4ZDDA

Structure of yeast d3,d2-enoyl-coa isomerase bound to sulphate ion
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
247
Chain Sequence
QNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKTSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords 3,2-trans-enoyl-CoA isomerase
total genus 92
structure length 247
sequence length 263
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zddA00
4RCNA 4K3WA 4JOTA 4KWBA 3MFMA 3TV5A 3K8XA 4NEKA 4B3JA 2HW5A 3GMAA 3H0UA 1UYSA 5DU8A 1EF8A 1EF9A 3QXIA 4KNPA 4MOUA 4LK5A 4JYLA 2F6IA 1J7XA 3Q1TA 3HE2A 3RSIA 3IAVA 2NP9A 3KTJA 4L8KA 3R9TA 4DI1A 1O8UA 4JJTA 2FW2A 3FF6A 4HC8A 1HZDA 1Y7OA 1W2XA 4QIIA 4OMRA 3TLFA 1XNYA 2F9YA 4EMPA 1RJMA 5DL1A 5JBXA 3TRRA 2J5GD 3OC7A 5DU4A 2W3PA 5C9GA 3H81A 3DJAA 3WG5A 2DEOA 1UYRA 5FUSA 4FB8A 3U9TB 2VSSF 4FZWC 4JVTA 3ZWCA 1RJNA 4U19A 2VSUE 2J5GA 5DTPA 2J5IA 1YG6A 3SWXA 2PG8A 3RRVA 2FZSA 5CTCA 3IB9A 3TT6A 2CE3A 2D3TA 3TDCA 2F9IB 1WDKA 4JFCA 1Q52A 4L6WA 4GM2A 1HNUA 3QREA 5G1RA 2X58A 4GHNA 3T89A 1K32A 4IZDA 1OD4A 2A7KA 5INIA 3ISAA 4ZU2A 4JCSA 2VSUC 4ELXA 3BEZA 2F9YB 3GF7A 5INGA 4WCZA 4WZ8B 2UZFA 5IKLB 2FBMA 3ZW9A 3KTKA 3P5MA 3KTIA 5E0SA 2VX2A 1N6EA 3HLN1 5MGBA 4MI2A 4QFEA 3PEAA 1X0UA 2VSUF 5KJPA 3KTHA 4ZDCA 3MT6A 4FN7A 4ZDEA 3H02A 3LAOA 3VIVA 5E0NX 1SG4A 2ZQQA 3Q0JA 5E0SH 1JXZA 3TVWA 4Z0MA 3MYBA 3HRXA 3DORA 2F9IA 1FC6A 4ZDDA 3T8AA 3QYRA 1XO6A 4I52A 3QWDA 3R6HA 5KDRB 3QMJA 2X24A 3P2LA 4JCTA 2J5II 3OMEA 4WYOB 4K2NA 2C8TA 2VSSE 3ZW8A 1HNOA 3LKEA 5JBWA 3GKBA 4KD6A 4FNBA 2ZQRA 3TT7A 4F47A 2A81A 3HP0A 4Q1IA 4Q0GA 3ZWBA 1ON3A 2ZL2A 4FZWA 4YLHA 1UIYA 3MOYA 4U18A 1XNVA 3IBBA 2IEXA 3STAA 3U9RB 4KPKA 1OD2A 3JU1A 4K29A 4JCQA 4IZBA 4FJWD 2EJ5A 4B3IA 3HINA 4QIJA 4IZCA 3U9SB 3I47A 4OG1A 5INFA 1WDLA 4JYJA 1XNWA 3H0JA 2ZL3A 2PPYA 1TG6A 3GF3A 1N6FA 4RYFH 3TZ3A 1WDMA 4ELSA 4JCRA 2VREA 3T3WA 1N6DA 4U0HA 5G1SA 2J5SA 3L3SA 3V5IA 5C90A 1MJ3A 5DZKA 3H0QA 3BF0A 4ZDBA 3R9SA 1K39A 3G64A 2BZRA 5FIFA 4RYFA 4NNQA 5KDRA 4U0GA 2DUBA 1PIXA 4I42A 2Q35A 1UYTA 2WTBA 3PE8A 1NZYB 1DUBA 3M6MA 4FNDA 2ZL0A 5DKPA 2PBPA 3Q7HA 5DUFA 2CBYA 4JSBA 3R0OA 3SLLA 3ST9A 1DCIA 4ZDFA 