4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
b'KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cholinephosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
2X1MA 4EG7A 1I6LA 3COZA 3FI0A 3QTBA 3FOCA 1R6UA 3H9CA 1JIJA 1N1DA 4NATA 3FG9A 3COYA 1N2EA 4DDMA 4PY2A 1V47A 1TYCA 1YIDA 2D13A 4CQNA 4HPWA 1O96A 1QNFA 1WJGA 2A86A 1D2RA 1JEEA 1R6XA 4HK4A 4MVWA 2RD2A 1H3FA 1QU3A 3RK1A 2A1UA 4QRDA 4DJAA 1KH2A 5JBNA 3IVGA 3LE8A 1N2GA 2QUJA 2C5SA 1NUQA 5HUHA 3KT3A 3FWKA 1VLHA 2X3FA 1NUUA 2WQ6A 4DDKA 3M5WA 4UZFA 4OUDA 3IDFA 2D5BA 2PXHA 3IOBA 2IELA 1NUPA 3TS1A 5J59A 1VBKA 3GUZA 4AS1A 2HMAA 3AL0C 1WXGA 4G6ZA 3DPIA 5TS2A 3BL5A 1Q15A 1WQ3A 3L92A 3P0JA 1YIAA 1T6ZA 2QTRA 3KT8A 4KR7A 2QTNA 2WQ7A 1VL2A 1WXHA 2CV1A 3AKZA 4CDMA 1JGTA 3CLRD 3CLRC 1MAWA 4MWDA 3I05A 4MVXA 1ILEA 5DASA 3OP1A 4EG6A 4EGAA 1NSYA 2CYCA 4TS1A 4GRIA 1U7DA 2A7XA 2J08A 3IVCA 2V0GA 3ZJTA 2GOYA 1JIKA 1JILA 4ZT6A 1XNJA 5EKDA 5H16A 3S3TA 1KP2A 4YMIA 4RUKA 3FY4A 1HYBA 3ILVA 2J5BA 3CLUC 3COVA 2VTBA 4ZCTA 3RJZA 1TEZA 1LI5A 4G5YA 1GTRA 3KT0A 1WXEA 3UMVA 3H05A 1KAQA 3SZ3A 2CT8A 4QREA 3C8ZA 3CVVA 2DETA 3GMIA 3SYTA 3E27A 1N75A 1BS2A 1MBZA 3NV7A 1O0BA 1EUYA 1IQ0A 1EFVB 5KHAA 3QE4A 3DV2A 1ZUNA 4NX2A 2R5WA 2ZUFA 1GAXA 2A1TR 1IH8A 1KR2A 3ZIUA 3G5AA 1Y42X 4GU5A 2IJGX 4MUEA 1J20A 1WXIA 2BYTA 2OQ2A 3UC5A 4DE5A 3VRHA 3HFJA 3JXEA 3LOQA 4I6JA 2QUHA 1MC1A 1N2JA 4ZCRA 4ND7A 1JIIA 4YP7A 1RQGA 1PFVA 3PNBA 4MLPA 4EG1A 3A05A 3A4IA 4YP5A 4JZYA 4MUGA 1H1TA 2D54A 1TYDE 4PBSA 1EXDA 1PG2A 2O5RA 1A8HA 4OJMX 2AKEA 1K92A 1MOPA 3ISJA 3P52A 4MUFA 1O0CA 1YUNA 3CA8A 3HMQA 3ZJVA 3IOCA 4QBTA 1DNPA 2TS1A 4MUJA 3QTTA 4MUKA 4CDNA 1N77A 1NI5A 4E1AA 3MLAA 1EFPA 4JFAA 1ZJWA 1JEDA 2CFOA 4NAHA 4F4HA 2DUMA 2ZUEA 4WNYA 1VBMA 1OWNA 1J1UA 2PIDA 2Z08A 1MRZA 1KORA 1NURA 3IMGA 3RK0A 4JYZA 3IUBA 1M8KA 4MW2A 4NZPA 1MAUA 1OD6A 5IJXA 4MUHA 4JXXA 4J76A 1N2BA 4MW5A 1NZJA 3MUEA 2JA2A 2PZBA 3X1JA 2I1LA 1OWMA 3DO8A 1IQRA 3D6VA 4I6EA 1KAMA 4MWEA 1ULHA 3DLAA 2DEUA 1K4KA 3RHSA 3UK2A 1GN8A 1Q77A 2YWCA 3ZGZA 4I6GA 2E0IA 1MB9A 5TEVA 2QJOA 1MB2A 3X1MA 5J5AA 5LLTA 2NSYA 4L2IB 2AZXA 4ZCSA 1GPMA 1JZSA 2WSIA 4DDHA 4KR9A 1N2HA 2J4DA 1I6KA 2GKSA 1NUSA 3SDBA 4R0NA 2J07A 4ZT5A 3Q10A 3ELBA 2PZAA 3VGJA 3CR8A 3MLBA 4YP6A 4ZT3A 1ZH0A 3CLSC 5LFAA 3CVUA 1FFYA 1YUMA 3COWA 2J09A 4MUNA 4ZCQA 2O8VA 1KQNA 4MW1A 2JANA 1OWPA 4ZT4A 1QRUA 1N3LA 3FDXA 2CV0A 1K4MA 3CLUD 3CVYA 1F9AA 3N05A 4EG8A 3K9WA 2E89A 1I6MA 1M8GA 2GM3A 1JHDA 1G8HA 2CSXA 1PFUA 2G36A 4R2LA 3KT6A 4K03A 1OBHA 3GLVA 1NYLA 4U8HA 4S1OA 1WZ2A 1OWLA 1IQUA 2A1TS 4MUIA 3D6UA 4ZT2A 3IOEA 3TNJA 1N2OA 5DK4A 2CUZA 1T9GR 2YXNA 3K32A 3P0IA 3OTWA 5KCMA 3AG6A 4KPUB 1TYAE 3UOWA 3RBAA 1QRTA 5AHWA 3ND5A 1QQTA 3FHJA 3PRHA 4MW6A 3ZXSA 2VXOA 2EL7A 5F23A 1P7PA 4ZT7A 1XNHA 1UFVA 3TQOA 1OWOA 1TYBE 4DLPA 2YY5A 2Z3VA 2XRZA 1IFXA 3H99A 1O5TA 2AG6A 1PFWA 5FO0A 5FO1A 5FNZA 1JMVA 1EUQA 4HJXA 4XFJA 3ZJUA 4XFDA 1J70A 1XJQA 1YI8A 4XSVA 1Q11A 1T6XA 1QRSA 1WY5A 1ZH6A 2H29A 3IODA 1XNGA 5H7XA 3HZRA 4ND6A 1NUTA 3AG5A 5HG0A 2CYAA 1F4LA 1KQPA 1IRXA 2E21A 1PFYA 4MWBA 1QJCA 3AIIA 2EJCA 1H3EA 3SP1A 1J1ZA 1WQ4A 1LI7A 2JAXA 3ZUGA 2BTEA 1M8FA 2HZ7A 3FIUA 4U7JA 1KH3A 3HL4A 4ARCA 4NDAA 1U7XA 4EF6A 4L2IA 3CLTD 4MVCA 3CLTC 1U0BB 1N78A 1GZUA 4MULA 1EJ2A 1QTQA 3A04A 1COZA 2PZ8A 3INNA 3CVWA 2A4MA 2YWBA 3HV0A 3LCJA 3IMCA 4U63A 5TEWA 4EFKA 4MW4A 5K0SA 1J09A 4UZEA 1G8FA 4Q93A 1U3CA 3IMEA 5J58A 4G5FA 1EFPB 3TZEA 3Q4GA 1JECA 2X0KA 4DNXA 4J75A 1O95D 1J21A 1O95C 2ZP1A 4MW9A 3RFFA 3MMXA 3UY4A 2WB2A 2Z09A 3SZGA 4FZJA 1PG0A 3KFLA 3MXTA 2DERA 1O96B 1K97A 4HJRA 1KQOA 2XRYA 4A91A 2A88A 3ND7A 3NBAA 5KWVA 1G59A 1GLNA 3AFHA 3NBKA 1H3NA 2A1UB 5DEOA 4EG5A 4EG4A 2DXIA 2DLCX 1IVSA 4ZCPA 1KKUA 3CLSD 1I2DA 1NP7A 3N9IA 1JZQA 1O97D 1O97C 1V8FA 1M8JA 2QJFA 1R6TA 1U3DA 1MJHA 3X1KA 3A2KA 3G6KA 3IUEA 4WSOA 2QUIA 4MW0A 1EFVA 1F7UA 1T6YA 3L93A 2E18A 4OUDB 2B7LA 2QUKA 3PNYA 3H97A 4YBRA 1LW7A 3PNVA 4KPUA 3FNRA 1X6VA 3N8HA 3Q12A 3TQIA 3VU8A 2CV2A 1IHOA 1VBNA 1S4MA 3F3MA 1SURA 2PFSA 3U1VA 2QJTA 2CYBA 1GTSA 3ZXIA 1FYDA 1F7VA 1KP3A 1T9GS 1X8XA 5HUJA 4MW7A 1YULA 4KR6A 1WKBA 4K0RA 1B6TA 1TQ8A 4PBRA 4KKVA 3FH0A 2V0CA 5TGTA 3N2YA 1M8PA 1WXFA 4CT0A 4NAUA 2QTMA 3SEQA 3ND6A 1KH1A 2H2AA 3HGMA 2VTBB 1M83A 3TZLA 1CT9A 1TFUA 4MQ6A 5DB4A 2DR2A 1WOYA 1OBCA 3FETA 3P0HA 1N2IA 2OV4A 4BWVA 4H3SA 1M1ZA 4R2MA 3CVXA 4P2BA 1G8GA 4MWCA 4RPIA 1Q19A 2IP1A 4PBTA 4F3RA 4X0EA 4MAFA 5IHXA 2NZ2A 4ARIA 3H9BA 1QU2A 3G59A 1EE1A 3SEZA 1O6BA 2HGZA 4Q16A 4JXZA 1O94D 1O94C 2A84A 3PXUA 3IVXA 5LM3A 4AQ7A 2DPLA 4MVYA 2PG3A 4EG3A 2X1LA 5K0TA 5BNZA 2RE8A 3IH5A
chains in the Genus database with same CATH superfamily
