2AYZA 4QU0A 1XEFA 2PXCA 4F86A 2R00C 3CWCA 3R7SA 4MVJI 3DOEA 3MPUA 1PK7A 1Y3BE 3D5TA 3FVTA 4RC9A 2FUG6 5KB3A 4A1FA 3EIUA 4G81A 5T8KA 1NM5A 1F2DA 2UUPA 3BCHA 2NNWB 4BVLA 5B1DA 2D2FA 1FFSA 1LCIA 4K05A 4BNDB 4C4OA 2J9ZB 5JT1A 3PI7A 2YIDA 1T29A 1WUHS 2B8WA 4FC6A 4M9RA 4YDHB 3HWX1 4B4KA 2ZM6B 4MV7A 2OSBA 1V0JA 2IYWA 1I10A 2CKDA 3JALA 3KKEA 4V24A 4F38A 4DYHA 1KIFA 3SZRA 3WIBA 3DCIA 4LC0A 3SC2A 3Q8XB 2ZS9A 3UPDA 1KOGA 2CHUA 1UF9A 1SC3A 2EZUA 2HQOA 3BXHA 3D4NA 1Y8CA 2QMUA 3HZZA 2DAPA 1J21A 4RIEA 4DA9A 2OVFA 1T8YA 4NJOA 5FI0B 5LFAA 3NDRA 5CA0F 4KNYA 5IZ4A 4BZWA 5CNJA 1CR0A 5JU6A 1MAHA 4DPKA 4Q3KA 5LQRA 2HMYB 4WZAB 4B75A 2GVDC 4ZOEA 3DWGA 3CC8A 4MS4A 2GRAA 4NEHB 4O1MA 4W8GA 2CBZA 3AESB 4IL5A 4YUXA 2CW5A 1H65A 2ZVDA 3KJGA 4L72A 4TV9F 1C4KA 1PGNA 4GYKA 4BZQA 1TC1A 5FA5A 1R8YA 2NUPA 1Z36A 3A9VA 3OAAD 1RYNA 2UUCB 1GY8A 3RTBA 4BLRA 1GA6A 2V9PA 1UK9A 5F3RA 4CM6A 1JEQB 1GQFA 1AGRA 4Z3OA 1T36A 3BFPA 3IAM6 4X1IB 4CPDA 1LPSA 2D1QA 2OBLA 3OEEA 4RSMA 4C6RA 5A6SA 2O8EB 3TKYA 2P2LA 4IJQA 2JDID 5JAIA 1KMIY 4RUKA 3LNCA 4JB8A 5BW6B 2Q28A 3AONB 4GP9A 1LBSA 1JQJC 3EXG2 3NNSA 4RHUA 1UUFA 1PNOA 4DG5A 1R0XA 2WU1A 1E62A 4J0CA 4K9MA 4GR4A 5KWJA 2IT1A 1NXTA 1U8CB 3V9AA 2OD2A 1FDUA 1NC3A 5IABA 1YMQA 4BQNA 4JQZA 3RRJA 4DJDC 2C99A 1PWZA 3DEJA 2VR1A 1KVQA 4X85A 1R4MB 2WAXA 1SBZA 3GX1A 4II7A 1GYRA 3WHKA 5KC8A 1GGVA 1I2ZA 2YXDA 1TIPA 2P2CA 3IDSA 3K16A 1BN7A 1CUSA 1CPYA 1H2AS 1OFUA 2D1FA 1JFFB 3DD5A 3VYWA 2R3SA 3KJNA 3BDIA 4BNTA 3FTCA 5JH7A 1G5PA 1WOMA 1CYEA 2LDBA 4PCVA 5AHXA 2QMOA 1RWKA 4DREA 3V4LA 3O92A 3GH1A 2X4DA 4L5JA 2QPTA 2W90A 3BGDA 2QNBA 4W9NA 4JBYA 5H70A 2ZIAA 4KMMA 1RRPA 3P5SA 2JC3A 1VZ2A 3QYAA 4DA0A 3QLVC 3BTSA 4KMSA 4Z99A 2WT9A 3IBCA 4XEUA 2Q3EA 4YCCA 1W36C 4EHNA 5IT0A 3CPJB 4RFVA 1VSVA 3CY6A 3VOTA 4LSMA 2C20A 2NSHA 1J8FA 2CDCA 4CODB 1RVDA 5HZKA 3CB4A 3LT5A 3QG5A 5DN6A 3QVTA 1C1XA 1OBVA 2F8LA 2AI2A 2NZ8A 3QTTA 4X54A 1ESNA 1H2XA 1Y3DE 2H7YA 5MFPA 4CG2A 4P0QB 3EVZA 5IH3A 3C14C 1NJ8A 1AO0A 2XUZA 1MBZA 2GERA 1ZZGA 2Z8XA 3WYGA 1QK3A 2ZQZA 1Z26A 4ALNA 3IE1A 2C83A 