4ZCTA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
133
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Cholinephosphate cytidylyltransferase
total genus 41
structure length 133
sequence length 142
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zctA00
4ND6A 2A1TS 4EG6A 5KCMA 4MUIA 4OJMX 2PIDA 4NAHA 2QUHA 1G59A 4R0NA 4DDMA 2DETA 1J20A 3CVYA 1I2DA 3S3TA 1KH3A 2XRZA 3D6VA 3OP1A 5AHWA 2QJOA 3CVXA 1GPMA 1M8FA 3AG5A 5HUHA 1KH2A 1HYBA 4G5YA 3ZUGA 4MUFA 5BNZA 1N77A 3DV2A 5LFAA 2DR2A 4ND7A 3ELBA 4JXXA 5F23A 3VU8A 3X1JA 2E0IA 5LM3A 1JECA 3RK1A 4YP5A 2A1TR 2E18A 1ZUNA 2H2AA 3IDFA 2DXIA 1H3EA 1TYCA 4HPWA 3SYTA 4MVXA 2D13A 3ZJVA 3DPIA 2BTEA 2IJGX 3H05A 4ZCRA 3TNJA 2BYTA 1WQ3A 1PG0A 1IFXA 1EUYA 1QNFA 3CLRC 4UZFA 3Q12A 3FOCA 1TYBE 3IMCA 4U7JA 1U7XA 2X0KA 5J58A 5TEVA 4AQ7A 3MMXA 2AG6A 3CLUC 3RK0A 1N2IA 1NI5A 4XSVA 3F3MA 1M83A 1NUTA 3KFLA 1EJ2A 4S1OA 3RFFA 1I6KA 1VBKA 1MAWA 4KKVA 1SURA 1T9GS 3IUBA 2PFSA 3IMGA 5HG0A 2YY5A 1P7PA 3PNBA 1J21A 1D2RA 1H1TA 1N2OA 4P2BA 4F4HA 1VLHA 1GTSA 1ZH0A 2A86A 1K4KA 3OTWA 2A1UA 1YUNA 1B6TA 4DDHA 1WOYA 3COVA 1O95C 1MBZA 2AZXA 1Q77A 2RD2A 1N1DA 5KHAA 1JEEA 4HJRA 1MB9A 2V0CA 1U3DA 3A05A 1QU3A 2OQ2A 3E27A 1G8GA 3ND5A 4U63A 4A91A 2AKEA 3RHSA 1WXGA 1GZUA 1JIJA 3N05A 3UOWA 2DUMA 1R6UA 3D6UA 3G5AA 4ZT5A 3IOBA 1F9AA 3G59A 4MUNA 3Q10A 5DASA 4MW0A 4GU5A 4MUEA 3TZEA 3CLTC 4YMIA 2IP1A 4H3SA 1WY5A 1M1ZA 4I6GA 1M8JA 1IVSA 1MAUA 4K03A 2DEUA 4MW6A 1X8XA 2A88A 4NATA 1OWLA 5FNZA 2JAXA 4MW9A 1QU2A 4YBRA 2WB2A 1VBMA 3ZGZA 1GN8A 3C8ZA 2ZUFA 1A8HA 1KP2A 3CLSD 3NBAA 3H97A 4TS1A 2A1UB 1XNJA 4EG8A 4MVCA 2PZ8A 5K0TA 2VTBB 1M8KA 1LW7A 4AS1A 3FDXA 1EFVA 3CVVA 1GLNA 1Q15A 3FG9A 2WSIA 1J09A 1KORA 2GOYA 3ND7A 1VBNA 4L2IA 4OUDA 3UMVA 4ZCTA 4RUKA 3PXUA 3SZGA 4MW7A 3AFHA 4CQNA 4JYZA 1YIDA 2PXHA 4U8HA 4MW2A 5TEWA 1X6VA 3FETA 1KR2A 4KPUA 4X0EA 4PY2A 5H16A 1EFPB 4JZYA 5KWVA 1T6XA 4E1AA 3QE4A 3PRHA 3NV7A 1PFUA 3PNYA 1NUQA 2X1LA 4J76A 3COYA 1QTQA 1N2JA 3SEQA 5DB4A 2J08A 4YP7A 2D54A 2Z08A 3UK2A 1KQNA 4KR9A 4QRDA 4MUKA 5H7XA 1BS2A 1K92A 1NUPA 2D5BA 4DNXA 1XNHA 1G8HA 5LLTA 1JEDA 3IODA 1IH8A 5HUJA 1N78A 4EG7A 1PFYA 1KKUA 1J1UA 1F7VA 1JILA 2J09A 2Z09A 3H9CA 5DEOA 3ZXSA 1JHDA 1WXEA 4MW5A 2H29A 1YIAA 1EFPA 4MQ6A 3AL0C 3L93A 4MW4A 1O94C 1KH1A 1FFYA 3P0JA 4PBRA 1S4MA 2C5SA 2CYBA 3HL4A 2OV4A 2PG3A 4DLPA 1T9GR 2QJFA 1OD6A 3FY4A 4QREA 2VTBA 3H99A 1NP7A 2CT8A 1IRXA 4R2LA 2HMAA 3MLAA 3KT6A 4OUDB 3IVCA 3N2YA 2VXOA 3K9WA 1O94D 3CLSC 3GUZA 1NYLA 5JBNA 2CV2A 5J5AA 1NUSA 4MWDA 1T6YA 1JZQA 4MWCA 1F7UA 3PNVA 1LI5A 1TYAE 2CUZA 2V0GA 4ZT6A 1FYDA 1ULHA 1JMVA 4I6EA 1K4MA 3TZLA 3HZRA 4ZCPA 3LE8A 2DERA 4K0RA 4G5FA 1Q19A 3QTBA 4MWBA 4NDAA 3HV0A 1G8FA 1NURA 5TGTA 4XFJA 1GTRA 4ARIA 3P52A 1O5TA 3A4IA 3N9IA 1TYDE 3GLVA 4BWVA 3ILVA 3H9BA 3KT0A 2NSYA 4HK4A 2YXNA 1N75A 1KQOA 5FO1A 1KP3A 4NAUA 2E89A 2E21A 2A7XA 2HGZA 2X1MA 4ZT2A 3X1KA 3IVXA 1MJHA 1ILEA 1ZJWA 2DPLA 1NZJA 3A04A 2JA2A 4ZCQA 3K32A 3M5WA 2PZAA 2RE8A 1DNPA 4EGAA 1O97D 1N2BA 3BL5A 4ZT4A 5IHXA 3CLRD 1NUUA 2JANA 2XRYA 1XNGA 4UZEA 2I1LA 4XFDA 2ZP1A 2HZ7A 3CR8A 1COZA 2CV1A 1H3FA 5K0SA 2A4MA 4EF6A 3U1VA 3CA8A 4MW1A 2EL7A 1ZH6A 3CLUD 1IHOA 5EKDA 3AIIA 4PBTA 4EG1A 4Q16A 2QTRA 3L92A 2ZUEA 4ZT7A 2J07A 1I6MA 3DLAA 4WSOA 2GKSA 3HMQA 3MLBA 4F3RA 3FI0A 3RJZA 1T6ZA 4CDMA 1JIKA 4JXZA 3TQOA 3QTTA 3RBAA 1N3LA 1N2EA 1OWMA 1R6TA 5DK4A 1WZ2A 3DO8A 4MLPA 4MWEA 1U7DA 1VL2A 1Y42X 2YWBA 2WQ6A 2Z3VA 1U0BB 1WJGA 3TQIA 3VGJA 1K97A 3ISJA 3IUEA 1O95D 2DLCX 2CFOA 1MRZA 3KT8A 1KAQA 1KQPA 4R2MA 2B7LA 2IELA 1J1ZA 1LI7A 3TS1A 1QRSA 2QUJA 1TFUA 1EE1A 1N2GA 2QTMA 1N2HA 1JIIA 3MUEA 1MB2A 1NSYA 1RQGA 3JXEA 2TS1A 1JGTA 1IQ0A 3COZA 4EFKA 1YUMA 2G36A 3FWKA 3I05A 3P0IA 1UFVA 3SDBA 1U3CA 1WQ4A 1XJQA 3IMEA 2CSXA 1O96B 1MC1A 3Q4GA 1WXFA 3A2KA 1WXHA 2O5RA 2WQ7A 2QUIA 5FO0A 4G6ZA 4GRIA 3FH0A 4RPIA 1V47A 3MXTA 3IOEA 3HFJA 1QRUA 1CT9A 3FIUA 1EFVB 3ZXIA 3SP1A 3FHJA 2QTNA 4MUGA 4NZPA 4FZJA 5TS2A 1WKBA 1GAXA 4YP6A 2CYCA 4MVYA 3UY4A 3UC5A 4ARCA 4HJXA 1YULA 4L2IB 1IQRA 4KPUB 4NX2A 4WNYA 1TQ8A 1O97C 4QBTA 4DDKA 4DJAA 4MAFA 3SEZA 3ZJTA 1I6LA 2NZ2A 3COWA 3N8HA 3AG6A 3AKZA 1MOPA 1PFWA 2PZBA 1OWNA 4PBSA 4ZCSA 1EXDA 1F4LA 1WXIA 1PG2A 4CDNA 2QUKA 4EG5A 4CT0A 3KT3A 2X3FA 4MULA 3HGMA 3FNRA 4DE5A 2QJTA 2R5WA 4JFAA 2J5BA 3ZJUA 3CVWA 4KR6A 3ND6A 1V8FA 4MUHA 3CVUA 1Q11A 4ZT3A 3VRHA 1OWPA 3GMIA 4J75A 1O96A 1JZSA 4I6JA 3IVGA 1R6XA 1IQUA 4Q93A 1EUQA 2YWCA 3INNA 2O8VA 1H3NA 4KR7A 2EJCA 1OWOA 1YI8A 1QRTA 3SZ3A 3LOQA 5IJXA 3CLTD 2GM3A 2J4DA 3G6KA 1KAMA 3ZIUA 4MUJA 2A84A 3LCJA 1TEZA 5J59A 2CV0A 1O0CA 4EG4A 4EG3A 1J70A 1PFVA 1O6BA 1QQTA 3P0HA 3NBKA 4MVWA 3IH5A 1OBCA 3IOCA 1M8PA 3X1MA 1O0BA 2CYAA 1M8GA 1OBHA 1QJCA
chains in the Genus database with same CATH superfamily
