4ZDDA

Structure of yeast d3,d2-enoyl-coa isomerase bound to sulphate ion
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
247
Chain Sequence
b'QNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKTSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,2-trans-enoyl-CoA isomerase
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 92
structure length 247
sequence length 263
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zddA00
2VSSF 2IEXA 3R9QA 3H81A 4FZWC 5DU4A 5FIFA 4U18A 3VIVA 5DZKH 3N6RB 1K32A 1NZYA 2BZRA 3ISAA 2ZL4A 3BEZA 3SWXA 4B3IA 4JCQA 5DL1A 2J5GD 2X24A 1W2XA 2HW5A 5G1RA 4WCZA 1J7XA 4IZDA 4EMMA 3IB9A 3KQFA 1TG6A 2WTBA 4Z0MA 3QXIA 5E0SA 5INGA 5CTBA 3H0QA 3RSTA 4Q0GA 4OG1A 3TVWA 2PPYA 4EMLA 2VSSE 4I4ZA 1TYFA 4NNQA 3R9TA 1YG6A 5DUCA 3PZKA 4U0GH 5DU6A 3TRRA 5DKPA 1WZ8A 5KDRA 1FC6A 3GMAA 5DZKA 1O8UA 4KWBA 4ZDDA 2J5IA 4FNDA 4L6WA 4NEKA 2UZFA 2FZSA 1RJNA 3ZW8A 1FCFA 3TT7A 4ELWA 3QXZA 1UYRA 3ZW9A 2VSUC 2Q34A 1K39A 5MGBA 3TZ3A 5E0SH 3IBBA 1ON9A 2ZL3A 4K3WA 1DUBA 4ZDCA 3RSIA 4EMPA 4GM2A 4FZWA 4U0GA 4FN8A 2F9IB 4LK5A 3JU1A 3MFMA 2VREA 3V5IA 3PEAA 4WZ8B 3MT6A 3U9SB 1FC9A 3PE8A 4JCTA 4FN7A 4ZDEA 4IZCA 3PGQA 4RCNA 1JXZA 3OC7A 4ZU2A 1UYSA 5IKLB 1VRGA 3HLN1 3WG5A 1Y7OA 3IAVA 2ZL0A 3K50A 1EY3A 5G1QA 4ASIA 3LAOA 3TT6A 1XNVA 4YLHA 3T88A 5JBWA 3HE2A 2J5SA 4U19A 2DEOA 2PBPA 4JYLA 3G64A 2X58A 3P85A 1FC7A 4I52A 3NJDA 3QKAA 3FF6A 3Q1TA 4U1AA 3V5EA 5DTPA 3R6HA 3U9RB 4KPKA 2F9YB 5DUFA 3DORA 1EF9A 3L3SA 2C8TA 4KNPA 2A7SA 1OD4A 3Q0JA 3P5MA 4JOTA 2Q35A 2W3PA 4FNBA 1X0UA 4ELXA 4RYFA 5C9GA 2A7KA 4Q1IA 3FDUA 3KTGA 2EJ5A 4HNKA 2VSUA 3TVUA 4K29A 2FBMA 2Q2XA 5FUSA 4JCRA 2F6IA 3H0UA 1UIYA 2VSUF 4JYJA 5KJPA 3BPPA 4QIIA 5KDRB 4G2RA 3ZWBA 3OMEA 2CBYA 4GHNA 3I47A 3LKEA 4F47A 4B3JA 2ZQQA 1HNOA 1ON3A 3TLFA 2ZQRA 1MJ3A 5G1SA 2F9IA 4OMRA 3GF3A 3KTJA 3T89A 1WDMA 3KTIA 1SZOA 3ZWCA 2VSUE 3KTHA 2FW2A 3H0JA 5INFA 3M6NA 3K8XA 4RYFH 4FB8A 4U0HA 3DJAA 4ZDBA 3GLMA 4WYOB 4I42A 3ZWAA 4L8KA 2F6QA 1YG8A 4ZDFA 5C90A 1SG4A 3QK8A 4MI2A 3TDCA 4QFEA 4KD6A 1XO6A 3H0SA 3HP0A 3SLLA 4K2NA 1WDLA 2F9YA 1NZYB 3P2LA 3RRVA 1HZDA 3T8AA 4JSBA 4DI1A 4QIJA 1RJMA 