3GHHA 5E9QA 1ISIA 3CB2A 4XAQA 2GHIA 4UCWA 1FLDA 2C5LA 1HO3A 1U4NA 4G23A 3A9CA 2XMQA 1J7KA 2VJKA 3TL6A 1OAOC 4XVUA 4FNMA 1JT2A 4KYUA 1GZUA 1QVVA 4UFNA 1SCUB 2QTVB 1PX2A 5LBUA 1A1SA 4XQEA 2GQ0A 3IV7A 4OGLA 2AQHA 1J56A 1Q2XA 4Y6SA 2XQIA 3S8MA 3UJAA 3AERB 4I50B 5B53A 3UKJA 5JADA 3WSTA 4RHTA 5E7MA 1Q7CA 3R5JA 1SQ6A 2NO0A 3DOUA 1J97A 1H22A 1KNQA 2Y4OA 3E70C 1NXWA 3JZFA 4HDOB 1I2BA 2G0TA 3NHWA 4HS4A 3Q7TA 4DKJA 3RKSA 1LVUA 1UKVY 2DLNA 1FCJA 3CQ9A 3H04A 3HVRA 3E1GA 4WGFA 1V95A 2B82A 3N7AA 2HLNA 2X9NA 4JB3A 1VP3A 5EHQA 5KU1A 3LXUX 2PS9A 4F6RB 1B15A 5FTKA 2XGMA 2MSLA 3A9SA 3EA0A 3HUDA 5A3VA 5LOVB 1UBFA 2VSQA 4MJXA 3ASZA 1HNNA 3F9CA 1F60A 4KRGA 1RHKA 2CZGA 1E9SA 5JNLA 1TM4E 1U8TA 3JD3A 2B98A 3ZHXA 2VHVA 2A94A 5HQ3A 2FPPB 3IUYA 2XGOA 5LN1A 1OBHA 4A0HA 5FTJA 3N75A 4ND6A 5FOXA 2ODBA 3W6PA 3P4XA 3SNKA 4QOHA 2JCYA 4A8JC 1JHMA 3GNTA 3ZY6A 4EAQA 2ORYA 3NIGB 3T06B 3FOZA 3ETNA 3SBEA 3A0RB 1V7PC 3D6NB 1E79A 1V1RA 4JLUA 2J0UB 1JDTA 2PZGA 2R44A 1NUPA 2UVQA 3ZZUA 3NT2A 4AW9A 1OH8A 2ZBEA 3IMGA 4D57A 2ZAYA 2O3JA 3K4PA 3HPRA 3CX7A 3LQYA 1G7RA 2JAUA 3AFHA 5DLEA 2Y8EA 3LQ1A 3LOQA 1WEHA 1OMOA 1YWGO 2CK3A 4FEAA 5EFZA 2HN9A 1QU3A 1YDMA 1UC4B 2XIJA 2QMYA 2HL6A 1IHOA 3C45A 3OLWA 3LHDA 4LK2A 3SOZA 3SX0A 3AEQA 3IPXA 3ROQA 1FQJA 1P44A 3WLMA 1NBOA 1Y33E 3AI2A 2N46A 3CEPB 3T5GA 1MXFA 3W77A 3FOFC 3GT4A 4DCVA 4OP2A 2RB5A 3G2IA 4AS2A 1Z6YA 3NUGA 3RNLA 5JDCC 3WLHA 4A2WA 1RAGA 4FFPA 4A5OA 1XMXA 2AH5A 2G77B 3NORA 4KDFA 1HYQA 4Y2GA 3T3PB 4MMXB 1ZYUA 1EFCA 2Z8YA 3WGYA 1LLCA 1H2YA 1PP4A 2QX7A 4HAWA 4DY6A 5BVHA 1R6UA 1U1CA 3AZPA 2GO1A 1V3QE 1JHAA 3E18A 4QXRA 1FFGA 5JUWA 1W1WA 2CHQA 1RJ9B 4V0LA 2VJCA 4KYIB 4CMCA 2KLBA 2Z08A 2PSEA 2Q5HA 3PYXA 4X1KA 3ZDCA 2DQ4A 4IHAA 4C0AC 1E3TA 1LA2A 1OT5A 3QFRA 4IJ6A 3MHTA 3TTXA 5BWNA 3MJRA 1XTPA 1QE0A 4XFKA 1BJTA 1E5DA 1URPA 2VATA 2NO5A 2DUMA 1S6YA 4HUTA 2ZE6A 1YS7A 5JLAA 4X1OA 1THZA 5TGDA 1MC1A 2E4AA 3KQSA 2V7VA 1MVLA 3MW8A 5ERXA 3N8HA 1CERA 3OZDA 3KALA 2JBAB 3AQIA 2AFIA 2RBKA 5KOJA 2VH5R 3TG8A 1H5NA 1QO7A 2UYQA 1ZD2P 2R8YA 1U0OC 5GIPE 4XWGA 