1S01A 1C9YA 2BEWA 3A25A 2H00A 1QHSA 1LC0A 1HR0B 3KOOA 3KZ1E 1FXWA 1R1DA 1VE5A 2W2XA 4C5AA 4EHDA 1Q0UA 3O6VA 5C34B 3UV3A 2VYFA 3JVEA 3M3PA 2V9ZA 3IOYA 1OCEA 3AM5A 4QRHA 3WBKA 3WNVA 3EIUA 7GPBA 1ZSYA 2COEA 2IOQA 4Q4CA 3UMRA 1BMFA 2LBPA 2PKEA 3A32A 1E98A 1JV2B 4IG4A 1MHTA 2CVOA 3CW9A 1JWLA 1E2MA 5KJCA 1JEEA 2HV9A 4NL4H 5EHNA 2JBAB 4QU8A 4B80A 4NYMQ 4NHEA 1D5WA 4CE6A 4R6WA 4QJ3A 3U3XA 2OFXA 3FOEC 3HL0A 1HG1A 2ZM6B 2VVTA 1XPUA 1U2EA 4FX5A 3DEHA 1UK6A 4RABA 1B93A 3ZG6A 1E9RA 4CKBB 3GCWA 2DLDA 1P4HA 1NXSA 2R6JA 4XGKA 4E4YA 1GUYA 1ODKA 2OOKA 2Q46A 4JI1B 1GRRA 1CW2B 2H2WA 3AB3A 5GGYA 2DUNA 2AR9A 3AQIA 5DM0A 4C29A 2IV3A 1V9SA 4FWIB 2X15A 2E49A 4GDFA 2WDPA 1O57A 5FADA 3WQBA 5JAMA 3NUQA 5CFPA 3UTDA 2WMYA 2SKEA 4F9FA 5IT9A 4D3SA 2P5YA 3AL0C 5CFLA 2PRYA 5K3EA 6Q21A 4FUTA 1J7JA 1JXMA 5LJIA 2WIBA 2HSEA 2W37A 4P0TA 3LOUA 4EWLA 5DDIP 4H3HB 4J43A 2QTRA 3IS3A 3KKEA 5BW8A 3EVGA 5FPKA 4WWHA 5KU7A 4MGEA 3GLTA 3NP9A 4PPQA 2G70A 5T57A 1CUBA 1H0RA 4FGSA 4PPFA 1F6BA 2IWRA 2GEFA 1P3Y1 1BN7A 1QS0B 2CGEA 1FCJA 3IKMB 4JBHA 4CLOB 2QVCA 3JTEA 5EFOA 5CA1A 4YAFA 4JUIA 3GFOA 3IRUA 3IIMA 4DOMA 3FHLA 1HFWA 3L7BA 4TGLA 1R8XA 2NWQA 5LQKA 5EGNA 4CCWA 4HH3C 1YHZA 4ZYTA 3QG5A 4X20A 3IR5A 1GSAA 2A7XA 1VJ5A 3D2CA 5T8KA 1WVIA 4JI5B 5BYBA 2WAMA 3W3AA 4GL4A 2HYDA 1N0HA 4ND4A 3BFKA 4H7HA 2RONA 4ND8B 10MHA 3N8KA 2J5BA 4LK2A 4FOLA 5EJAA 3LA6A 4K9NA 1JB1A 3L5KA 1SBQA 1ZSVA 2HXYA 1T4GA 2GCPA 3LT4A 4UNSA 3ZWWA 5L7TA 3SJBA 1KAQA 3NYWA 3S5UA 1X92A 2QLMA 3H4TA 1B6SA 5CCDA 3FSGA 4FSDA 1W34A 3DMHA 4R1TA 3ZI7A 3BWVA 1O0BA 1FX1A 2JCSA 3R3JA 3DUWA 3QXJA 3W5HA 4CNBA 3P9PA 4D8VA 3E5HA 4WH0A 4HGQA 3UGKA 2HPVA 3NVMB 3MQ2A 2PLNA 3UJBA 2BMJA 3TSAA 3PHCA 2OLEA 2JFWA 5BT9A 2NO1A 3A6HA 3OMXA 2ZG6A 3ZCVA 2WM2A 3NUZA 1Z29A 1E6KA 5EPUA 3C5HA 3NHZA 1L4UA 1MOZA 2C9ZA 3QX7A 4K2AA 4BC0A 4RTNA 1B0ZA 4DHWA 3AUUA 4C01A 1C0LA 1FLAA 1DJPA 4MI6A 5IHPA 1Z0DA 3C8HA 2X0RA 2IZ0A 5TE9A 3O0TA 3I42A 1ONNA 1EKXA 4R0VA 1SG0A 2J0SA 3AW8A 3K31A 4D99A 1T43A 2J3IA 3NOXA 3WGUA 3I3OA 5BNWA 4A6XA 3PL5A 3BRSA 3HEMA 3L1UA 1YO6A 3O1JC 3G2PA 3JQPA 3LLVA 4L3VA 4QJBA 5ADUS 4RTRA 2BFAA 2JFHA 3M34A 4TMVA 1S3FA 3X3HA 1O6ZA 4KLNA 4KOEC 4DPMA 1CEQA 3ZBQA 3O31A 3GELA 3LO5A 2LDBA 3MRTA 3MT0A 3C2QA 4MUFA 2VSFA 4ZKDA 4FWTA 2Y8EA 2JBAA 4YLGA 3S0JA 1D5CA 1DNPA 3PUHA 4XVRA 4U7DA 3I34X 5LQJA 3JQDA 3SLKA 2ZRMA 3K8ZA 1XR3A 4Y6PA 3ZNQA 4ETNA 2JJ8A 3N6XA 3UWDA 3V4SA 2M98A 2P41A 4P36A 5TS3A 4CKBA 4YCNA 3EFEA 3T1HB 2X2OA 2Q3EA 3DOFA 1SXJD 3ZI4A 1OX6A 2NXJA 3M1AA 2BELA 1CP3A 3IMGA 3B78A 3A31A 3CYFA 1TIPA 1WWKA 2FP4B 3UUFA 2X42A 3H3JA 1NX9A 5IM4A 4PAOA 2V59A 4YJ3F 2YUTA 4ZVTA 4BNYA 3A4NA 4GSYA 1TT5B 2JJYA 4OJNA 2QN7A 4XWAA 1FB5A 2EX0A 1E58A 1N5MA 4YDHB 3RH0A 2QD5A 3CGGA 2D0OB 1EP9A 3ANMA 5EPEA 3WP1B 2Q9UA 2XXAB 4LXTA 3TRDA 3JTMA 3ZZ0A 2DUWA 1IJKA 1KRHA 1ZD5A 4TS4A 3UW1A 5C4IA 1YRYE 1Q74A 2WU4A 3OIFA 3DVSX 2IS1A 3B8HA 3NPAA 1Y7IA 4NH0A 4RH1A 5AIBA 3HTXA 4DA9A 4WXHA 1J8VA 4P82A 5KWIA 1QZ3A 1UBTS 2NVBA 1Z13A 2H52A 1JTVA 2W6JA 1XN1A 5FR1A 2WYUA 4PZUA 3JQGB 3RS2A 4U5XA 3PSAA 5HIJA 2QKYA 1WB5A 4CLOA 4CTOA 1OREA 3JWGA 4HTFB 2D7JA 5CDUA 2XWPA 1HURA 2R1ZA 3RFVA 4EIWA 4B4WA 2FUNB 4MYRA 4D3DA 2CF5A 4CM5A 3BXPA 3BT7A 4RHYA 1XPRA 5K8VA 2BD0A 2ERYA 2EBFX 3O4VA 1IOVA 5KOIA 3RYCB 1QQ7A 2VI5A 1L1FA 5L40A 1CSEE 3K1TA 3D7RA 4ND8A 4YNBA 2GKOA 1KFCB 2HJHA 4WOBA 4Y0AA 3W9SA 1PZXA 1V3QE 3OMWA 4QICA 4Q03A 4D4LA 1R12A 4DXHA 3PEFA 2WAYA 3WISA 5K03A 2ZUBA 4ZRMA 4OP3A 2V9PA 5JWOA 1DGQA 4QGBA 4E5NA 2CMHA 1EINA 4P5DA 4D45A 3VNQA 3ZS9A 4BJ1A 4B4OA 1KC1A 2DY1A 2LIVA 2XCIA 2I1QA 3L8ZA 1NNEA 1PW7A 1K4MA 2H2GA 4KNVA 3U7QA 5IDXA 3PUZA 4C06A 3BK7A 1K88A 5BWNA 4KLAA 6YASA 2CMGA 2WF5A 2GAJA 4BQNA 1ZHFA 3I5UA 4Y9TA 4KRFA 1PZNA 2VJQA 3DW1X 4RMGA 4XIGS 4GF5A 2C7PA 1W6RA 2BHRA 3IKLA 3KZOA 2YJTD 2XEDA 4JS0A 1N57A 1NJ1A 3D8UA 5I7AA 3IOEA 4I08A 2M6RA 3TSOA 3ZHOA 2C99A 3VZRA 5JR3A 4OIFA 5AJVB 1KO5A 5ER9A 1ONOA 5CLJA 2E5WA 3BXXA 1XQ6A 1YDGA 3LFTA 4UD2A 3RBAA 2BV3A 3WDMA 4YMUA 1PU2A 3D4IA 4MKHA 3UHJA 3KNZA 5KJ6A 4CU5A 4Z53A 5GZ3A 2QBYA 4F06A 4NY1A 1SUAA 2H5IA 3NASA 3T3OA 3I73A 4BRUA 3C5VA 1R37A 4LIPD 1E9EA 4C7BA 3AUYA 4BNLA 3S68A 2EWVA 4R2IA 3H1EA 2QR2A 1OX4B 3IAUA 5HKKD 3ND8A 3G0BA 3R3HA 1AZSC 2PO5A 3RT9A 3F78A 5DT2A 3T54A 4WXPA 5FO1A 3L0SA 3A6LA 2WWTA 1E1RA 1NY6A 4HJXA 4XFJA 4CEIB 1XO1A 4GGPA 4XFDA 1LZLA 4GI1A 1UKYA 2FY8A 3IQDB 4OAOA 2VSXA 1XTKA 3IXMA 5HZKA 1JDZA 3O4JA 1E69A 5CNIA 1HTTA 5AM0A 1GG8A 3K9NA 2IEYA 1DRKA 3BMXA 2AK2A 1TT5A 3GFQA 1P1FA 4ETIA 4Z9YA 4N7RA 5CNMA 4F60A 1T8YA 1OXMA 3GOQA 4XLLA 3ROXA 2G80A 1DBPA 1EQ2A 4QHSA 4DR2B 2XNHA 1BG6A 2G1JA 1T5HX 3LBNA 4PQFA 3U4CA 5KNDA 4RDCA 5EWMA 1JJIA 5CR9A 3UFBA 3CMCO 4XDHA 1S3SA 5C31A 4NDAA 1EG2A 4UJ3A 3ZVLA 1WW8A 1JQKA 3TD9A 3K0BA 2W00A 3JQGA 3ADOA 2VUSA 2ZWVA 3ZVMA 4YRBA 3B9RA 5KTTA 2KM1A 4RZ2A 5MHTA 1XNRB 4EY7A 1JQAA 3O75A 3OETA 1WNTA 1KQFA 2G5TA 3UHAA 3IMKA 1HNXB 1X94A 5JS6A 5TEWA 1ZCJA 1AKMA 5JNSA 1KKMA 3QXCA 1K86A 5FA5A 3W04A 3FBGA 4EFMA 1QP4A 1QHEA 3E5RA 2DULA 2C59A 4L27A 1XEWY 1EA5A 3GVCA 1V3VA 2PKCA 3TVTA 3RYCA 4IFIA 1SHLA 2BGMA 1TAQA 3AM4A 4UFOA 4AKGA 1XRLA 3K2QA 1FX0B 1RRKA 3DE2X 2DFTA 2HBQA 1S2DA 3L2OB 5EZ6B 2J48A 4H1WA 2FU5C 2ZITA 1TQ4A 3MXTA 4WY2A 3HWX1 4KQIA 1IN6A 3T12A 1KI7A 1Z34A 4JLNA 2ZIFA 4ZK6A 3ABSB 3K16A 5LZ5A 4X66B 4A91A 4EPWA 2A88A 3TIIA 7REQA 3NH9A 3RUFA 3PP8A 4A03A 3T9AA 4G1FA 4DCTA 2PJRA 3NBKA 4K6KA 2D8MA 2FWBA 2JLWA 3AILA 1SQ5A 4RHUA 3NIBA 5KHLB 3OQOA 4IOJA 