2CE3A 4JWVA 5DTWA 1N6FA 4JFCA 1XX4A 1XNYA 3MOYA 2ZL2A 3QMJA 1EF8A 3QYRA 3GKBA 1N6DA 4ELSA 2A81A 3U9TB 3HINA 3QREA 5E0NX 3Q0GA 2DUBA 4JVTA 3R9SA 3H02A 3OT6A 2VX2A 2J5II 2NP9A 1Q52A 3T8BA 5INIA 3T3WA 1PIXA 2D3TA 3KTKA 3NJBA 3HRXA 3QWDA 1N6EA 3Q7HA 1Q51A 3M6MA 4JJTA 3R0OA 1HNUA 5DU8A 4HC8A 2J5IB 4MXIA 4B3HA 2QQ3A 2PG8A 1PJHA 1DCIA 4OLQA 2J5GA 1UYVA 3GF7A 4FJWD 3BF0A 4MOUA 5CTCA 3TV5A 4JCSA 2GTRA 3MYBA 3ST9A 3STAA 1WDKA 1OD2A 4IZBA 5JBXA 2VSSA 1XNWA 1UYTA
chains in the Genus database with same CATH superfamily
2VSSF 2IEXA 3R9QA 3H81A 4FZWC 5DU4A 5FIFA 4U18A 3VIVA 5DZKH 3N6RB 1K32A 1NZYA 2BZRA 3ISAA 2ZL4A 3BEZA 3SWXA 4B3IA 4JCQA 5DL1A 2J5GD 2X24A 1W2XA 2HW5A 5G1RA 4WCZA 1J7XA 4IZDA 4EMMA 3IB9A 3KQFA 1TG6A 2WTBA 4Z0MA 3QXIA 5E0SA 5INGA 5CTBA 3H0QA 3RSTA 4Q0GA 4OG1A 3TVWA 2PPYA 4EMLA 2VSSE 4I4ZA 1TYFA 4NNQA 3R9TA 1YG6A 5DUCA 3PZKA 4U0GH 5DU6A 3TRRA 5DKPA 1WZ8A 5KDRA 1FC6A 3GMAA 5DZKA 1O8UA 4KWBA 4ZDDA 2J5IA 4FNDA 4L6WA 4NEKA 2UZFA 2FZSA 1RJNA 3ZW8A 1FCFA 4NARA 3TT7A 4ELWA 3QXZA 1UYRA 3ZW9A 2VSUC 4J2UA 2Q34A 1K39A 5MGBA 3TZ3A 5E0SH 3IBBA 1ON9A 2ZL3A 4K3WA 1DUBA 4ZDCA 3RSIA 4EMPA 4GM2A 4FZWA 4U0GA 4FN8A 3BPTA 2F9IB 4LK5A 3JU1A 3MFMA 2VREA 3V5IA 3PEAA 4WZ8B 3MT6A 3U9SB 1FC9A 3PE8A 4JCTA 4FN7A 4ZDEA 4IZCA 3PGQA 4RCNA 1JXZA 3OC7A 4ZU2A 1UYSA 5IKLB 1VRGA 3HLN1 3WG5A 1Y7OA 3IAVA 2ZL0A 3K50A 1EY3A 5G1QA 4ASIA 3LAOA 3TT6A 1XNVA 4YLHA 3T88A 5JBWA 3HE2A 2J5SA 4U19A 2DEOA 2PBPA 4JYLA 3G64A 2X58A 3P85A 1FC7A 4I52A 3NJDA 3QKAA 3FF6A 3Q1TA 4U1AA 3V5EA 5DTPA 3R6HA 3U9RB 4KPKA 2F9YB 5DUFA 3DORA 1EF9A 3L3SA 2C8TA 4KNPA 5HUQA 2A7SA 1OD4A 3Q0JA 3P5MA 4JOTA 2Q35A 2W3PA 4FNBA 1X0UA 4ELXA 4RYFA 5C9GA 2A7KA 4Q1IA 3FDUA 3KTGA 4HDTA 2EJ5A 4HNKA 2VSUA 3TVUA 4K29A 2YJGA 2FBMA 2Q2XA 5FUSA 4JCRA 2F6IA 3H0UA 1UIYA 2VSUF 4JYJA 5KJPA 3BPPA 4QIIA 5KDRB 4G2RA 3ZWBA 3OMEA 2CBYA 4GHNA 3I47A 3LKEA 4F47A 4B3JA 2ZQQA 1HNOA 1ON3A 3TLFA 2ZQRA 1MJ3A 5G1SA 2F9IA 4OMRA 3GF3A 3KTJA 3T89A 1WDMA 3KTIA 1SZOA 3ZWCA 2VSUE 3KTHA 2FW2A 3H0JA 5INFA 3M6NA 3K8XA 4RYFH 4FB8A 4U0HA 3DJAA 4ZDBA 3GLMA 4WYOB 4I42A 3ZWAA 4L8KA 2F6QA 1YG8A 4ZDFA 5C90A 1SG4A 3QK8A 4MI2A 3TDCA 4QFEA 