3GFFA 3HGQA 4HDSA 4EF5A 3LCCA 3GJ5A 4ABTA 3HK2A 4LRWA 4AXBA 1HLDA 3MCZA 1W59A 4FYHA 1C4OA 2ZAOA 3HS3A 4OHPA 3VU9B 2A1UB 4LK3A 1FFDA 4PYNA 3T5CA 3GWGA 3RC7A 1OHHD 1GT6A 2WJ4A 5K7SA 3IS3A 1XWFA 2DU8A 2X0NA 2VAWA 3DWIA 4BMYA 5AW7A 4PBSA 3SVTA 3ADBA 3JQPA 2PFGA 5DV9A 4ZP1A 1T5TA 4F04A 2QZ9A 3FMGA 1U0GA 4HDRB 2NQ2C 1SN7A 4EB0A 4DRYA 4PQFA 2FSGA 2GEFA 3T7IA 4ZN6A 5CDSA 4J4BA 4JFAA 3U4DA 3ZIDA 3U44A 2W8BA 821PA 1LDNA 2BM0A 1XZIA 1UQTA 4ENRA 1I4OA 1P72A 4DYVA 3EVDA 2ZI3A 3BWBA 1HMYA 1RADA 3C6MA 3KL4A 1VHJA 3OQIB 2PKXA 3QGMA 3RSQA 1ZA1A 3UWPA 4IBOA 1RXEA 3TI9A 8MHTA 1H0RA 5K6TA 3C97A 2CLLB 3D59A 4QOGA 3X1WA 2XVMA 3IEIA 2XSZD 1WXDA 1FMJA 2HA7A 5IKEA 2Q0QA 2C88A 2QI9F 3QE4A 4OQXA 3IMCA 3DKPA 2IHTA 1NBMA 3JCZA 2H08A 2PY6A 3EGOA 2KE5A 5H9WA 2D7CA 2V6BA 1E1RD 4HDMB 3H99A 1FTQA 2OXEA 2ZRMA 5B3KA 1U7XA 2XDQB 1WZIA 3OURA 3OTQA 1T8WA 2HNBA 1NVWQ 2VXOA 3I9JA 4K88A 3VVMA 2BVNA 3IUJA 1MO3A 1FOEB 2YR0A 1BS2A 1RAFA 3QPUA 4JLDA 2JLQA 3LUPA 2ESRA 3GB9A 3E3AA 1WW8A 1LLDA 1RYZA 2HH9A 4NYMR 3R3JA 4RDHA 4WHMA 4FFNA 4Z6KA 5DCLA 4ESVA 1DJOA 1NI3A 1DIHA 2ETXA 2GZRA 1H2EA 2VG8A 3BE6A 3HYTA 1FFXA 1AG9A 1DXHA 3E9DA 3PDHA 4JJ8A 5C34B 1V5FA 3KFVA 3SIWA 5ABPA 1NP3A 3I1JA 2PT6A 2QBYB 4IJ5A 4CEIA 3RS4A 4D4KA 2HJRA 2I55A 4GL2A 2CXPA 3DQQA 3N0VA 3N5KA 2ENWA 2OCGA 3KCNA 1J5PA 3LLUA 4B48A 4M1TA 4MZXA 3UB4A 3AGPA 4BLTA 5DF1A 2DEUA 1CNEA 1A5TA 1X7YA 2QAGC 3DOHA 4FNAA 2R00A 3AB3A 1PL6A 3GNSA 3H18A 3D5QA 4N18A 3BX1A 1P0FA 4OXNA 4Q3AA 4A2PA 2BZSA 4KXMA 2R85A 4J0KA 3VVBA 4ZI7A 3OQOA 1AV6A 1XNRB 4ZTZB 4L9RA 3VR4D 4Y1RB 5CLGA 3ODGA 1GR1A 3HEBA 4NYMQ 5EWMA 5EZYB 5HIJA 3MYYA 1QOPB 4FOTA 3RUEA 1B16A 2O23A 4P83A 1MJ5A 4MS4B 3AQ4A 3LGAA 2YYSA 3MYRA 4YT8A 1UANA 2C7QA 2JKYA 4LBZA 2GBFA 1HEIA 3FNHA 5IWCA 3U4QA 2GASA 3LF1A 2H52A 2HIMA 4DB2A 2X8WA 2GILA 4IOLA 4TL7A 5AI9A 2ZYVX 4BVKA 4ISCA 2E7ZA 1A4XA 1XQXA 3UWSA 1X3SA 2W00A 4F3NA 5BN5B 4R7TA 1L4GA 1BOOA 4U9IS 2FUKA 4HX5A 1HLFA 3KHKA 3NETA 3LXRA 2C7BA 3KOXA 3A6ZA 3CUTA 2ZK7A 5FRDA 2VT7A 2HDNB 1SR8A 3INGA 5IKOA 4DQ0A 1XVVA 1E2LA 1JAZA 3G8DA 2X3YA 