4MS3B 3R6DA 2RHHA 3GAZA 2J30A 4PC7A 3NRCA 4WUVA 1ODTC 2HMSA 3ZE7A 3OEEA 5GY7A 3EZ6A 3DD1A 4DR1B 1OH5A 2GBLC 2GZHA 1WKCA 5HKBA 3EAQA 3X1KA 5IT4A 4P93A 2PZEA 5BRJA 3IUEA 3DONA 1OROA 4WZ6A 4HAXA 1DJOA 3MUNA 2ZJ0A 3JQCA 4G1VA 3ROMA 4EDHA 5KVSA 1NT2A 5DI3B 1R6DA 2ROQA 3U49A 4ZHSA 5ELXA 2QUKA 4M0FA 1E1CB 1HM5A 1ES9A 1P7VA 3E22A 3JQAB 4XD7D 2V65A 1CY2A 4O6VA 3W6PA 2RAVA 4MARA 1C3EA 1GPWB 4XVCA 4ZOLB 5BYKA 1ADJA 1XA3A 3EQ9A 4IJQA 2ALJA 3OFVA 1K6IA 4FW9A 1PRYA 3MRXA 4TWZA 2QTGA 4UC0A 1ADGA 3GGJA 3PICA 2G1PA 2OFFA 5CEFA 1RHKA 4QTZA 3AVXA 2JGJA 3NHUA 3ZZUA 2VDVE 3LL7A 3AF0A 5T5QA 2XTNA 3CF2A 1Y9EA 2YIJA 1X8XA 3L8FA 2PRIA 2JDID 3E9NA 4M3NA 5HUJA 1FQJA 4JJGA 4YCBA 4Y2VA 1HDEA 4FOOA 4HC4A 2C07A 2PRZA 1JG4A 1OX4A 4GRDA 3OF3A 4I8XA 1LDGA 4XDZA 3I28A 3WLIA 5L3SB 2Z1MA 2GA9A 1M7HA 1OT3A 3DEJA 3FH0A 4I1SA 1UP6A 2DY0A 3X2SA 4CDGA 5F7XA 4CEIA 1WX1A 3DPUA 4DPKA 2QTMA 4XASA 4NK4A 1TRKA 4DBLE 1PR6A 2JEYA 3HGMA 2GJ9A 4ICIA 4MWSA 3QRWA 4Q7MB 1N1MA 3T0IA 2WG2A 4G2NA 5AVJA 5KNBD 2VTBB 2DHEA 3ZV7A 4WFJA 3AHCA 4UTVA 2ZE5A 1TECE 4ZJZA 3GJRA 4BV3A 4A8JB 3ELYA 5FT9A 1KY2A 4K46A 2GRJA 5J2UB 1LY1A 4RMNA 1HEUA 3NHMA 3JV7A 4B9AA 4BWVA 5LOVF 5EIAA 1XU4A 3A6EA 1L7RA 2JAHA 2FFJA 3ITKA 3L7KA 3WKAA 1KETA 2OHOA 4JLWA 4RNDB 3RTBA 1OILA 3HB4X 4YRZA 4ZEVA 3SVTA 3VO8A 2C8LA 3O1LA 4MWCA 3JQRA 3RS7A 4B5KA 1Y6ZA 4B6OA 5AJWA 4KN9S 5IXSA 4D9GA 2WLSA 1JHVA 1M1YE 1BMTA 1WXDA 2FPOA 1YJBA 4RLFA 4C2TA 1J00A 4RPKA 4JR2A 5DXAA 3UBMA 5IK2D 4M1MA 1O87A 4P81A 2PV0A 1OU4A 1YRAA 2OMKA 3IVXA 4OHWA 4GPZA 4NXNB 2IHJA 3WS7A 3O2NA 1KEWA 3BSYA 3FCEA 5H3HA 1EDEA 3AWDA 1IOWA 1AZTA 3AUJB 4JEMA 3M3DA 4EG3A 4Q7EA 5HM6A 1JVBA 4R8KA 1X9IA 1YK1A 4CQMB 1L8XA 4GNKA 2DECA 3HE3A 2YKGA 1P0IA 721PA 1I6LA 2QLFA 2O3JA 3I2KA 4NG5A 3BZUA 2CLKB 1QGED 1BDMA 1OV4A 2XE4A 3CC8A 3M1LA 1WB6A 3N8DA 2CHUA 1E7YA 1W1UA 4ND1A 1GKLA 2HSGA 4B5LA 1FX0A 3KQYA 4OKSA 1KDVA 1H2XA 2NV0A 3E8MA 1T6BY 3QPAA 4N54A 1NYRA 5DOZA 3UUGA 3VMMA 3RHFA 4A0GA 2F3UA 4EYGA 4OHPA 4X63A 4DJEC 3PIIA 1L4YA 4HQLA 5JQWA 5BNIA 1C7QA 3QWHA 1YR1A 3QVJA 4MV7A 3SJAA 3R5FA 1Z12A 4CXMA 5BXYA 1IULA 4TTJA 4MS3A 1KH2A 2B8TA 3TDNA 4C1NA 2GPYA 4PONA 1JXOA 4NF2A 3R9XB 2VQ3A 1VPEA 1GA4A 4ZPXA 1UEXC 4N01A 5L4NA 4B3BA 1ADCA 1JHPA 3AC0A 4H77A 1JSCA 4MV8A 4KFRA 4UEKA 4RZXA 3O21A 1QHFA 3STWA 3X1DA 4YRFA 1VL5A 3DHYA 3TTUA 3V1TC 2JLYA 3F2VA 1U9ZA 3FSJX 2H1RA 5A62A 3DDSA 4UZFA 3RJTA 4DF3A 4YI5A 1E1CA 1C9DB 2Y0EA 2INGX 2V54A 3JQAA 4XUDA 5KB3A 2G5GX 3C45A 4E21A 2HMAA 1TE2A 2H17A 5CURA 4ZOLA 4K40A 1U81A 2I6QA 3DDHA 1ECFA 4JUAA 4MVJE 1Q15A 3QKRB 2H8KA 5I4KA 3EDYA 3WLOA 1CEEA 1V6AA 1CZLA 3EE6A 2VNHA 2RHCA 2ODWA 4FXOA 3SR0A 1Z5ZA 1NW3A 4IGIA 2Q4EA 4Z4GA 4LDZA 5A3QA 1P29A 1S8FA 3F49S 4ARUA 3WIBA 5JAQA 1OOEA 3DPSA 1J8MF 4YVFA 3TW8B 4PIMA 1AKUA 3G02A 4Q4AB 5HKLA 3R7WB 1O2DA 4LX0A 2CFIA 1JPNA 1XTQA 1Q16A 2VHCA 1COWD 1QHNA 5C53B 5CFQA 1NASA 4EKYA 5ALNA 5L3SA 3P9NA 1NSYA 3L01A 2ZT8A 2VHQA 4ALIA 1AQUA 3A9SA 4FPXA 1F12A 5ADVA 2PGJA 1JILA 1O5IA 4RCVA 2HJVA 3V1UA 2W70A 4AJNA 3CB2A 4I7EA 2VTBA 5EE0A 3WAJA 2Q0SA 4RTQA 5AICA 3MCWA 4C4PA 1WF3A 2OPBA 2AS0A 1D2HA 4LZZA 9LDBA 4ABYA 1WULS 2WT9A 1GA1A 1BS2A 4JSTA 4A4DA 4CL0A 4BGDA 2PT9A 1H2AS 5J2UA 1AHPA 1PF7E 2BGNA 1Q1NA 3T61A 3TLMA 3VJRA 5J1TB 1UBHS 2ZRNA 1QO0D 3CLKA 5CXQA 2C54A 1D3AA 2OGUA 4PYMA 4UW9A 1V0JA 3HB1A 5ILOA 3G2MA 3G5UA 4YRPA 2Y6UA 3MWJA 2YUIA 4Z54A 1L2TA 1R8JA 5DJ5A 3A4LA 5B6JA 2VIIA 3ZCTA 2N9UA 5DTQA 1JDPA 4DV6B 2YRXA 4R0MA 2RG1A 5DBFA 3O8QB 1OA1A 2DJ5A 2GHQA 2YIVX 3R4VA 4ZAZA 3UHFA 4N7MA 4Y1GA 3WLAA 5JAHA 4WOKA 2EG9A 2D2XA 2TECE 1T9BA 3SAJA 3RRNA 1DE0A 1EUCB 4G0NA 1UC5B 3IUMA 4S12A 3U7IA 3Q7SA 4O8CA 1AG9A 1BHO1 1OX5A 2QUHA 4PQRA 4WVFA 3RLIA 4CM9D 2OESA 1UDBA 1R9JA 3LJKA 4D3ZA 3STUA 1GQQA 1WCIB 1ZA1A 1MJGM 3DYVA 3T1YB 4QE3A 3DLHA 2ZRFA 4CQMA 4EEXA 2P0EA 1X3LA 2EDAA 1Y5NA 2O3UA 1SQSA 1KYWA 3GNLA 3EEYA 3ROGA 3UJDA 3UJHA 4DM4A 1NI3A 1T2AA 1CUVA 3O4HA 1YWGO 2DP4E 2LXNA 3LUHA 1B3BA 4H1TA 4LXIA 4LRXA 3R3VA 3EW7A 4LY0A 4H6VA 2CHEA 3L8EA 3AP2A 1JYFA 4KB5A 3P52A 4CT4B 3R5JA 1UBJS 1C4OA 1T91A 3DBLB 1V6SA 1KPIA 4WLEA 5BVHB 1F2VA 3IBCA 3CR3C 3TJZA 2BGTA 5LCXA 1TM5E 2X2PA 4MVJF 5DH9A 4JBLA 2AQKA 1EFPA 2CJYA 4K9KA 4F3TA 4NYJR 3IHLA 1MAVA 1Z62A 4MIEA 4HTAA 3U4HA 4NE2A 4AUEA 3OLQA 3R9XA 3JQ9C 4Z7OB 4CMAA 4MQ4A 3TLCA 4BX9A 1J1UA 1SXJC 4GEKA 5FBVB 1YB6A 1E2BA 3M6MD 4JYZA 2CL0X 4FEYA 1TK9A 4LX8A 4P92A 1BE8A 4DWVA 5IU6A 4RL6A 1Y33E 5F77A 1VQ1A 1J49A 2BJWA 4M9QA 1Y4AE 4PLYA 1EVKA 1PLJA 3INYA 4Q3CA 5IT0A 3PQ5A 4GX0A 2B7CA 2JLQA 1JEQB 3W6NA 2PZBA 4M1ZA 1OWMA 3V4RA 5T6BA 5EYPA 1M2WA 1LRJA 2HMUA 4II3A 1Y7TA 5BR7A 1RHUA 3DLAA 4BMNA 2P9HA 1C9MA 3TFQA 3SMVA 1F2TB 2JFYA 1LC3A 2VATA 1UBMS 3MT7A 2HXSA 3OM9A 2RH4A 3EMDA 3QKRA 4CM4B 3A4VA 1JG7A 4JOCA 5AOCA 2VJOA 4FHZA 1KC3A 1C7IA 2GI4A 2B4TO 4MEJA 2WY2D 3T94A 3T1TA 4GXQA 2ZYRA 4KQXA 4REOA 1Z8DA 3ZI0A 3WWCA 4DS3A 1WNFA 2H54A 4OBEA 3TW8A 4Q4AA 4EPVA 3IPLA 4A5OA 1G2OA 1GYQA 1STOA 4GQIA 3R7WA 2C97A 5KO2A 1FIUA 1NUSA 1QDEA 4Q6BA 1EGAA 1IHDA 2OVBA 4TXNA 1JMKC 1CFZA 2J07A 1NSFA 5AJXA 4CRWB 5IANA 