5DZKH 3R9QA 1PJHA 1NZYA 1WZ8A 1FCFA 4ELWA 1FC9A 4B3HA 1VRGA 3PZKA 3T8BA 2QQ3A 1EY3A 2VSUA 3T88A 3H0SA 1SZOA 4OLQA 5G1QA 4EMMA 3ZWAA 3BPPA 1Q51A 5CTBA 3QKAA 3NJBA 3V5EA 2F6QA 4MXIA 3PGQA 3KTGA 1ON9A 4HNKA 5DUCA 4I4ZA 3QXZA 3TVUA 4FN8A 3NJDA 3P85A 1FC7A 3KQFA 3FDUA 4G2RA 3K50A 1XX4A 2Q2XA 5DU6A 3GLMA 4JWVA 4U0GH 4ASIA 1YG8A 1TYFA 5DTWA 2GTRA 3Q0GA 1UYVA 4EMLA 3M6NA 3QK8A 2VSSA 4U1AA 3N6RB 3RSTA 2Q34A 2A7SA 2J5IB 2ZL4A 3OT6A
chains in the Genus database with same CATH superfamily
4RCNA 4K3WA 4JOTA 4KWBA 3MFMA 3TV5A 3K8XA 4NARA 4NEKA 3BPTA 4B3JA 2HW5A 3GMAA 3H0UA 1UYSA 5DU8A 1EF8A 1EF9A 3QXIA 4KNPA 4MOUA 4LK5A 4JYLA 2F6IA 1J7XA 3Q1TA 3HE2A 3RSIA 3IAVA 2NP9A 3KTJA 4L8KA 3R9TA 4DI1A 1O8UA 4JJTA 2FW2A 3FF6A 4HC8A 1HZDA 1Y7OA 1W2XA 4QIIA 4OMRA 3TLFA 1XNYA 2F9YA 4EMPA 1RJMA 5DL1A 5JBXA 3TRRA 2J5GD 3OC7A 5DU4A 2W3PA 5C9GA 3H81A 3DJAA 3WG5A 2DEOA 1UYRA 5FUSA 4FB8A 3U9TB 2VSSF 4FZWC 4JVTA 3ZWCA 1RJNA 4U19A 2VSUE 2J5GA 5DTPA 2J5IA 1YG6A 3SWXA 2PG8A 3RRVA 2FZSA 5CTCA 3IB9A 3TT6A 2CE3A 2D3TA 2YJGA 3TDCA 2F9IB 1WDKA 4JFCA 1Q52A 4L6WA 4GM2A 1HNUA 3QREA 5G1RA 2X58A 4GHNA 3T89A 1K32A 4IZDA 1OD4A 2A7KA 5INIA 3ISAA 4ZU2A 4JCSA 2VSUC 4ELXA 3BEZA 2F9YB 3GF7A 5INGA 4WCZA 4WZ8B 2UZFA 5IKLB 2FBMA 3ZW9A 3KTKA 3P5MA 3KTIA 5E0SA 2VX2A 1N6EA 3HLN1 5MGBA 4MI2A 4QFEA 3PEAA 1X0UA 2VSUF 5KJPA 3KTHA 4ZDCA 3MT6A 4FN7A 4ZDEA 3H02A 3LAOA 3VIVA 5E0NX 1SG4A 2ZQQA 3Q0JA 5E0SH 1JXZA 3TVWA 4Z0MA 3MYBA 3HRXA 3DORA 2F9IA 1FC6A 4ZDDA 3T8AA 3QYRA 1XO6A 4I52A 3QWDA 3R6HA 5KDRB 3QMJA 2X24A 3P2LA 4JCTA 2J5II 3OMEA 4WYOB 4K2NA 2C8TA 2VSSE 3ZW8A 1HNOA 3LKEA 5JBWA 3GKBA 4KD6A 4FNBA 2ZQRA 3TT7A 4F47A 2A81A 3HP0A 4Q1IA 4Q0GA 3ZWBA 1ON3A 4J2UA 2ZL2A 4FZWA 4YLHA 1UIYA 3MOYA 4U18A 1XNVA 3IBBA 2IEXA 3STAA 3U9RB 4KPKA 1OD2A 3JU1A 4K29A 4JCQA 4IZBA 4FJWD 2EJ5A 4B3IA 3HINA 4QIJA 4IZCA 3U9SB 3I47A 4OG1A 5INFA 1WDLA 4JYJA 1XNWA 3H0JA 2ZL3A 2PPYA 5HUQA 1TG6A 3GF3A 1N6FA 4RYFH 3TZ3A 1WDMA 4ELSA 4JCRA 2VREA 3T3WA 1N6DA 4U0HA 5G1SA 2J5SA 3L3SA 3V5IA 5C90A 1MJ3A 5DZKA 3H0QA 3BF0A 4ZDBA 3R9SA 1K39A 3G64A 2BZRA 5FIFA 4RYFA 4NNQA 5KDRA 4U0GA 2DUBA 1PIXA 4I42A 2Q35A 1UYTA 2WTBA 