4ZDEA

Crystal structure of yeast d3,d2-enoyl-coa isomerase f268a mutant
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
269
structure length
259
Chain Sequence
b'QEIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRARQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,2-trans-enoyl-CoA isomerase
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 101
structure length 259
sequence length 269
chains with identical sequence B, C
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zdeA00
5C90A 2PPYA 5INFA 5KDRA 3R9SA 3ZWCA 1X0UA 2FW2A 4GHNA 1N6DA 2VSUA 3BPPA 4L6WA 4NEKA 1K39A 2CBYA 4JCTA 3H02A 5DTPA 2J5GA 3RSTA 4U19A 3TVUA 2X24A 3BF0A 4FJWD 3M6NA 1WZ8A 4Q0GA 3HP0A 3KTHA 3GF7A 3PZKA 3HINA 4DI1A 3TV5A 3T8AA 1ON9A 4Z0MA 4K29A 3TDCA 4EMMA 2FBMA 1RJMA 4KNPA 4JFCA 2A7SA 3PGQA 4U18A 2VSSE 1ON3A 2VSSA 4IZBA 3TT6A 3STAA 4JVTA 3QREA 3U9TB 5C9GA 2W3PA 4OG1A 5DZKA 1Y7OA 3MT6A 2EJ5A 1WDLA 4ELXA 2NP9A 4EMLA 4ZDEA 4U0GA 4JWVA 4MI2A 4QIJA 5G1SA 4ELWA 5DU6A 1TYFA 2VSUC 4QFEA 5E0SA 4IZDA 3T3WA 1XO6A 4FNBA 2F9YB 4NNQA 4OLQA 3R9TA 4JYJA 1NZYA 3QYRA 3KTKA 4JYLA 1SG4A 5DL1A 4JOTA 3TVWA 1UYTA 4FZWA 3V5EA 3Q0JA 1FC9A 2PG8A 3DJAA 4WCZA 2D3TA 3ISAA 1J7XA 1TG6A 4KPKA 3HE2A 2X58A 2VSSF 3V5IA 3P5MA 2J5IB 4RYFH 4QIIA 2WTBA 5CTCA 3T8BA 5JBXA 4ZDDA 5KJPA 2VSUE 3NJBA 2A81A 2ZL2A 5CTBA 4LK5A 1DUBA 4I4ZA 4ELSA 5KDRB 3ZWBA 3QK8A 3ZW9A 2IEXA 5DUCA 2QQ3A 1N6FA 1Q51A 3GMAA 4WYOB 4JSBA 4B3HA 3KTGA 1XNWA 1YG6A 3I47A 3Q1TA 3QWDA 4WZ8B 3H0QA 3GKBA 5DU8A 3VIVA 1FC7A 4FZWC 3TT7A 3OT6A 2VX2A 4EMPA 1YG8A 5FUSA 2DEOA 4Q1IA 3MYBA 3OC7A 2HW5A 5MGBA 5FIFA 2Q35A 2F9IB 4IZCA 4JCSA 3T89A 3G64A 4U1AA 5IKLB 4RCNA 2VSUF 3L3SA 1UYVA 3QXIA 3RSIA 3P2LA 3IB9A 4YLHA 3MOYA 4FN8A 4G2RA 4ZU2A 1UYSA 1W2XA 1OD4A 1N6EA 1PIXA 3BEZA 3KQFA 4JCQA 2J5SA 3K8XA 4MXIA 4B3JA 2DUBA 3NJDA 3HRXA 1EF9A 3IAVA 2Q2XA 3M6MA 4JCRA 4I42A 5DUFA 1VRGA 1NZYB 5INGA 1OD2A 1EY3A 5DKPA 3ZW8A 1K32A 2C8TA 2ZL3A 1HNUA 3SLLA 3R6HA 1DCIA 4OMRA 3IBBA 3FF6A 3PEAA 5G1RA 5JBWA 2PBPA 3Q7HA 2FZSA 4F47A 5INIA 1FCFA 3H0UA 2ZQQA 4U0HA 2F6QA 3LKEA 3DORA 1PJHA 3N6RB 2F6IA 3R0OA 4FN7A 2Q34A 2A7KA 3U9SB 4RYFA 3T88A 