1A5AB 1TPZA 4YCDA 1RYBA 2AMJA 5DHAA 2ID7A 1WLSA 4GBED 2WD8A 3QUAA 1TX4B 3W05A 1DO8A 4OJMX 4ENSA 2BGKA 1GUBA 2PSEA 1ZD8A 4AJ4A 1M33A 4NPAA 1ZFNA 4B7ZA 2G63A 4A2PA 6ABPA 4KR2A 4K6MA 4UE2A 4OF4A 2NUPA 1G291 2XRZA 4WN3A 2QZSA 2QJOA 4AUNA 4EB3A 2W22A 4WXHA 3UHAA 1UOEA 3EXHC 4IUYA 1AQUA 1VJ5A 3AI1A 5I7EA 3IS3A 2BC9A 2PMWB 1J39A 4URYR 2OEPA 3E3OA 3NHSA 2DR2A 1NAIA 1TMOA 2PBFA 3H0CA 5BVGA 1YFZA 4Y6RA 1Y48E 1A8IA 1YV9A 3H8SA 1MHPA 2DR0A 3CLHA 2VQ3A 4EY5A 4QAQA 2NUBA 3EFHA 4ISCA 1K68A 1LRJA 2PR7A 2PVSA 4H7KA 1JHXA 3MA0A 3IBSA 4NU6A 3BFVA 4B75A 4H7DA 1XRNA 3H2YA 2HFKA 3CPEA 1PHPA 5IVDA 4WUTA 3A28A 4MYTA 4NOLA 5JMPA 3ZJYA 5MGNA 5DKFA 4ZZIA 2UU9B 2Y66A 3Q2IA 4DDVA 2ZWAA 3VC1A 1KRWA 4JP1A 3C16C 4RVOA 2Q0HA 4GRDA 4I5IA 4LHZA 5KWSA 1YL6A 5DSXA 4JBGA 2AEJA 3RH0A 2AYXA 2BBTA 2H63A 2H2FA 1OH7A 1VB3A 3LRPA 1I3NA 1E8DA 4PTLA 3SIXA 3K5WA 3KLMX 5EJ2A 3ROMA 5HRAA 4GOJA 5H3CA 4E0BA 4OHMA 2P67A 3OJEA 4YCJA 4LYDA 2EJWA 2Q8PA 5TQVA 3L82B 2JATA 1ESCA 2H4YA 4E2FA 4XYLA 1UBJS 1X7WA 3OHPA 5HG0A 2YIJA 4QOEA 3STVA 5LA6B 1EXNA 1P7PA 1J21A 4HNUA 1SCUA 3H9JA 3CMMA 4M0DA 1ZH0A 1E4EB 3E0QA 3QVTA 4IIGA 4Z2YA 5JPIA 1B0PA 1U9IA 2XMBA 4BJ5A 4E31A 3FDZA 4UFOA 2DQZA 4CMBA 1Z0AA 1ILWA 3NXKA 1AUVA 1WOYA 1R0ZA 2EIXA 1J97A 3FJOA 1MBZA 3OIYA 4S0XA 3MFQA 4FIDA 1MXHA 1NLZA 5AJWA 2AE2A 2W8ZA 3A2MA 3FYSA 1RXUA 1XU4A 2HY7A 2KW5A 4HQKA 4R83A 4DQLA 2VRWA 2ZAYA 1R50A 4M98A 3VPGA 4NK4A 5ES4B 1A72A 2QRGA 4ZVRA 1E6UA 2IGTA 5KNCH 1KJZA 3V7FA 4LNAA 1DO2A 4QBHA 4WW0A 2OT3B 2PVPA 2QRLA 2CE7A 3OTHA 3EMBA 2C92A 3WQSB 4Z7NB 1R6UA 3CNHA 4E09A 5IDWA 1PBTA 5JXJA 2JHPA 1CB0A 1CE8B 4MUNA 1FEZA 1X3SA 1E3MA 4FWIB 1HL7A 1C1DA 1JQJC 3CLTC 1NW7A 5T3YA 4BFTA 3RVPA 1U8TA 4HGYA 1F5NA 3KZOA 3E03A 1M2JA 4LCBA 3RS0A 4TL9A 4HDSA 2DEUA 1Z6ZA 4YMSA 2OCXA 4CFZA 2NO9A 3P94A 2XBMA 1NLFA 4BL5A 2YL2A 5KCZA 2ZRNA 10MHA 4LOIA 5CXQA 2QJRA 4C20A 1Y3DE 4PRYA 4ZQIA 3GU3A 4A8JC 4OHVA 3ZHXA 1IPHA 1WY7A 2NAPA 1DMRA 2ICAA 4OUKX 1QF7A 3THRA 1DP4A 1SVMA 3JQ9A 4LYGA 1YBFA 3DZGA 1QR2A 4X8HA 4KRXA 2CZGA 3AU8A 3OZUA 4U7TB 3GJQA 2O1SA 1M7BA 5IN5A 3NBUA 4IHJF 1M8KA 4EY3A 3M1YA 3ADBA 1EFVA 3PDIA 1FQKA 1Q3HA 1ULUA 3FA2A 4K6FA 1AB5A 1YRWA 1RJEA 1ZXLA 2YMLA 3FMGA 3ETGA 4QQ8A 3EEFA 2I1VB 2C4UA 5K6AA 2YZ7A 3WICA 3GT3A 3LT5A 3D9QX 3ZHOA 3AONB 4CG3A 4ESOA 3VVCA 3WO0A 2ODQA 2Q4OA 4ZEMA 1VG9B 2FSPA 2F3SA 4ZIRA 3QVXA 1Z26A 2WOJA 5TLSA 2QN8A 2QL9A 5HCUA 4EHIA 3MHPA 1GTG1 4LYHA 3JD1A 4C0BA 2C4MA 1IM5A 2YW9A 4JYZA 5JD3A 4D99A 2HLPA 4WQMA 3L7AA 1NHWA 3IAFA 4MW2A 1EXVA 1H2BA 4X1KB 5CU7A 3PT5A 1P6QA 2PSHA 3IR6A 1LDBA 4HFNA 1DAMA 3NV9A 4OB6A 5DOVA 4PY2A 1E7QA 4NU5A 2ZR0A 2FK7A 3JQCA 2A6PA 4F3YA 3WIOA 5EGNA 3DDUA 3IQHX 3KVVA 4JSRA 4QE3A 2P78A 4CV3A 4TMTA 4O4IF 1CF9A 2YXEA 4TUYF 3OAAA 1M72A 3EPHA 1OFUX 2QIPA 4U7FA 3ZDRA 1AHIA 1D3AA 1E59A 1EVKA 1H5QA 3U3MA 5KTYA 4NMXB 2JLQA 4RE6A 1OILA 5DIZA 3ZHRA 5E3HA 1SQFA 3EISA 2FEMA 4TUYB 3QHAA 1CQJB 1ONOA 1CUZA 4KJXA 3NFYA 1GZVA 1T4CB 2ZWMA 1ARZA 5FB3A 2CHQA 4XPIB 4PPNA 3PNQA 4O8ZA 2E7ZA 1MVLA 2H51A 3ZWCA 1Q1NA 1B15A 3PNLA 2R6JA 2Z9DA 4OKIA 4II2A 2ZIEA 5KJEA 5DRYA 4HVLA 1FXWA 1ES9A 5LQSA 1Y6RA 3S2IA 4OHOA 3LI2A 5AO9A 1A9ZA 2FPXA 2P35A 3W3AA 5JH7F 3MXOA 1FXSA 1DLIA 3N28A 3S27A 3M7IA 5JAUA 3TW4A 5SY6A 4V2IA 1U1GA 1NOIA 4NE2A 2YS7A 1ZH8A 3D7KA 3GJSA 2V6MA 3A4TA 3QU2A 3OZVA 1EVIA 3FJYA 4M38A 4BXOA 1QANA 5FA5A 2XIJA 4LRTB 3CGWA 4LC1A 4WT7A 2A9KA 3ESBA 2XMSA 3Q3EA 4EZIA 3H2KA 1X92A 2GBCA 5H81A 3S1AB 3ZWXA 3GC6A 3NRJA 3V1UA 3VR2A 3DOCA 5F5XA 1NUHA 1O9HA 1KPHA 1E9FA 5DFAA 3WLEA 3ISVA 5J4VA 4XWOA 3VZDA 2ZU0C 1ZD4A 3ROPA 3TQQA 2WF7A 4YMUA 5BVHA 1IY1A 3TQCA 4ZZ0A 3W9UA 4QJ5A 4WI1A 4DANA 4JXKA 1VLVA 2QR2A 2C0CA 1HQKA 3CX6A 3DQZA 5I3CA 1Y89A 3IVMA 4M76B 5M3BA 3D7RA 2I2DA 5F51A 4IIJF 4YIKA 1CDDA 3GVIA 1WUYA 3LY9A 3BB3A 1YKSA 2P8SA 1B23P 2IWRA 3FRIA 1XA4A 3H2BA 2XEXA 2HHAA 1X19A 2HDHA 1LX6A 4RHEA 4HX5A 4IIJB 1GDHA 1MA3A 2JCGA 4XVRA 1HDGO 4PVDA 3JAMA 3AB3A 3ILXA 3LPCA 4P98A 2IUYA 4HFJA 2PKEA 4IP0A 4QSHA 5EIBC 1FSGA 2XI4A 5DX0A 5B12A 1CY4A 4TTVA 1V5GA 3TZLA 5A4MS 1JR4A 4JY7A 3L5KA 3IGFA 1Y8RB 3QTBA 3OQNA 2LD4A 1II8B 4H1TA 3TNLA 2ZTUA 4BJ6A 3TLBA 1LPNA 1NURA 2Z6UA 1DXOA 2WVHA 3AR8A 1IBCA 3P52A 4Q02A 5KJ6A 3WFIA 3CIFA 3I6YA 4YLEA 1Y5MA 3DL0A 2JPDA 3OEED 1WWKA 3R7SA 4WXMA 4BX0A 2OWEA 3H5WA 3LQRA 1GSOA 4M7RA 5KVVA 2PMKA 4ENUA 2G83A 2RI0A 3DNPA 3LRTA 1FFEA 2QYHA 2O52A 4ZV4A 1HNWB 3ZI0A 1Y6GA 1TKBA 1XQ6A 3MN1A 4JYBA 5EPOA 5FOVA 4DA0A 4CEIB 5BYAA 1GQRA 2XVXA 4RSHA 3F6EX 2HJSA 4BXOB 2DU8A 1IY0A 1L5HB 3DV0B 1L5NA 3QM1A 4NCHA 1YO6A 2XX3A 1ENOA 3K32A 4YX9A 1M1NA 2Q6TA 4O2BA 4KAFA 2II6A 4YJKA 3PD0A 1O97D 5AIAA 3QKSB 2BEVB 1UP4A 2LWIA 1YRHA 3ANMA 2GHRA 3DTTA 4BEWA 4HXGA 3SDZA 4FYYA 2OKCA 3MYYA 1NBOA 2Z98A 4Y6GB 1KEUA 2PVCA 2CMKA 2YOHA 5A4KA 2CLKB 2DTEA 2OYSA 3EIXA 2IEAA 2B5OA 2PTGA 1CRZA 2EKZA 1UXOA 1EGVB 3VGPA 1GU7A 3F90A 4L1KA 4B6FA 3FVVA 3MRXA 4WASA 2HZ7A 1SXPA 1ZVQA 2RHBA 1B26A 3OCVA 1E9VA 5G53C 2PT7A 3KCNA 3N6VA 5EHZA 5K0SA 1CBUA 4Y9TA 1FZQA 2OUKA 5GJVC 4ZCLA 5LN1A 5KPDA 1JR2A 1A9SA 4P7KA 2PUGA 1CQJA 1NOKA 1UCFA 1U65A 3DBHA 2YXPX 4JHXA 2VQFB 1T9BA 3UF0A 1IHOA 3HUFA 4BX9A 4WNAA 1U2EA 1LPAB 1DTSA 1RRPA 4MINA 3BX1A 5IW8A 5IAGA 1MORA 4G9EA 3NJRA 3L06A 1GXSA 4WSOA 3K5HA 1HXHA 1R4MB 2JC3A 1NTRA 4HH3C 1W1UA 3BCSA 3FPKA 3GP5A 2DUWA 4QXQA 3PEFA 2SKDA 4CDMA 3RV3A 3KPVA 3PHIA 5CPFA 4JX8A 2F3UA 3WK7A 5IZ4A 3ZDEA 2X4DA 4DCGA 