3PE8A 1NZYB 1DUBA 3M6MA 4FNDA 2ZL0A 5DKPA 2PBPA 3Q7HA 5DUFA 2CBYA 4JSBA 3R0OA 3SLLA 3ST9A 1DCIA 4ZDFA 5DZKH 3R9QA 1PJHA 1NZYA 1WZ8A 1FCFA 4ELWA 1FC9A 4B3HA 1VRGA 3PZKA 3T8BA 2QQ3A 1EY3A 2VSUA 3T88A 3H0SA 1SZOA 4OLQA 5G1QA 4EMMA 3ZWAA 3BPPA 1Q51A 5CTBA 3QKAA 3NJBA 3V5EA 2F6QA 4MXIA 3PGQA 3KTGA 1ON9A 4HNKA 5DUCA 4I4ZA 3QXZA 3TVUA 4FN8A 3NJDA 3P85A 1FC7A 3KQFA 3FDUA 4G2RA 3K50A 1XX4A 2Q2XA 5DU6A 3GLMA 4JWVA 4U0GH 4ASIA 1YG8A 1TYFA 5DTWA 2GTRA 3Q0GA 1UYVA 4EMLA 3M6NA 3QK8A 2VSSA 4U1AA 3N6RB 3RSTA 2Q34A 2A7SA 2J5IB 4HDTA 2ZL4A 3OT6A
chains in the Genus database with same CATH topology
4RCNA 4K3WA 4JOTA 4KWBA 3MFMA 3TV5A 3K8XA 4NARA 4NEKA 3BPTA 4B3JA 2HW5A 3GMAA 3H0UA 1UYSA 5DU8A 1EF8A 1EF9A 3QXIA 4KNPA 4MOUA 4LK5A 4JYLA 2F6IA 1J7XA 3Q1TA 3HE2A 3RSIA 3IAVA 2NP9A 3KTJA 4L8KA 3R9TA 4DI1A 1O8UA 4JJTA 2FW2A 3FF6A 4HC8A 1HZDA 1Y7OA 1W2XA 4QIIA 4OMRA 3TLFA 1XNYA 2F9YA 4EMPA 1RJMA 5DL1A 5JBXA 3TRRA 2J5GD 3OC7A 5DU4A 2W3PA 5C9GA 3H81A 3DJAA 3WG5A 2DEOA 1UYRA 5FUSA 4FB8A 3U9TB 2VSSF 4FZWC 4JVTA 3ZWCA 1RJNA 4U19A 2VSUE 2J5GA 5DTPA 2J5IA 1YG6A 3SWXA 2PG8A 3RRVA 2FZSA 5CTCA 3IB9A 3TT6A 2CE3A 2D3TA 2YJGA 3TDCA 2F9IB 1WDKA 4JFCA 1Q52A 4L6WA 4GM2A 1HNUA 3QREA 5G1RA 2X58A 4GHNA 3T89A 1K32A 4IZDA 1OD4A 2A7KA 5INIA 3ISAA 4ZU2A 4JCSA 2VSUC 4ELXA 3BEZA 2F9YB 3GF7A 5INGA 4WCZA 4WZ8B 2UZFA 5IKLB 2FBMA 3ZW9A 3KTKA 3P5MA 3KTIA 5E0SA 2VX2A 1N6EA 3HLN1 5MGBA 4MI2A 4QFEA 3PEAA 1X0UA 2VSUF 5KJPA 3KTHA 4ZDCA 3MT6A 4FN7A 4ZDEA 3H02A 3LAOA 3VIVA 5E0NX 1SG4A 2ZQQA 3Q0JA 5E0SH 1JXZA 3TVWA 4Z0MA 3MYBA 3HRXA 3DORA 2F9IA 1FC6A 4ZDDA 3T8AA 3QYRA 1XO6A 4I52A 3QWDA 3R6HA 5KDRB 3QMJA 2X24A 3P2LA 4JCTA 2J5II 3OMEA 4WYOB 4K2NA 2C8TA 2VSSE 3ZW8A 1HNOA 3LKEA 5JBWA 3GKBA 4KD6A 4FNBA 2ZQRA 3TT7A 4F47A 2A81A 3HP0A 4Q1IA 4Q0GA 3ZWBA 1ON3A 4J2UA 2ZL2A 4FZWA 4YLHA 1UIYA 3MOYA 4U18A 1XNVA 3IBBA 2IEXA 3STAA 3U9RB 4KPKA 1OD2A 3JU1A 4K29A 4JCQA 4IZBA 4FJWD 2EJ5A 4B3IA 3HINA 4QIJA 4IZCA 3U9SB 3I47A 4OG1A 5INFA 1WDLA 4JYJA 1XNWA 3H0JA 2ZL3A 2PPYA 5HUQA 1TG6A 3GF3A 1N6FA 4RYFH 3TZ3A 1WDMA 4ELSA 4JCRA 2VREA 3T3WA 1N6DA 4U0HA 5G1SA 2J5SA 3L3SA 3V5IA 5C90A 1MJ3A 5DZKA 3H0QA 