2Q6LA 1JR3A 2C03A 3E61A 3ECSA 1SPBS 5A5DA 2P68A 2OPHA 3N2IA 3GFPA 1U2DA 1Y5RA 1L5VA 3NETA 3ZE1B 4IRMA 4DANA 4DJDC 5JXHA 5JMTA 3ESCA 4DJFC 1YQWA 4I1IA 3TZHA 5CA1F 3DTVB 3R7SA 1AXGA 2YVLA 4OSEA 5AJZA 3WX0A 4J91A 4G0UA 3TKYA 4UTXA 3LUJA 4DRXB 1NG9A 1YUMA 1OYOA 2AVNA 3C70A 4LBWA 3PKIA 2JANA 3ROEA 2P6UA 3VVLA 3JWJA 4Q82A 1QK5A 3LFHA 2AVDA 2B94A 3AMVA 3GYGA 4JQSA 3M8KA 5B53A 2CLLB 3JARB 4A6DA 3KQQA 3LYAA 4JR0A 1B00A 2PQ2A 3ONNA 3AEZA 3DZBA 3MW8A 2PEYA 1BS9A 2B35A 5P21A 3ERCA 5IX8A 3RE1A 3B20A 5IAJA 1XQ9A 4NMHA 3T7SA 4O8ZA 5HCIA 4BMPB 5FLEX 2IHTA 2Q5FA 1CJTC 2JHPA 2ZCUA 3CTMA 3O8QA 3OJFA 5CNJA 5D5HA 1JAZA 5MF6A 4MSUA 1BQ4A 1OAAA 2Q4TA 4M0MA 5K0BA 2GTIA 2FZCA 1Z7GA 3BREA 1OBHA 3N75A 1C4XA 1EUCA 4W5QA 5JBIA 1US8B 4IIDA 2YV1A 3D6UA 3V8BA 1R0XA 4D6YA 1Y5MA 4HNAB 3GXBA 4FX2A 2KQUA 2XNKA 2CB0A 2TYSB 2GNOA 1WCIA 4OBWA 1CUUA 2ZSKA 3G68A 4OY3A 5KKNB 1ZISA 4Q3NA 4F04A 3G23A 3AG6A 4KPUB 1GQFA 2YYZA 1IPFA 1TYAE 3FRIA 1NMZA 2GXQA 3CN7A 1ZBQA 4UU1A 4UBJA 5CW2A 3UOWA 5HR5A 1Z38A 2A9PA 4QO7A 1QRTA 3VOSA 2AT1A 1A3CA 3W7BA 3HNRA 1P2DA 1ULSA 2FWJA 2J9XB 2VRWA 3F7MA 3OQ6A 4JFRA 4QDKA 4IZHA 4MW6A 4XOUA 2ID9A 1W0KD 2AXQA 3KCNA 4RYDA 1ZI8A 2ONKA 4UVDA 4N4AA 1RRGA 3IEIA 3DBLA 1B8PA 1EK5A 4WPGA 1CWUA 5BVHA 1N5KA 4I9FA 4NBKA 2H9YA 2VN8A 3HFSA 1QUEA 4DTCA 4N41A 3N3AC 2FMHA 1ARZA 3OE7D 1FYFA 4U8GA 5A0FA 2HK8A 2HF9A 4P8RA 2A5YB 3MHPA 2ISCA 2Z8XA 1AK1A 5FO0A 1SCIA 4DRYA 1RD4A 2FTKE 1FRVA 5DFAA 3FWPA 3OJCA 1E9VA 1PTJA 1PYOA 1CPYA 1XYVA 3TOSA 3LWNA 4YAOA 4IHKA 3SLRA 4EJSC 3FKQA 1WS6A 3OOWA 5BOVA 3ZU2A 5BV8A 2CFTA 1AQ6A 4AMZA 1JEQA 1ZGJA 2AL7A 3SBOA 2VWQA 2AG1A 4N5IX 4AM8A 4LE1A 2CE7A 4QWMA 1NULA 4OGGA 121PA 2VG8A 3ISVA 2KPOA 1E3SA 4L50A 4RTLA 3L7LA 3DEKA 1H3EA 5TC4A 3WQQA 1ITZA 1LKZA 1MA0A 1QG2A 4HXYA 4IGAA 3G2KA 3A9CA 2GEVA 3P1JA 4E5UA 5C1OA 2Q5CA 3EPRA 1F2TA 5TF0A 4YPOA 4CM4A 2E37A 1UDAA 4GKKB 3DV0B 1QFXA 2RGYA 1SC6A 1XMJA 4NZNA 4BQFA 1PG5A 4IIGA 1TAHA 4E5PA 6NULA 3P96A 3R0IA 4URXR 1KEZA 3RQIA 3FPCA 4OHXA 3CNHA 5KX5B 3L6OO 2AEMA 2CY0A 4M0EA 1BROA 4MKIA 3AYXB 4ZI2A 3DT6A 3E0QA 4H1HA 1XKTA 4YMLA 1D04A 4KIUA 1JDSA 2JEOA 3F9IA 1W25A 1NHWA 4IIBA 4RZQA 3GWGA 2PD4A 1PV4A 2A4MA 2PUBA 4FDAA 5DP2A 4U1RA 2D1FA 4ZEOA 1DCMA 3FN4A 4OJYA 4M0CA 5IN4A 4GPAA 1ISPA 1VKOA 3H9UA 3WIEA 4G5GA 3MM4A 1IC6A 3D4OA 2F55A 2VJPA 2FG7C 2WJJA 3HJUA 3H2BA 1UK9A 4XB2A 3FTEA 3FAZA 2JHGA 3FB1A 3DTVA 3QUBA 4IOKA 3RFFA 3NEPX 1NKTA 5F52A 4B7XA 4DRXA 5HF8A 1HSOA 1VG0B 4P80A 1K97A 2E4AA 4H1UA 4HJRA 4P84A 4TTAA 4PAGA 1IXYA 3T4XA 2ZB2A 3AGPA 1QVVA 5JARA 1RE1A 3NBAA 1IBMB 1UPXA 1NDUA 4UQLA 4LRWA 5F2EA 2E5LB 1G8MA 1M2OB 1MJGA 1G5QA 2J3DA 4BTLA 3JARA 4QFBA 1QONA 4KE9A 2FSPA 3DFIA 1V8DA 4RPJA 5JQGF 1LDMA 3HUDA 2JGAA 4UOQA 4XX0B 1HUQA 3N0XA 4G41A 3N9IA 4JBNA 4MI9A 4QGFA 5EYPB 5FOVA 3EMVA 3SS9X 3NORA 3LSYA 3A1CA 1DDOA 3B48A 1CF2O 1FFGA 5IPFA 3T5DA 1V4VA 1LWOA 1V41E 1YNOA 3T9BA 3R40A 2R8RA 4U00A 3NB0A 3FLBA 1BE6A 1Z6ZA 1P0QA 4ZZ2A 2Y1GA 4OXNA 1F8UA 1EWTA 1XRMA 2J9FB 4V0ME 4DYHA 1LBHA 4HWSA 4NDZA 1US8A 4IDPA 3AKYA 2IHNA 4ES6A 3M6XA 4Z3KA 1SKQA 4J2OA 1VYVA 3OE1A 5T3YA 1BWRA 3IDOA 2HQOA 4DCJA 4NV1A 3DBIA 2ZBPA 4PG6A 4F2HA 3H97A 1HV8A 2VHUA 1OH7A 3ORYA 4KPUA 1JKMA 3F0TA 3HVHA 1N5RA 1T9AA 5JPCA 2GDZA 1QX4A 5JNUA 5M34A 5C8ZA 1IHOA 1SURA 2CXOA 2XOKD 2PFKA 3ZX5A 3AW9A 4YV2A 4WGGA 1VL0A 3L6CA 5E1DA 1KP3A 1C9KA 5B3JC 5AW1A 4DCUA 1FPMA 1N2CB 1QFJA 3MAGA 3PQEA 4ZMBA 4IVRA 3ST7A 2IYEA 1ZN2A 3L84A 4G0XA 2I22A 4R2JA 1E92A 5SZIA 1SXJB 4LRSB 3EWNA 1UWKA 4UHBA 4D3FA 5A3RA 2VT3A 1EU1A 2ODBA 1TZKA 3SQLA 1CHDA 3HDQA 1UBKS 3O93A 4YV7A 1U8TA 2GDJA 3K9CA 3C1AA 4F4JA 5JBQA 2GBFA 3S2EA 5DULA 2W6ZA 3RI3A 1FRFS 1XN4A 5CLLA 4E4TA 3GJ5A 2VXCA 4EY8A 1X7ZB 2QPOA 2WFZA 3OICA 2CZCA 2PMDA 3DSRA 4GP6A 1V95A 1S8AA 3QEJA 2JIDA 1TFUA 3UMJA 1V9CA 3GGSA 2BE9A 2DR2A 4MPRA 3TF5A 3SOPA 1LXCA 1GNSA 2DFLA 1UZUA 3IERA 4I99A 3CHYA 3IDZA 1PD0A 4ZALA 2C20A 2IA5A 4EHIA 1QVRA 3E2MA 4US1R 1QIHA 2YQ5A 4K7JA 3WGJA 3AR2A 3BIXA 1Y8CA 1OZAA 2XDYA 3OO0A 4U9HS 4P2BA 2QRPA 4JVOA 4UUPA 2I3BA 1M2EA 1OI4A 1SWVA 1KEPA 3C3YA 3R5SA 4E1VA 3TVYA 4TV8B 3DV0A 5IHXA 2RAFA 4M1OA 3NAQA 4N0DA 4HAIA 4C5BA 3AEQB 2SNIE 3PLRA 1CQXA 2H0RA 2X8JA 2G9NA 1YRQA 4UEOA 5AKKA 2HGZA 4X6UA 5C52B 3HCRA 3K4HA 4EKGA 3COJA 3PXUA 1SCKA 2TMKA 4BKRA 1QLHA 1I3NA 1DB3A 1TM7E 2GPNA 5CB6A 3LHSA 3GRUA 4XM0A 1CF9A 3OQHA 1T2DA 4OX9B 4LVOA 2XMSA 2Z9BA 1Y37A 2VK8A 4HLDA 3WL5A 5K0TA 1KOGA 1ZK4A 2PH5A 4XOIA 3DXFA 3TBHA 1CC1S 5I01A 5LQCA 4OHRA 5KNLA 1UWVA 4B46A 3IVRA 2W9XA 3T9DA 3OSUA 3QTBA 4YV1A 1A1VA 3H9CA 3BAFA 4N6OA 1XQ1A 5UKDA 2DFDA 3U48A 3COYA 4M8SA 1N2EA 4DY6A 2HK6A 4HNTA 5FFFA 2QRZA 1PR1A 2O1EA 2FJPA 3M6LA 5ARDA 4ED9A 1WMFA 3AOEC 5D7BA 3PS9A 1VE7A 4JI6B 5ICMA 3VGPA 3TDKA 4QJIA 5AO9A 1DCTA 2BFEB 1E1LA 2NUTB 2OV3A 2WA2A 2ZPTX 3A4TA 3I4FA 4MRRA 1M72A 1VJ1A 1L5WA 4JASB 4B2PA 3W2IA 4QRDA 221PA 3GPDG 4HUQB 1YBMA 4XX0A 1O03A 1NT4A 1GNQA 4OMFG 4F2WA 4EVSA 3NEAA 1M5UA 1EWYA 3DZFA 3PE4A 3I0NA 1R0SA 4TTIA 3KALA 4O4IB 2QG9A 4YAGA 4GXNA 4P5EA 3T34A 3VJLA 3TQTA 3WHLA 3FW1A 4S1PA 4Y2PA 4CM1A 