4CIWA 1H0HA 1IZ9A 2IK8A 5BW8A 5DK4A 2B6HA 3LVRE 1T4MA 1YBVA 4IINA 5DT9A 1NNEA 4M49A 4Q6WA 5H82A 4PNPA 5IAKA 4BNDB 4RZ2A 4QYXA 3UWPA 4XD2A 5U4QA 2XUDA 4D8UA 1NU6A 2UUPA 1VBFA 2P3OA 3LC0A 4Y0AA 2RJNA 3O90A 2OAP1 4CWAA 2O2SA 1A4IA 4MVJA 2OC4A 3QV2A 6REQA 4D2IA 4QICA 1U0BB 1L8OA 2C5BA 3VGJA 2C9YA 3WG9A 3KP1A 3VJMA 3D2BA 1J33A 1O95D 1G41A 3GDFA 2VSYA 4R6WA 5AKYA 3H18A 3VX4A 3CHYA 3WHIA 4ZI7A 2GWHA 4WLEA 4ESHA 2C4NA 1PQUA 1ZN7A 1XF9A 2BV3A 4P3KA 2GHTA 3CPSA 2AN5A 1XHFA 2IYOA 3TWOA 4OLAA 1FNBA 2HHJA 1LGYA 3RIXA 4HGPA 5C5IA 3LX5A 1IJBA 4HVTA 4K86A 5DTRA 1G2IA 3O26A 4WESB 1O4VA 4BTVA 1LLUA 4E4YA 4Y9DA 3FF4A 2TS1A 2HHLA 3I12A 4Y18A 3R6WA 4KMRA 1VL0A 2BR4A 3W2FA 3SQDA 1GPYA 2HTFA 3VFDA 4S1NA 1E66A 3CG4A 5BRAA 1W2WB 2NADA 1G1MA 2ZSKA 4I9GA 1ZSYA 2AL7A 5KOHA 1GZHB 3SYNA 1I80A 4QGGA 3VSBA 5JZ9A 5LPNA 4NTZA 1MIHA 2NVUB 1E2HA 5A2GA 3Q4GA 3WISA 3LUJA 2BEWA 3D6MA 3QVMA 4G6ZA 4P9NA 4DA4A 4V39A 2H7YA 4RPIA 4BFUA 1CNFA 3K8QA 2YHIA 2WMDA 4IOMA 1WDWB 3QY9A 2OXTA 3RANA 5EQTA 4GEGA 4C05A 1T4BA 2XQGA 3QBVA 5C1BA 2ANBA 4FYKA 2VHYA 3H0KA 3WKEA 2WWWA 4YHHB 1YDEA 4P22A 2DKFA 3A27A 3OJCA 3RGGA 5BR7A 4TROA 5B1EA 3I28A 3FOWA 1IQRA 4D4IA 2VS1A 4PGMA 4O0LA 3R3WA 4DJAA 1EH5A 1JLLB 3QXGA 4EA8A 3HDQA 5LZ8A 3AKZA 1TVKA 5JFGA 3A6GA 4MS3B 3CNBA 2NOAA 3CV3A 4RKFA 3OIDA 3G7UA 2F9MA 3ZHVA 2C5AA 5K1ZA 4UTNA 4D96A 3UZUA 4U7DA 4LHVA 3WLMA 3CF6R 1ZICA 2BMFA 4R2WA 4ZAFA 1GZSA 4ZRDA 1YCFA 1I7LA 4YONB 1USVA 3I0ZA 4MZDA 5D3MB 4DR4B 4R1TA 1HLPA 4PTZA 3UNXA 5LDGA 1V8OA 4QG3A 4LK2A 3QU4A 3GL9A 2NIPA 4IYRA 2ID8A 5HJ5A 3H4VA 2QVZX 3EA0A 1BX1A 1R5BA 3UPDA 3W7AA 4E1VA 3ADPA 5BWBA 3FMIA 2C5LA 4US1R 1E7RA 3I2GA 3IVGA 5M2QA 2R6FA 1IM2A 3DE6X 3RU7A 4LOAA 5BSTA 4C4PA 3JQDA 2ZBFA 1ZQ9A 2OGZA 1GTJ1 3LUHA 1P7VA 5C1OA 1KDVA 1Y8CA 3BWBA 4UUBA 3ZIUA 5KIAA 1E2EA 2C96A 3VYTB 1OB5A 3EIQA 3NAQA 3GLGA 2HI0A 3W6PA 2YKGA 1J0EA 1SUIA 1FIUA 4RV9A 1Z6GA 4NPHA 4QYTA 3K1TA 3GDHA 4KX3A 3ZLBA 1LJ8A 4YPOA 1PJCA 2B20A 3BTOA 1VJ1A 5TGZA 2UUBB 5I9BA 2X4GA 3DO5A 5DI3B 1MZVA 3W77A 3IOCA 1GADO 1ZITA 2QZJA 3QVGB 3UMRA 1I4LD 1IOLA 2GUGA 2RGUA 3OOJA 4Q5IA 2O5CA 4U39A 4LDNA 1LPBB 4X5OA 3PQEA 4BKPA 2JD2A 3INRA 2FPSA 4UBOA 4EHHA 4WFJA 4BN0A 3G0IA 3COJA 1TLTA 2V6JA 4XIIA 5KVQA 2G70A 1Z37A 2PH1A 4ZFNA 1FCJA 1NW3A 2DBZA 3P2IA 1KJ8A 4X3OA 5GIOE 5TMPA 1PJAA 4LNUA 2FSVA 3LXMA 3OT1A 3TAHA 3I72A 2X3UA 4FFOA 1VIYA 4J3JA 1GPMA 4MR9A 3LFTA 4ND3A 1I0IA 3S70A 1Z16A 2YV4A 3ZU4A 4AG6A 5HIKA 5IJ9A 2CDAA 3FIJA 4X65B 3VI4B 4YMWA 3KVRA 3ZUGA 1G0OA 1JUDA 2G9VA 2WYVA 1ZJYA 3NAGA 3A1NA 1YQ9A 3WB9A 2RK6A 2BFEB 3DONA 1B43A 4RD0A 4ZVMA 3KYCA 2WTAA 4II7A 1HOTA 3AV3A 4P92A 1H5UA 1XTPA 3DMYA 4MRMA 5FHRA 3WE7A 1B2RA 4BZWA 3AVXA 1JECA 3D8RA 4YP5A 2VT2A 3MAGA 2E18A 3IDFA 4X20A 4QT0A 3OLZA 3PC4A 2G82A 3HCAA 3QU7A 2E2WA 2FN7A 4GXRA 3FUVA 1HDXA 3B6KA 4PQYA 2ZE6A 4V0MA 4HDKB 1SHLA 3I9NA 3LSYA 2WYIA 4FXOA 5CT6A 3LTNC 1L3CA 4HNAB 3GBPA 5F3RA 3AGQA 2MSDB 2SCUB 2WKRA 2WJJA 1UWVA 3C97A 1ZMOA 5A1TA 2AE1A 3CLRC 4G4SP 3UQYS 3WL7A 1YR9A 3PGMA 2GPNA 3OJWA 1J0DA 4DVGA 1ADFA 4F46A 1FJGB 1W36C 4JUIA 3SYKA 3U17A 3UAZA 3DDHA 5B3AA 4C5CA 3EXIA 4DLLA 1C9NA 1QGOA 1D6JA 1PWXA 4KO2S 3STYA 1GPUA 3F3SA 3AHEA 4ZVSA 1KDPA 3OX1A 4LZNA 2W6ID 4YAJA 5E3JA 2YVLA 4ALJA 4WDRA 5LXTB 3UUWA 3DHEA 1NUTA 4QEZA 1T1EA 5THQA 3SXJA 5L3QA 4Y2SA 1VRVA 3S55A 2HOQA 4CLHA 4DHWA 4Q9JA 4I1OA 4EGJA 2F7SA 1FE8A 4N39A 2CHGA 5KJCA 1F20A 3D6JA 3MS7A 4LI3X 3ABZA 3D7MA 2YY5A 1DEHA 2ZBRA 1DEOA 2R84A 1ORVA 5IASA 4IQ4A 4AW9A 2AFIE 2OL4A 4L6AA 1L4YA 1OXVA 1RE1A 1SOVA 1T35A 2D1TA 3ECSA 3HMKA 4MVJF 5THKA 4F7DA 4B3BA 2YY6A 5G0TA 1FFCA 3BG5A 4DLYA 1VYHA 3F6CA 2V7XA 1PR6A 3T52A 4YRBA 2QG9A 3L1UA 3O47A 2GTIA 5AM2A 2Z5VA 2G40A 4DABA 2FWBA 1US8B 4A2QA 1XXHB 3NKLA 4PRKA 5EHIA 4JUDX 1QU3A 4GUAA 4WV3A 2AKEA 4RESA 2GJKA 3LGXA 5REQB 4FFVA 2H1HA 1N1GA 1ZNWA 3CZ4A 1YZKA 2AG5A 3AKCA 3D6HA 3GJ5A 4ENWA 3TB6A 2I62A 3OPYI 4DXHA 3LXRA 4DJ5X 1JQAA 2XOEA 3USZA 3VISA 2ZBGA 2BMEA 2ODPA 4HWTA 4AYWA 2ODBA 4XD7D 4LJKA 1X38A 4CLEA 1R8QA 3IXMA 4LGCA 1KIFA 4QFDA 3RHTA 2QLLA 2NU7A 2IWHA 3BXPA 1VG1A 3JQAA 1EFLA 1K3FA 3HFGA 5DW0A 3AXSA 4NJEA 4UVGA 1Y1PA 3OTIA 5SYNA 1J0AA 4ZU3A 2HBRA 2VQDA 2O4UX 1UK7A 5ALGA 5J4LA 2PNJA 3QW4B 2FUG1 1OIXA 1W96A 4LV6A 3VU3A 3W9BA 4M0KA 2G7ZA 5BSHA 1UDCA 2GPJA 1R3DA 3H6GA 4JNKA 5FCDA 1CFJA 1VI6A 1WMSA 521PA 3E23A 3EZLA 4NZZA 3PTZA 4Y6PA 3M4YA 3GFSA 3CT4A 3DOOA 2H92A 3LZDA 5DNAA 1ZU5A 3RT1A 1SXJB 2DHQA 4YUZA 5TS3A 3KZCA 3SYMA 2E5LB 3EVFA 4AS1A 3BDVA 4R84A 1NJGA 2B5VA 3NKFA 2QRNA 4Q9NA 4TMYA 4ZO4A 2QL5A 1UBFA 3C6BA 2NXEA 4MWOA 4FFWA 1GT6A 4ABTA 2P6RA 2DTXA 1UM9A 3B6MA 3P4UA 4JGGA 5C8YB 3QEJA 1GQQA 5IYZA 3M2PA 3DHVA 2DQYA 4C4XA 2Z4TA 4CUJA 5JALA 1GLGA 4AJEA 5ISMA 4HL6A 2Q21A 1T2NA 1MP0A 1MV8A 3ICVA 4H7FA 1BXRB 4PS1A 2A5FA 1QZXA 1Z36A 2NTYC 2XOKA 4GT1A 1RI3A 1IG0A 5DM1A 3L7CA 1ZOIA 4JROA 1BO6A 3K72B 1R0LA 4MS3A 3KSBC 4NCBA 4B74A 2WM9B 1ZM2A 2QYSA 3GNQA 2L82A 3KD2A 3V46A 3SQXA 4Q03A 4MVJM 2OQVA 2ZREA 2QGNA 4WK2B 3ZDQA 2AF3C 4WNIA 5FNVF 3ZDAA 4KR0A 3T5DA 5IM4F 3OZEA 3FSGD 4LTMA 2RGXA 4OP1A 1EB9A 3DDCA 