3BF0A 4ZDBA 3R9SA 1K39A 3G64A 2BZRA 5FIFA 4RYFA 4NNQA 5KDRA 4U0GA 2DUBA 1PIXA 4I42A 2Q35A 1UYTA 2WTBA 3PE8A 1NZYB 1DUBA 3M6MA 4FNDA 2ZL0A 5DKPA 2PBPA 3Q7HA 5DUFA 2CBYA 4JSBA 3R0OA 3SLLA 3ST9A 1DCIA 4ZDFA 5DZKH 3R9QA 1PJHA 1NZYA 1WZ8A 1FCFA 4ELWA 1FC9A 4B3HA 1VRGA 3PZKA 3T8BA 2QQ3A 1EY3A 2VSUA 3T88A 3H0SA 1SZOA 4OLQA 5G1QA 4EMMA 3ZWAA 3BPPA 1Q51A 5CTBA 3QKAA 3NJBA 3V5EA 2F6QA 4MXIA 3PGQA 3KTGA 1ON9A 4HNKA 5DUCA 4I4ZA 3QXZA 3TVUA 4FN8A 3NJDA 3P85A 1FC7A 3KQFA 3FDUA 4G2RA 3K50A 1XX4A 2Q2XA 5DU6A 3GLMA 4JWVA 4U0GH 4ASIA 1YG8A 1TYFA 5DTWA 2GTRA 3Q0GA 1UYVA 4EMLA 3M6NA 3QK8A 2VSSA 4U1AA 3N6RB 3RSTA 2Q34A 2A7SA 2J5IB 4HDTA 2ZL4A 3OT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCN A;  4K3W A;  4JOT A;  4KWB A;  3MFM A;  3TV5 A;  3K8X A;  4NEK A;  4B3J A;  2HW5 A;  3GMA A;  3H0U A;  1UYS A;  5DU8 A;  1EF8 A;  1EF9 A;  3QXI A;  4KNP A;  4MOU A;  4LK5 A;  4JYL A;  2F6I A;  1J7X A;  3Q1T A;  3HE2 A;  3RSI A;  3IAV A;  2NP9 A;  3KTJ A;  4L8K A;  3R9T A;  4DI1 A;  1O8U A;  4JJT A;  2FW2 A;  3FF6 A;  4HC8 A;  1HZD A;  1Y7O A;  1W2X A;  4QII A;  4OMR A;  3TLF A;  1XNY A;  2F9Y A;  4EMP A;  1RJM A;  5DL1 A;  5JBX A;  3TRR A;  2J5G D;  3OC7 A;  5DU4 A;  2W3P A;  5C9G A;  3H81 A;  3DJA A;  3WG5 A;  2DEO A;  1UYR A;  5FUS A;  4FB8 A;  3U9T B;  2VSS F;  4FZW C;  4JVT A;  3ZWC A;  1RJN A;  4U19 A;  2VSU E;  2J5G A;  5DTP A;  2J5I A;  1YG6 A;  3SWX A;  2PG8 A;  3RRV A;  2FZS A;  5CTC A;  3IB9 A;  3TT6 A;  2CE3 A;  2D3T A;  3TDC A;  2F9I B;  1WDK A;  4JFC A;  1Q52 A;  4L6W A;  4GM2 A;  1HNU A;  3QRE A;  5G1R A;  2X58 A;  4GHN A;  3T89 A;  1K32 A;  4IZD A;  1OD4 A;  2A7K A;  5INI A;  3ISA A;  4ZU2 A;  4JCS A;  2VSU C;  4ELX A;  3BEZ A;  2F9Y B;  3GF7 A;  5ING A;  4WCZ A;  4WZ8 B;  2UZF A;  5IKL B;  2FBM A;  3ZW9 A;  3KTK A;  3P5M A;  3KTI A;  5E0S A;  2VX2 A;  1N6E A;  3HLN 1;  5MGB A;  4MI2 A;  4QFE A;  3PEA A;  1X0U A;  2VSU F;  5KJP A;  3KTH A;  4ZDC A;  3MT6 A;  4FN7 A;  4ZDE A;  3H02 A;  3LAO A;  3VIV A;  5E0N X;  1SG4 A;  2ZQQ A;  3Q0J A;  5E0S H;  1JXZ A;  3TVW A;  4Z0M A;  3MYB A;  3HRX A;  3DOR A;  2F9I A;  1FC6 A;  