3AKYA 4GNKA 3NM6B 3UJDA 4GPTA 1V3TA 4H7JA 1USWA 1JHRA 5HKKD 5KOIA 1X7HA 2H17A 3DMRA 3OUUA 4L50A 4N7RA 1Q91A 3T35A 4B4WA 4OG2A 4Y7DA 3ZU3A 4M6WB 5JHHB 4XUCA 1MX5A 2AL7A 4K28A 1E0SA 4O1IA 2REXB 3UW3A 1VMAA 1UM9A 1XQWA 3TR0A 2QTFA 4C07A 4BNGA 1T4CB 2FSPA 1BA2A 2JAWA 5EMNA 1DCMA 5EZYF 3TCNA 3U6KA 5JNSA 3D6UA 1PS0A 1RLUA 2OO5C 3V5NA 5B30A 2X3UA 3NAMA 3DO8A 3V9PA 2QD1A 4FFWA 3LZ6A 2GPTA 2O5CA 4YCAA 3NS7A 3H2SA 2WAOA 3ET4A 3FZGA 4TTIA 4UAVA 2QS9A 3SLGA 4EY8A 4PGAA 1QRTA 1QYIA 1XXHE 1TCUA 2YWFA 5E4FA 3ZKWB 3U31A 3IR6A 5CK4A 5JH7F 3CNBA 4RJIA 2ECQA 1EVLA 2FSVC 3FUTA 4AXXA 1GAQA 1O6CA 1I7NA 2DZDA 3E9NA 4DKXA 1YB2A 2GN6A 2XIQA 1Z15A 1ZUD1 3EXIB 1HDZA 4NVRA 3H0CA 5KTOA 1L4FA 2IVFA 1HSOA 3HN7A 4MP8A 4BGUA 4HWKA 2FYTA 4ML3A 2XQJA 3PQ6A 2O8EA 1K5DA 3L1VA 1Z6QA 3WNDA 1JEYB 3FMPB 1A5ZA 1N7JA 1NBHA 5FUBA 3KBBA 4YQFA 3HWWA 3DT9A 2CN1A 5M04A 2KM1A 5ALWA 2BKVA 4HLUC 3HNRA 2W9XA 1E3DA 3K0KA 3R8CA 1VJCA 4DGQA 2NUPB 2P68A 4C1NA 1E9FA 2UYOA 4LDZA 1Q15A 2YJ5A 1UBJS 5ITZB 1ZZEA 4UVEA 5E6RB 1A2OA 4Y2VA 3Q41A 3RKUA 3X1ZA 1N2ZA 1NRIA 4QLAA 1G42A 4RF3A 1ONBA 4ZHSA 1ISHA 3ADOA 3IALA 5CT8A 2PMDA 4ZMSA 1WMBA 3F1LA 5I9LA 3BG5A 3U17A 4C30A 2BDTA 1LF0A 1KDVA 1FS6A 1H94A 2J3DA 1AO3A 2ZPTX 3LY7A 1MB9A 3B1JA 4DM4A 5BT9A 1XTVA 1M34B 1KARA 1BS9A 1BX1A 1ZP6A 5JIBA 5JRZA 1KOJA 3O1JC 3HZOA 5KZMB 5A0VA 3IJRA 1FX0B 3LF2A 4X6YA 2PSSA 3FGZA 1WG8A 1YXMA 1L9KA 2CNOA 1FVXA 1ULSA 4DDVA 5HKAA 3WLEA 5J40A 2J4DA 3R7NA 1P7WA 3ANLA 2Z9CA 2BEJA 1W73A 1IQ0A 2WWIA 4M8NE 4UASA 3TPFA 1FJGB 1BO6A 4RK1A 4BCDA 4YAJA 4EGFA 3A2MA 3T1OA 1ISJA 5LZ8A 3QFHA 2IF2A 4D82A 2NUBA 1GZ5A 1IDOA 2IYVA 1ZNYA 3BXZA 2JLVA 2YL2A 4JI8B 4C88A 2O8DB 2X19A 4L8VA 1I94B 1R5BA 2DMRA 3LKDA 3ORQA 1Q7TA 4XLZA 2I6SA 1D2HA 4L8FA 5KNBD 5F51A 2FZEA 2BE9A 2DWOA 1UKBA 3WWYA 1Y9AA 4Y18A 3I5UA 5IASA 5THXA 3BHNA 3W04A 1C29B 2Z09A 5L3QA 3PWZA 2A9JA 2QGZA 5KIAA 1XI2A 2YMLA 1HLPA 2FN7A 3WIEA 2QTTA 1XMPA 3PFNA 4HQLA 1M6EX 2ODAA 3QUCA 4YVFA 1AMUA 5DXJA 4MCJA 1JR3D 3INRA 1L5RA 5C81A 4M46A 4HL6A 2EWWA 2P6MA 4E7OA 5AXCA 4C7OA 3BC1A 4UCXA 