4ZDFA

Crystal structure of yeast enoyl-coa isomerase helix-10 deletion (sceci2-h10) mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
256
Chain Sequence
b'EIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,2-trans-enoyl-CoA isomerase
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 94
structure length 256
sequence length 264
chains with identical sequence B
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zdfA00
3HP0A 2F6IA 3R9TA 4FJWD 3RSIA 2F9YB 2J5IB 1JXZA 3ZW8A 4EMLA 2J5II 4U18A 2A7KA 4U19A 2EJ5A 3G64A 4JWVA 3P85A 4B3IA 1YG6A 4NEKA 1PIXA 1ON3A 4K3WA 3OT6A 1FC9A 2UZFA 3ZW9A 2ZQQA 1XO6A 3R0OA 5DTWA 3TVWA 3ZWAA 1SZOA 1XNYA 2DEOA 1FCFA 1DUBA 2WTBA 4ZDEA 3STAA 5DUCA 4Z0MA 5E0NX 2VSUE 5KDRA 4HNKA 1X0UA 3R9SA 3IBBA 2CBYA 1UYTA 2J5SA 3T89A 2VX2A 3IB9A 4JCRA 3K8XA 3FF6A 3Q7HA 3DORA 4JCQA 5KDRB 3GF7A 3KQFA 3RRVA 4ELWA 4GHNA 1OD2A 1Y7OA 5CTCA 2Q35A 3SLLA 5CTBA 1XNWA 4FNBA 4K2NA 4HC8A 3H02A 4QIJA 4EMMA 1O8UA 3SWXA 5DUFA 4IZCA 2VSUA 1RJNA 4JVTA 3Q0GA 3TDCA 2Q34A 1FC6A 1W2XA 2NP9A 3QXIA 2VSSE 4U0HA 5G1SA 2F9YA 3P2LA 2J5IA 3NJDA 4KD6A 5IKLB 1N6EA 3ST9A 4WZ8B 3U9TB 4FN7A 2CE3A 2W3PA 4FB8A 3PZKA 4ZDBA 4I4ZA 5MGBA 3T88A 1N6FA 2HW5A 1ON9A 3H81A 1WDKA 5DU6A 2VSUC 1XX4A 2VSSF 1HNOA 3JU1A 4QIIA 3KTJA 4JFCA 2VSSA 3ZWCA 1DCIA 5JBWA 3OC7A 3PEAA 1Q52A 3V5IA 2FZSA 1UIYA 4U0GH 4Q0GA 3T3WA 3H0UA 4JYLA 2ZQRA 2DUBA 3BEZA 3KTIA 4U0GA 4MOUA 5DU4A 3GMAA 1K39A 3H0QA 3QMJA 3I47A 1MJ3A 1UYVA 3FDUA 5JBXA 3KTGA 3TT7A 2ZL0A 4RYFH 5DZKH 4JSBA 3ISAA 4RYFA 5DZKA 1RJMA 2C8TA 3QWDA 2VSUF 4ZU2A 1EY3A 4FZWA 3TLFA 4B3HA 5INGA 2J5GD 5DTPA 4JYJA 4NNQA 1SG4A 2PG8A 1UYRA 4ZDDA 3LAOA 1HZDA 1UYSA 3MFMA 1XNVA 4ZDFA 1FC7A 2F9IA 1K32A 2QQ3A 4K29A 3ZWBA 3U9SB 4OMRA 4DI1A 3Q1TA 3TRRA 3HE2A 3KTKA 5FIFA 3QK8A 2D3TA 2A7SA 4WYOB 3KTHA 2IEXA 2GTRA 3R9QA 4FN8A 5DL1A 3HRXA 3MYBA 4GM2A 2PPYA 3T8AA 2F9IB 3LKEA 3GKBA 4YLHA 3OMEA 4FZWC 4JCTA 4L8KA 3QXZA 4JJTA 3TV5A 4ASIA 4ELSA 3HLN1 1NZYA 3H0SA 3QKAA 4ELXA 3U9RB 5G1RA 4JCSA 5E0SH 4KNPA 3IAVA 3NJBA 5KJPA 2J5GA 4LK5A 4IZBA 5G1QA 3BPPA 3R6HA 5E0SA 3H0JA 4EMPA 1NZYB 3MOYA 4MI2A 3M6MA 1J7XA 2FW2A 3RSTA 2Q2XA 1EF8A 4FNDA 2ZL3A 4B3JA 