1Q52A 4I52A 3TLFA 3LAOA 1WDKA 3JU1A 3R9QA 2UZFA 4HNKA 4B3IA 4GM2A 1HNOA 2J5II 1FC6A 2J5GD 3TZ3A 3GF3A 2ZL0A 5DZKH 4FB8A 2GTRA 4MOUA 1O8UA 4ZDCA 4ZDFA 3H0SA 2ZL4A 2VREA 4U0GH 2F9IA 3U9RB 3HLN1 4ASIA 5DTWA 4KWBA 5E0SH 1UYRA 3P85A 3QKAA 3H0JA 1WDMA 4ZDBA 1JXZA 3RRVA 1SZOA 2F9YA 2ZQRA 5DU4A 4KD6A 3SWXA 3QMJA 3KTIA 1XNVA 4JJTA 3OMEA 3FDUA 4FNDA 3WG5A 2BZRA 3QXZA 3TRRA 4K3WA 1MJ3A 4L8KA 1XX4A 1RJNA 5G1QA 3ST9A 3H81A 5E0NX 3GLMA 3Q0GA 1UIYA 2CE3A 2J5IA 1XNYA 3K50A 4K2NA 3PE8A 1HZDA 3KTJA 4HC8A 3MFMA 1EF8A 3ZWAA
chains in the Genus database with same CATH superfamily
5C90A 2PPYA 5INFA 5KDRA 3R9SA 3ZWCA 1X0UA 2FW2A 4NARA 4GHNA 1N6DA 2VSUA 3BPPA 4L6WA 4NEKA 1K39A 2CBYA 4JCTA 3H02A 5DTPA 2J5GA 3RSTA 4U19A 3TVUA 2X24A 3BF0A 4FJWD 3BPTA 3M6NA 1WZ8A 4Q0GA 3HP0A 3KTHA 3GF7A 3PZKA 3HINA 4DI1A 3TV5A 3T8AA 1ON9A 4Z0MA 4K29A 3TDCA 4EMMA 2FBMA 1RJMA 4KNPA 4JFCA 2A7SA 3PGQA 4U18A 2VSSE 1ON3A 2VSSA 4IZBA 3TT6A 3STAA 4JVTA 3QREA 3U9TB 5C9GA 2W3PA 4OG1A 5DZKA 1Y7OA 3MT6A 2EJ5A 1WDLA 4ELXA 2NP9A 4EMLA 4ZDEA 4U0GA 4JWVA 4MI2A 4QIJA 5G1SA 4ELWA 5DU6A 1TYFA 2VSUC 4QFEA 5E0SA 4IZDA 3T3WA 1XO6A 4FNBA 2F9YB 4NNQA 4OLQA 3R9TA 5HUQA 4JYJA 1NZYA 3QYRA 3KTKA 4JYLA 1SG4A 5DL1A 4JOTA 3TVWA 1UYTA 4FZWA 3V5EA 3Q0JA 1FC9A 2PG8A 3DJAA 4WCZA 2D3TA 3ISAA 1J7XA 1TG6A 4KPKA 3HE2A 2X58A 2VSSF 3V5IA 3P5MA 2J5IB 4RYFH 4QIIA 2WTBA 2YJGA 5CTCA 3T8BA 5JBXA 4ZDDA 5KJPA 2VSUE 3NJBA 2A81A 2ZL2A 5CTBA 4LK5A 1DUBA 4I4ZA 4ELSA 5KDRB 3ZWBA 3QK8A 3ZW9A 2IEXA 5DUCA 2QQ3A 1N6FA 1Q51A 3GMAA 4WYOB 4JSBA 4B3HA 3KTGA 1XNWA 1YG6A 3I47A 3Q1TA 3QWDA 4WZ8B 3H0QA 3GKBA 5DU8A 3VIVA 1FC7A 4FZWC 3TT7A 3OT6A 2VX2A 4EMPA 1YG8A 5FUSA 2DEOA 4Q1IA 3MYBA 3OC7A 2HW5A 5MGBA 5FIFA 2Q35A 2F9IB 4IZCA 4JCSA 3T89A 3G64A 4U1AA 5IKLB 4RCNA 2VSUF 3L3SA 1UYVA 3QXIA 3RSIA 3P2LA 3IB9A 4YLHA 3MOYA 4FN8A 4G2RA 4ZU2A 1UYSA 1W2XA 1OD4A 1N6EA 1PIXA 3BEZA 3KQFA 4JCQA 2J5SA 3K8XA 4MXIA 4B3JA 2DUBA 3NJDA 3HRXA 1EF9A 3IAVA 2Q2XA 3M6MA 4JCRA 4I42A 5DUFA 1VRGA 1NZYB 5INGA 1OD2A 1EY3A 5DKPA 3ZW8A 1K32A 2C8TA 2ZL3A 1HNUA 3SLLA 3R6HA 1DCIA 4OMRA 3IBBA 3FF6A 3PEAA 5G1RA 5JBWA 2PBPA 3Q7HA 2FZSA 4F47A 5INIA 1FCFA 3H0UA 2ZQQA 