1ZJYA 4L5AA 4Q9IA 1IVYA 3ONVA 4FFSA 3URMA 5BUSA 2CUKA 4LY3A 2JB9A 1BH6A 4MVCA 3G5LA 1HE5A 2XT6A 4AZ0A 1XL1A 3CNQS 1XXHB 4UNSA 1PDWA 3LGXA 1ZI9A 5G4KB 2YH2A 4DWVA 3B12A 4KC0A 3DE2X 3NWJA 2C8LA 3HVIA 5FUVA 2H1SA 1NPYA 3K6RA 3AI3A 2PNJA 1XZMA 1K8YB 3BXPA 3HDGA 1W76A 4WNAA 5T64A 2RH5A 4H35A 3F78A 1LK7A 4AMBA 3ZW7A 1DAFA 1UJ6A 2C4TA 2YC2C 3DVLA 3B51X 3JAWB 4Q01A 4D80A 5C8ZA 1E5VA 3IOYA 4EYEA 3EXFA 2NXNA 2WEKA 3CS3A 3VGJA 2GGSA 3WYAA 4QGFA 2AC2A 1ZRNA 2ID4A 3F6RA 3SZUA 1QB7A 3R3WA 4I7EA 4RCYA 4JCCA 1Y98A 2FQQA 5EQTA 3IERA 5LJLA 3D02A 4H7KA 2FDRA 4QOJA 3DTVB 1KK1A 2PEZA 2YN4A 3WKBA 1Z45A 3JQ8B 3K6KA 3A7EA 3WX0A 3WFZA 5FBRB 4FXPA 1VGQA 5DT9A 2P4QA 2IGTA 3D64A 5JD6A 4IJVA 4BLWA 2BFDA 1P74A 4H15A 5I7EA 2P65A 3PTZA 4RK5A 4YCSA 5AKGA 4LF7B 2ZOSA 2F3PA 2Q2NA 3UMBA 3C2QA 3BD6A 1IN5A 1M83A 1Z6TA 2NPOA 5LLSA 3HWRA 3ZWKA 2ACWA 2P62A 4LJAA 3Q0IA 1GA4A 2NTJA 2DJIA 2DT8A 2A7XA 4ND3A 2R8OA 1PGQA 4CM3A 3UMRA 3OQPA 2R11A 4BFSA 4M98A 4CKEA 1QG4A 1QF7A 2JIPA 2GDJA 1MX1A 5ENVA 3Q3IA 5I8ZA 5CRIA 2VBIA 1XTBA 2WPDA 3MJVA 4DLWA 3ODPA 3T1TA 1HH4A 1F9EA 5DNWA 3DVAA 1I7QB 1UJBA 1W581 2M1ZA 4K81B 2EYUA 1KZ1A 4L4XA 1ZQ9A 4G1EB 1L5LA 3T61A 3I01M 2VTKA 3FPSA 4L2IB 1BXGA 2C9ZA 1MOQA 2EYQA 1TW3A 5CFLA 5F64A 2BSXA 2C2ZA 1I14A 2CSUA 4MUHA 4L22A 2Q1YA 4XUEA 1W4BA 3Q40A 4MVJF 4ZZ1A 3OQMA 1E0AA 2I9PA 1K4YA 3ENNA 3O8LA 1S2LA 4WJKB 5A5VA 3CSUA 1E58A 1NSTA 1KOFA 4RTOA 2W83A 3QOXA 2ZYHA 1L3IA 4MR7B 3HJBA 1UPCA 5JZOA 3RUFA 5A4JA 3WSVA 2FE4A 3VPGA 3NCTA 1U9JA 4NPCA 3RU7A 3STHA 3STYA 3KJEA 3H8SA 2GK3A 1W2GA 4MYCA 2CV1A 3MT0A 3BB1A 2ZR0A 2R8ZA 3KQVA 1EIZA 3SKYA 5KUTA 3WWOA 1Q2UA 5U1PA 5LWHA 1NVVR 5LLTA 5L7YA 1G7SA 1UBNA 4Q9AA 4X9XA 2PLNA 5FOVA 5JISA 5A9RA 2CUTA 3OO0A 1UAAA 3OU2A 3J81A 1BQ3A 3QYJA 2QT1A 4GI2A 5ECWA 2QNRA 5HYVA 3DDWA 2P7IA 3D8RA 2DBVO 1CV2A 1GXSA 3ZQJA 2NIPA 4FYIA 1Z47A 3BIWA 3GZTB 1IYZA 2C3OA 3WNZA 3L43A 2MOKA 4B2LA 4D7AA 4LCEA 2EKPA 1QFZA 1H5UA 1SUCA 2ZDGA 3G2QA 3IMKA 1DBPA 3OZUA 2ZBVA 4DMCA 4L57A 1ULBA 5JMTA 1KFCB 2DYKA 2GN0A 1IEWA 1PJBA 4LPKA 3WGUA 3UMMA 4BN0A 