4ZDD A;  3T8A A;  3QYR A;  1XO6 A;  4I52 A;  3QWD A;  3R6H A;  5KDR B;  3QMJ A;  2X24 A;  3P2L A;  4JCT A;  2J5I I;  3OME A;  4WYO B;  4K2N A;  2C8T A;  2VSS E;  3ZW8 A;  1HNO A;  3LKE A;  5JBW A;  3GKB A;  4KD6 A;  4FNB A;  2ZQR A;  3TT7 A;  4F47 A;  2A81 A;  3HP0 A;  4Q1I A;  4Q0G A;  3ZWB A;  1ON3 A;  2ZL2 A;  4FZW A;  4YLH A;  1UIY A;  3MOY A;  4U18 A;  1XNV A;  3IBB A;  2IEX A;  3STA A;  3U9R B;  4KPK A;  1OD2 A;  3JU1 A;  4K29 A;  4JCQ A;  4IZB A;  4FJW D;  2EJ5 A;  4B3I A;  3HIN A;  4QIJ A;  4IZC A;  3U9S B;  3I47 A;  4OG1 A;  5INF A;  1WDL A;  4JYJ A;  1XNW A;  3H0J A;  2ZL3 A;  2PPY A;  1TG6 A;  3GF3 A;  1N6F A;  4RYF H;  3TZ3 A;  1WDM A;  4ELS A;  4JCR A;  2VRE A;  3T3W A;  1N6D A;  4U0H A;  5G1S A;  2J5S A;  3L3S A;  3V5I A;  5C90 A;  1MJ3 A;  5DZK A;  3H0Q A;  3BF0 A;  4ZDB A;  3R9S A;  1K39 A;  3G64 A;  2BZR A;  5FIF A;  4RYF A;  4NNQ A;  5KDR A;  4U0G A;  2DUB A;  1PIX A;  4I42 A;  2Q35 A;  1UYT A;  2WTB A;  3PE8 A;  1NZY B;  1DUB A;  3M6M A;  4FND A;  2ZL0 A;  5DKP A;  2PBP A;  3Q7H A;  5DUF A;  2CBY A;  4JSB A;  3R0O A;  3SLL A;  3ST9 A;  1DCI A;  4ZDF A;  5DZK H;  3R9Q A;  1PJH A;  1NZY A;  1WZ8 A;  1FCF A;  4ELW A;  1FC9 A;  4B3H A;  1VRG A;  3PZK A;  3T8B A;  2QQ3 A;  1EY3 A;  2VSU A;  3T88 A;  3H0S A;  1SZO A;  4OLQ A;  5G1Q A;  4EMM A;  3ZWA A;  3BPP A;  1Q51 A;  5CTB A;  3QKA A;  3NJB A;  3V5E A;  2F6Q A;  4MXI A;  3PGQ A;  3KTG A;  1ON9 A;  4HNK A;  5DUC A;  4I4Z A;  3QXZ A;  3TVU A;  4FN8 A;  3NJD A;  3P85 A;  1FC7 A;  3KQF A;  3FDU A;  4G2R A;  3K50 A;  1XX4 A;  2Q2X A;  5DU6 A;  3GLM A;  4JWV A;  4U0G H;  4ASI A;  1YG8 A;  1TYF A;  5DTW A;  2GTR A;  3Q0G A;  1UYV A;  4EML A;  3M6N A;  3QK8 A;  2VSS A;  4U1A A;  3N6R B;  3RST A;  2Q34 A;  2A7S A;  2J5I B;  2ZL4 A;  3OT6 A; 
#chains in the Genus database with same CATH topology