4U0HA 2F6QA 3LKEA 3DORA 1PJHA 3N6RB 2F6IA 4HDTA 3R0OA 4FN7A 2Q34A 2A7KA 3U9SB 4RYFA 3T88A 1Q52A 4I52A 3TLFA 3LAOA 1WDKA 3JU1A 3R9QA 2UZFA 4HNKA 4B3IA 4GM2A 1HNOA 2J5II 4J2UA 1FC6A 2J5GD 3TZ3A 3GF3A 2ZL0A 5DZKH 4FB8A 2GTRA 4MOUA 1O8UA 4ZDCA 4ZDFA 3H0SA 2ZL4A 2VREA 4U0GH 2F9IA 3U9RB 3HLN1 4ASIA 5DTWA 4KWBA 5E0SH 1UYRA 3P85A 3QKAA 3H0JA 1WDMA 4ZDBA 1JXZA 3RRVA 1SZOA 2F9YA 2ZQRA 5DU4A 4KD6A 3SWXA 3QMJA 3KTIA 1XNVA 4JJTA 3OMEA 3FDUA 4FNDA 3WG5A 2BZRA 3QXZA 3TRRA 4K3WA 1MJ3A 4L8KA 1XX4A 1RJNA 5G1QA 3ST9A 3H81A 5E0NX 3GLMA 3Q0GA 1UIYA 2CE3A 2J5IA 1XNYA 3K50A 4K2NA 3PE8A 1HZDA 3KTJA 4HC8A 3MFMA 1EF8A 3ZWAA
chains in the Genus database with same CATH topology
5C90A 2PPYA 5INFA 5KDRA 3R9SA 3ZWCA 1X0UA 2FW2A 4NARA 4GHNA 1N6DA 2VSUA 3BPPA 4L6WA 4NEKA 1K39A 2CBYA 4JCTA 3H02A 5DTPA 2J5GA 3RSTA 4U19A 3TVUA 2X24A 3BF0A 4FJWD 3BPTA 3M6NA 1WZ8A 4Q0GA 3HP0A 3KTHA 3GF7A 3PZKA 3HINA 4DI1A 3TV5A 3T8AA 1ON9A 4Z0MA 4K29A 3TDCA 4EMMA 2FBMA 1RJMA 4KNPA 4JFCA 2A7SA 3PGQA 4U18A 2VSSE 1ON3A 2VSSA 4IZBA 3TT6A 3STAA 4JVTA 3QREA 3U9TB 5C9GA 2W3PA 4OG1A 5DZKA 1Y7OA 3MT6A 2EJ5A 1WDLA 4ELXA 2NP9A 4EMLA 4ZDEA 4U0GA 4JWVA 4MI2A 4QIJA 5G1SA 4ELWA 5DU6A 1TYFA 2VSUC 4QFEA 5E0SA 4IZDA 3T3WA 1XO6A 4FNBA 2F9YB 4NNQA 4OLQA 3R9TA 5HUQA 4JYJA 1NZYA 3QYRA 3KTKA 4JYLA 1SG4A 5DL1A 4JOTA 3TVWA 1UYTA 4FZWA 3V5EA 3Q0JA 1FC9A 2PG8A 3DJAA 4WCZA 2D3TA 3ISAA 1J7XA 1TG6A 4KPKA 3HE2A 2X58A 2VSSF 3V5IA 3P5MA 2J5IB 4RYFH 4QIIA 2WTBA 2YJGA 5CTCA 3T8BA 5JBXA 4ZDDA 5KJPA 2VSUE 3NJBA 2A81A 2ZL2A 5CTBA 4LK5A 1DUBA 4I4ZA 4ELSA 5KDRB 3ZWBA 3QK8A 3ZW9A 2IEXA 5DUCA 2QQ3A 1N6FA 1Q51A 3GMAA 4WYOB 4JSBA 4B3HA 3KTGA 1XNWA 1YG6A 3I47A 3Q1TA 3QWDA 4WZ8B 3H0QA 3GKBA 5DU8A 3VIVA 1FC7A 4FZWC 3TT7A 3OT6A 2VX2A 4EMPA 1YG8A 5FUSA 2DEOA 4Q1IA 3MYBA 3OC7A 2HW5A 5MGBA 5FIFA 2Q35A 2F9IB 4IZCA 4JCSA 3T89A 3G64A 4U1AA 5IKLB 4RCNA 2VSUF 3L3SA 1UYVA 3QXIA 3RSIA 3P2LA 3IB9A 4YLHA 3MOYA 4FN8A 4G2RA 4ZU2A 1UYSA 1W2XA 1OD4A 1N6EA 1PIXA 3BEZA 3KQFA 4JCQA 2J5SA 3K8XA 4MXIA 4B3JA 2DUBA 3NJDA 3HRXA 1EF9A 3IAVA 2Q2XA 3M6MA 4JCRA 4I42A 5DUFA 1VRGA 1NZYB 5INGA 1OD2A 1EY3A 5DKPA 3ZW8A 1K32A 2C8TA 2ZL3A 1HNUA 3SLLA 3R6HA 