5JUWA 1X80B 2CDAA 5EGSA 4MVJD 4RY2A 1CZHA 1NPDA 1SIWA 2D1TA 2J9FA 2QQEA 4UULA 5H4GA 2AJTA 5E95A 5B1DA 3O9VA 1CUZA 2CFCA 3KRTA 5A7GA 1SVKA 4PVDA 3UXYA 4OLBA 3HB0A 2PXHA 4ZYUA 3QMVA 2WVGA 4Y2JA 3ZCQA 3HJFA 2WWRA 3NFRA 3VYSB 2ZJ3A 3R74A 2M2IA 2XF8A 1DO0A 1TVMA 4GLLA 3OT1B 2WFLB 5IF3A 5A05A 4PZYA 1DWOA 1QQBA 1A50B 2F4NA 1DMSA 2FEKA 5A6SB 3P9CA 1HK7A 1H0HA 3DP9A 1GTVA 2P4SA 3EVFA 1NMSA 1XCLA 3DWIA 1MIOB 2HN9A 1XVVA 3JD3A 4OATA 5DTRA 1WZIA 4ZVPA 3SYKA 2GN9A 4R7ZA 3LQYA 3UWPA 3QVUA 4NS4A 3IHTA 3NBFA 2VHJA 1FSFA 4AZ3B 3I9OA 2FX3A 1JSLA 4CDMA 1E1DA 5T3UA 4MA4A 1NRJB 1L5NA 5FWXB 4TQUS 2G5CA 3I05A 2G6BA 2XYPA 5C32A 3VYRB 1SXJA 1WBJB 3D6JA 3WLHA 4RM3A 4PYJA 4FNAA 5IJ0A 1YI0A 3TLEA 1SVUA 1SZJG 5LKAA 3F4KA 1UJMA 1AUOA 3MJ4A 1DTWB 4EKIA 4UPVA 1K6XA 4P1ZA 1ZAYA 3O7MA 4ZT6A 1S3IA 2TMDA 4Q4LA 5U1PA 3VPBA 3ZHVA 1CUAA 2W48A 3IJPA 1NVFA 4NBWA 4UUQA 3WNDA 4B4UA 4XGNA 4DLLA 4ECAA 4EJMA 3RJZA 4LFAB 1LI5A 1X7ZA 4G5YA 4RF4A 5FAXA 3RREA 3WDLA 1T0UA 3E03A 3C8ZA 2R7NA 3KTAB 3CVVA 2E6UX 2GJ8A 3O1IC 3QLTA 4JJFA 4L0QA 1M2JA 2A6PA 3I1FA 1TLLA 3MGCA 3C74A 2VCYA 4INOA 2Q7DA 3V34A 3AHIA 1Y8QA 2EKPA 1J0AA 1Z2AA 4M89A 4R8SA 1CS4C 3CCCA 4FMDF 4WMLA 4DEYA 4MDEA 3MGKA 2P27A 1ZLYA 3L6RA 4KRGA 3MWYW 4BCCA 4L9SA 4L95C 4JQCA 5E9WA 1DINA 1CK4A 2W58A 1B74A 4RWZA 4TTRA 4TV8A 5JYBA 1TYZA 1RRFA 2OO5C 1R88A 2QTTA 5ALEA 4DW8A 3ZCRA 5B58C 2ZJFA 2ICAA 4IUCS 3AEQA 1N2XA 1WUJS 3SQXA 3LX6A 1NVGA 3OM1A 2BFBB 3JVUA 3L8HA 1X2EA 3HP4A 2IODA 3CW2A 4LWQA 4WKNA 5DN6D 3E4DA 4XXHA 5GONF 4W7SA 4FYMA 4B84A 5BSVA 2BCGY 2VPPA 3HFJA 4PX2A 2P9QA 3B3JA 3BIWA 3RT1A 1THTA 3UV6A 2F8MA 1JAHA 4IEIA 1JP7A 4BJ6A 1EVYA 4D46A 1P1BA 4X85A 3CRMA 3E18A 4JLDA 1L7QA 3Q1LA 2QMHA 5DBGA 2JCGA 2QRKA 1ZSNA 3FOZA 2P8SA 2B4RO 4GXRA 2ONJA 1D4ZA 2HMTA 4OU4A 4F96A 4B3XA 2J5KA 1VMIA 3WK8A 1KE2A 2HIMA 4Y9SA 2R00C 1R0ZA 1K7XB 3IPCA 2VEOA 1YU6A 4FMBB 5HJ2A 3I37X 4OJMX 4LFCB 3T4UA 1PUJA 4OX9Y 2E4VA 1VBFA 4XB1A 3H2KA 1WU8A 1WBBA 3HMQA 1ZL2A 3EGOA 4EYOA 2VPYA 4W1QA 1DJNA 2BFEA 3EUFA 3BWDD 1MEJA 2OBYA 4J3JA 4WZAA 4YAJA 3AWIA 2F1IA 4CFYA 4UCXA 1YFLA 1T3SA 4S0XA 3KDAA 5D1NA 5IZCA 2C7RA 2GZRA 3G13A 4HUQA 5DBEX 4G4SP 3PHLA 2CWDA 2BHNA 1OSNA 3OOYA 2GESA 2IXAA 2OHIA 4L5JA 4O4IA 5H5JA 3DKIA 3EFHA 2OM2A 4H6PA 3ZJ5A 4LEIA 1KORA 4LPKA 3RK0A 3ZZ1A 1KI8A 3EVZA 1PYGA 1X80A 2G0AA 1AH2A 4OH7A 4IH9A 2X5NA 2VA9A 3GD5A 4HWGA 4IEEA 1HLGA 2X4IA 1GU7A 1OD6A 2I1VB 2RGXA 2VUUA 2YMMA 2WWWA 4QBGB 3SZOA 4JXXA 5AUOB 1Q7BA 3ED1A 3ZUPA 4G2TA 1E9BA 3GFRA 4FCCA 3O8NA 1Z2OX 2QVXX 3HFRA 2YHBA 2A2ZA 1ULHA 1H9BA 5ED4A 3OT1A 2IHKA 2WFLA 2HT1A 4M53A 3AUSA 3X1XA 4ENWA 5A6SA 2Q8QA 3DOIA 3TQQA 2GCEA 5EIXA 1YGYA 2E0IA 1MIOA 3IBGA 4AW9A 5DMHA 1MX5A 3OLYA 4ZI3A 3WRXC 5LIPA 2SKDA 3VR5H 1JAYA 5L51A 5EIBD 4ZCSA 5HKKA 2O7NA 1LVHA 2CL6X 1SBHA 2HRZA 2DQSA 4NYIR 1OY1A 3QBVA 3WYNA 4H15A 1TM4E 4AZ3A 1G8KA 5SY6A 4AVYA 1LVGA 4NOKA 3U3RA 3UG6A 1EP2B 2H6EA 5FWXA 3R3SA 2D0DA 4RFVA 5CK4A 2N42A 2CXXA 3VUEA 1I7QB 4TRMA 3NEYA 3PJRA 2B0CA 5CDTA 2JLUA 1Z33A 5IVIA 1GGJA 1NF2A 3AINA 2NZYA 1DTWA 2C31A 3MCUA 3B85A 4ZHQF 2HPZA 1WDLA 2NQ2C 3KETA 4RDIA 4ZT3A 1CQJB 3AI7A 3CNBA 3GL9A 2QDXA 4GWKA 3ZNOA 2GB4A 1UP4A 2IXTA 2OC9A 3G1WA 3CLSC 5LFAA 3THXB 1KBOA 1OU0A 1NVKA 4C87A 3KTAA 3UWMA 3FCXA 1XPJA 3IC5A 3KAJA 4O2LA 1SUPA 2FSIA 4PXAA 4OXRA 5IKOA 4NKRA 5HK8A 3RAEC 2HQRA 1IMJA 1YCFA 4RBNA 3EPPA 3GZTB 4ARZB 3VUFA 5BT8A 1XWWA 1C9NA 3GJYA 3QU2A 4FCTA 5CJ2A 1E3WB 1ISJA 1JHYA 3IAFA 5FTWA 3B1ZA 1R18A 3AVQA 3OIUA 1PQYA 4OHCA 1T26A 1L5HB 4KQ2A 5AW3A 2CV0A 2ZZNA 1QG4A 3F7OA 5K0EA 3LHKA 4K86A 5BN3B 1YB1A 3N05A 1ZRHA 2GZDA 2PUFA 1M0TA 2Q29A 4L9RA 5CEEA 1DAGA 1NQWA 3WKBA 1SKMA 1HE4A 3MTDA 3IAXA 1XSEA 1Z68A 3EEQA 3USCS 2BSQA 1IBKB 2M6KA 3SSMA 1WUIS 2BFBA 3JSAA 4RTOA 4WNAA 3P2JA 2DERA 4P3NA 3B5EA 4LRYA 4FK8A 3WLJA 4EW2A 5KYWB 4OKIA 1HGXA 3O9ZA 2JGIA 4ERXA 1TD1A 3HXKA 1IQUA 2A67A 5ALIA 1CVIA 3OWOA 1A97A 5K4GA 5AK6A 1X74A 3TK1A 1CUJA 1N2OA 2QMQA 4DYVA 2GN0A 3BE6A 2QLBA 1LDEA 3B1JA 3G5LA 4OHVA 4YJFB 4B35A 3TTSA 5E4YA 2WJYA 3OTWA 2C4KA 1TVKB 1P7CA 4TQAA 1U0LA 3OEWA 1I0ZA 3OFJA 2XE7A 5G0WA 4ZMSA 3VH4A 1E3QA 4LHVA 1PX2A 16PKA 1XQVA 2DKFA 2ZSAA 3NVDA 1SXQA 1W1IA 2P11A 2VDRB 1O7JA 3EG9B 3PQ7A 5AJUA 3UB2A 2D2FA 3B3FA 1P19A 1Z0UA 4D6XA 3DCIA 2R3SA 4HB4A 1Z8HA 4PO9A 1UFOA 3KYCB 2PPVA 5G2OA 3HZOA 4IUYA 3ER6A 1G7RA 5F4BA 2WVJA 1I7SB 2X0IA 1EK1A 3BYZA 5CK5A 2H5LA 5F73A 4YHHB 3H11B 4R6XA 1ATIA 1QE3A 4RY0A 3ILHA 2FWMX 5BN4B 2WJ6A 2W93A 5GJBA 2QD3A 1KZ4A 4QUJA 4UBKA 1ZUNB 1WLYA 4UM8B 3QQ5A 3KSDO 5ELLA 2R4QA 1J9GA 3QA3E 4XD7A 3ZHYA 3AR5A 3R8FA 4G25A 3CEAA 3H5AA 1XMQB 3CH4B 4AJ4A 3NANA 3FUVA 1NE2A 4WOCA 3LAWA 5JJLA 1M2NA 5E0OA 4P32A 3TPFA 3WAKA 2ABWA 1QC5B 1VFNA 2EQBA 2C3MA 2P7IA 2PWYA 2VZEA 3FLEA 4MWBA 4QDTA 1XZEA 4V39A 4H2DA 5D84A 3RTGA 2E55A 3N39C 3MJCA 4XQ0A 2Z4SA 2QTVB 2DTEA 2K2QB 2Q9BA 3VYVA 4Q15A 3BB4A 2XTMA 3F6SA 4TROA 1XT6A 3DQPA 2ZJZA 5CDGA 2J3QA 4MKRA 2CL7X 3B7GA 3V5NA 3ZKWB 3DL7A 1TPYA 3BDIA 3ILYA 4HDMB 1V7PC 5GWXA 1VJCA 1WETA 5C51B 4Y2RA 4XUCA 2OCYC 3QH4A 1T9KA 4LJ4A 5F21A 1VJ0A 1DXHA 3C7KA 