 4RCN A;  4K3W A;  4JOT A;  4KWB A;  3MFM A;  3TV5 A;  3K8X A;  4NAR A;  4NEK A;  3BPT A;  4B3J A;  2HW5 A;  3GMA A;  3H0U A;  1UYS A;  5DU8 A;  1EF8 A;  1EF9 A;  3QXI A;  4KNP A;  4MOU A;  4LK5 A;  4JYL A;  2F6I A;  1J7X A;  3Q1T A;  3HE2 A;  3RSI A;  3IAV A;  2NP9 A;  3KTJ A;  4L8K A;  3R9T A;  4DI1 A;  1O8U A;  4JJT A;  2FW2 A;  3FF6 A;  4HC8 A;  1HZD A;  1Y7O A;  1W2X A;  4QII A;  4OMR A;  3TLF A;  1XNY A;  2F9Y A;  4EMP A;  1RJM A;  5DL1 A;  5JBX A;  3TRR A;  2J5G D;  3OC7 A;  5DU4 A;  2W3P A;  5C9G A;  3H81 A;  3DJA A;  3WG5 A;  2DEO A;  1UYR A;  5FUS A;  4FB8 A;  3U9T B;  2VSS F;  4FZW C;  4JVT A;  3ZWC A;  1RJN A;  4U19 A;  2VSU E;  2J5G A;  5DTP A;  2J5I A;  1YG6 A;  3SWX A;  2PG8 A;  3RRV A;  2FZS A;  5CTC A;  3IB9 A;  3TT6 A;  2CE3 A;  2D3T A;  2YJG A;  3TDC A;  2F9I B;  1WDK A;  4JFC A;  1Q52 A;  4L6W A;  4GM2 A;  1HNU A;  3QRE A;  5G1R A;  2X58 A;  4GHN A;  3T89 A;  1K32 A;  4IZD A;  1OD4 A;  2A7K A;  5INI A;  3ISA A;  4ZU2 A;  4JCS A;  2VSU C;  4ELX A;  3BEZ A;  2F9Y B;  3GF7 A;  5ING A;  4WCZ A;  4WZ8 B;  2UZF A;  5IKL B;  2FBM A;  3ZW9 A;  3KTK A;  3P5M A;  3KTI A;  5E0S A;  2VX2 A;  1N6E A;  3HLN 1;  5MGB A;  4MI2 A;  4QFE A;  3PEA A;  1X0U A;  2VSU F;  5KJP A;  3KTH A;  4ZDC A;  3MT6 A;  4FN7 A;  4ZDE A;  3H02 A;  3LAO A;  3VIV A;  5E0N X;  1SG4 A;  2ZQQ A;  3Q0J A;  5E0S H;  1JXZ A;  3TVW A;  4Z0M A;  3MYB A;  3HRX A;  3DOR A;  2F9I A;  1FC6 A;  4ZDD A;  3T8A A;  3QYR A;  1XO6 A;  4I52 A;  3QWD A;  3R6H A;  5KDR B;  3QMJ A;  2X24 A;  3P2L A;  4JCT A;  2J5I I;  3OME A;  4WYO B;  4K2N A;  2C8T A;  2VSS E;  3ZW8 A;  1HNO A;  3LKE A;  5JBW A;  3GKB A;  4KD6 A;  4FNB A;  2ZQR A;  3TT7 A;  4F47 A;  2A81 A;  3HP0 A;  4Q1I A;  4Q0G A;  3ZWB A;  1ON3 A;  4J2U A;  2ZL2 A;  4FZW A;  4YLH A;  1UIY A;  3MOY A;  4U18 A;  1XNV A;  3IBB A;  2IEX A;  3STA A;  3U9R B;  4KPK A;  1OD2 A;  3JU1 A;  4K29 A;  4JCQ A;  4IZB A;  4FJW D;  2EJ5 A;  4B3I A;  3HIN A;  4QIJ A;  4IZC A;  3U9S B;  3I47 A;  4OG1 A;  5INF A;  1WDL A;  4JYJ A;  1XNW A;  3H0J A;  2ZL3 A;  2PPY A;  5HUQ A;  1TG6 A;  3GF3 A;  1N6F A;  4RYF H;  3TZ3 A;  1WDM A;  4ELS A;  4JCR A;  2VRE A;  3T3W A;  1N6D A;  4U0H A;  5G1S A;  2J5S A;  3L3S A;  3V5I A;  5C90 A;  1MJ3 A;  5DZK A;  3H0Q A;  3BF0 A;  4ZDB A;  3R9S A;  1K39 A;  3G64 A;  2BZR A;  5FIF A;  4RYF A;  4NNQ A;  5KDR A;  4U0G A;  2DUB A;  1PIX