1RWOA 4MDFA 1AUPA 4BQFA 3PPWA 3AX6A 3H84A 4MB0A 3LYAA 1U6IA 3TRFA 1AHHA 1H2ZA 1TADA 2WJJA 4C6HA 4BEJA 4QFCA 4BP8A 2JBAA 4URYR 1A9XA 2NT4A 4IVNA 2JKVA 3LSTA 2RSLA 4TKVA 2MSKA 2J7PD 1JJVA 2GK7A 2ZJYA 3PC4A 3TD9A 4CF6A 2XTJA 2FJUA 4XIFA 3ZI0A 3A1VA 4E51A 4X64B 3RRBA 1R00A 4MI9A 2VJNA 4WA7A 4ECEA 2P2SA 1OXKB 5FNVB 1TRHA 1X38A 3S29A 1ZUNB 3T7AA 1W87A 3CNOA 2L2QA 4RULA 3Q9NA 2DJ5A 1CP2A 3OF3A 4J8PA 4KXWA 5HRUA 2ZB8A 1K5GA 2CK3D 2P6NA 4NE2A 3B3GA 4BOYA 4B3TB 3NANA 3N0TA 1LGYA 3R6DA 4Q24A 4R1OA 2G36A 1VHWA 5FI1B 4YQEA 4BEWA 4M9XA 4IGAA 2VI5A 2XNJA 2VRWA 2ZTVA 3O1HB 4P54A 4X90A 5HQJA 3WRVA 1VB3A 2AX3A 3MVEA 3BZUA 3UGQA 3G0DA 1NW3A 4CYMA 3GHYA 4BAGA 2C9BA 1DCFA 1GL3A 1RJGA 1UMDB 2F1IA 3DE4X 3KZKA 3HJGA 2QRGA 4HLDA 2G0NA 2O9JA 2ZULA 3K3PA 4KXVA 4KVAA 4RCZA 5FTNA 3V1KA 1IH8A 4DLZA 2PGDA 1A8IA 3U60B 2C0CA 2GN8A 5K1ZA 5KVQA 3SF8B 1G8AA 1NY6A 1RACA 1NF9A 1PG5A 2BBWA 2EHJA 3OQIA 4Q9DA 1DBRA 5AIBA 2V8BA 1UZAA 3EFBA 4U8GA 4ZVLA 1WXQA 4RPGA 3KWFA 1GARA 1YT5A 4G07A 4JL8A 3B6JA 4A2QA 2WAYA 4TYNA 1SKYE 1VBMA 1SULA 1QZ3A 3H4MA 4YJ3A 1QR6A 2WT4A 4OBWA 4TMZA 1EDZA 3SMQA 3SEQA 3P4UA 2PXHA 4A3SA 2WWYA 1FVHA 1OWLA 1WX1A 2BZGA 2QJTA 1XF9A 4IDOA 4KIUA 4UBJA 4MW2A 3U7QB 5A9SB 4J0JA 2J9RA 2J07A 1NSYA 4FNGA 4EA7A 2EAUA 2DLCX 4QUKA 4PC1A 5KTSA 5LL6P 2XOEA 1SFRA 3M6FA 1A1VA 1KSHA 4YN3A 3OJCA 2QI9C 2QM7A 1DBVO 4AY5A 5KAPA 3A6EA 1MT3A 5HK8A 5L95A 2FWAA 3WB1A 2L0XA 2XYVA 4RAQA 4L3VA 5HBRA 2WKPA 1OBCA 3TSAA 2SHKA 1MABB 3BKWA 3Q7QA 4YJ2F 3OQBA 3TJZA 1K3TA 1QH9A 3KVRA 4TT3D 1V8DA 3W4KA 3WLOA 1WQ3A 2F43A 3WLFA 2YNMC 3ZV6A 3B9RA 4PR0A 1RZVA 4B40A 3NT5A 3JRXA 3PV0A 3FUXA 2GRUA 2OQIA 1E4EB 1IC6A 2NTVA 3AL3A 4NJMA 3F49S 4FDAA 3U3DA 4PINA 2KQUA 1A2KC 1ADCA 2DFDA 1Z3CA 3D0QA 3IDFA 2Q2VA 4OXQA 4TKZA 4S05A 1JILA 4RBNA 2FF7A 5FFMA 1ZMXA 2QSZA 3H1BA 4EYSA 1D4AA 1E3WA 4S24A 1NQVA 3D2CA 4J16A 1CS0B 2ZBPA 2QRQA 3LIIA 3DW3X 1WE2A 1JKMA 3SZGA 1R6AA 1OZ0A 4N3BA 3HCCA 3W6UA 1QQ5A 4BQIA 4MW9A 5IYZA 3IT1A 4X94A 3K1TA 3WGVA 2DFNA 1NLFA 4BBPA 3R4CA 4D8VA 2O1WA 5L45A 3MQFA 4TLCA 2IDKA 1O6GA 