1DCIA 4OMRA 3IBBA 3FF6A 3PEAA 5G1RA 5JBWA 2PBPA 3Q7HA 2FZSA 4F47A 5INIA 1FCFA 3H0UA 2ZQQA 4U0HA 2F6QA 3LKEA 3DORA 1PJHA 3N6RB 2F6IA 4HDTA 3R0OA 4FN7A 2Q34A 2A7KA 3U9SB 4RYFA 3T88A 1Q52A 4I52A 3TLFA 3LAOA 1WDKA 3JU1A 3R9QA 2UZFA 4HNKA 4B3IA 4GM2A 1HNOA 2J5II 4J2UA 1FC6A 2J5GD 3TZ3A 3GF3A 2ZL0A 5DZKH 4FB8A 2GTRA 4MOUA 1O8UA 4ZDCA 4ZDFA 3H0SA 2ZL4A 2VREA 4U0GH 2F9IA 3U9RB 3HLN1 4ASIA 5DTWA 4KWBA 5E0SH 1UYRA 3P85A 3QKAA 3H0JA 1WDMA 4ZDBA 1JXZA 3RRVA 1SZOA 2F9YA 2ZQRA 5DU4A 4KD6A 3SWXA 3QMJA 3KTIA 1XNVA 4JJTA 3OMEA 3FDUA 4FNDA 3WG5A 2BZRA 3QXZA 3TRRA 4K3WA 1MJ3A 4L8KA 1XX4A 1RJNA 5G1QA 3ST9A 3H81A 5E0NX 3GLMA 3Q0GA 1UIYA 2CE3A 2J5IA 1XNYA 3K50A 4K2NA 3PE8A 1HZDA 3KTJA 4HC8A 3MFMA 1EF8A 3ZWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C90 A;  2PPY A;  5INF A;  5KDR A;  3R9S A;  3ZWC A;  1X0U A;  2FW2 A;  4GHN A;  1N6D A;  2VSU A;  3BPP A;  4L6W A;  4NEK A;  1K39 A;  2CBY A;  4JCT A;  3H02 A;  5DTP A;  2J5G A;  3RST A;  4U19 A;  3TVU A;  2X24 A;  3BF0 A;  4FJW D;  3M6N A;  1WZ8 A;  4Q0G A;  3HP0 A;  3KTH A;  3GF7 A;  3PZK A;  3HIN A;  4DI1 A;  3TV5 A;  3T8A A;  1ON9 A;  4Z0M A;  4K29 A;  3TDC A;  4EMM A;  2FBM A;  1RJM A;  4KNP A;  4JFC A;  2A7S A;  3PGQ A;  4U18 A;  2VSS E;  1ON3 A;  2VSS A;  4IZB A;  3TT6 A;  3STA A;  4JVT A;  3QRE A;  3U9T B;  5C9G A;  2W3P A;  4OG1 A;  5DZK A;  1Y7O A;  3MT6 A;  2EJ5 A;  1WDL A;  4ELX A;  2NP9 A;  4EML A;  4ZDE A;  4U0G A;  4JWV A;  4MI2 A;  4QIJ A;  5G1S A;  4ELW A;  5DU6 A;  1TYF A;  2VSU C;  4QFE A;  5E0S A;  4IZD A;  3T3W A;  1XO6 A;  4FNB A;  2F9Y B;  4NNQ A;  4OLQ A;  3R9T A;  4JYJ A;  1NZY A;  3QYR A;  3KTK A;  4JYL A;  1SG4 A;  5DL1 A;  4JOT A;  3TVW A;  1UYT A;  4FZW A;  3V5E A;  3Q0J A;  1FC9 A;  2PG8 A;  3DJA A;  4WCZ A;  2D3T A;  3ISA A;  1J7X A;  1TG6 A;  4KPK A;  3HE2 A;  2X58 A;  2VSS F;  3V5I A;  3P5M A;  2J5I B;  4RYF H;  4QII A;  2WTB A;  5CTC A;  3T8B A;  5JBX A;  4ZDD A;  5KJP A;  2VSU E;  3NJB A;  2A81 A;  2ZL2 A;  5CTB A;  4LK5 A;  1DUB A;  4I4Z A;  4ELS A;  5KDR B;  3ZWB A;  3QK8 A;  3ZW9 A;  2IEX A;  5DUC A;  2QQ3 A;  1N6F A;  1Q51 A;  3GMA A;  4WYO B;  4JSB