1KRHA 3PRHA 1P4AA 1AJEA 4XVCA 2CXHA 1N3BA 1LPOA 1TT7A 4OB8A 2FX5A 1MLDA 3SEQA 2DM6A 2GA8A 2J08A 2WHPB 3RHZA 5C4IA 4B3DA 1TO1E 4LGYA 1KVUA 4H31A 1NQWA 4MIOA 5K3DA 4A8JA 5LQRA 2FDCA 1DBRA 1P2FA 3ZTYA 5C32A 2IXBA 3WRWA 2OV6A 2XNCA 1F2UA 3MTGA 4MUKA 1N7IA 3VVMA 2OGTA 4TLCA 2X1HA 5SZJA 2OGWA 3HR8A 3KELA 4MRRA 3RWBA 1JPUA 3ZTTA 2E85A 1ST2A 1F0PA 2DLNA 4IOJA 3BHNA 4BNXA 4BZXA 1T8WA 4LVCA 4RZSA 5A03A 7ABPA 2XZPA 3TKLA 5C7YA 4PWYA 1S2IA 2FZKA 3PKZA 1PQPA 1FNSA 3WRVA 4GNKA 3W2EA 4S35A 4YR9A 2XGSA 3O31A 4MSUA 4C6TB 1B16A 1V1RB 4X24A 4FGJA 5EQJB 1YHZA 2Q29A 1CY8A 2AQIA 1ODIA 2F8LA 3LM8A 3DZDA 4HDMB 1IEWA 4DBLE 4H60A 4DG8A 4FILA 2RK3A 4V3BA 3LKZA 4UHKA 4IYJA 1Y8QB 1ZZEA 5IAAA 5L7WA 1VKNA 2H16A 1JQ3A 1T9GR 4DLPA 1HMYA 3NC4A 3SZUA 3SQOA 1M5TA 2UYQA 5CA1F 4OXQA 4Q4DA 3AW9A 5L53A 2OCBA 4NFLA 4PFJA 4WZ6A 2NO1A 1N3YA 5FPPA 1FFBA 1AKWA 1ACMA 4TVKA 4RETA 4NYMQ 3E7WA 4R9VA 5K99A 5K9ZA 4LQ4A 2CW5A 5ALDA 4EY7A 2EKQA 3H3FA 1PT9A 2P1RA 1Q7CA 3L0IB 5LP6C 5K51A 2ZJ5A 3PC7A 5JWHA 1FMFA 4LYJA 4FMDB 4IMIB 3C3YA 2QLTA 1FP2A 2A9OA 2V7QA 3DAHA 4L3VA 3SE7A 4DC0A 3NC1C 4RXUA 1DUSA 3VZCA 3GCDA 3OQJA 1V7ZA 4WZAA 3UIEA 1PL8A 3LWBA 2FPRA 3BMNA 3JWGA 3ZWQA 2QX9A 3DDNA 4I66A 1EIWA 4IG4A 1MNAA 1PNVA 3PFNA 3IEKA 1M2WA 4B2PA 1ULHA 4FGKA 4I8IA 4JB0A 1TVMA 4KXUA 2QSJA 3JU3A 5IC5A 3CB2A 1L8XA 4LJSA 3NOVA 2GF9A 3L0DA 4NABA 2KBEA 4YT8A 3H1FA 3H8VA 1AV6A 2HSEA 3BIFA 3T61A 3HV0A 1UFKA 3MQ4A 4NQZA 5CCXA 5TGTA 4E6EA 4IKPA 4QM6A 2B36A 4WOKA 2WHRA 3II6X 4NFSA 4E5PA 3FTPA 1EINA 3HKBB 1POWA 3N9IA 3VUEA 1KMQA 3GLVA 3JYPA 4EJ2A 1OU4A 3RYFA 1LJUA 1XEFA 1E1RA 4ANFA 3DFMA 3O4FA 3EGXB 5CCEA 1B4DA 3P71T 3PDJA 1Y9ZA 2JKVA 4RYLA 2AOTB 2V6GA 2X1MA 3G2HA 1DL5A 1FX1A 4HF7A 4GHWA 4WZBA 3S1LA 3UAVA 3DD5A 1NHGA 1FNDA 3ISTA 3EYWA 3S7TA 1UOQA 2ZJOA 4GBGA 4B79A 5JYBA 4GIBA 1QPBA 4Z9FA 4AMVA 4OIFA 3MQ2A 1NVDA 5J43A 3HEBA 1EK6A 3M5DA 1WVMA 3ZDFA 4P7BA 1YDFA 3GQBA 3UB2A 5K0EA 2WUEA 1PVOA 4IUDS 3OF5A 4OREX 1XDUA 4WD3A 1C8VB 1JQ5A 3WLIA 3NDBB 4DSNA 1U7ZA 2RC6A 4Q3LA 4BGEA 4IHKA 1H2HA 1W6UA 5H02A 2QSUA 1A9YA 1QE5A 1Y8RA 1WABA 2CSUA 2GHIA 3BS4A 4JBNA 4TQGA 5CIQA 4F91B 1MFPA 2P2SA 4DLRA 4P54A 3D02A 2ZYGA 2PXCA 2QRJA 2EERA 4IDCA 4NULA 1RTTA 1G55A 1P1RA 3IEMA 4FB5A 1VCMA 4CLDA 1H66A 1W85B 1L7OA 3EUWA 5EKDA 1G3MA 2QTVA 4BNGA 2D5AA 5HKKD 4F21A 4QYIA 3AM4A 4OB7A 1S8NA 1KO5A 1CZRA 1M2OA 2VT7A 3DKIA 1F9EA 3HO1A 1G8JA 1K5GA 2FGJA 1B8PA 4F3RA 2XT6A 3DWIA 2CLIB 3KKOA 4V03A 5BMVA 1U0GA 2QTHA 3PIIA 1PP4A 4KFRA 3ILHA 2UDPA 1E60A 3NR2A 4XIYA 4R8KA 4W1SA 4TPKA 1PWZA 3GWGA 3IP9A 2V58A 4TMVA 3GJXC 1OFHA 3I6QA 3D1JA 3U48A 4BKOA 4KQ6A 1Q95A 1K75A 2WV7A 1AM4D 1VL2A 3QFCA 2C97A 2EP8A 2I78A 4P80A 2YWBA 1VYTA 3D4NA 4RELA 4XCXA 5JZBA 4ZVOA 4FI3F 1T2DA 4OU4A 5AOAA 4G85A 5F2KA 4HTFB 3KJXA 3NB0A 2ORWA 3HSYA 3LIPA 3W78A 1BYIA 2BEUA 1XQXA 2V6FA 3JPWA 3MD0A 4HNRA 1Z7WA 2P1ZA 4HN4B 4QECA 5G4LA 3C3JA 4I81A 4QGHA 5EIOA 3RTBA 3HXQA 4NEHB 1H42A 2NU7B 3WYNA 3TR0A 4YRNA 5CCBA 1MC4A 3OFND 2TYSB 2X14A 2XKAA 2DWQA 3LDHA 3HM9A 3H8WA 2GH1A 2A0KA 2ZYAA 2JIZA 2X5NA 1J22A 1PG5A 3B1WA 1T8UA 4PNZA 4ARZB 1TZMA 3I34X 2X58A 3OZSA 3VR3A 2JRLA 3U7HB 4YRIA 2AD5A 5EWMB 2BHSA 3LPNA 3N2GA 4P34A 5CHYA 2VZ0A 1CEQA 2ZVQX 4TM7A 3MPUA 3R5HA 3PUKA 2XGJA 1C30A 3C5CA 1K7FB 3F6SA 2GAFA 4HWKA 4MUYA 1KZGB 5ITZB 2A1IA 1D7AA 4J03A 1ZSNA 4OP3A 4RCZA 4MI9A 2XE4A 4J1SA 4AJ2A 1GUZA 5C53B 2FZEA 4CGYA 5JAOA 3AX6A 2V59A 5EQFA 4MV4A 1JDUA 2HRQA 3P45A 4ZQEA 1XPJA 4MUGA 1PNRA 1QWOA 5DNCA 1ID8A 2W2VA 6NULA 4DSAA 2HMVA 3KOWA 1N9ZA 1KY2A 5LSAA 3JVVA 3ASVA 1PTKA 3GCGA 1I4DD 4X60A 1FF9A 4KBFA 1XF1A 1HDIA 2A0YA 3A6ZA 4PIVA 2IYZA 4QPPA 3SWWA 1E79D 5BN3B 3DHNA 5ITVA 4CIBA 1EWKA 1WW3A 3G68A 2C3MA 3N8HA 1F38A 2MCFA 1CQXA 1SGWA 2C82A 5K8LA 2IYNA 2ZTVA 3B1YA 1OI7A 1XROA 2GUWA 3HSSA 4PLTA 3HY4A 4YO8A 4N82A 3ZCPA 4C0JA 4Z4CA 4B83A 1IK4A 5CVJA 3FB4A 1U3FA 2MSKA 3KT3A 3K8OE 1T9KA 4TYYA 4HCJA 2C5EA 5AVXA 3ONDA 2OC9A 4DE5A 3CMCO 5HKBA 1G6HA 3VDRA 2MSCB 5CW1A 1XZNA 2Q3JA 3TMKA 1JH9A 1OI3A 4BMDA 3O38A 3AUJB 4M9RA 2FF7A 3LHFA 2SCUA 2FMKA 1JZSA 4GX0A 3KSDO 5KINB 2GPTA 5CT8A 3KNZA 1NQVA 3DTVB 2WKQA 4NBTA 3PV0A 2RGNA 3RYTC 1TJ4A 1KQGA 2O8VA 4BY9E 2ZYUX 2XF8A 1A1VA 1V1RA 4BV9A 4ZV9A 4DCOA 2VJYA 4LY0A 2TMYA 3JCZA 4RQBA 4U5XA 1CS0A 5LBUA 5COBA 5E7QA 4W8GA 3WNQA 3TR5A 3SF0A 2IYWA 2BWJA 5NLLA 5EIEA 2ONZA 5KNBA 4GQBA 4F96A 1T0PA 1H9BA 1NI4B 1XTZA 3E4DA 4XYMA 2ZM6B 3SHQA 3QVLA 3TTYA 3M34A 1WOMA 4WJZA 1E3JA 1FP7A 4C7MA 2IH4A 221PA 3EVCA 4DSOA 1JWAB 3UKDA 3U4AA 4D9EA 3VQTA 1ZGJA 3D81A 5A04A 3RCBA 2P4QA 3JR3A 1ZIXA 2W11A 2A1TS 3Q9SA 4GPTA 2OP0A 5ICSA 5KCMA 2V0NA 4BC1A 4JWKA 1B73A 4ZYTA 2POQX 4EJSC 3G7NA 1HQCA 2HEGA 2M2IA 3T7EA 1X1TA 2OTCA 4KV7A 1UH5A 2F67A 1AS3A 2VYQA 3LZ6A 5FWXA 4E4TA 2ZJ1A 3FHTA 2WF5A 1CQIA 4JJ8A 4KMSA 4PZUA 2Z3ZA 3UMFA 1P8AA 2Y27A 5MFPA 1WE2A 5CJJA 2O2JA 2H1OA 1Z2OX 3EQ9A 3OP1A 4YGXB 4C7XA 4P3YA 1EFTA 1YASA 2ON6A 3EDOA 1SK9A 5EJFA 3OMXA 3GELA 3TL6A 3VR3D 4BMXA 2XNKA 1BFKA 1E6CA 2PUWA 5FULA 3ZU6A 2JCXA 4UEWA 3VOAA 1DHTA 4ARAA 4BHTA 2IYTA 1SCDA 2R1UA 1MAHA 2DP4E 3ELBA 3DM5A 2A94A 