4KD6A 1XO6A 3H0SA 3HP0A 3SLLA 4K2NA 1WDLA 2F9YA 1NZYB 3P2LA 3RRVA 1HZDA 3T8AA 4JSBA 4DI1A 4QIJA 1RJMA 2CE3A 4JWVA 5DTWA 1N6FA 4JFCA 1XX4A 1XNYA 3MOYA 2ZL2A 3QMJA 1EF8A 3QYRA 3GKBA 1N6DA 4ELSA 2A81A 3U9TB 3HINA 3QREA 5E0NX 3Q0GA 2DUBA 4JVTA 3R9SA 3H02A 3OT6A 2VX2A 2J5II 2NP9A 1Q52A 3T8BA 5INIA 3T3WA 1PIXA 2D3TA 3KTKA 3NJBA 3HRXA 3QWDA 1N6EA 3Q7HA 1Q51A 3M6MA 4JJTA 3R0OA 1HNUA 5DU8A 4HC8A 2J5IB 4MXIA 4B3HA 2QQ3A 2PG8A 1PJHA 1DCIA 4OLQA 2J5GA 1UYVA 3GF7A 4FJWD 3BF0A 4MOUA 5CTCA 3TV5A 4JCSA 2GTRA 3MYBA 3ST9A 3STAA 1WDKA 1OD2A 4IZBA 5JBXA 2VSSA 1XNWA 1UYTA
chains in the Genus database with same CATH topology
2VSSF 2IEXA 3R9QA 3H81A 4FZWC 5DU4A 5FIFA 4U18A 3VIVA 5DZKH 3N6RB 1K32A 1NZYA 2BZRA 3ISAA 2ZL4A 3BEZA 3SWXA 4B3IA 4JCQA 5DL1A 2J5GD 2X24A 1W2XA 2HW5A 5G1RA 4WCZA 1J7XA 4IZDA 4EMMA 3IB9A 3KQFA 1TG6A 2WTBA 4Z0MA 3QXIA 5E0SA 5INGA 5CTBA 3H0QA 3RSTA 4Q0GA 4OG1A 3TVWA 2PPYA 4EMLA 2VSSE 4I4ZA 1TYFA 4NNQA 3R9TA 1YG6A 5DUCA 3PZKA 4U0GH 5DU6A 3TRRA 5DKPA 1WZ8A 5KDRA 1FC6A 3GMAA 5DZKA 1O8UA 4KWBA 4ZDDA 2J5IA 4FNDA 4L6WA 4NEKA 2UZFA 2FZSA 1RJNA 3ZW8A 1FCFA 4NARA 3TT7A 4ELWA 3QXZA 1UYRA 3ZW9A 2VSUC 4J2UA 2Q34A 1K39A 5MGBA 3TZ3A 5E0SH 3IBBA 1ON9A 2ZL3A 4K3WA 1DUBA 4ZDCA 3RSIA 4EMPA 4GM2A 4FZWA 4U0GA 4FN8A 3BPTA 2F9IB 4LK5A 3JU1A 3MFMA 2VREA 3V5IA 3PEAA 4WZ8B 3MT6A 3U9SB 1FC9A 3PE8A 4JCTA 4FN7A 4ZDEA 4IZCA 3PGQA 4RCNA 1JXZA 3OC7A 4ZU2A 1UYSA 5IKLB 1VRGA 3HLN1 3WG5A 1Y7OA 3IAVA 2ZL0A 3K50A 1EY3A 5G1QA 4ASIA 3LAOA 3TT6A 1XNVA 4YLHA 3T88A 5JBWA 3HE2A 2J5SA 4U19A 2DEOA 2PBPA 4JYLA 3G64A 2X58A 3P85A 1FC7A 4I52A 3NJDA 3QKAA 3FF6A 3Q1TA 4U1AA 3V5EA 5DTPA 3R6HA 3U9RB 4KPKA 2F9YB 5DUFA 3DORA 1EF9A 3L3SA 2C8TA 4KNPA 5HUQA 2A7SA 1OD4A 3Q0JA 3P5MA 4JOTA 2Q35A 2W3PA 4FNBA 1X0UA 4ELXA 4RYFA 5C9GA 2A7KA 4Q1IA 3FDUA 3KTGA 4HDTA 2EJ5A 4HNKA 2VSUA 3TVUA 4K29A 2YJGA 2FBMA 2Q2XA 5FUSA 4JCRA 2F6IA 3H0UA 1UIYA 2VSUF 4JYJA 5KJPA 3BPPA 4QIIA 5KDRB 4G2RA 3ZWBA 3OMEA 2CBYA 4GHNA 3I47A 3LKEA 4F47A 4B3JA 2ZQQA 1HNOA 1ON3A 3TLFA 2ZQRA 1MJ3A 5G1SA 2F9IA 4OMRA 3GF3A 3KTJA 3T89A 1WDMA 3KTIA 1SZOA 3ZWCA 2VSUE 3KTHA 2FW2A 3H0JA 5INFA 3M6NA 3K8XA 4RYFH 4FB8A 