A;  4B3H A;  3KTG A;  1XNW A;  1YG6 A;  3I47 A;  3Q1T A;  3QWD A;  4WZ8 B;  3H0Q A;  3GKB A;  5DU8 A;  3VIV A;  1FC7 A;  4FZW C;  3TT7 A;  3OT6 A;  2VX2 A;  4EMP A;  1YG8 A;  5FUS A;  2DEO A;  4Q1I A;  3MYB A;  3OC7 A;  2HW5 A;  5MGB A;  5FIF A;  2Q35 A;  2F9I B;  4IZC A;  4JCS A;  3T89 A;  3G64 A;  4U1A A;  5IKL B;  4RCN A;  2VSU F;  3L3S A;  1UYV A;  3QXI A;  3RSI A;  3P2L A;  3IB9 A;  4YLH A;  3MOY A;  4FN8 A;  4G2R A;  4ZU2 A;  1UYS A;  1W2X A;  1OD4 A;  1N6E A;  1PIX A;  3BEZ A;  3KQF A;  4JCQ A;  2J5S A;  3K8X A;  4MXI A;  4B3J A;  2DUB A;  3NJD A;  3HRX A;  1EF9 A;  3IAV A;  2Q2X A;  3M6M A;  4JCR A;  4I42 A;  5DUF A;  1VRG A;  1NZY B;  5ING A;  1OD2 A;  1EY3 A;  5DKP A;  3ZW8 A;  1K32 A;  2C8T A;  2ZL3 A;  1HNU A;  3SLL A;  3R6H A;  1DCI A;  4OMR A;  3IBB A;  3FF6 A;  3PEA A;  5G1R A;  5JBW A;  2PBP A;  3Q7H A;  2FZS A;  4F47 A;  5INI A;  1FCF A;  3H0U A;  2ZQQ A;  4U0H A;  2F6Q A;  3LKE A;  3DOR A;  1PJH A;  3N6R B;  2F6I A;  3R0O A;  4FN7 A;  2Q34 A;  2A7K A;  3U9S B;  4RYF A;  3T88 A;  1Q52 A;  4I52 A;  3TLF A;  3LAO A;  1WDK A;  3JU1 A;  3R9Q A;  2UZF A;  4HNK A;  4B3I A;  4GM2 A;  1HNO A;  2J5I I;  1FC6 A;  2J5G D;  3TZ3 A;  3GF3 A;  2ZL0 A;  5DZK H;  4FB8 A;  2GTR A;  4MOU A;  1O8U A;  4ZDC A;  4ZDF A;  3H0S A;  2ZL4 A;  2VRE A;  4U0G H;  2F9I A;  3U9R B;  3HLN 1;  4ASI A;  5DTW A;  4KWB A;  5E0S H;  1UYR A;  3P85 A;  3QKA A;  3H0J A;  1WDM A;  4ZDB A;  1JXZ A;  3RRV A;  1SZO A;  2F9Y A;  2ZQR A;  5DU4 A;  4KD6 A;  3SWX A;  3QMJ A;  3KTI A;  1XNV A;  4JJT A;  3OME A;  3FDU A;  4FND A;  3WG5 A;  2BZR A;  3QXZ A;  3TRR A;  4K3W A;  1MJ3 A;  4L8K A;  1XX4 A;  1RJN A;  5G1Q A;  3ST9 A;  3H81 A;  5E0N X;  3GLM A;  3Q0G A;  1UIY A;  2CE3 A;  2J5I A;  1XNY A;  3K50 A;  4K2N A;  3PE8 A;  1HZD A;  3KTJ A;  4HC8 A;  3MFM A;  1EF8 A;  3ZWA A; 
#chains in the Genus database with same CATH topology