4FHZA 3WK8A 1SCUB 3ORYA 1Z5OA 1XZAA 2D1RA 1D09A 4RM3A 4K9LA 5GWXA 3ASYA 2TMGA 3R77A 4H6VA 5BWOA 2YMMA 2DUUA 3O2JA 2A1TR 2ODAA 1V3TA 2H2AA 2VHUA 4YUYA 4HPWA 2O3RA 2ZYSA 3RRMA 3GV0A 1QVAA 3NHYA 4B09A 2FR1A 3T0IA 4DCCA 1YCDA 4B3MB 2XPCA 4H3KB 1VG8A 4GSYA 1N5KA 5DBOA 3TNJA 5IZCA 4Y1FA 4LXXA 3VU1A 2IQ5A 4YT5A 3F71A 4OCZA 1P19A 5A06A 2EG9A 1VIVA 1E8MA 1XTJA 3ED1A 5U1PA 2ZK7A 1ZJ4A 3L8DA 3NANA 2IQIA 1Q0PA 5AJXA 4B7XA 3ZU3A 3VPFA 5JOQA 4P2GA 4PONA 1GDTA 3BHIA 3NBQA 5A6SA 1GZ3A 1Z5UA 3RK0A 3TRIA 1EWTA 1CZLA 4ND1A 4Q3BA 3HRKA 1NFFA 3JQAB 1OZAA 1QDLB 3C6MA 3H1PA 3U37A 3EMVA 1PGNA 2QQGA 4G67A 1Q92A 3T41A 2ZAOA 2UYHA 4AX4A 1S7CA 4IMRA 1XD9A 1X7XA 5MN5A 3RNLA 3AJ8A 3RROA 3NHKA 3R20A 4D5EA 2DRIA 4DDUA 3BGDA 4NMWA 3A0RB 1QHIA 2V6BA 4C1NA 1YWGO 2HCBA 2JGIA 1ODTC 2ET6A 3VZBA 4DPMA 2QTTA 5HZHA 3A4YA 2LV8A 3GF4A 3OEYA 1I7SB 3CVOA 3RDPA 5BSKA 4MS1B 1A82A 4W7HA 5AI0A 2QRMA 3AETA 1KC1A 5C34B 3VZSA 2B25A 1DEAA 1Q44A 2P8JA 3PFBA 4S2UA 3O8CA 4H4DA 1PFGA 2VDWA 5CBPB 4ZYVA 2VXCA 1NDQA 2RHWA 4FCVA 4II3A 4WKGA 4BNHA 4ERXA 4WPGA 2QU8A 3TM5A 4Q9HA 1MRNA 1UFQA 1S3GA 4FE4A 4FE3A 1G8GA 1ZSVA 2FFJA 5I4BA 3L6BA 4LISA 4B87A 4GP7A 1W2GA 2VFAA 3EAQA 4Q4LA 2C2YA 3ITNA 5EIBD 2I55A 2HF7A 4FX5A 1F9AA 4LDPA 4Q9AA 2OO5C 3ZPXA 5LWHA 1TCBA 3Q0IA 4Q7LA 4AMZA 3MNFA 3M3DA 3SS7X 4YUWA 1NMSA 1FUUA 1YA8A 3R3ZA 3KQQA 3MRSA 4A6XA 2OD7A 3U60B 4ZXPA 4EHJA 3G8BA 3NC0C 1GAEO 2H07A 1SVOA 2XYRA 2ZB3A 5CX1A 4ZQBA 3URKA 4MQFB 4OXKA 3M81A 2D59A 4QARA 5FBRB 1FFHA 1WPGA 3WXMA 3FGOA 3P4YA 5IHPA 3Q5GA 4GZ5A 3SYRA 1F48A 1YR2A 5AXDA 1RQ2A 2IF2A 1ZI6A 4L4UA 5KDLA 3SIRA 4AIIA 1Y7PA 2JJQA 1RWXA 5BWCA 2A1UB 4Q7KA 4TZ6A 3KX2A 3BSWA 4KN5A 4NI5A 2QBYA 3L0BA 5AW3A 4D3FA 1HQDA 1N0IA 1P4RA 5FQNA 4EGQA 4OGLA 2YFYA 1M9NA 2Y0EA 3MWKA 3OBBA 2VDUE 5K3FB 5ELXA 4KIGA 3LPMA 3TTUA 3NYQA 3ZNNA 5DLYA 4PZPA 1AKNA 1KORA 1LNZA 4BZPA 1Z0UA 4M0FA 4OD0A 1P1KA 3D2CA 1QBKC 2GPWA 1BEUB 3KU1A 4TXHA 1ORHA 1YR1A 3BMCA 4FPXA 4MYRA 3WFJA 3I1JA 1Q7GA 5I47A 1N7HA 2OHOA 2RIRA 4FEAA 3SKYA 3SVLA 1J2YA 2DPXA 3KK0A 2B2NA 5AVVA 5BWMA 3Q15C 2VDNB 5A9RA 4F93B 4HB3A 2POCA 5DNEA 4F38A 1QYIA 1DIHA 1RAGA 1V25A 3L7BA 3ZCVA 5JFTA 4PQEA 3NYIA 3GG9A 2WSLA 4PC2A 3TCXB 4BQOA 5J2UA 2BZ1A 2H4JA 5IMBA 2ZIAA 4XYEA 2J9FB 5HW0A 3F74A 3QQPA 1SVNA 4L9RA 3DEJA 2BKEA 1K9SA 2CL6X 3I9V6 3KWLA 3QPCA 1MEEA 2BKAA 4HLQB 4OMCA 5EPUA 5H0IA 3CWZA 1QTQA 1ZC3A 3JR7A 5DGXA 2IBTA 1RXWA 4YP7A 1RVDA 4F3CA 3FPHA 3GVXA 5CDFA 1XTVA 4OFWA 4TV8A 1QPGA 4X93A 4RTQA 3F7TA 5ER6A 4OXIA 4CIYA 4CKCB 1KAGA 4QRDA 1S2LA 3JWPA 1YZNA 3AUFA 3EN0A 2I3BA 3KETA 2CLEB 4LAFA 1Z88A 1A8SA 4PHTA 2VPWA 2QV0A 3OPQA 1WCYA 3OU7A 2EHDA 1OB2A 3ZLJA 3MAAC 3B2EA 3MT7A 5AUNB 4PC6A 3CR7A 1YDGA 3BJIC 2JVKA 4F7WA 2FLKA 1F7VA 3FMOB 1NXWA 1N6NA 1Z2PX 1XDWA 4O3MA 5C2JB 4QQFA 3H9CA 1ZD2P 3V9PA 4AO8A 2FW7A 1JFFB 2PRZA 1PEAA 3LNCA 4HFRA 1N1EA 2PGXA 4EFLA 1JNXX 2VBCA 1Q57A 2IIQA 2I3ZA 2JLCA 2GXQA 4GWGA 4R1OA 4WLNA 4YH1A 1PEYA 3FYUA 3IA2A 2NU8A 4BU1A 4YUAA 1LJLA 1RLTA 1JAIA 4RJLA 1G21E 3LLVA 3G8CA 3AKYA 4G0WA 2ZTSA 1HA3A 5KU7A 1TIPA 1WUTA 3K1YA 3FKQA 5T57A 1H2RS 2GN8A 2QLFA 4LXYA 4QREA 3QLJA 5SICE 1GKLA 1NP7A 4MV5A 4O0MA 4YJFB 1X1CA 2IOFK 2P91A 5JFOA 1EFUA 1Z06A 4JSYA 3M1IA 1H22A 2FW8A 5KKCA 4Q12A 3M4JA 5B58T 5KBYA 1TUBA 5CT4A 3DMPA 4KH1A 5TE9A 4B3RB 3K0BA 1XTIA 3L07A 1JWBB 2Y1DA 3CKMA 3PFHA 2JJMA 3NDPA 4LZWA 4MO9A 3QFTA 3WGOA 4OHWA 2VSQA 3W1WA 3H13A 4GMGA 4LUCA 4R41A 4QOFA 3C3WA 1ZGGA 4XXHA 2VHXA 1U8EA 3RUFA 3FNHA 3M6WA 2XLBA 3BJMA 2XXBA 1FQWA 5F35A 4DHEA 4JIMA 1NUSA 3NP9A 5H4GA 5EA2A 2CUTA 2HBQA 2IUFA 3D6NB 3PHLA 2CC2A 4JOCA 4PZZA 5HMLA 2E49A 4RMIA 1C0IA 3RU2A 3S2GA 1ZISA 4C0HA 4YUXA 3PQ4A 4KODA 4G0NA 5IS2A 3EQ8A 2C3UA 5EI5A 2AC2A 1FFAA 3NNSA 1OCEA 4QDXA 1HTWA 2V97A 2CUZA 3OE1A 2PZFA 4ZT6A 3U3KA 4DYHA 1R0YA 1Y8ZA 4W7IA 1XQVA 1W4RA 2QN3A 2Y0CA 2VCEA 2VK1A 4B3SB 3JQ6A 3S7ZA 1IXZA 3LXUX 4F5EA 1EFDN 1S4QA 2E5WA 2FQXA 3LVQE 4Q24A 3T3DA 1CHNA 4M6WB 1EK0A 1KI4A 1C80A 1L4LA 1K7YA 1V5FA 1CZUA 1X9GA 3T7RA 3F73A 1CVRA 1J5PA 1GTRA 3C1AA 1LF0A 2ZETA 2KI5A 2GN1A 2LCIA 3PNMA 1DG9A 3WDLA 1U8AA 3KVNA 3HU1A 1CDEA 1KO4A 4H6XA 2NSYA 1C1YA 2OZKA 2Z2XA 5FJJA 1IDN1 4C2TA 3KBBA 5BWLA 1JJBA 1EIZA 4EW3A 4CUZA 4DV7B 1FB5A 2JFGA 3CN7A 1ILEA 4Q1VA 4IMPA 4B9AA 5FEMA 1YE5A 4EI7A 4MCJA 3UWSA 3Q9UA 4EY4A 4GZ6A 3TCNA 3AUXA 4TTPA 3NEAA 1HZJA 2NZJA 3PC8A 3RSFA 5HZKA 2PWYA 2W8BB 1VJCA 4OU5A 1FRNA 1QORA 4TL6A 4C7KA 4KOAA 4UD6A 4JENA 5JSQA 1OAOA 1WDLA 3QWAA 4ZT4A 3E8XA 5FJIA 1H0RA 3SLGA 2ECPA 4REQB 2ZJAA 1NI3A 3ACCA 4EAAA 3UKJA 4HDNA 3CJQA 2ZSFA 4Z9XA 2ZR7A 1NVMB 3CR8A 4MP6A 1Q83A 2D0OB 4BDTA 2GB4A 4QFMA 4CQLB 2H5LA 4X85A 2OXEA 4D0GA 1U7TA 1JKJB 4TWIA 1IXSB 1XYGA 4RAOA 1QZUA 4GOLD 1QKIA 4I55F 4YGYA 1RFGE 3DE0X 3QRWA 3V8QA 1L9XA 2CCGA 1K2VN 2ZRMA 3FPBA 3K9HA 5AFSA 2QTRA 3UXYA 1QHNA 1M0WA 3RV4A 4ZT7A 5M34A 1RJWA 3HJCA 2J07A 4RA6B 2W58A 4W63A 2VNKA 1EQUA 4DR3B 1SRRA 3ZHQA 1WW8A 4RA9B 4KMMA 1MPTA 4XQGA 3ZJUA 2ZI6A 3DMRA 1BQEA 4X6UA 4OBWA 4CL0A 1N6LA 1YQTA 3AZQA 3EE6A 3JVIA 4TM8A 2ZYWX 4V0RA 2W6IA 3E22A 4LE0A 2VBFA 4OHPA 3SSNA 2I6GA 4RIFA 