1ADYA 1O77A 1A72A 3DCNA 4JT4A 4O4LB 5A5FA 4BPBA 4GL2A 1C30A 1PHRA 3OZWA 3KQKA 4UPEA 4PZDA 4QPPA 1UQUA 3LCJA 3N53A 3P71T 4U63A 3GX1A 5I7VA 2XUDA 2QN1A 3ANXA 2BHTA 4C5CA 1IPHA 2H1FA 4MO9A 4X92A 5KNBA 5DHUA 1IY1A 3L4JA 5FOSA 4M38A 5GJWC 2I4NA 4KACA 3TOXA 2H2FA 1J9ZA 1OTXA 1S4QA 1VPDA 1JA9A 3PJGA 2E4YA 4DNXA 1BXKA 1AHIA 2PKQO 3SZGA 3THXA 1DOZA 4DCVA 1SH7A 2XKAA 4WLOA 4MV0A 2AYXA 1DUVG 1FJXA 2XRYA 3OJWA 4QOEA 3SJ7A 1N36B 3G2JA 3PFWO 2F9MA 4ARZA 1ND6A 2PUVA 4O1IA 3RVJA 1FDSA 1N25A 1E3WA 4MCJA 2FFQA 1P7YA 2VAVA 3TNYA 1VYHA 1Z6GA 4AX4A 1L5HA 3LW8A 5EE1A 1ZUHA 5DOVA 3O2JA 1KKUA 5BN3A 4N48A 5IK2A 2LCFA 4FGKA 3FPLA 1VIYA 4NNJA 4UMVA 1XVIA 5GP1A 3CJQA 3AR4A 2Q1XA 4LDNA 2BF7A 3B5IA 1RJ9A 4LUCA 4LFBB 1W36D 4ENSA 2L42A 5HIMA 3TZCA 3R77A 2OD7A 4AJPA 4BNJA 2LIPA 3HFGA 1E0AA 5KYWA 3G5MA 4KE6A 1WB4A 1NR7A 1QWOA 2YXLA 4J3FA 3DEIA 4OUDB 2XQFA 1OZHA 4AF8A 3U09A 5A0TA 1QQ5A 2BMFA 2RC5A 3B1XA 1E6LA 1K27A 1XYYA 2GTHA 2B61A 1G0OA 1S8OA 2B7BA 5ANRB 3A1TA 4YJFA 4D7AA 3AY0A 5DWDA 2EFJA 1OBFO 4OI4A 1RXCA 1TVKA 3AOEA 3R5XA 1G5IA 3AU9A 2GJ4A 3EDCA 3VU8A 2YFHA 4MKXA 1OMOA 2QA5A 1S4MA 2OL4A 1VSBA 2C2XA 1E9FA 1RWBA 4HBGA 6LDHA 2GLTA 4OPMA 3GK3A 3EG9A 4X00A 3UICA 2HC9A 1J25A 2BZ0A 4YYZA 4TLAA 4I50B 4DBLC 2ILTA 2CDCA 1TW2A 2ZIAA 1FYVA 3WWPA 3UBTA 3FX2A 1TO2E 1JUDA 4AQDA 4PCUA 4K9OA 5AK0A 4ODIA 3KQUA 1RPAA 1P0FA 1VHJA 1D0VA 2J59A 1SUWA 3IQXA 3HBMA 2H4WA 2PZKA 2V3VA 3LDUA 3MCVA 5L3VA 3H11A 3OCCA 5FWYB 5KHOC 2BSAA 4XKJA 5BN4A 3OJ0A 4YFYA 5GM2A 4G0VA 1U0OC 3NAGA 1AT1A 2VT7A 2FYTA 4GI2A 1AQYA 1SN7A 1XELA 5KSOA 4WINA 2XGGA 1RMTA 1HE5A 2FSUA 1PQWA 4N3NA 3ZEAA 4Y30A 1NOIA 2J4CA 5BQOA 4GMFA 2P0AA 2MYTA 4Z2AA 4HZUB 1R0WA 1RYDA 2Z5FA 2O5EA 3T1VA 4LG1A 2F17A 1JE1A 2JB9A 4AF6A 4H7PA 1QC5A 2BE7A 3C15C 3EW9A 3OOSA 4UXIA 1WOMA 5HOQA 4ZO4A 2KI5A 4DIFA 2V6IA 2FF5A 1KJJA 3EQ6A 2CLMB 3MGAA 4E2XA 1AS0A 4Q3LA 1GPKA 2JARA 5TGDA 2QTVA 3KP1A 2CK3D 3RWMB 3K70D 2AJCA 2G28A 3O8OB 3TMAA 3WFJA 3ZKWA 4MAFA 3AV3A 4XIYA 4HDMA 7ABPA 4MYSA 1B3RA 4JY7A 1COWA 1K3FA 3ZLVA 1IXZA 2GZ1A 3DYIA 4EL5A 4PW0A 4BLVA 3SHTA 2JATA 3QBTA 3O95A 4MEBA 5JEEA 2HLPA 2ZM5A 3MD0A 2KBEA 4O4LA 3F3YA 2A84A 4XJSA 2EZTA 4ZRDA 1CRLA 2FG6C 5DGXA 3JW8A 1ZIOA 3F47A 1T25A 2DPLA 4MVYA 4CMBA 4N5HX 4EP1A 3D31A 5KU1A 4S1NA 2ONCA 2IGBA 4CG1A 1GL3A 2WC1A 1NF9A 1HI9A 3NTLA 2X1MA 3ESDA 4HEA1 4KXFB 1DDIA 1UBNA 1Y0BA 1L5KA 1PR0A 3SYRA 2GPBA 2P2GA 2F3SA 2R8EA 3K4QA 2ZYWX 4FT2A 2QPLA 5ALLA 2PX3A 3W5IA 1K89A 3OG9A 3OFND 3B1YA 3UW3A 2XWSA 3UF0A 2W6QA 3V1KA 2NUAB 1QO0A 3QIVA 1V7QA 1G291 4LMAA 4AP6A 1RS0A 3HA3A 4FEAA 1W4AA 2BGKA 4DNQA 4C6TB 1THGA 4E09A 1MLDA 4YP1A 3Q98A 2KLBA 1BGWA 2O3TA 3D8TA 2OO5A 3GLSA 1KO8A 3WK7A 3HJHA 5E38A 4JP5A 1TQ2A 3FUTA 1ZYUA 3MELA 4DJAA 4ZFNA 2WUEA 1GPAA 3CX3A 4RK7A 1D1SA 3BD8A 4FR5A 1X8JA 3SU8A 2Q50A 4FZVA 5I7UA 1QH9A 1AQJA 1HC7A 2XNCA 1ABEA 3HXPA 1HSZA 3OZUA 4MXDA 4RIGA 3RV4A 5I8WA 1NUQA 4CM9A 2ZZMA 2Y0DA 3T7JA 3ZZTA 3UKDA 1DQRA 2A14A 4WI1A 3HRHA 3EPHA 1Z47A 2YV4A 4WNIA 2H1SA 4KXWA 4FFBB 3AXTA 1QX3A 1IZ9A 4OUDA 4D57A 2O2EA 2NYRA 3ONFA 5LNK1 2R00A 2H3HA 2OXRA 1JHRA 5J59A 4LCBA 3GUZA 2BR3A 1OIWA 1BH2A 3KPJA 1CQPA 4URVR 4CM6A 1F9EA 5A5EA 1WCWA 5KOHA 2IPOA 4BNHA 1YQEA 4E2WA 3UUWA 1NN0A 1ZG3A 3IQIX 1YIAA 4BB5A 3QA9A 5KWJA 5DGDA 1ZD1A 2ACWA 2CEAA 2J5XA 2NX2A 1RHJA 4BP1A 4V2IA 2X77A 4B3IA 2OV8A 2QTNA 3TSWA 1BGVA 1G3MA 4PWYA 2B9VA 1NVWQ 1WXHA 2RHOA 2FEMA 4BX8A 2HPHA 1ETHA 2E48A 1FL9A 3P5BA 4I50A 4IZ6A 1HZZA 3EHEA 3V2UA 2GF0A 2J6IA 3OZAA 3C6KA 4L5CA 4P86A 1AB6A 5IAOA 2REQB 4NPAA 3SICE 2X1VA 3NIDB 3BFPA 2H4XA 3I6ZA 5AK5A 3PL1A 2JLVA 1IL0A 1JDTA 3DDOA 1P4AA 3SN6A 1Z6AA 3QLUC 1SD5A 3DBOB 1KVSA 2OV6A 3ZGVA 2RHGB 2BKVA 2VNIA 5BMVB 4P7JA 4ZO6A 3MJSA 4JT9A 1JJ7A 1R6VA 4RWEA 4LQCA 1QMPA 5AM2A 4HZUA 3ITNA 2N46A 3EXG1 1U9CA 4RFSB 2BGUA 3JSXA 5HF9A 2PQMA 2BHLA 3INTA 1C7JA 1I4WA 1MG0A 2JBHA 4LPSA 1FTWA 3ENKA 5KDOA 3KJEA 1ZNQO 3SS8A 1YCDA 3DV2A 3L6DA 4JYCA 1KK2A 2MTBA 2KMLA 1QTRA 2YVKA 3UJ7A 6ADHA 1RZRD 1FUUA 3WLFA 1BO6A 1VOTA 3OOEA 3O8OA 2W2KB 3L8GA 5I4CA 3P9SA 2QLTA 4B82A 4MUMA 5FAKA 5K4AA 1V71A 1ZVKA 4C4RA 1ZHHA 1J90A 3HP1A 3I9NA 4FI3F 2XMCA 3QKUA 4G1BA 4GMKA 4Y18A 1UMDB 4DE5A 2O54A 4HNUA 1UF9A 1GTJ1 4KAJA 1XXLA 4PRYA 3M9LA 3EPKA 4G63A 1AQNA 1W93A 2ZXUA 1FS6A 2JLXA 4DCMA 1ID8A 2OCIA 1MB3A 2QVLA 1T5LA 4M98A 3ITEA 4A2CA 1JI3A 4V0KA 3CUWA 3OD1A 1JFFB 5AFSA 2R6HA 4DCNA 1WBDA 3X2FA 2WTEA 3RS4A 2IYNA 2JCXA 4ZV7A 4C4YA 1HTWA 2DUJA 4WFQA 4EA7A 5A7HA 1T1SA 4UHEA 5JRDS 5BOSB 4I5DA 3JD0A 5EJ4A 1J97A 4WXYB 1XGKA 2BCJQ 1CUFA 4HQ0A 2W90A 1YR2A 1XJ0A 1NQXA 1XU7A 4HBZA 1K92A 4RLHA 2ISQA 3AEXA 2YS6A 3AF3A 3VZPA 3I2YX 4C6TA 4ESOA 1I8TA 2QU7A 1VGQA 1HQKA 4EFLA 1E2PA 1TZBA 4QSMA 1XEWX 1HFKA 4AO6A 1LW6E 1HTBA 1N2SA 4A8JC 4DQVA 1DIRA 3PCRB 3EG5A 1JEDA 1Z5WA 4RADA 4RLQA 3G89A 2ZTMA 3C5EA 1USUA 1ZPDA 3UAOA 1NBMD 2QD4A 4PS1A 1OVGA 3E5MA 1KSHA 3BRQA 1OFUA 3M82A 3FPEA 1K2WA 1NURA 3O3NB 5CVJA 4YCMA 3HVUA 1KDTA 4IJUA 4KGZA 3OC6A 2RBGA 5CA0F 1VKJA 5LLDA 4Q24A 4FFBA 4AS2A 4EHNA 4JP8A 3O1HB 1ZH8A 3GV0A 4GOND 2GETA 4M2LA 1FS5A 4NFYA 