 5C90 A;  2PPY A;  5INF A;  5KDR A;  3R9S A;  3ZWC A;  1X0U A;  2FW2 A;  4NAR A;  4GHN A;  1N6D A;  2VSU A;  3BPP A;  4L6W A;  4NEK A;  1K39 A;  2CBY A;  4JCT A;  3H02 A;  5DTP A;  2J5G A;  3RST A;  4U19 A;  3TVU A;  2X24 A;  3BF0 A;  4FJW D;  3BPT A;  3M6N A;  1WZ8 A;  4Q0G A;  3HP0 A;  3KTH A;  3GF7 A;  3PZK A;  3HIN A;  4DI1 A;  3TV5 A;  3T8A A;  1ON9 A;  4Z0M A;  4K29 A;  3TDC A;  4EMM A;  2FBM A;  1RJM A;  4KNP A;  4JFC A;  2A7S A;  3PGQ A;  4U18 A;  2VSS E;  1ON3 A;  2VSS A;  4IZB A;  3TT6 A;  3STA A;  4JVT A;  3QRE A;  3U9T B;  5C9G A;  2W3P A;  4OG1 A;  5DZK A;  1Y7O A;  3MT6 A;  2EJ5 A;  1WDL A;  4ELX A;  2NP9 A;  4EML A;  4ZDE A;  4U0G A;  4JWV A;  4MI2 A;  4QIJ A;  5G1S A;  4ELW A;  5DU6 A;  1TYF A;  2VSU C;  4QFE A;  5E0S A;  4IZD A;  3T3W A;  1XO6 A;  4FNB A;  2F9Y B;  4NNQ A;  4OLQ A;  3R9T A;  5HUQ A;  4JYJ A;  1NZY A;  3QYR A;  3KTK A;  4JYL A;  1SG4 A;  5DL1 A;  4JOT A;  3TVW A;  1UYT A;  4FZW A;  3V5E A;  3Q0J A;  1FC9 A;  2PG8 A;  3DJA A;  4WCZ A;  2D3T A;  3ISA A;  1J7X A;  1TG6 A;  4KPK A;  3HE2 A;  2X58 A;  2VSS F;  3V5I A;  3P5M A;  2J5I B;  4RYF H;  4QII A;  2WTB A;  2YJG A;  5CTC A;  3T8B A;  5JBX A;  4ZDD A;  5KJP A;  2VSU E;  3NJB A;  2A81 A;  2ZL2 A;  5CTB A;  4LK5 A;  1DUB A;  4I4Z A;  4ELS A;  5KDR B;  3ZWB A;  3QK8 A;  3ZW9 A;  2IEX A;  5DUC A;  2QQ3 A;  1N6F A;  1Q51 A;  3GMA A;  4WYO B;  4JSB A;  4B3H A;  3KTG A;  1XNW A;  1YG6 A;  3I47 A;  3Q1T A;  3QWD A;  4WZ8 B;  3H0Q A;  3GKB A;  5DU8 A;  3VIV A;  1FC7 A;  4FZW C;  3TT7 A;  3OT6 A;  2VX2 A;  4EMP A;  1YG8 A;  5FUS A;  2DEO A;  4Q1I A;  3MYB A;  3OC7 A;  2HW5 A;  5MGB A;  5FIF A;  2Q35 A;  2F9I B;  4IZC A;  4JCS A;  3T89 A;  3G64 A;  4U1A A;  5IKL B;  4RCN A;  2VSU F;  3L3S A;  1UYV A;  3QXI A;  3RSI A;  3P2L A;  3IB9 A;  4YLH A;  3MOY A;  4FN8 A;  4G2R A;  4ZU2 A;  1UYS A;  1W2X A;  1OD4 A;  1N6E A;  1PIX A;  3BEZ A;  3KQF A;  4JCQ A;  2J5S A;  3K8X A;  4MXI A;  4B3J A;  2DUB A;  3NJD A;  3HRX A;  1EF9 A;  3IAV A;  2Q2X A;  3M6M A;  4JCR A;  4I42 A;  5DUF A;  1VRG A;  1NZY B;  5ING A;  1OD2 A;  1EY3 A;  5DKP A;  3ZW8 A;  1K32 A;  2C8T A;  2ZL3 A;  1HNU A;  3SLL A;  3R6H A;  1DCI A;  4OMR A;  3IBB A;  3FF6 A;  3PEA A;  5G1R A;  5JBW A;  2PBP A;  3Q7H A;  2FZS A;  4F47 A;  5INI A;  1FCF A;  3H0U A;  2ZQQ A;  4U0H A;  2F6Q A;  3LKE A;  3DOR A;  1PJH A;  