4DIMA 5AJTA 4ISBA 4QLBA 2EJTA 1KSJA 3PQ5A 2FOIA 4EITA 4WHMA 1ZEMA 3DO8A 4F97A 3V4RA 2YJ4A 5I5GA 3IULA 4OXXA 4DUZB 4Q82A 4RF2A 5K4AA 1H05A 1X3LA 1QHEA 1Z4IA 2FJPA 3K7EA 5FI3A 3ZLUA 4EUEA 3K71B 2H5JA 3QZUA 2QTWB 1E5XA 2ASEA 1QLWA 2WFAA 4H7PA 3L0PA 1DC5A 3T3MB 1RMYA 3EZGA 5KVSA 4FDTA 1DWQA 4DR2B 4BC0A 4EYSA 4GMFA 2E4WA 3R9KA 5KU1A 1ZO8A 1EVYA 2WAMA 4IPTA 4G01B 4PAQA 1DT5A 1VMEA 3AEUB 3I30X 2B7LA 3UCEA 5JISA 1J1ZA 5KTMA 1OH8A 1Y82A 2C9OA 3ITKA 1CZOA 3UMJA 4QAJA 2VDMB 3E1KA 1Z12A 3FNBA 1JIIA 4FGSA 4MROA 4GEKA 5IVIA 4BMSA 3W0LB 2BELA 3BWYA 3OHSX 4URXR 1D9ZA 1BMFD 1PJTA 2VTVA 4RFSA 1JGTA 4EUSA 3V7UA 4JP3A 4K3UA 4W5WA 2XDWA 3HP1A 3D3JA 4PPYA 3QIVA 2BKXA 3KKEA 4ES6A 1XJWA 5E6UB 4BMNA 3D7SA 3GVCA 4M21A 4Y6LA 5ADHA 1JTEA 2A0XA 1YQQA 1ZA1A 2CKMA 3NALA 4M3NA 3T1NA 1XJQA 2WYHA 1CUDA 1MC1A 4XRRA 1AZWA 4YJ2F 5GJCA 3U40A 2O5RA 3RT7A 1UDXA 1V26A 2PH3A 1T4GA 5ALLA 2XMGA 1O03A 3FH0A 2R8PA 3HP4A 2OHGA 2G8LA 3HFJA 1A9XA 4LF7B 1ADGA 1NP6A 3LPAA 5FQOA 3REOA 2OP1A 3I0MA 4G84A 4YJ2B 4NZPA 2XCUA 3OY2A 3EW7A 3ZH9B 3SR4A 3ZV5A 6YASA 1G38A 4WZAE 3IQGX 1UJ2A 4B85A 1JDVA 3JQ8B 1OVGA 1RSZA 1IY2A 1XYVA 2UKDA 2X2FA 5A3QA 2G6TA 3T94A 2C4VA 4HTAA 4DIBA 1VL5A 4U2DA 1Z5PA 4F56A 1VMAA 1JAXA 2VHZA 3MPOA 1NVUQ 5K2OA 1DKNA 1G3IA 5A5DA 1A04A 3K70D 2HQ1A 3GJYA 3WFZA 1MDBA 3KPUA 2QRPA 1TZJA 2A5YB 1Z75A 3NDRA 4YRDA 1TTQB 1DINA 2F3TA 3IPLA 1VP3A 4ZD6A 3S1AA 2QJTA 2QLNA 2BGNA 4X54A 2VDOB 5E38A 5F4ZA 1QQAA 1BSVA 4WXRA 2W48A 1JMYA 3FWYA 3NHUA 5EN4A 3G5LA 4YQYA 5DGIA 4GPAA 3P2JA 4OMUA 4PHGA 5FPSA 3B5EA 3CVUA 2H9AA 4FB4A 1HF3A 2P79A 1X7GA 3SNKA 2JIBA 2R4UA 4GPD1 4JELA 2JJYA 4NCXA 5IKMA 4QDJA 5GOZA 4CKCA 2C4HA 1PFQA 2J31A 2O23A 1L5GB 721PA 2FWIA 4IX1A 2EJCA 4ZKEA 5NULA 1IJKA 1FFDA 3WL5A 1YAHA 3LOQA 3M4ZA 2EQAA 3GXOA 4LJ8A 2JGJA 5B1IA 4DLVA 3VYRB 5BNWA 1KAHA 2C94A 4AJ1A 1W8DA 1O94A 4D7AA 1JHYA 3SPXA 1J70A 4RF3A 1VMKA 2BBOA 4JP5A 1SXGA 1XELA 2YCBA 3BREA 7MDHA 4MVWA 4YN3A 2GXUA 1OH6A 2PWPA 2CCJA 2N1MA 2YN0A 4QQNA 3HN7A 3HJAA 1E0AA 3DFUA 2AG0A 2E82A 2YZNA 3B2QA 1WO8A 1OBHA 4S3MA 2HADA 4HDRB 1YR3A 4ZEWA 2IEIA 2L19A 3DAOA 3KJZA 2IHKA 2V7UA 2WWVD 2GVNA 4GRAA 4H08A 1OE0A 2JVJA 2H2GA 4FOOA 1DARA 1T5BA 3AQIA 3DBLA 3OECA 4D8XA 3AR5A 2DHRA 3MJRA 1J20A 1KBQA 3G2JA 4JBYA 4R2IA 2VQEB 4L50A 3PD7A 3HDYA 3QG1A 5IARA 4ZDKA 3T7TA 3RJTA 2NACA 2YIVX 5T8KA 5DNUA 1IMJA 1ZCJA 3DEYX 4U02A 1XMVA 1F8GA 4KIUA 4FJ2A 3WZ2A 4ZICA 3U09A 5K3FA 2QPTA 4C30A 5LDHA 5IVPA 5CM2Z 4KGXA 4QTTB 4TLAA 2Y76A 4UVHA 1GDDA 1OF1A 2QVGA 2DVMA 4YRCA 4HSEA 1B93A 4NSNA 3UJNA 1WU8A 2I4TA 3VTZA 4HGNA 4JL8A 4P5DA 5CLQA 3PE4A 5AJUA 2G07A 3PRJA 3BZWA 3FWHA 4W8HA 3RFUA 4HR7A 3UUEA 2EATA 3DUFA 4FLMA 1TYCA 5ENDA 3GPBA 5IX8A 1H3EA 2EZ9A 1RYFA 1HR0B 3TTVA 1Y1LA 4M1EA 3R5XA 4Z0HO 3FTQA 1P2VA 2Z2KA 4V0SA 2XWJI 4TL7A 1FMLA 2ZJ6A 2HUPA 4YYZA 3DW3X 1QV9A 2GI4A 3P9YA 1P2GA 1LQUA 4TSFA 2RC5A 4FE7A 2X8WA 5B4TA 3NGMA 3ZJ4A 5F9FA 5JR3A 2J0UA 2M9MA 4L74A 4V1CB 4HD8A 1ZYUA 2G1UA 4PPGA 3AL3A 5WRFA 3BWXA 3P19A 4ZOCA 4G0YA 4OK3A 3PSAA 1NNUA 4CV1A 2G4CA 4X44A 5BUCA 3DW1X 1U7XA 4EPTA 4CEHB 1MA0A 2HPZA 4BRSA 3LPDA 4Q3NA 4C88A 1M54A 3DCNA 2ZSHA 1NL3A 4FUQA 3I01A 2XNHA 5JSFA 3IOMA 3I2KA 4XSVA 1DE0A 1D07A 3QE0A 4PO9A 1CC1S 4G5HA 2FEAA 4COKA 5C52B 4DNQA 5LJLA 3ZY4A 1GM5A 2RG7A 3BIOA 4JEHA 1J00A 2B94A 1XU7A 1AG9A 4DC1A 2H2HA 2BUBA 2PN1A 4MUMA 2A2ZA 1UBUS 2FFQA 3VYUB 1NF2A 1ZPDA 1H1TA 3E7DA 1N2OA 2UVDA 2I2AA 3F3KA 3OE5A 4RCYA 4RXMA 2Y1CA 1PUIA 3BE6A 3DEFA 1PAUA 2DFPA 2PLAA 3Q6IA 4O4HA 5FIUA 1GZ4A 1Q50A 4OOEA 5BURA 1U63A 5E7JA 2GKGA 2F1RA 3HDTA 3TSZA 2M32A 1L9KA 3V33A 4ZODA 2C29D 1O6ZA 3FSEA 4J0IA 1XR3A 3T4PA 3U4CA 4DSUA 4YAEA 5C5DA 1DC7A 4Z9BA 8ABPA 1OLUB 1EQ2A 1FTQA 1M1XB 2VP0A 1OROA 4PSUA 3KOZA 2EHJA 4D9FA 2F62A 5A5GA 4OKSA 2HSJA 1C8LA 3G79A 3BORA 4ZT5A 2GAIA 1BJKA 1OJ7A 4H16A 4LTNA 1ADBA 4GR4A 1SK8A 3AJ9A 4HPJB 2GO1A 4PLYA 4ALLA 3BF7A 3PKJA 5P8WA 2JGDB 3KWMA 2QYOA 2V3VA 4H3SA 4MRNA 4HADA 5HQTA 1SIWA 2VP2A 1U4NA 3LDAA 3A36A 3LLMA 4HS4A 4P86A 5BYBA 3ANLA 3X44A 4BECA 4A6PA 3LA6A 1ESMA 1IULA 1ZUD1 3B1VA 3LDUA 4Q19A 4PQFA 1CXZA 2NYVA 1NE2A 1QNLA 1T34A 4OHUA 3WMWA 3QH4A 4CKEA 2IHTA 1YACA 1HDCA 1Q22A 3NX4A 4G2TA 3WSTA 1DRVA 1KDRA 1NVFA 1QGZA 2VK8A 1MOQA 1JPNA 2HH9A 1OXKB 3CLSD 1MU0A 4PC1A 5A7HA 3S2UA 1FLAA 1AO3A 3QFRA 5IF3A 4IJ5A 1AZTA 3H86A 3TMAA 5KWJA 2PKQP 4NLLA 3N75A 4MGEA 3P2EA 2G71A 1P9RA 4PO1A 4TN5A 1BMDA 5EAIA 4YWHA 1LW7A 1G0NA 3FR7A 3JQGB 4JLVA 2QW1A 4K40A 2O8CA 1IN7A 1G20E 1H2WA 4TV8B 4HH0A 2NO0A 4R69A 1UR5A 1SHTX 2VO1A 1LEHA 1F17A 1YZQA 3M6LA 4QFCA 3BRWD 3DZBA 3T5BA 2GCEA 1V7PC 3VHXB 3BEOA 1CRWG 5A9SA 1QV7A 1QH9A 4DA9A 3AEQB 5CFOA 5CLIA 4GD3Q 1OT5A 5LYYA 2FW0A 5T5QA 3IAM6 2PO7A 1W48A 2G5GX 2J7KA 3D8NA 2ZSIA 1OX4B 3KYBA 4L4RA 3VPSA 4DZZA 2DG2A 3L7NA 1E3DA 4WBXC 3BE4A 3GJ0A 3NWBA 4E1BA 4AC9A 2QQ5A 1SZCA 3HZZA 2DH6A 4UATA 4MEAA 5CBKA 4P32A 1W5TA 5A5VA 4L72A 5EWLA 1VI2A 2ONYA 4HKTA 4AZTA 4DN6A 1N4DA 1H4VB 4Q66C 3LUGA 3DB2A 2PH5A 1D7OA 2IXGA 2YJNA 2GM4A 3I2HA 3MM4A 2UVQA 2D54A 1FTWA 1S8AA 5L7YA 1KDZA 3SVTA 3VOTA 2JIPA 2WHYA 3R0XA 3T7CA 1Z4NA 