4U0HA 3DJAA 4ZDBA 3GLMA 4WYOB 4I42A 3ZWAA 4L8KA 2F6QA 1YG8A 4ZDFA 5C90A 1SG4A 3QK8A 4MI2A 3TDCA 4QFEA 4KD6A 1XO6A 3H0SA 3HP0A 3SLLA 4K2NA 1WDLA 2F9YA 1NZYB 3P2LA 3RRVA 1HZDA 3T8AA 4JSBA 4DI1A 4QIJA 1RJMA 2CE3A 4JWVA 5DTWA 1N6FA 4JFCA 1XX4A 1XNYA 3MOYA 2ZL2A 3QMJA 1EF8A 3QYRA 3GKBA 1N6DA 4ELSA 2A81A 3U9TB 3HINA 3QREA 5E0NX 3Q0GA 2DUBA 4JVTA 3R9SA 3H02A 3OT6A 2VX2A 2J5II 2NP9A 1Q52A 3T8BA 5INIA 3T3WA 1PIXA 2D3TA 3KTKA 3NJBA 3HRXA 3QWDA 1N6EA 3Q7HA 1Q51A 3M6MA 4JJTA 3R0OA 1HNUA 5DU8A 4HC8A 2J5IB 4MXIA 4B3HA 2QQ3A 2PG8A 1PJHA 1DCIA 4OLQA 2J5GA 1UYVA 3GF7A 4FJWD 3BF0A 4MOUA 5CTCA 3TV5A 4JCSA 2GTRA 3MYBA 3ST9A 3STAA 1WDKA 1OD2A 4IZBA 5JBXA 2VSSA 1XNWA 1UYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSS F;  2IEX A;  3R9Q A;  3H81 A;  4FZW C;  5DU4 A;  5FIF A;  4U18 A;  3VIV A;  5DZK H;  3N6R B;  1K32 A;  1NZY A;  2BZR A;  3ISA A;  2ZL4 A;  3BEZ A;  3SWX A;  4B3I A;  4JCQ A;  5DL1 A;  2J5G D;  2X24 A;  1W2X A;  2HW5 A;  5G1R A;  4WCZ A;  1J7X A;  4IZD A;  4EMM A;  3IB9 A;  3KQF A;  1TG6 A;  2WTB A;  4Z0M A;  3QXI A;  5E0S A;  5ING A;  5CTB A;  3H0Q A;  3RST A;  4Q0G A;  4OG1 A;  3TVW A;  2PPY A;  4EML A;  2VSS E;  4I4Z A;  1TYF A;  4NNQ A;  3R9T A;  1YG6 A;  5DUC A;  3PZK A;  4U0G H;  5DU6 A;  3TRR A;  5DKP A;  1WZ8 A;  5KDR A;  1FC6 A;  3GMA A;  5DZK A;  1O8U A;  4KWB A;  4ZDD A;  2J5I A;  4FND A;  4L6W A;  4NEK A;  2UZF A;  2FZS A;  1RJN A;  3ZW8 A;  1FCF A;  3TT7 A;  4ELW A;  3QXZ A;  1UYR A;  3ZW9 A;  2VSU C;  2Q34 A;  1K39 A;  5MGB A;  3TZ3 A;  5E0S H;  3IBB A;  1ON9 A;  2ZL3 A;  4K3W A;  1DUB A;  4ZDC A;  3RSI A;  4EMP A;  4GM2 A;  4FZW A;  4U0G A;  4FN8 A;  2F9I B;  4LK5 A;  3JU1 A;  3MFM A;  2VRE A;  3V5I A;  3PEA A;  4WZ8 B;  3MT6 A;  3U9S B;  1FC9 A;  3PE8 A;  4JCT A;  4FN7 A;  4ZDE A;  4IZC A;  3PGQ A;  4RCN A;  1JXZ A;  3OC7 A;  4ZU2 A;  1UYS A;  5IKL B;  1VRG A;  3HLN 1;  3WG5 A;  1Y7O A;  3IAV A;  2ZL0 A;  3K50 A;  1EY3 A;  5G1Q A;  4ASI A;  3LAO A;  3TT6 A;  1XNV A;  4YLH A;  3T88 A;  5JBW A;  3HE2 A;  2J5S A;  4U19 A;  2DEO A;  2PBP A;  4JYL A;  3G64 A;  2X58 A;  3P85 A;  1FC7 A;  4I52 A;  3NJD A;  