5JZMA 5MN5A 5J2UF 1PX0A 4E4RA 1SCAA 2FN4A 2GAIA 1L8AA 5HS4A 1YZKA 1E1QA 1VJTA 1PJTA 2NU6A 4E5SA 2JJ2D 5KNCA 3OA2A 3GQBA 2DFKB 4OMDA 2G76A 4HC4A 5B1YA 1MNQA 1X2EA 5BQFA 2XD4A 1RM5A 3VAYA 2UYGA 2OZPA 1KS2A 1AGXA 5J5AA 1U7PA 3TQQA 2IIQA 3ER6A 4P1ZA 2ZETA 1A9ZA 1TZJA 4X7BA 5EPUA 1RE1A 3KE8A 1TAGA 4S1PA 5H68A 4DMGA 2W6IA 2EEZA 4IWXA 4C4XA 1UDAA 1JFVA 3BB3A 3IO3A 2F64A 2XKBA 3M4NA 1SB8A 1PL7A 1CQPA 3CZRA 3QUAA 5AK4A 5FUXA 3SSMA 4B35A 1FFHA 4B3DA 3GFPA 4UZFA 3GLVA 4HNQA 1TLLA 2DPYA 1GDDA 3QEJA 1PWYE 2ERXA 1T8UA 3T52A 2GZ1A 4CTMA 4M7PA 2OD9A 3M6LA 2IP2A 4KQFA 5CBPB 1X14A 1M1NA 1QLHA 1U0EA 2QUJA 1NTRA 1EGMB 1TKRA 4RMNA 4BO9A 4GUAA 4YMSA 5G0WA 4KFTA 1P8AA 4QBHA 4XIJA 5HNKA 2F3SA 2YXPX 4JGIA 1Z07A 4KAAA 3L8EA 1P0MA 1OLSB 4E2WA 2B1RA 2JHPA 1K7XB 3TM4A 4JLMA 5ALTA 5SY9A 2CXHA 4E2XA 2Z2JA 4JVSB 1RRFA 2DR0A 2FWNA 2FWMX 1WXGA 2C42A 2OHFA 1ZNWA 2QD4A 3C5WP 1KRHA 4O4HF 4RPHA 3DHWC 3VU3A 4RPCA 4DLKA 1X1DA 4TMKA 1C2TA 4NKRA 3UMSA 3U7FB 3IDOA 4H0CA 3V4SA 1NN0A 3FCYA 3T34A 5BQ3A 5FHRA 1BXZA 4AMYA 3ADPA 3C87A 2WSBA 1LRLA 4NU8X 5ADWA 3LVQE 3AK4A 5MHTA 4WFJA 5L4NA 2XE4A 2ZE5A 4OM8A 3NJ8A 4RKQA 2IHZA 1KDOA 2VL7A 4V39A 5TE9A 3ZVLA 3TXAA 3HU5A 2AXPA 2VJBA 3PRJA 5FA8A 5BURA 2QTZA 3A4TA 4WKNA 4LDQA 4DC1A 1CFZA 3O90A 1T2NA 3Q8LA 5FEUA 4ZJZA 5FQOA 4ENQA 2R9VA 2WF5A 2ODNA 3SYMA 4GUDA 5KNCD 5T41A 1U7OA 2OC9A 2WJZB 3BEDA 4AC9A 4AQYB 3CSSA 4IMRA 1QDEA 3ISTA 2IYUA 4FGKA 4FHCA 5AQEA 421PA 1QWSA 2JKZA 2ZTHA 4J2HA 4ZZ2A 1A4UA 2Z6UA 4JJ4A 3TBHA 3WLIA 4BO6A 3OT5A 1DXQA 2I2BA 3K2EA 1BDIA 1JB1A 3CBGA 1W46A 1YCHA 3U16A 1POXA 4MGKR 4QG7A 5F2NA 1KKUA 5F35A 3SQDA 2W2OA 2BFCA 3DL2A 1IUPA 4EMSA 4LF9B 1Y3HA 2ZIZA 5AKJA 1IZYA 2FZ4A 2QGFA 5IT5A 2FX2A 3LKZA 5AICA 1RI5A 3ESYA 1N1MA 4TMXA 1ECBA 4JV5B 1GTMA 4P34A 3ZJ5A 1QH1A 1OYYA 2PX3A 3PX2A 1VJDA 2BW0A 3JWIA 3Q12A 1XKLA 5CJJA 5CA1A 1F6BA 1ZK3A 1NG9A 1SD2A 5IF9A 1M8JA 4BLOA 4HGQA 3EVGA 5EZSA 3D8BA 3SJUA 1CDZA 2HXGA 5BSGA 4DSTA 4ZXPA 3QKUA 1YFZA 1WDKA 3ITKA 1E2FA 1WBBA 2PMEA 4PO1A 1XRRA 3NYWA 5KVCA 2QTGA 4IDDA 4NJMB 2M9MA 4L15A 3BIXA 