2BGWA 5BMOA 5L3QB 4F0JA 4E2WA 4KITB 3P2MA 1KBOA 2PMDA 2AFHA 3ADKA 5F76A 3VC2A 5IBQA 3LECA 2XQKA 5ARCA 5GMOA 5F2OA 1LC0A 3MQFA 4ZI7B 1EX7A 4IO0A 1HDEA 4U7WA 1JTVA 4O8CA 5FTJA 4RORA 3L1VA 4MCHA 3R5JA 4O1HA 3JX9A 4YCNA 1RPJA 4FM9A 1ONNA 3ZV7A 2HA0A 2R2GA 1JFSA 1JSZA 4H17A 4UXJA 1IBSA 2VHQA 3UGKA 2RBEA 2I7CA 2HCRA 1JLMA 1HFKA 4ARBA 3D5TA 4QYSA 1T2EA 2H29A 1EVJA 4DWJA 2FWJA 3L93A 4MYCA 5EMMA 4H0FA 4YQEA 2F9LA 3QKWA 1WD7A 2UZ3A 3GJ6A 2IA5A 3M4XA 4G1EB 1LBIA 2GZAA 4EF5A 3EZNA 4NRDA 1UKCA 4MDHA 3HI4A 3HUUA 1XZCA 3ECCA 4URUR 3U3DA 1W36B 3HYNA 3KFVA 1HYHA 1T36A 3LO5A 4ZANA 2VHTA 5JC8A 2QJFA 2YN2A 4LQLA 5KC8A 2AK3A 3MJFA 1TM3E 2VTBA 4AJKA 1DBIA 3KKQA 5AR1A 1NVAA 4W5JA 4YRFA 2QSZA 1NJFA 1ZJ6A 3SC4A 3GA7A 2DFDA 2VXOA 3UWOA 4GKVA 4KTTE 1YJXA 4I4TA 4JKOA 4MPJA 2XYVA 1YQUA 4WNAB 3WJ2A 3ZBTA 5IANA 1K89A 3DBHB 1Z0KA 5G3ZA 4CV0A 2KB0A 2Q5IA 4KXXA 2DY0A 2O5VA 2QX6A 3KQMA 2QE7A 2CL5A 3HP7A 4F06A 2CVHA 2RG1A 1KERA 1NN0A 3A26A 2XZDA 4JLPA 3E84A 1Z47A 4DM7A 3PJEA 3IURA 4F86A 2JI6A 3GUVA 1PJZA 3HI6A 1Z8NA 2QUAA 3C39A 3CEMA 3GCWA 3C3KA 3PQCA 1IEVA 3EY9A 1CW2B 2ZRKA 4N0DA 3NYWA 4YC7A 4ALKA 3TFOA 2C58A 2WINI 4B3FX 1XPOA 3BIXA 5I9SA 1NJ6A 2VNHA 1K4MA 4J0KA 3HJFA 3E81A 1TAUA 4Q4JB 3U4HA 2B98A 4GYKA 1PEDA 2PZMA 2H1IA 5BN1A 2DERA 2YFKA 3TSYA 1ORRA 1AA9A 4XDGA 1VHTA 3H4IA 4Q7JB 5EQDA 9ABPA 1YBAA 2UXBB 3IE0A 1YJCA 1T13A 2IP2A 3IEIA 1TEVA 2GPSA 3CX4A 4BS9A 1YI1A 4MUBA 1GKKA 3VPAA 1N1MA 3JQQA 3ZE1B 2VWPA 1DAGA 1TYDE 3ZWWA 4X62B 4OX9Y 2JI4A 2P6NA 3HB7A 1P6XA 3ILVA 5GVRA 4AF8A 2Z2JA 1BOFA 1S96A 2YV5A 1T0JB 1IHUA 1GA4A 4FIZA 4J4BA 4PAWA 2ZIUB 1M66A 2SKEA 2B83A 1HNZB 1WETA 3U9SA 4WECA 3D31A 5DZSA 4QG7A 3TJMA 2OK7A 2PMCA 2HGZA 4WINA 4YY3B 3IVXA 4CMJA 3EC1A 4IVPA 4YLYA 5CDHA 3D7NA 5BV2P 2CXUA 5ETJA 3K8ZA 5D7NA 3K4PA 1YJAA 4MPDA 2FU5C 2ZRCA 1OYYA 4GMXA 4FCTA 4UHBA 4DARA 1UPAA 4D9IA 3B12A 4OGFA 3VO1A 5FFNA 1BKDR 4ICIA 1F2TA 4KXMA 5EWJB 5C81A 1OLUA 3O8LA 1V45E 4RD4A 4NVRA 1SIOA 1EJ0A 5TT1A 1S8FA 2QU7A 4JR2A 1RJGA 1BCSB 2PUCA 3ABSB 2XECA 1G9XA 1N5MA 3C6ZA 4MVJH 3WB0A 3JARA 4UARA 3HABA 4IICA 1I5RA 2VK4A 5FD8A 1JI0A 2P6PA 3DTYA 8OHMA 3U44A 3JD2A 4DB2A 3P2YA 2XB4A 5B3JC 2DWPA 1UBNA 1VDZA 4R5MA 2YCLA 4GI1A 4MV6A 3QYFA 1SCIA 5AM4A 4U2GA 1P2BA 4AS3A 1C3EA 1R27A 2WIKA 4QNNA 1FJXA 2GFIA 4BJHB 3WLJA 2Y4OA 3K9QO 3V5NA 2R68A 2QRUA 3STHA 3GUYA 1I6MA 1WIWA 1NXPA 1U7WA 3DZFA 3E7FA 5D86A 4DRYA 4WX2B 4YRKA 4IWXA 3G2PA 5GGYA 5IWAB 3V3TA 1EAYA 2QN1A 3PX3A 4MWTA 5ECGC 1N0UA 3A4NA 2VNSA 3GOQA 3NEPX 1IVYA 1RXYA 3IILA 4LYEA 4RW0A 4A73A 4BNIA 4CI9A 3B9QA 1CP3A 4KXNA 4O2AB 4QOGA 3THYB 3MZ0A 2R48A 3GLSA 2AJ8A 5CB8A 1QQ6A 2GNOA 1JX6A 1WZ2A 2NU9B 1CUBA 2QTBA 3QPWA 5KYWA 2QRQA 2PX4A 3PC8C 4YJGB 3K0KA 3BDAA 4HYTA 3DP7A 4TV9F 3L02A 2JCSA 2WQ6A 1VB5A 3PXEA 1OVMA 2FQ1A 1JEQB 2R1VB 3SF8A 1NT4A 2CFRA 3PXCX 4C0QC 2YZMA 1PNTA 1A9TA 2CB0A 5CEJA 1KQPA 2WJYA 5LLSA 1FVHA 2IELA 4UOZA 3ID6C 5BRJA 2NUTB 3J7TA 3GLHE 4JFRA 4ZOLF 4OSOA 2XWBF 4KTVE 4NNOA 4OVKA 1RLIA 1K66A 2GKOA 2R87A 3LYAA 4LF4B 1LV7A 2WJHA 4DV0B 1U8UA 3VJLA 3L8EA 3WAGA 1YUMA 4HI0E 3IIJA 2XZOA 1C7IA 4QDKA 4JC5A 4V0LA 1T8RA 1CR1A 1BE8A 3RTCA 3AUKA 3ROTA 2OV1A 4B3CA 3KSUA 3HN6A 5A4JA 1QIJA 1GAQA 3LK6A 2GFHA 1IHPA 3PU6A 5JO0A 3A06A 1Z74A 4MQUA 4NZMA 2CXOA 2WE8A 5K03A 5DNYB 1GQSA 2IOHA 5E9QA 1JA9A 1YBHA 1LW6E 5KYUB 2OGUA 1XFDA 2XUJA 2QD3A 2ZJFA 3THOA 5LQJA 3IAUA 4PYOA 4FZJA 4YRQA 4HYQA 2BFDA 2IITA 1M2NA 5G1OA 3KR0A 3O6VA 3W2TA 4A7PA 3SIWA 4AY2A 5D5QA 4ZTZB 4REOA 1G6KA 3MTBA 3IEVA 3FD8A 2ZE7A 3SHFA 3OEHD 1O97C 3PYLA 3VZRA 4EUHA 3RVKA 1USGA 1KEVA 1F1JA 2R6GA 1TM4E 2WNSA 2JNWA 3PXAA 5EJEA 5LZ2A 1H0SA 1EXDA 1T2AA 4EABA 2FSUA 3GEDA 5DX8A 3HYSA 4BO2A 1OZ0A 1RPAA 1DZ3A 2FFAA 1Z82A 5ADUS 5T8KC 3AR2A 2R5WA 3PBKA 4UVDA 1VHQA 2X7XA 4BUJA 4RQTA 5DHPA 2IOYA 1EX9A 3RARA 4JFAA 1AKTA 1OPXA 3CZAA 5AHRA 1DU4A 1P1BA 1P62B 5L3ZA 3S4YA 5JD5A 2D7JA 3M2TA 4FW9A 3IEXA 3PYMA 3DNMA 1ZOOA 3GMIA 1KVQA 5HF8A 5T41A 5B36A 1W88B 3CONA 4L73A 4GGPA 4E14A 5F9HA 1PR1A 1VCNA 2PZKA 2QM7A 3GAZA 4PPQA 2W2MA 4KQ9A 1OA0A 4IV0A 1O89A 4CCWA 1YB2A 4GZ3A 3HWWA 3T5PA 2PRYA 2Q7OE 1HE4A 4XIFA 4ACBA 1OPRA 2J4DA 1W5EA 4MUJA 1CE8A 3LCJA 2ASVA 3JTEA 3DZJA 4X8LA 1F8UA 3MERA 3JQ8A 2I1QA 5AUQA 3KL4A 4JKIA 2VP9A 4RDCA 1KY5A 5AM1A 4LHXA 1D8TA 2PZGA 4QQKA 3H1GA 3IBYA 4MI1A 4O4JF 2O57A 3NBKA 3C3PA 3VUFA 2NMVA 1U31A 2IYPA 3PQ8A 5FOXA 1ZN2A 1YL5A 4V0QA 2IHZA 4EO9A 2BGMA 1XEWY 1M6NA 1QJCA 3CJTA 4I1VA 3V9AA 1J2JA 3IT2A 4CG1A 5AKIA 4HQ6A 2HCFA 3GEIA 4R0MA 4A2CA 1XRQA 3THSA 1T25A 3H9EO 5BR8B 4E6PA 2W98A 3W5AA 1HLGA 2Z6VA 1C50A 1ZG3A 4IXWA 1MKYA 3LBHA 3TLGB 5JW6A 1QRRA 1BDIA 1CQPA 3NUGA 3D6VA 3DGFC 3GFFA 4ZMSA 1M73E 1FUIA 3QKTA 3PJGA 2DBYA 5FUBA 4JC0A 2NPFA 3DBOB 4MIEA 1LXCA 4CIDA 1GV1A 1NW5A 4RMNA 1IZZA 2QP4A 4WK6A 4CKXA 3M1AA 4HDCA 4KL8S 4Y8VA 4E15A 1KARA 4FKZA 1TJYA 2AFIB 4X7MA 1PK9A 2GEKA 1VIMA 3R4VA 3WYCA 1ULZA 1L4NA 3PL5A 3QLVA 1PS0A 4DLUA 2DKOA 2H1SA 2OV3A 4FOLA 3TVYA 1ZUNA 3T1TA 2AOTA 2DXIA 1C9DB 3BXEA 1TPYA 4Q9LA 4Z0PA 1CCWA 1KAOA 1Q0LA 3H2SA 2XE7A 4L16A 1W36D 1WMDA 1DX9A 4NBLA 1VZ2A 3K2QA 2Q4RA 