3QKA A;  3FF6 A;  3Q1T A;  4U1A A;  3V5E A;  5DTP A;  3R6H A;  3U9R B;  4KPK A;  2F9Y B;  5DUF A;  3DOR A;  1EF9 A;  3L3S A;  2C8T A;  4KNP A;  2A7S A;  1OD4 A;  3Q0J A;  3P5M A;  4JOT A;  2Q35 A;  2W3P A;  4FNB A;  1X0U A;  4ELX A;  4RYF A;  5C9G A;  2A7K A;  4Q1I A;  3FDU A;  3KTG A;  2EJ5 A;  4HNK A;  2VSU A;  3TVU A;  4K29 A;  2FBM A;  2Q2X A;  5FUS A;  4JCR A;  2F6I A;  3H0U A;  1UIY A;  2VSU F;  4JYJ A;  5KJP A;  3BPP A;  4QII A;  5KDR B;  4G2R A;  3ZWB A;  3OME A;  2CBY A;  4GHN A;  3I47 A;  3LKE A;  4F47 A;  4B3J A;  2ZQQ A;  1HNO A;  1ON3 A;  3TLF A;  2ZQR A;  1MJ3 A;  5G1S A;  2F9I A;  4OMR A;  3GF3 A;  3KTJ A;  3T89 A;  1WDM A;  3KTI A;  1SZO A;  3ZWC A;  2VSU E;  3KTH A;  2FW2 A;  3H0J A;  5INF A;  3M6N A;  3K8X A;  4RYF H;  4FB8 A;  4U0H A;  3DJA A;  4ZDB A;  3GLM A;  4WYO B;  4I42 A;  3ZWA A;  4L8K A;  2F6Q A;  1YG8 A;  4ZDF A;  5C90 A;  1SG4 A;  3QK8 A;  4MI2 A;  3TDC A;  4QFE A;  4KD6 A;  1XO6 A;  3H0S A;  3HP0 A;  3SLL A;  4K2N A;  1WDL A;  2F9Y A;  1NZY B;  3P2L A;  3RRV A;  1HZD A;  3T8A A;  4JSB A;  4DI1 A;  4QIJ A;  1RJM A;  2CE3 A;  4JWV A;  5DTW A;  1N6F A;  4JFC A;  1XX4 A;  1XNY A;  3MOY A;  2ZL2 A;  3QMJ A;  1EF8 A;  3QYR A;  3GKB A;  1N6D A;  4ELS A;  2A81 A;  3U9T B;  3HIN A;  3QRE A;  5E0N X;  3Q0G A;  2DUB A;  4JVT A;  3R9S A;  3H02 A;  3OT6 A;  2VX2 A;  2J5I I;  2NP9 A;  1Q52 A;  3T8B A;  5INI A;  3T3W A;  1PIX A;  2D3T A;  3KTK A;  3NJB A;  3HRX A;  3QWD A;  1N6E A;  3Q7H A;  1Q51 A;  3M6M A;  4JJT A;  3R0O A;  1HNU A;  5DU8 A;  4HC8 A;  2J5I B;  4MXI A;  4B3H A;  2QQ3 A;  2PG8 A;  1PJH A;  1DCI A;  4OLQ A;  2J5G A;  1UYV A;  3GF7 A;  4FJW D;  3BF0 A;  4MOU A;  5CTC A;  3TV5 A;  4JCS A;  2GTR A;  3MYB A;  3ST9 A;  3STA A;  1WDK A;  1OD2 A;  4IZB A;  5JBX A;  2VSS A;  1XNW A;  1UYT A; 
#chains in the Genus database with same CATH topology