3N6R B;  2F6I A;  4HDT A;  3R0O A;  4FN7 A;  2Q34 A;  2A7K A;  3U9S B;  4RYF A;  3T88 A;  1Q52 A;  4I52 A;  3TLF A;  3LAO A;  1WDK A;  3JU1 A;  3R9Q A;  2UZF A;  4HNK A;  4B3I A;  4GM2 A;  1HNO A;  2J5I I;  4J2U A;  1FC6 A;  2J5G D;  3TZ3 A;  3GF3 A;  2ZL0 A;  5DZK H;  4FB8 A;  2GTR A;  4MOU A;  1O8U A;  4ZDC A;  4ZDF A;  3H0S A;  2ZL4 A;  2VRE A;  4U0G H;  2F9I A;  3U9R B;  3HLN 1;  4ASI A;  5DTW A;  4KWB A;  5E0S H;  1UYR A;  3P85 A;  3QKA A;  3H0J A;  1WDM A;  4ZDB A;  1JXZ A;  3RRV A;  1SZO A;  2F9Y A;  2ZQR A;  5DU4 A;  4KD6 A;  3SWX A;  3QMJ A;  3KTI A;  1XNV A;  4JJT A;  3OME A;  3FDU A;  4FND A;  3WG5 A;  2BZR A;  3QXZ A;  3TRR A;  4K3W A;  1MJ3 A;  4L8K A;  1XX4 A;  1RJN A;  5G1Q A;  3ST9 A;  3H81 A;  5E0N X;  3GLM A;  3Q0G A;  1UIY A;  2CE3 A;  2J5I A;  1XNY A;  3K50 A;  4K2N A;  3PE8 A;  1HZD A;  3KTJ A;  4HC8 A;  3MFM A;  1EF8 A;  3ZWA A; 
#chains in the Genus database with same CATH homology
 5C90 A;  2PPY A;  5INF A;  5KDR A;  3R9S A;  3ZWC A;  1X0U A;  2FW2 A;  4NAR A;  4GHN A;  1N6D A;  2VSU A;  3BPP A;  4L6W A;  4NEK A;  1K39 A;  2CBY A;  4JCT A;  3H02 A;  5DTP A;  2J5G A;  3RST A;  4U19 A;  3TVU A;  2X24 A;  3BF0 A;  4FJW D;  3BPT A;  3M6N A;  1WZ8 A;  4Q0G A;  3HP0 A;  3KTH A;  3GF7 A;  3PZK A;  3HIN A;  4DI1 A;  3TV5 A;  3T8A A;  1ON9 A;  4Z0M A;  4K29 A;  3TDC A;  4EMM A;  2FBM A;  1RJM A;  4KNP A;  4JFC A;  2A7S A;  3PGQ A;  4U18 A;  2VSS E;  1ON3 A;  2VSS A;  4IZB A;  3TT6 A;  3STA A;  4JVT A;  3QRE A;  3U9T B;  5C9G A;  2W3P A;  4OG1 A;  5DZK A;  1Y7O A;  3MT6 A;  2EJ5 A;  1WDL A;  4ELX A;  2NP9 A;  4EML A;  4ZDE A;  4U0G A;  4JWV A;  4MI2 A;  4QIJ A;  5G1S A;  4ELW A;  5DU6 A;  1TYF A;  2VSU C;  4QFE A;  5E0S A;  4IZD A;  3T3W A;  1XO6 A;  4FNB A;  2F9Y B;  4NNQ A;  4OLQ A;  3R9T A;  5HUQ A;  4JYJ A;  1NZY A;  3QYR A;  3KTK A;  4JYL A;  1SG4 A;  5DL1 A;  4JOT A;  3TVW A;  1UYT A;  4FZW A;  3V5E A;  3Q0J A;  1FC9 A;  2PG8 A;  3DJA A;  4WCZ A;  2D3T A;  3ISA A;  1J7X A;  1TG6 A;  4KPK A;  3HE2 A;  2X58 A;  2VSS F;  3V5I A;  3P5M A;  2J5I B;  4RYF H;  4QII A;  2WTB A;  2YJG A;  5CTC A;  3T8B A;  