3CRNA 3NTRA 2Q9CA 4M8SA 3BTUA 2YHUA 2BM8A 4XD7A 4BNMA 3Q2KA 1W4LA 1LFDB 3K92A 4ITRC 1EA7A 1PCXA 3DOIA 1FRZA 3EVTA 1HZZC 1IL0A 3IMCA 5FA6A 3JALB 2PYIA 2R4QA 3G13A 1PS8A 4AMGA 3VR4D 5EUQB 5FUXA 4HXYA 4EMTA 3SFVA 1L7MA 1Y33E 1DBWA 1T8SA 1AD2A 3H7AA 2EZTA 3O3OB 3T9CA 2WRZA 1VKOA 1W4ZA 2Y1XA 3QVUA 4JX9A 4Q01A 2OFFA 3H3JA 4ZYUA 4JQOA 1IB0A 1P17A 5CVUA 2AMVA 3FGPA 2FZLA 2YVUA 5AI5A 5CITA 2IUEA 1U2GC 2XUKA 4YMVA 1YNSA 1Y9JA 1LPPA 2Y0PA 2FDRA 2V5UA 4L3OA 1D2RA 1YCGA 3KZMA 4NZNA 4QUJA 4WA8A 4OQFA 4YP0A 4M1OA 4DJTA 2Q1TA 4IEFB 4IIHA 3V8BA 4K28A 1I0ZA 4UM8B 3OCZA 4XE5A 1UJ4A 3OTWA 3L7YA 2K6GA 2FEPA 4RIIA 3AP1A 1ZMRA 4HEHA 4J8PA 4AY5A 1DDIA 2V5VA 2AJLI 4E22A 2QAGA 1WD5A 5AP9A 5T4HA 1SWWA 4U7GA 2VKTA 5KHLB 1E3WB 4R1SA 3LLUA 4AWAA 4A6DA 5JH7A 4M1MA 1TC1A 1BH2A 1KSFX 5C1DA 3ZQ4A 3C15C 5B6PA 1UFRA 1WCIB 2H3EA 1WL8A 1II9A 2VP5A 3BQMB 1DADA 1YVUA 4YTEA 3RIGA 2HMUA 1JIJA 2DFLA 1GL9B 4KW7A 4RULA 2Q1WA 2R8RA 2WG1A 2EGUA 2GD0A 1ULSA 2EKLA 3GMSA 1C2TA 2ZQZA 3TZEA 5JSZB 5TX7A 1PHRA 1AUQA 2G4VA 3BK1A 4R0VA 4LFAB 1J9ZA 1FQOA 1NBME 4HDMA 1PSDA 3ZGYA 4BATA 5DXFA 2WSSD 1X8XA 5F73A 2BPOA 2DUNA 3LU1A 3N8DA 3NETA 2X0DA 1OI2A 1X8KA 2JGLA 3AEXA 2W0MA 3C6XA 1PT8A 4RIEA 2PL1A 5T64A 2OZPA 2HA3A 4AMBA 1KP2A 2AZTA 1KS9A 1SVKA 1CR4A 1D4OA 1RZ3A 2GJSA 3E5MA 3GD5A 3VI3B 1MD9A 1NRIA 2YW2A 4OQQA 1E2FA 2Q9AA 3QF7A 3ESRA 1VL6A 2OCLA 2G28A 3FCEA 1AK1A 2VRCD 3G5TA 4FFLA 1RM5A 1O54A 4LOLA 4TXNA 3AFMA 4QPJC 4XVQA 4CQMB 5IJ9B 5TV2A 3U9TA 4X3CA 2JAPA 4KAXA 1XT6A 3NHBA 1ZIYA 4IH4A 4NYMR 4UPDA 1ECLA 3DFKA 4FCCA 2TMKA 1RYYA 2PX0A 4QXOA 3HDJA 3WQRA 4OUDA 1F4PA 2QX4A 2WK1A 5IJZA 4HDOB 3KAPA 2WT9A 1JEJA 3JD3A 4ID9A 3G7SA 4UCQA 2Z1DA 4UMVA 1OJLA 3KYDB 4IHJA 3KJGA 2BKLA 3STUA 2PXHA 5A5FA 2QTGA 1YQXA 2GESA 5EIXA 5CDSA 2WU3A 2Z8YM 2EFEB 5I7RA 5AOCA 1USKA 2WG0A 1GR0A 3AINA 4X0EA 2WIDA 4XWGA 5H16A 4NJMB 3FDZB 4E1AA 4UHHA 4DJEC 1IHYA 4FYIA 4NV0A 5HJ7A 1E4EA 3CEJA 3O4IA 3R3YA 2F8SA 1KYIA 5E7IA 4KOEC 3WBJA 1G8SA 4BU0A 2HNKA 4DCSA 3BVPA 1R0XA 2JFNA 2XWPA 5DB4A 3TUJC 4JI0B 5LQKA 4LVNA 4MS4B 4FFBB 1QG6A 1GG9A 2PS0A 2Z3WA 1BU5A 3SHWA 4PO3X 4IJUA 1KQNA 3O3NB 2XCOA 3AVYA 3DPUA 4G4SO 1T3ZA 1V6CA 2EZ8A 3ZY2A 4K9QA 3WDKA 2W43A 5DWQA 2BCGY 3GFBA 4BZQA 4WBNB 1NTOA 3VU9A 2JAWA 1GRVA 1VHWA 1ZK3A 4AYTA 2CK3A 1PJ4A 2D5LA 2GARA 4JN6B 2DSTA 3OQBA 4YVFA 1JA0A 4UMDA 1JQLB 3MELA 4ZVPA 5F9MA 1CFZA 3B20A 5A0FA 4E11A 1W1IA 1SBTA 4NBSA 1E62A 3C5VA 1Q91A 3OOEA 2NU6A 3E18A 3VMFA 4P53A 1ZA2A 5DEOA 2CNLA 1IYZA 3TLAA 1E79A 1I2AA 3LL7A 4UQOA 1RHRA 4ENTA 1DBQA 2GZSA 3VO8A 4XB2A 1I3OA 2Y1EA 4W5OA 4MYUA 1GGNA 1EVLA 3FHCB 3HKCB 3G8AA 5A3JA 3AYXB 1S4MA 3SS8A 2C3OA 2WKPA 3O5AA 3V2HA 4G1UC 3QKUA 1C4OA 1RWWA 4BJ3A 1PF7E 1RC1A 1RHQA 4Z7QB 1OD6A 1WULS 5FWXB 3WV4A 1U0HC 3RPEA 1RC8A 2G25A 1XZPA 2IHBA 4KRGA 4RTJA 3R44A 2V03A 4OUDB 3UOAB 1BVRA 1U1CA 1TO2E 4C14A 2UYCA 3EB9A 3DC2A 5JMTA 3UMSA 1QGDA 2ZB4A 3UG7A 4GKJB 3JRXA 4F8JA 3IUMA 1RBYA 2AHRA 5I5EA 5JBNA 5KNBD 3L6OO 4QVIA 5DP1A 4AG5A 4R81A 4BAUA 1V7QA 4BBZA 2XE6A 4JASB 3OFNA 2HMTA 3UJAA 5A02A 4YACA 1NI4A 2YV1A 4I08A 5B55A 1F8FA 1BRTA 4GX5A 1YFJA 3TH5A 2OGSA 2XCRB 2GK7A 1VHDA 4IS3A 4N9WA 2RHRA 3VPBA 3V8MA 1UXKA 3GRPA 3LFHA 5F12A 2YUTA 5KSPA 3NHRA 4RE5A 2WG2A 4JCCA 3D54D 2A35A 5I9NA 3DFFA 2OHFA 4WY5A 3USCS 1O95A 1OREA 1TTHA 3EVBA 4AY6A 1P0IA 5A3VA 5LB4A 4AIRA 3ER9A 4P0PB 1UIRA 5ERXA 3VDXA 5HPYB 4HP8A 3SC2A 3NBXX 2I2XB 3LC7O 1TRHA 1N7GA 4RC9A 1U0NA 5J2UF 1PR9A 1WF3A 2RHDA 3SC2B 4BO3A 5JNSA 3MIZA 6REQB 2HSGA 4KWIA 4Y0NA 3WGGA 2UZ0A 1GD1O 5AVOA 3VR5D 3RYCB 2VPZA 4LPSA 2ATEA 2JGKA 3WGNA 4IJVA 4Q4HA 4YMTA 3LT2A 4NBUA 1H94A 5ULLA 2X0IA 3FXAA 1PLLA 3ILSA 1N75A 3OX3A 4WVFA 3Q3IA 5CR9A 4YO7A 4UUNA 2O0KA 4BMVA 3UCFA 2O8FB 1C7RA 4FBGA 2OMEA 2CBZA 2E89A 3CKKA 2XDYA 4M54A 4XPZA 3WNVA 1IZ0A 3BN3A 3OA2A 1PIWA 8LDHA 1MJHA 2PXXA 4NYJR 2HX1A 1TD9A 1RQNA 2AS0A 5EWLB 2B4TO 3HA2A 4KFSA 3W8DA 2XDQA 3M5WA 4LEIA 3WB1A 5AW8A 1IM8A 1GXSB 2YHAA 1RLOA 5D85A 4RK0A 2XYQA 4PC3A 5LQDA 3WI7A 1XZLA 1JJIA 2VH5R 2VTKA 1JBQA 2IDKA 1ORDA 3K1AA 4AZ0B 4MHTA 3HHPA 4JC4A 2C4TA 3WNBA 1F06A 5CBPA 1IHDA 2JRCA 3E61A 2JANA 2HN9A 3KPYA 4NBVA 1BJTA 3FPAA 4TT3D 5ALHA 1Z13A 2P9QA 2EJVA 2ZP1A 3H1EA 2AXEA 4AXXA 1QVWA 2IS1A 3JYQA 1P7ZA 4BX3A 3ZBUA 3OF3A 3P9CA 5DNVA 2OBNA 3EBLA 1HG0A 1LBHA 4CFYA 4HOYA 4INAA 3B52X 3K0AB 3MW8A 4JQSA 3BD8A 4MGHA 2IU6A 1JDBC 3IT3A 3MOIA 2WD7A 1KQ3A 4I50A 2B69A 1JKXA 3REQB 3MRVA 2AIRA 5LYJF 4CMEC 1TL7C 3DMDA 2FE4A 3DKRA 3HVUA 3CH4B 2FX3A 2P7IA 4FZ5A 1LY1A 4AD8A 3O7MA 1BD4A 1BWPA 1K3TA 2DFTA 2GRJA 4NY1A 5JCOA 1PV4A 1NF3A 3RO7A 1PZGA 1SUAA 2CDBA 4JXZA 2W2KB 2C1EA 1U2SA 4E2ZA 2FFHA 1FDVA 1HTTA 1VE5A 2I6UA 2XOXA 1U2PA 2GBLA 2HCTA 2HZBA 2ZPUA 3EG5A 1QGUB 5IAOA 2FZGA 1AA6A 1W4AA 4PNEA 3Q1LA 3I76A 5AUOB 2I65A 3W6OA 2OHJA 5IXSA 1JBKA 5TIIA 1WZCA 1H4QA 3ABOB 3JAKB 1QHHA 4EFMA 3OEHA 3MK31 1RP1A 4N7MA 4MPPA 3TQIA 4RFLA 3PF9A 4FFBA 3VYSB 1X15A 2IEYA 4NENA 1DQRA 3IDQA 3JWHA 4N49A 3LTEA 5FADA 3WKBA 4D44A 2FN4A 4F9GA 4M9ZA 2VZ9A 3ILYA 1E3EA 4Z7OB 2RH9B 5ALQA 2AOUA 3ROQA 2C9BA 3DCIA 4TVSA 4XM2A 2NW6A 1AX9