 2VSS F;  2IEX A;  3R9Q A;  3H81 A;  4FZW C;  5DU4 A;  5FIF A;  4U18 A;  3VIV A;  5DZK H;  3N6R B;  1K32 A;  1NZY A;  2BZR A;  3ISA A;  2ZL4 A;  3BEZ A;  3SWX A;  4B3I A;  4JCQ A;  5DL1 A;  2J5G D;  2X24 A;  1W2X A;  2HW5 A;  5G1R A;  4WCZ A;  1J7X A;  4IZD A;  4EMM A;  3IB9 A;  3KQF A;  1TG6 A;  2WTB A;  4Z0M A;  3QXI A;  5E0S A;  5ING A;  5CTB A;  3H0Q A;  3RST A;  4Q0G A;  4OG1 A;  3TVW A;  2PPY A;  4EML A;  2VSS E;  4I4Z A;  1TYF A;  4NNQ A;  3R9T A;  1YG6 A;  5DUC A;  3PZK A;  4U0G H;  5DU6 A;  3TRR A;  5DKP A;  1WZ8 A;  5KDR A;  1FC6 A;  3GMA A;  5DZK A;  1O8U A;  4KWB A;  4ZDD A;  2J5I A;  4FND A;  4L6W A;  4NEK A;  2UZF A;  2FZS A;  1RJN A;  3ZW8 A;  1FCF A;  4NAR A;  3TT7 A;  4ELW A;  3QXZ A;  1UYR A;  3ZW9 A;  2VSU C;  4J2U A;  2Q34 A;  1K39 A;  5MGB A;  3TZ3 A;  5E0S H;  3IBB A;  1ON9 A;  2ZL3 A;  4K3W A;  1DUB A;  4ZDC A;  3RSI A;  4EMP A;  4GM2 A;  4FZW A;  4U0G A;  4FN8 A;  3BPT A;  2F9I B;  4LK5 A;  3JU1 A;  3MFM A;  2VRE A;  3V5I A;  3PEA A;  4WZ8 B;  3MT6 A;  3U9S B;  1FC9 A;  3PE8 A;  4JCT A;  4FN7 A;  4ZDE A;  4IZC A;  3PGQ A;  4RCN A;  1JXZ A;  3OC7 A;  4ZU2 A;  1UYS A;  5IKL B;  1VRG A;  3HLN 1;  3WG5 A;  1Y7O A;  3IAV A;  2ZL0 A;  3K50 A;  1EY3 A;  5G1Q A;  4ASI A;  3LAO A;  3TT6 A;  1XNV A;  4YLH A;  3T88 A;  5JBW A;  3HE2 A;  2J5S A;  4U19 A;  2DEO A;  2PBP A;  4JYL A;  3G64 A;  2X58 A;  3P85 A;  1FC7 A;  4I52 A;  3NJD A;  3QKA A;  3FF6 A;  3Q1T A;  4U1A A;  3V5E A;  5DTP A;  3R6H A;  3U9R B;  4KPK A;  2F9Y B;  5DUF A;  3DOR A;  1EF9 A;  3L3S A;  2C8T A;  4KNP A;  5HUQ A;  2A7S A;  1OD4 A;  3Q0J A;  3P5M A;  4JOT A;  2Q35 A;  2W3P A;  4FNB A;  1X0U A;  4ELX A;  4RYF A;  5C9G A;  2A7K A;  4Q1I A;  3FDU A;  3KTG A;  4HDT A;  2EJ5 A;  4HNK A;  2VSU A;  3TVU A;  4K29 A;  2YJG A;  2FBM A;  2Q2X A;  5FUS A;  4JCR A;  2F6I A;  3H0U A;  1UIY A;  2VSU F;  4JYJ A;  5KJP A;  3BPP A;  4QII A;  5KDR B;  4G2R A;  3ZWB A;  3OME A;  2CBY A;  4GHN A;  3I47 A;  3LKE A;  4F47 A;  4B3J A;  2ZQQ A;  1HNO A;  1ON3 A;  3TLF A;  2ZQR A;  1MJ3 A;  5G1S A;  2F9I A;  4OMR A;  3GF3 A;  3KTJ A;  3T89 A;  1WDM A;  3KTI A;  1SZO A;  3ZWC A;  2VSU E;  3KTH A;  2FW2 A;  3H0J A;  5INF A;  3M6N A;  3K8X A;  4RYF H;  4FB8 A;  4U0H A;  3DJA A;  4ZDB A;  3GLM A;  4WYO B;  4I42 A;  3ZWA A;  4L8K A;  2F6Q A;  1YG8 A;  4ZDF A;  5C90 A;  1SG4 A;  3QK8 A;  4MI2 A;  3TDC