3TZ3A 3M6NA 4RCNA 3WG5A 5DU8A 1YG8A 3TT6A 2PBPA 5DKPA 2X24A 3PE8A 4QFEA 2FBMA 2VREA 1TYFA 2A81A 1Q51A 3V5EA 3GF3A 4G2RA 5INIA 1WZ8A 3GLMA 4I52A 1VRGA 4MXIA 1PJHA 2X58A 2F6QA 4L6WA 1TG6A 2ZL4A 4OG1A 1WDLA 3PGQA 2BZRA 4ZDCA 5C90A 4F47A 3P5MA 2ZL2A 4OLQA 3HINA 4KPKA 4I42A 1HNUA 1OD4A 3DJAA 3N6RB 4KWBA 1EF9A 5INFA 3T8BA 3MT6A 3BF0A 4JOTA 3VIVA 4IZDA 3TVUA 4WCZA 4U1AA 3Q0JA 3QYRA 3QREA 5FUSA 5C9GA 3K50A 3L3SA 4Q1IA 1N6DA 1WDMA
chains in the Genus database with same CATH superfamily
3HP0A 2F6IA 3R9TA 4FJWD 3RSIA 2F9YB 2J5IB 1JXZA 3ZW8A 4EMLA 2J5II 4U18A 4J2UA 2A7KA 4U19A 2EJ5A 3G64A 4JWVA 3P85A 4B3IA 1YG6A 4NEKA 1PIXA 1ON3A 4K3WA 3OT6A 1FC9A 2UZFA 3ZW9A 2ZQQA 1XO6A 3R0OA 5DTWA 3TVWA 3ZWAA 1SZOA 1XNYA 2DEOA 1FCFA 1DUBA 2WTBA 4ZDEA 3STAA 5DUCA 4Z0MA 5E0NX 2VSUE 2YJGA 5KDRA 4HNKA 1X0UA 3R9SA 3IBBA 2CBYA 1UYTA 2J5SA 3T89A 2VX2A 3IB9A 4JCRA 3K8XA 3FF6A 3Q7HA 3DORA 4JCQA 5KDRB 3GF7A 3KQFA 3RRVA 4ELWA 4GHNA 1OD2A 1Y7OA 5CTCA 2Q35A 3SLLA 5CTBA 1XNWA 4FNBA 4K2NA 4HC8A 3H02A 4QIJA 4EMMA 1O8UA 3SWXA 5DUFA 4IZCA 2VSUA 1RJNA 4JVTA 3Q0GA 3TDCA 2Q34A 1FC6A 1W2XA 2NP9A 3QXIA 2VSSE 4U0HA 5G1SA 2F9YA 3P2LA 2J5IA 3NJDA 4KD6A 5IKLB 1N6EA 3ST9A 4WZ8B 3U9TB 4FN7A 2CE3A 2W3PA 4FB8A 3PZKA 4ZDBA 4I4ZA 5MGBA 3T88A 1N6FA 2HW5A 1ON9A 3H81A 1WDKA 5DU6A 2VSUC 1XX4A 2VSSF 1HNOA 3JU1A 4QIIA 3KTJA 4JFCA 2VSSA 3ZWCA 1DCIA 5JBWA 3OC7A 3PEAA 1Q52A 3V5IA 2FZSA 1UIYA 4U0GH 4Q0GA 3T3WA 3H0UA 4JYLA 2ZQRA 2DUBA 3BEZA 3KTIA 4U0GA 4MOUA 5DU4A 3GMAA 1K39A 3H0QA 3QMJA 3I47A 1MJ3A 1UYVA 3FDUA 5JBXA 3KTGA 3TT7A 2ZL0A 4RYFH 5DZKH 4JSBA 3ISAA 4RYFA 5DZKA 1RJMA 2C8TA 3QWDA 2VSUF 4ZU2A 1EY3A 4FZWA 3TLFA 4B3HA 5INGA 2J5GD 5DTPA 4JYJA 4NNQA 1SG4A 2PG8A 1UYRA 4ZDDA 5HUQA 4NARA 3LAOA 1HZDA 1UYSA 3MFMA 1XNVA 4ZDFA 1FC7A 2F9IA 1K32A 2QQ3A 4K29A 3ZWBA 3U9SB 4OMRA 4DI1A 3Q1TA 3TRRA 3HE2A 3KTKA 5FIFA 3QK8A 2D3TA 2A7SA 4WYOB 3KTHA 2IEXA 2GTRA 3R9QA 4FN8A 5DL1A 3HRXA 3MYBA 4GM2A 2PPYA 3T8AA 2F9IB 3LKEA 3GKBA 4YLHA 3OMEA 4FZWC 4JCTA 4L8KA 3QXZA 4JJTA 3TV5A 4ASIA 4ELSA 3HLN1 1NZYA 3H0SA 3QKAA 4ELXA 3U9RB 5G1RA 4JCSA 5E0SH 4KNPA 3IAVA 3NJBA 5KJPA 2J5GA 4LK5A 3BPTA 4IZBA 5G1QA 3BPPA 3R6HA 5E0SA 3H0JA 