1KDRA 5DYWA 2PXAA 4ZK6A 1D4OA 2C7PA 4LOAA 2QE7D 3HR4A 1CUEA 2H92A 2QA5A 1Q3TA 3L0CA 4XJTA 4ZVKA 3WL8A 3LUFA 1YK0A 5AXBA 4CLHA 4CU5A 3DM5A 4DZTA 4AJNA 1Z5VA 2NZ2A 1CJTC 3CRNA 3GZ4A 1TU3A 4M38A 4BQPA 3GA7A 4JKOA 3WIOA 4CLXA 3EHDA 1X3LA 2VF8A 3LLVA 4PZCA 4QXAA 4DANA 1VHQA 2DFPA 1U3VA 3LWDA 1OU4A 2XSZA 1WZNA 5DCYA 1CZNA 1X1TA 4YJ2A 2ENUA 1NLUA 5G4KA 3BAFA 3QX9A 4JOCA 4P3XA 1XZLA 2OV3A 3SCZA 3SQNA 3AOEA 2CLSA 3AF2A 4GU5A 4KWIA 5K8VA 3ZDAA 3E15A 1OV6A 2IP4A 3WGHA 1JLMA 1Y7HA 2W6MA 3FOAA 4IDGA 3K09A 4JLPA 4EB3A 1P4SA 2BGGA 1QHSA 1Y1PA 4PLCA 1P5JA 3WHIA 1R74A 4RELA 3AEKB 4EJSB 1OFUX 1W48A 3NHUA 4I4NA 5GJCA 3W78A 4LYDA 1NN3A 2ZIXA 1ISPA 3ZXSA 3SAJA 4QU8A 1UFQA 4MQ6A 5IP5A 2PLRA 5REQA 3K6SB 1ORDA 4MS3B 1YNSA 3OOWA 4GZMA 4K6GA 4MUAA 2PA0A 4HH3C 2IEDA 3SEFA 2XB6A 1WQ1R 4X5OA 3FPLA 1E2MA 1Z4KA 1SUPA 3IP8A 5DYTA 5LNK6 1Q0SA 4BP9A 1DOAA 2JFOA 3I0ZA 3QZUA 4HEA1 4NNPA 5ERGB 3K0AA 3F6SA 3L4BC 1JKJB 2X0KA 3BD9A 4LZZA 4YK7A 2NUTA 1SC9A 3UATA 1YFLA 1QZUA 2BONA 2XJ9A 4RSRA 5BYKA 1HL3A 1I7SB 1P91A 4JJGA 3MIZA 2PBZA 3EPJA 2UZ4A 4MQEB 2V4UA 1EP1B 2NYAA 4PG5A 1RZUA 4BP1A 3M6UA 3RFTA 4LG1A 2R96A 4ARUA 1J06A 1WUJS 1LBHA 4JLKA 3MWGA 3VR4A 2BRUC 3DR3A 3PFKA 4G01B 2GM4A 4B85A 2CD9A 2OG1A 3OY2A 4QX6A 3U44B 4A26A 4X66B 2XZDA 4YRZA 5HJ7A 1NXPA 3UOGA 5BYJA 5DP2A 3UK0A 5BWBA 1FFAA 3C43A 3NZEA 4Y9UA 5AI8A 2VYNA 4BGVA 2BEUB 2QAGB 5AW8A 4MVJD 1RZ3A 3LKVA 3PEFA 3V46A 3GEBA 3DXFA 4O4LB 1YCGA 3GLRA 3NPMA 3RT9A 3BE8A 3IKTA 2OYRA 2RHHA 1G3MA 1XCBA 4I19A 4AUKA 2GZ3A 3I2KA 4QOFA 3EE6A 3OH8A 1T1IA 3WQHA 4EW2A 5JYDA 1DC6A 5LMCA 1K66A 2R751 4EJSC 5DK6A 4ZAFA 1EP2B 2YVAA 1GU0A 4PW0A 2Q4TA 2CNWD 2J3LA 4WKGA 3KJZA 4PSKA 4R0MA 3Q9SA 1I5OA 1MC4A 4AVYA 4IIFA 4YRKA 5FA6A 5C80A 2RD2A 2EQBA 2X0IA 1WABA 3HVKA 4A36A 1DJQA 3THSA 4ESHA 2AMLA 2FVYA 1JIKA 4HGZA 4JLNA 3TE6A 4ARZB 1RLOA 4C20A 1NQAO 2W4MA 4R7ZA 3GXBA 1NW8A 1TVMA 4MWTA 3X1YA 1Z56C 1WUKS 1WZEA 3LBAA 1BWPA 4XX1A 1U6KA 4YJGB 1KMHB 4V0RA 3KSRA 3J7AC 1UOQA 2GS9A 5ES4B 4Y0VA 1E60A 2JAOA 5EIBD 1GKUB 3GVPA 3EGDB 4K87A 1NBMD 3GQVA 4KR7A 3A4L