A;  4QFE A;  4KD6 A;  1XO6 A;  3H0S A;  3HP0 A;  3SLL A;  4K2N A;  1WDL A;  2F9Y A;  1NZY B;  3P2L A;  3RRV A;  1HZD A;  3T8A A;  4JSB A;  4DI1 A;  4QIJ A;  1RJM A;  2CE3 A;  4JWV A;  5DTW A;  1N6F A;  4JFC A;  1XX4 A;  1XNY A;  3MOY A;  2ZL2 A;  3QMJ A;  1EF8 A;  3QYR A;  3GKB A;  1N6D A;  4ELS A;  2A81 A;  3U9T B;  3HIN A;  3QRE A;  5E0N X;  3Q0G A;  2DUB A;  4JVT A;  3R9S A;  3H02 A;  3OT6 A;  2VX2 A;  2J5I I;  2NP9 A;  1Q52 A;  3T8B A;  5INI A;  3T3W A;  1PIX A;  2D3T A;  3KTK A;  3NJB A;  3HRX A;  3QWD A;  1N6E A;  3Q7H A;  1Q51 A;  3M6M A;  4JJT A;  3R0O A;  1HNU A;  5DU8 A;  4HC8 A;  2J5I B;  4MXI A;  4B3H A;  2QQ3 A;  2PG8 A;  1PJH A;  1DCI A;  4OLQ A;  2J5G A;  1UYV A;  3GF7 A;  4FJW D;  3BF0 A;  4MOU A;  5CTC A;  3TV5 A;  4JCS A;  2GTR A;  3MYB A;  3ST9 A;  3STA A;  1WDK A;  1OD2 A;  4IZB A;  5JBX A;  2VSS A;  1XNW A;  1UYT A; 
#chains in the Genus database with same CATH homology
 2VSS F;  2IEX A;  3R9Q A;  3H81 A;  4FZW C;  5DU4 A;  5FIF A;  4U18 A;  3VIV A;  5DZK H;  3N6R B;  1K32 A;  1NZY A;  2BZR A;  3ISA A;  2ZL4 A;  3BEZ A;  3SWX A;  4B3I A;  4JCQ A;  5DL1 A;  2J5G D;  2X24 A;  1W2X A;  2HW5 A;  5G1R A;  4WCZ A;  1J7X A;  4IZD A;  4EMM A;  3IB9 A;  3KQF A;  1TG6 A;  2WTB A;  4Z0M A;  3QXI A;  5E0S A;  5ING A;  5CTB A;  3H0Q A;  3RST A;  4Q0G A;  4OG1 A;  3TVW A;  2PPY A;  4EML A;  2VSS E;  4I4Z A;  1TYF A;  4NNQ A;  3R9T A;  1YG6 A;  5DUC A;  3PZK A;  4U0G H;  5DU6 A;  3TRR A;  5DKP A;  1WZ8 A;  5KDR A;  1FC6 A;  3GMA A;  5DZK A;  1O8U A;  4KWB A;  4ZDD A;  2J5I A;  4FND A;  4L6W A;  4NEK A;  2UZF A;  2FZS A;  1RJN A;  3ZW8 A;  1FCF A;  4NAR A;  3TT7 A;  4ELW A;  3QXZ A;  1UYR A;  3ZW9 A;  2VSU C;  4J2U A;  2Q34 A;  1K39 A;  5MGB A;  3TZ3 A;  5E0S H;  3IBB A;  1ON9 A;  2ZL3 A;  4K3W A;  1DUB A;  4ZDC A;  3RSI A;  4EMP A;  4GM2 A;  4FZW A;  4U0G A;  4FN8 A;  3BPT A;  2F9I B;  4LK5 A;  3JU1 A;  3MFM A;  2VRE A;  3V5I A;  3PEA A;  4WZ8 B;  3MT6 A;  3U9S B;  1FC9 A;  3PE8 A;  4JCT A;  4FN7 A;  4ZDE A;  4IZC A;  3PGQ A;  4RCN A;  1JXZ A;  3OC7 A;  4ZU2 A;  1UYS A;  5IKL B;  1VRG A;  3HLN 1;  3WG5 A;  