A;  4I42 A;  2Q35 A;  1UYT A;  2WTB A;  3PE8 A;  1NZY B;  1DUB A;  3M6M A;  4FND A;  2ZL0 A;  5DKP A;  2PBP A;  3Q7H A;  5DUF A;  2CBY A;  4JSB A;  3R0O A;  3SLL A;  3ST9 A;  1DCI A;  4ZDF A;  5DZK H;  3R9Q A;  1PJH A;  1NZY A;  1WZ8 A;  1FCF A;  4ELW A;  1FC9 A;  4B3H A;  1VRG A;  3PZK A;  3T8B A;  2QQ3 A;  1EY3 A;  2VSU A;  3T88 A;  3H0S A;  1SZO A;  4OLQ A;  5G1Q A;  4EMM A;  3ZWA A;  3BPP A;  1Q51 A;  5CTB A;  3QKA A;  3NJB A;  3V5E A;  2F6Q A;  4MXI A;  3PGQ A;  3KTG A;  1ON9 A;  4HNK A;  5DUC A;  4I4Z A;  3QXZ A;  3TVU A;  4FN8 A;  3NJD A;  3P85 A;  1FC7 A;  3KQF A;  3FDU A;  4G2R A;  3K50 A;  1XX4 A;  2Q2X A;  5DU6 A;  3GLM A;  4JWV A;  4U0G H;  4ASI A;  1YG8 A;  1TYF A;  5DTW A;  2GTR A;  3Q0G A;  1UYV A;  4EML A;  3M6N A;  3QK8 A;  2VSS A;  4U1A A;  3N6R B;  3RST A;  2Q34 A;  2A7S A;  2J5I B;  4HDT A;  2ZL4 A;  3OT6 A; 
#chains in the Genus database with same CATH homology
 4RCN A;  4K3W A;  4JOT A;  4KWB A;  3MFM A;  3TV5 A;  3K8X A;  4NAR A;  4NEK A;  3BPT A;  4B3J A;  2HW5 A;  3GMA A;  3H0U A;  1UYS A;  5DU8 A;  1EF8 A;  1EF9 A;  3QXI A;  4KNP A;  4MOU A;  4LK5 A;  4JYL A;  2F6I A;  1J7X A;  3Q1T A;  3HE2 A;  3RSI A;  3IAV A;  2NP9 A;  3KTJ A;  4L8K A;  3R9T A;  4DI1 A;  1O8U A;  4JJT A;  2FW2 A;  3FF6 A;  4HC8 A;  1HZD A;  1Y7O A;  1W2X A;  4QII A;  4OMR A;  3TLF A;  1XNY A;  2F9Y A;  4EMP A;  1RJM A;  5DL1 A;  5JBX A;  3TRR A;  2J5G D;  3OC7 A;  5DU4 A;  2W3P A;  5C9G A;  3H81 A;  3DJA A;  3WG5 A;  2DEO A;  1UYR A;  5FUS A;  4FB8 A;  3U9T B;  2VSS F;  4FZW C;  4JVT A;  3ZWC A;  1RJN A;  4U19 A;  2VSU E;  2J5G A;  5DTP A;  2J5I A;  1YG6 A;  3SWX A;  2PG8 A;  3RRV A;  2FZS A;  5CTC A;  3IB9 A;  3TT6 A;  2CE3 A;  2D3T A;  2YJG A;  3TDC A;  2F9I B;  1WDK A;  4JFC A;  1Q52 A;  4L6W A;  4GM2 A;  1HNU A;  3QRE A;  5G1R A;  2X58 A;  4GHN A;  3T89 A;  1K32 A;  4IZD A;  1OD4 A;  2A7K A;  5INI A;  3ISA A;  4ZU2 A;  4JCS A;  2VSU C;  4ELX A;  3BEZ A;  2F9Y B;  3GF7 A;  5ING A;  4WCZ A;  4WZ8 B;  2UZF A;  5IKL B;  2FBM A;  3ZW9 A;  3KTK A;  3P5M A;  3KTI A;  5E0S A;  2VX2 A;  1N6E A;  3HLN 1;  5MGB A;  4MI2 