1E59A 3RCBA 2KWIA 3ELDA 6AT1A 3DWEX 1YCHA 1L7XA 3A28A 4NC9A 4WY5A 4TVSA 4O4HF 5LZ7A 4LOAA 3F8SA 5FA8A 1PWZA 1Z5UA 3IPXA 1RRPA 2P3QA 2YWCA 1W0KA 3ORFA 2ZATA 4MVJM 1OXTA 2AX3A 2WDZA 1T15A 3DAPA 5ALDA 4ZZ0A 2JKVA 3PJFA 4CL2A 3IHWA 1GPH1 2ZAOA 3CUSA 3I6BA 1ZQ1A 1DHRA 4L2IB 2FRDA 4BFWA 5EIBC 3KQHA 4K3VA 1ZGBA 4OI2A 5F12A 1SUSA 2PX0A 1IN4A 2QP3A 3OE7A 1U4NA 4FGLA 5JZMA 2ZIEA 3P32A 4B7CA 2Q5LA 3BCSA 1DVRA 1FP2A 2MSKA 3B38A 1XCOA 3WLQA 4R0NA 4RK1A 1WMEA 3U4IA 1T2UA 3IA2A 4YC7A 2REQA 3OAAD 4I3FA 4N47A 3FPGA 2X7JA 2XB6A 3S55A 1PP4A 2YCLA 3DE1X 3RARA 4R05A 4MRVA 2I67A 4D43A 3P20A 2BEJA 3BOSA 4INZA 4LDPA 4TL8A 4KUEA 4PNHA 2DT8A 3G9UA 1M1YB 4LGCA 3W90A 1W76A 2BZGA 4OSOA 5LXTF 5BMVA 2UUBB 3D1VA 5IBCA 3G8DA 2NLOA 3AT1A 3DBRB 3FCSB 4RFSA 1TUGA 3GFGA 1GPLA 1MGPA 1XD8A 1U0JA 4HXFB 2JCBA 2IU0A 1JJBA 2EJTA 3B3AA 3NBMA 2IHYA 4HN2A 1G60A 2QVYX 2AUNA 1X7WA 4CGYA 4BJ5A 3LIPA 5GV8A 1A4UA 2IUFA 1NP6A 5DP1A 1ISSA 1R0BA 2GZMA 3GVPA 5D8DA 1Z6QA 2J41A 3CLUD 5HQ3B 2QTWB 1NQOA 3DHWC 1DKMA 2NYUA 4DLYA 2OKCA 5AYVA 2W2KA 2WABA 4QYWA 3O8DA 3F67A 4NZYA 1YQXA 4HYQA 4EY5A 1H1LB 2Y67A 1MGOA 5IYZF 1I2CA 3ED5A 4DC1A 1J24A 2V5AA 1Z17A 3TMYA 4IJVA 3RSSA 2CSXA 4N40A 1ZJ5A 4R2LA 3WQRA 2CJWB 1UMDA 3OM0A 3W05A 2EW8A 4B1FA 4GM4A 2CLOB 1U4OA 4IV5A 3UJNA 2FNAA 1YIOA 4DV4B 1E1KA 1XDUA 4FBGA 4GRAA 4OXKA 3V7YA 5ITWA 3OLVA 4RV9A 1LB1B 3Q3VA 3CE6A 3A7DA 5ICGA 2VP4A 1UFQA 3EK2A 4DABA 2GYUA 5K6TA 1U3WA 1Z22A 1JFFA 3EY4A 1ONSA 5BUQA 5BR8B 3D7SA 5GM1A 2GBGA 1FFDA 5EIWA 1SCAA 2ZJOA 2H4HA 1VI2A 3N58A 4O4JB 1K08A 1HPLA 1OFGA 2AV6A 4QRIA 5E0KB 1JHOA 4NS1A 3PGA1 2B9EA 4WTOA 3FHJA 5BOSA 2AOUB 4C0LA 3U61B 2J6HA 5T4BA 5K8CA 1D1TA 1XNHA 3B1KA 3MTJA 2FQYA 2GVZC 4UTZA 3ZQJA 1NA5A 1BYUA 3GT0A 5JHHB 4BVBA 3WOVA 1USGA 5TPWB 5LNK6 3OQBA 4WUTA 5FBLB 3RVPA 2IUSA 4NPHA 4KMOA 3N2NA 5J43A 5B1HA 4TZ6A 2OGWA 3ZJUA 2XUPA 1Y89A 1PJ3A 2ZB3A 3E1GA 5CHEA 5EP1A 3WSTA 1XK7A 3EVNA 2BTQB 1KMHB 3HYNA 5LMNB 1UBEA 2GRUA 2OHHA 4H7FA 1WY5A 1ZH6A 4HN4B 4LSGA 3W5CA 5GINE 1N7HA 3REQB 1PUIA 1BQEA 4FWBA 4LF4B 1VG8A 2HXGA 2CDBA 3QFSA 2XMZA 4Q4HB 4G26A 4X8HA 1B8NA 2RI1A 4F5DA 1KJQA 4QEDA 2B1JA 4OMCA 5JSZB 1GTRA 1YVDA 1FLVA 1SVNA 4TVKA 2XOKA 2XNSA 2QUZA 3EYWA 3FXAA 4TTVA 4URWR 1DRWA 3H65A 4YO8A 2O8EB 2X76A 1W0JA 1SKBA 2G9QA 1U28C 4U0KA 5A02A 1LVUA 2WTUA 4KIGA 1H6AA 1CUYA 2XUKA 2YMPA 4GPTA 2UZ1B 5AXBA 3PD0A 1M75A 2HZ7A 3I9KA 1TJNA 3BAZA 5AMXA 4DIBA 4L2IA 5HCUA 4JLSA 1XTTA 1Y48E 3LY9A 4XRGA 3TNFA 5CIQA 1WPGA 2QV0A 5HEKA 2YWJA 2AJLI 1A7JA 1LPOA 3VZDA 2K7FA 2WVAA 1Q91A 1KDPA 2J9RA 3HO6A 5CLGA 5DNUA 5AI8A 2W6OA 4QYIB 1U7WA 2MR5A 4MW4A 4PLTA 3IELA 5CT4A 5K0SA 1MXHA 3VNBA 1PNOA 2I55A 2RHJA 2VUHB 2XV1A 4B3HA 1ZGHA 4OGFA 4OYYA 1YACA 2RAUA 1NNI1 1KEVA 1W581 3V8MA 4Q37A 1SOAA 2H7XA 1KSFX 3LK6A 3PIDA 3SSNA 2HY7A 3ULKA 1KY4A 1PG0A 2VUIB 3DBRA 1C7ZA 2J3KA 5KQSA 1Z83A 1GDHA 4X8MA 1N5JA 5FUVA 4B3JA 1JLMA 3FIJA 3ND7A 3SC4A 5JTTA 4DYDA 3ZDQA 1U4SA 1ACLA 4J1QA 4REQA 1MRNA 2WD9A 2D4HA 2YIDA 3ZBPA 4Q7QA 2DXIA 2O8FB 1QGZA 1ZN8A 3EUAA 5JFGA 5KC9A 2I6UA 2IBMA 4R3WA 2AD5A 5HQ3A 4RW0A 3A3YA 3N7AA 2PT6A 4YBZA 2ZULA 3E1SA 1EUDA 2DHCA 2ZK7A 2OUIA 5JYDA 1H1LA 2D0IA 4FYPA 1OFTA 3MIIA 5IN5A 5SV2A 2C5GA 3Q5EA 5F35A 1W36C 3R9WA 2BY4A 4GVXA 4IHJB 2CJWA 4F8EA 5C1BA 2HA5A 1AU9A 1R0YA 3W79A 3L93A 5B64A 2V55B 3UMFA 2B7LA 1XRRA 2CNWA 4FQ7A 1NSTA 2F90A 1YZTA 3KR9A 4NONA 4MR9B 4PPNA 3W3AH 3ZEIA 5FI0B 1YL5A 4GBGA 4BV8A 1FC0A 1X70A 4WVLA 2IUUA 3MWDB 4KDEA 4RD4A 1MX9A 3DOEA 3GHYA 5JHGB 1XMOB 3A14A 1MORA 1ZC3A 4GICA 4C4SA 4O4JA 3K6KA 3T6KA 4BMSA 4R9UC 4AYWA 3WLRA 1BC5A 3NU1A 5BUZA 2EKZA 2PFSA 1L4HA 2BR4A 2J85A 5LYJB 2R0QC 3ZHQA 1A8IA 3L4SO 3R41A 4OHBA 4ON9A 1JRLA 2OBXA 4QJ5A 3PHJA 1JR2A 5AVKA 1K75A 1X1CA 2E1RA 3EULA 1HH4A 3RANA 4CIXA 3DDZX 1V1MB 4BQPA 1UXJA 3PHIA 2E4UA 1SUEA 3IDAA 3QNWA 3E7XA 3N8NA 2D1QA 2GRAA 4KXQA 4GWLA 2JD2A 5K6AC 3QXGA 5K8JB 1MP0A 1H5UA 3IJRA 3MTQA 4DARA 4ZIRB 5TPWA 3JVDA 2FZKA 3MIZA 1O4WA 1RYHA 2WM9B 1RC0A 2Q2NA 3DZIA 1JEYB 4BMVA 1H66A 4JA0A 1CE8A 3IP7A 4OOFA 1RI2A 1E77A 2JLAA 1VGVA 3LUCA 2J46A 4GSLA 1ZUWA 3LRTA 3PDIB 3KXDA 4OHKA 3M5PA 1YBAA 4ILEA 3SDZA 1P61B 1THMA 4RQUA 2O8CB 3REQA 3CTPA 5DHRA 1PSDA 2I2WA 1AVTA 1NQAO 1VSVA 1EDBA 3L79A 4Y67A 4C0WA 5EKSA 4TKMA 1K3UB 3H5WA 5DPMA 4ZEXA 4ESVA 1Y81A 5JSZA 5M7EA 4RC9A 3EVCA 1GV0A 2EAUA 3GA0A 1P3DA 3H5RA 2IOHA 3DLBA 3KYBA 2O8EA 3ZW9A 2ZW9A 2EXXA 1K8ZB 4JNKA 5F7ZA 3WIDA 5A5GA 1RYEA 3TECE 1MO2A 3GP3A 2V96A 1NJ8A 1XRJA 2WFMA 2UZ1A 3ZIAD 4TLEA 1W48A 2FMKA 5FFMA 1AGNA 3OE5A 5KDLA 5KSWB 1RWMA 3FCUB 3UZUA 5EXEA 1CFJA 2WNIA 4GOKA 4OQXA 4PAMA 1W5FA 4PSUA 2EKDA 2YMQA 4ZQFA 4AYXA 1T5IA 3S44A 3ZWOA 5LLSA 2NXEA 4PR3A 4UUBA 4PN3A 1L9XA 4RQTA 1QF7A 3A4MA 1HRDA 4O63O 3ZK9A 1XE3A 4BO1A 2JG3A 3QLUA 2X1LA 3HGQA 3HJRA 4QYIA 3MTAA 3RIGA 1VMDA 1DEXA 4YLEA 2XYVA 3D7LA 1GG9A 4IWYA 3LZ6A 1AMNA 4EG7A 4G0ZA 4LCEA 1JG1A 1MPTA 4DLKA 4KQFA 4LW8A 3ESXA 4WBNA 2C8KA 1PKEA 4HUJA 1N0WA 3BKXA 2VZ8A 3L05A 1YD7A 5HJEA 1WKVA 4LTNA 4BLQA 3OQIB 1IWOA 3FZGA 4CQNA 1H2FA 5ALKA 5F9FA 3RYIB 5A04A 1M6NA 3K5IA 3SHFA 4YCCA 