1Y7O A;  3IAV A;  2ZL0 A;  3K50 A;  1EY3 A;  5G1Q A;  4ASI A;  3LAO A;  3TT6 A;  1XNV A;  4YLH A;  3T88 A;  5JBW A;  3HE2 A;  2J5S A;  4U19 A;  2DEO A;  2PBP A;  4JYL A;  3G64 A;  2X58 A;  3P85 A;  1FC7 A;  4I52 A;  3NJD A;  3QKA A;  3FF6 A;  3Q1T A;  4U1A A;  3V5E A;  5DTP A;  3R6H A;  3U9R B;  4KPK A;  2F9Y B;  5DUF A;  3DOR A;  1EF9 A;  3L3S A;  2C8T A;  4KNP A;  5HUQ A;  2A7S A;  1OD4 A;  3Q0J A;  3P5M A;  4JOT A;  2Q35 A;  2W3P A;  4FNB A;  1X0U A;  4ELX A;  4RYF A;  5C9G A;  2A7K A;  4Q1I A;  3FDU A;  3KTG A;  4HDT A;  2EJ5 A;  4HNK A;  2VSU A;  3TVU A;  4K29 A;  2YJG A;  2FBM A;  2Q2X A;  5FUS A;  4JCR A;  2F6I A;  3H0U A;  1UIY A;  2VSU F;  4JYJ A;  5KJP A;  3BPP A;  4QII A;  5KDR B;  4G2R A;  3ZWB A;  3OME A;  2CBY A;  4GHN A;  3I47 A;  3LKE A;  4F47 A;  4B3J A;  2ZQQ A;  1HNO A;  1ON3 A;  3TLF A;  2ZQR A;  1MJ3 A;  5G1S A;  2F9I A;  4OMR A;  3GF3 A;  3KTJ A;  3T89 A;  1WDM A;  3KTI A;  1SZO A;  3ZWC A;  2VSU E;  3KTH A;  2FW2 A;  3H0J A;  5INF A;  3M6N A;  3K8X A;  4RYF H;  4FB8 A;  4U0H A;  3DJA A;  4ZDB A;  3GLM A;  4WYO B;  4I42 A;  3ZWA A;  4L8K A;  2F6Q A;  1YG8 A;  4ZDF A;  5C90 A;  1SG4 A;  3QK8 A;  4MI2 A;  3TDC A;  4QFE A;  4KD6 A;  1XO6 A;  3H0S A;  3HP0 A;  3SLL A;  4K2N A;  1WDL A;  2F9Y A;  1NZY B;  3P2L A;  3RRV A;  1HZD A;  3T8A A;  4JSB A;  4DI1 A;  4QIJ A;  1RJM A;  2CE3 A;  4JWV A;  5DTW A;  1N6F A;  4JFC A;  1XX4 A;  1XNY A;  3MOY A;  2ZL2 A;  3QMJ A;  1EF8 A;  3QYR A;  3GKB A;  1N6D A;  4ELS A;  2A81 A;  3U9T B;  3HIN A;  3QRE A;  5E0N X;  3Q0G A;  2DUB A;  4JVT A;  3R9S A;  3H02 A;  3OT6 A;  2VX2 A;  2J5I I;  2NP9 A;  1Q52 A;  3T8B A;  5INI A;  3T3W A;  1PIX A;  2D3T A;  3KTK A;  3NJB A;  3HRX A;  3QWD A;  1N6E A;  3Q7H A;  1Q51 A;  3M6M A;  4JJT A;  3R0O A;  1HNU A;  5DU8 A;  4HC8 A;  2J5I B;  4MXI A;  4B3H A;  2QQ3 A;  2PG8 A;  1PJH A;  1DCI A;  4OLQ A;  2J5G A;  1UYV A;  3GF7 A;  4FJW D;  3BF0 A;  4MOU A;  5CTC A;  3TV5 A;  4JCS A;  2GTR A;  3MYB A;  3ST9 A;  3STA A;  1WDK A;  1OD2 A;  4IZB A;  5JBX A;  2VSS A;  1XNW A;  1UYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...