A;  4QFE A;  3PEA A;  1X0U A;  2VSU F;  5KJP A;  3KTH A;  4ZDC A;  3MT6 A;  4FN7 A;  4ZDE A;  3H02 A;  3LAO A;  3VIV A;  5E0N X;  1SG4 A;  2ZQQ A;  3Q0J A;  5E0S H;  1JXZ A;  3TVW A;  4Z0M A;  3MYB A;  3HRX A;  3DOR A;  2F9I A;  1FC6 A;  4ZDD A;  3T8A A;  3QYR A;  1XO6 A;  4I52 A;  3QWD A;  3R6H A;  5KDR B;  3QMJ A;  2X24 A;  3P2L A;  4JCT A;  2J5I I;  3OME A;  4WYO B;  4K2N A;  2C8T A;  2VSS E;  3ZW8 A;  1HNO A;  3LKE A;  5JBW A;  3GKB A;  4KD6 A;  4FNB A;  2ZQR A;  3TT7 A;  4F47 A;  2A81 A;  3HP0 A;  4Q1I A;  4Q0G A;  3ZWB A;  1ON3 A;  4J2U A;  2ZL2 A;  4FZW A;  4YLH A;  1UIY A;  3MOY A;  4U18 A;  1XNV A;  3IBB A;  2IEX A;  3STA A;  3U9R B;  4KPK A;  1OD2 A;  3JU1 A;  4K29 A;  4JCQ A;  4IZB A;  4FJW D;  2EJ5 A;  4B3I A;  3HIN A;  4QIJ A;  4IZC A;  3U9S B;  3I47 A;  4OG1 A;  5INF A;  1WDL A;  4JYJ A;  1XNW A;  3H0J A;  2ZL3 A;  2PPY A;  5HUQ A;  1TG6 A;  3GF3 A;  1N6F A;  4RYF H;  3TZ3 A;  1WDM A;  4ELS A;  4JCR A;  2VRE A;  3T3W A;  1N6D A;  4U0H A;  5G1S A;  2J5S A;  3L3S A;  3V5I A;  5C90 A;  1MJ3 A;  5DZK A;  3H0Q A;  3BF0 A;  4ZDB A;  3R9S A;  1K39 A;  3G64 A;  2BZR A;  5FIF A;  4RYF A;  4NNQ A;  5KDR A;  4U0G A;  2DUB A;  1PIX A;  4I42 A;  2Q35 A;  1UYT A;  2WTB A;  3PE8 A;  1NZY B;  1DUB A;  3M6M A;  4FND A;  2ZL0 A;  5DKP A;  2PBP A;  3Q7H A;  5DUF A;  2CBY A;  4JSB A;  3R0O A;  3SLL A;  3ST9 A;  1DCI A;  4ZDF A;  5DZK H;  3R9Q A;  1PJH A;  1NZY A;  1WZ8 A;  1FCF A;  4ELW A;  1FC9 A;  4B3H A;  1VRG A;  3PZK A;  3T8B A;  2QQ3 A;  1EY3 A;  2VSU A;  3T88 A;  3H0S A;  1SZO A;  4OLQ A;  5G1Q A;  4EMM A;  3ZWA A;  3BPP A;  1Q51 A;  5CTB A;  3QKA A;  3NJB A;  3V5E A;  2F6Q A;  4MXI A;  3PGQ A;  3KTG A;  1ON9 A;  4HNK A;  5DUC A;  4I4Z A;  3QXZ A;  3TVU A;  4FN8 A;  3NJD A;  3P85 A;  1FC7 A;  3KQF A;  3FDU A;  4G2R A;  3K50 A;  1XX4 A;  2Q2X A;  5DU6 A;  3GLM A;  4JWV A;  4U0G H;  4ASI A;  1YG8 A;  1TYF A;  5DTW A;  2GTR A;  3Q0G A;  1UYV A;  4EML A;  3M6N A;  3QK8 A;  2VSS A;  4U1A A;  3N6R B;  3RST A;  2Q34 A;  2A7S A;  2J5I B;  4HDT A;  2ZL4 A;  3OT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...