1I9CA 4TSRA 3WNZA 4UTRA 4ZMRA 1HFEL 2B4QA 1TU3A 2F62A 4FEGA 5CLQA 5JO9A 4D8XA 2LGJA 3HWSA 2GF2A 2L82A 4FB5A 3I1JA 4LISA 4DWJA 1E4OA 5CT5A 4ZXFA 2O8FA 1LD3A 3CBGA 1ZU4A 1T9HA 3U4QB 5DN6A 1IBSA 4ZGBA 1PNRA 2E82A 1PL8A 2JAOA 1P33A 3H5LA 5D85A 5GVRA 3VU1A 2GAIA 1CYDA 3KAQA 1X9HA 3EZFA 1I33A 2REOA 3E2PA 1RFGE 3IEKA 4WZBE 1T1GA 2FFAA 3RGGA 3H84A 1XXHE 3KT3A 3HUTA 3QGMA 3W77A 5EZ5A 3BRWD 5EG5A 4IHJA 2YC4C 5BSGA 2WQ6A 4KDRA 3T7EA 3LDGA 1E4VA 3ETGA 5ADWA 5ER6A 2QK4A 3IDFA 1UIMA 3CPSA 4PZEA 2BM9A 4JBIA 5SY9A 4S2EA 2LPMA 5J2TB 3RU3A 3NXSA 1EFAA 4N5NA 2O05A 4KV9A 1KY3A 3A6DA 1PAUA 2FAXA 4BX2A 4J2HA 4MCHA 2ILVA 2PLRA 1EWQA 3PSHA 3NDIA 3AHGA 4A8TA 2R6AA 4LMRA 4B3MB 4U6SA 2H9IA 5LYJA 4L0MA 3T5GA 1Z6TA 1U7OA 3H2HA 4A1FA 2FN7A 1UCFA 1DEHA 3ZDCA 1GJRA 1I0LA 1XCMA 4NOLA 4HLUA 4QBIA 5FD8A 4A8JA 3BF8A 2Y4NA 1ZM4A 4NMXB 4Y6QA 1I13A 4BHTA 9LDTA 1V1MA 1JGTA 2YHAA 3QW4B 4FLEA 1G3UA 2FWAA 3GLRA 1TA9A 2L18A 4HDOB 3U2QA 3ZKAA 4ZIRA 3P2IA 5DASA 3OP1A 4EGSA 2XWJI 1JEYA 5LQMA 3OZVA 3A70A 1K7FB 1XKXA 3CRW1 1Y34E 1QOQB 2GH1A 1HZJA 4YRRA 4QGSA 4JODA 2UYYA 3CNLA 2JH8A 4E6EA 1MU0A 1E7RA 3GJQA 1RJDA 4YMIA 3PDIA 3QJYA 3SC6A 2Y0BA 3ZBUA 3G0CA 1UC8A 3ZXYA 4U2GA 5K0ZA 1OIVA 1YFJA 4GYYA 2O8CA 2JPDA 2PBLA 4REMA 4L78A 3SYTA 2FV8A 4TLCA 2BFWA 3RC7A 1HYEA 3BORA 2MYUA 1BCSB 3ZOKA 3QENA 3JYOA 4KCGA 2AEEA 5LZ2A 3FYHA 5EUCA 4YX9A 4B3CA 4V0NA 3VDRA 4B87A 3QU7A 4Z4FA 1HEIA 3RDPA 3N8GA 3K7EA 3FCYA 4JBWA 3PRJA 3FFBA 4C08A 2A1TR 4H7IA 1PWHA 3DKPA 4M9CA 2X13A 3SDSA 3ZIUA 4M87A 1NLZA 4Y9RA 1NN3A 4BVAA 1B15A 1BMDA 3P2OA 4I1YA 5FUYA 3NWBA 1J8FA 4O5OA 1UZLA 1VECA 2I6SA 1HORA 2NQTA 3R3YA 1E2QA 4F9TA 5CGZA 4F4IA 3L7CA 1XDSA 2QYOA 1JKJB 1F8YA 1TDJA 5C46F 3VSBA 4J0IA 2Q6OA 2GSWA 1VXOA 4E22A 1Q0HA 4Z4EA 4C0BA 4DR4B 4HGZA 2XYQA 4HGYA 4EVQA 4JKOA 2V97A 2V6JA 3OQJA 2F4VB 1BVUA 2C1ZA 1RLJA 1Z4KA 1JQEA 4KWTA 4P54A 2FH5B 3JVVA 3A4IA 4JZYA 5FOWA 2OO7A 2WKRA 4XTCS 4KBYA 1L0BA 2V03A 1NIJA 2ACVA 2DCMA 3NJ8A 4J4BA 5AKGA 1UJ5A 4CUKA 1UBOS 2GO1A 2FUKA 4MH0R 4HV4A 3NYIA 4QUDA 3OQIA 2RHTA 1OYVA 1WIWA 3DE5X 3HA2A 4QUKA 5JZOA 3RYIA 4N3CA 4RVHA 5KNDH 1O0CA 1MQ8B 2IQIA 2J0EA 1I5RA 1NC3A 3UMSA 1IEXA 2XF2A 2ECKA 1R00A 1GR1A 3NRBA 2P8JA 1TF5A 2G1AA 4JFAA 1IAQA 1IVNA 3TR0A 3HWWA 1W36B 2V5UA 1UC4B 2ODNA 3VISA 1CR0A 4HR7A 5FLYA 4KWHA 3V46A 1SG9A 4MCAA 3T1OA 3BHMA 2C3PA 3UPDA 5JI3E 1YGPA 2I7XA 2C98A 2O1XA 3GMSA 4ITRC 4UU0A 5DT9A 5ETJA 2OXIA 1P4GA 1FVHA 2NVWA 4W9NC 2G4CA 3DBVO 3OPYA 4C4ZA 1M8KA 2FPKA 1MAUA 1QH1B 3P0EA 4LWPA 1DC4A 4RZIA 3ZHUA 1ZCFA 4BN4A 4BEWA 3LBAA 2K5UA 1NPTO 1V8PA 2FSGA 4PRZA 3RD5A 4C0AC 3PC4A 1QXSA 5KYKA 3U4AA 2ZWPA 3KAPA 5BRNA 5J2TA 1V11B 4OK3A 4J07A 4NQZA 4PTZA 3C7CB 3TQFA 3ZY3A 2GR9A 4KSBA 5KQRA 4X24A 3HN6A 3PC8A 4JITA 3NBXX 2JJ1D 1S2GA 5FIUA 5HRAA 5JV5A 2DFKB 2IYTA 5LLTA 3H6GA 3NR2A 1ECBA 4BPRA 1AS2A 2ZPAA 2B1RA 3BUSA 4LYEA 3PFKA 4WQMA 2AZXA 1MEOA 2H2IA 4LVUA 1B6RA 1XQXA 3KOUA 3O3CA 3RBXA 2Z2XA 1KMNA 1QR6A 1DAMA 1NVAA 2G7MC 3MT9A 4Q1FA 5DB4A 3VAZA 4KR9A 3GRCA 2AG5A 1QCCA 1R9GA 3UAWA 4FMCF 3AVTA 4AS3A 2EQ5A 3FLAA 1WSAA 4GG1A 3PF9A 4HRXA 4NYJQ 1JFLA 4R9NA 5FTKA 1GQRA 3UK6A 1KFKB 5G3ZA 3WLLA 3HXQA 4N1AA 1VP3A 4POAA 4BZPA 2QX8A 4GT1A 1YFZA 4KYIB 5B55A 4LAFA 1CERA 1NVVR 2EF1A 3JQQA 5CVTA 2JJQA 3RIEA 4ZYLA 5CFOA 3LVBA 2HHCA 3PIRA 3OF2A 1Z45A 1MVOA 1FDIA 5IKPA 4OJKA 2Y05A 2CHFA 4K81B 4PLVA 4XYEA 3BB1A 4WJKB 3FROA 4ZVRA 4JV5B 4QYMA 1U8AA 4RK5A 1IBRA 2YV3A 4B4KA 3UFXB 3WY9A 3PXXA 2EW1A 3H2ZA 5IM4F 3F46A 4MKZA 4IQ4A 1OJLA 3WV4A 3K70B 2OM6A 2X3UA 5DGCA 5CVUA 1BCSA 2GYWA 3GR6A 4XPZA 5LN1A 2R7MA 1QRUA 1BVYF 5JNVA 3FMFA 1XOIA 3BXGA 2Z4RA 4YQFA 5DNAA 1ORIA 1ZN9A 3QELA 3FAKA 3IULA 2XXJA 5SZHB 4EITA 5GADl 4JIMA 3RIXA 1XWIA 1Y9AA 5DCYA 4FHEA 4FKZA 2GAAA 1WUKS 3KQWA 4FMDB 1J99A 3SYNA 1OZGA 4KX3A 3I76A 3C3XA 2IEZA 1AF7A 3H1FA 2ZWAA 3GY0A 3PUYA 4UUAA 2OZVA 2G36A 4I9GA 5LP6A 4QL3A 4RU1A 1PR4A 1YQGA 1NYLA 3ESZA 1JKJA 1KYIA 3M7IA 4DB4A 4TS9A 4LJYA 5IC5A 3NIWA 1A98A 1C4KA 3SXUA 4I1OA 1FW8A 4UNNA 4YIHA 1JIXA 2E87A 2PAFA 1V2GA 1SY7A 4ACBA 5AVQA 5JXIA 2QQ5A 1RXUA 5AVOA 3K32A 3P0IA 3VDMA 2FQQA 2Z30A 3F7NA 4FCVA 4RL4A 3PUJA 3SBEA 1N6LA 3R09A 1XD2B 3IX7A 1JVNA 1QG6A 3Q9NA 2D4AA 4KIWA 5AVYA 3AFNA 2O2XA 5DYWA 1DKUA 1SCJA 4OQLA 4CR6A 3N86A 3SE0A 2H59A 4KUGA 3U4DA 1NVUQ 2XCQA 1ODJA 4KHZA 3ZXSA 2XLBA 2OZPA 2OWDA 2XCUA 2CZGA 2I99A 1Z3CA 3IMFA 4PANA 5BWBA 1OAKA 2FN9A 1SU7A 1T1EA 4TSFD 3X44A 1JW9B 2FSVC 1VMKA 2VDNB 2P69A 2VHWA 3A11A 3G9QA 2YWHA 3ODPA 1P91A 4JH0A 4QULA 5BR1A 1UT6A 4CETA 5EIHA 4R1QA 4BVFA 3MWKA 1NMQA 4ONEA 3V3KA 5CX1B 4L3WA 3K1AB 1I80A 5HM8A 2AG6A 1PFWA 1W1WA 2QMZA 2PQ6A 1SO8A 2EWWA 2CXPA 5EEGA 3VU9A 4TKVB 3C1UA 1J70A 2QNBA 4KFUA 3CINA 1Q11A 3TLKA 4Z4IA 2J4FA 3NHLA 4EARA 2QJWA 3FCOA 5FWNA 3DD5A 1F20A 2OILA 3F5DA 1G8SA 2R8OA 2NZVG 5CIWA 2VA8A 3P7MA 1ZMOA 1WDTA 4HADA 3U7JA 3WO0A 3UPTA 5E7MA 3QEBZ 2E21A 2B30A 2VDUE 5G40A 2HCTA 2BZ1A 2XYRA 3DE0X 4LGYA 1GUFA 2EBWA 1KFJB 1V11A 2J31A 3OY7A 1TC1A 1CRWG 2XQVA 1TTPB 1E64A 4QPCA 5ALSA 3FWZA 3VR4D 4TKZA 1O08A 1GKIA 2QT9A 2W8BA 4GOOD 2C4NA 2EBUA