5JBX A;  4ZDD A;  5KJP A;  2VSU E;  3NJB A;  2A81 A;  2ZL2 A;  5CTB A;  4LK5 A;  1DUB A;  4I4Z A;  4ELS A;  5KDR B;  3ZWB A;  3QK8 A;  3ZW9 A;  2IEX A;  5DUC A;  2QQ3 A;  1N6F A;  1Q51 A;  3GMA A;  4WYO B;  4JSB A;  4B3H A;  3KTG A;  1XNW A;  1YG6 A;  3I47 A;  3Q1T A;  3QWD A;  4WZ8 B;  3H0Q A;  3GKB A;  5DU8 A;  3VIV A;  1FC7 A;  4FZW C;  3TT7 A;  3OT6 A;  2VX2 A;  4EMP A;  1YG8 A;  5FUS A;  2DEO A;  4Q1I A;  3MYB A;  3OC7 A;  2HW5 A;  5MGB A;  5FIF A;  2Q35 A;  2F9I B;  4IZC A;  4JCS A;  3T89 A;  3G64 A;  4U1A A;  5IKL B;  4RCN A;  2VSU F;  3L3S A;  1UYV A;  3QXI A;  3RSI A;  3P2L A;  3IB9 A;  4YLH A;  3MOY A;  4FN8 A;  4G2R A;  4ZU2 A;  1UYS A;  1W2X A;  1OD4 A;  1N6E A;  1PIX A;  3BEZ A;  3KQF A;  4JCQ A;  2J5S A;  3K8X A;  4MXI A;  4B3J A;  2DUB A;  3NJD A;  3HRX A;  1EF9 A;  3IAV A;  2Q2X A;  3M6M A;  4JCR A;  4I42 A;  5DUF A;  1VRG A;  1NZY B;  5ING A;  1OD2 A;  1EY3 A;  5DKP A;  3ZW8 A;  1K32 A;  2C8T A;  2ZL3 A;  1HNU A;  3SLL A;  3R6H A;  1DCI A;  4OMR A;  3IBB A;  3FF6 A;  3PEA A;  5G1R A;  5JBW A;  2PBP A;  3Q7H A;  2FZS A;  4F47 A;  5INI A;  1FCF A;  3H0U A;  2ZQQ A;  4U0H A;  2F6Q A;  3LKE A;  3DOR A;  1PJH A;  3N6R B;  2F6I A;  4HDT A;  3R0O A;  4FN7 A;  2Q34 A;  2A7K A;  3U9S B;  4RYF A;  3T88 A;  1Q52 A;  4I52 A;  3TLF A;  3LAO A;  1WDK A;  3JU1 A;  3R9Q A;  2UZF A;  4HNK A;  4B3I A;  4GM2 A;  1HNO A;  2J5I I;  4J2U A;  1FC6 A;  2J5G D;  3TZ3 A;  3GF3 A;  2ZL0 A;  5DZK H;  4FB8 A;  2GTR A;  4MOU A;  1O8U A;  4ZDC A;  4ZDF A;  3H0S A;  2ZL4 A;  2VRE A;  4U0G H;  2F9I A;  3U9R B;  3HLN 1;  4ASI A;  5DTW A;  4KWB A;  5E0S H;  1UYR A;  3P85 A;  3QKA A;  3H0J A;  1WDM A;  4ZDB A;  1JXZ A;  3RRV A;  1SZO A;  2F9Y A;  2ZQR A;  5DU4 A;  4KD6 A;  3SWX A;  3QMJ A;  3KTI A;  1XNV A;  4JJT A;  3OME A;  3FDU A;  4FND A;  3WG5 A;  2BZR A;  3QXZ A;  3TRR A;  4K3W A;  1MJ3 A;  4L8K A;  1XX4 A;  1RJN A;  5G1Q A;  3ST9 A;  3H81 A;  5E0N X;  3GLM A;  3Q0G A;  1UIY A;  2CE3 A;  2J5I A;  1XNY A;  3K50 A;  4K2N A;  3PE8 A;  1HZD A;  3KTJ A;  4HC8 A;  3MFM A;  1EF8 A;  3ZWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...