4EMPA 1NZYB 3MOYA 4MI2A 3M6MA 1J7XA 2FW2A 3RSTA 2Q2XA 1EF8A 4FNDA 4HDTA 2ZL3A 4B3JA 3TZ3A 3M6NA 4RCNA 3WG5A 5DU8A 1YG8A 3TT6A 2PBPA 5DKPA 2X24A 3PE8A 4QFEA 2FBMA 2VREA 1TYFA 2A81A 1Q51A 3V5EA 3GF3A 4G2RA 5INIA 1WZ8A 3GLMA 4I52A 1VRGA 4MXIA 1PJHA 2X58A 2F6QA 4L6WA 1TG6A 2ZL4A 4OG1A 1WDLA 3PGQA 2BZRA 4ZDCA 5C90A 4F47A 3P5MA 2ZL2A 4OLQA 3HINA 4KPKA 4I42A 1HNUA 1OD4A 3DJAA 3N6RB 4KWBA 1EF9A 5INFA 3T8BA 3MT6A 3BF0A 4JOTA 3VIVA 4IZDA 3TVUA 4WCZA 4U1AA 3Q0JA 3QYRA 3QREA 5FUSA 5C9GA 3K50A 3L3SA 4Q1IA 1N6DA 1WDMA
chains in the Genus database with same CATH topology
3HP0A 2F6IA 3R9TA 4FJWD 3RSIA 2F9YB 2J5IB 1JXZA 3ZW8A 4EMLA 2J5II 4U18A 4J2UA 2A7KA 4U19A 2EJ5A 3G64A 4JWVA 3P85A 4B3IA 1YG6A 4NEKA 1PIXA 1ON3A 4K3WA 3OT6A 1FC9A 2UZFA 3ZW9A 2ZQQA 1XO6A 3R0OA 5DTWA 3TVWA 3ZWAA 1SZOA 1XNYA 2DEOA 1FCFA 1DUBA 2WTBA 4ZDEA 3STAA 5DUCA 4Z0MA 5E0NX 2VSUE 2YJGA 5KDRA 4HNKA 1X0UA 3R9SA 3IBBA 2CBYA 1UYTA 2J5SA 3T89A 2VX2A 3IB9A 4JCRA 3K8XA 3FF6A 3Q7HA 3DORA 4JCQA 5KDRB 3GF7A 3KQFA 3RRVA 4ELWA 4GHNA 1OD2A 1Y7OA 5CTCA 2Q35A 3SLLA 5CTBA 1XNWA 4FNBA 4K2NA 4HC8A 3H02A 4QIJA 4EMMA 1O8UA 3SWXA 5DUFA 4IZCA 2VSUA 1RJNA 4JVTA 3Q0GA 3TDCA 2Q34A 1FC6A 1W2XA 2NP9A 3QXIA 2VSSE 4U0HA 5G1SA 2F9YA 3P2LA 2J5IA 3NJDA 4KD6A 5IKLB 1N6EA 3ST9A 4WZ8B 3U9TB 4FN7A 2CE3A 2W3PA 4FB8A 3PZKA 4ZDBA 4I4ZA 5MGBA 3T88A 1N6FA 2HW5A 1ON9A 3H81A 1WDKA 5DU6A 2VSUC 1XX4A 2VSSF 1HNOA 3JU1A 4QIIA 3KTJA 4JFCA 2VSSA 3ZWCA 1DCIA 5JBWA 3OC7A 3PEAA 1Q52A 3V5IA 2FZSA 1UIYA 4U0GH 4Q0GA 3T3WA 3H0UA 4JYLA 2ZQRA 2DUBA 3BEZA 3KTIA 4U0GA 4MOUA 5DU4A 3GMAA 1K39A 3H0QA 3QMJA 3I47A 1MJ3A 1UYVA 3FDUA 5JBXA 3KTGA 3TT7A 2ZL0A 4RYFH 5DZKH 4JSBA 3ISAA 4RYFA 5DZKA 1RJMA 2C8TA 3QWDA 2VSUF 4ZU2A 1EY3A 4FZWA 3TLFA 4B3HA 5INGA 2J5GD 5DTPA 4JYJA 4NNQA 1SG4A 2PG8A 1UYRA 4ZDDA 5HUQA 4NARA 3LAOA 1HZDA 1UYSA 3MFMA 1XNVA 4ZDFA 1FC7A 2F9IA 1K32A 2QQ3A 4K29A 3ZWBA 3U9SB 4OMRA 4DI1A 3Q1TA 3TRRA 3HE2A 3KTKA 5FIFA 3QK8A 2D3TA 2A7SA 4WYOB 3KTHA 2IEXA 2GTRA 3R9QA 4FN8A 5DL1A 3HRXA 3MYBA 4GM2A 2PPYA 3T8AA 2F9IB 3LKEA 3GKBA 4YLHA 3OMEA 4FZWC 4JCTA 4L8KA 3QXZA 4JJTA 3TV5A 4ASIA 4ELSA 3HLN1 1NZYA 3H0SA 3QKAA 4ELXA 3U9RB 5G1RA 4JCSA 5E0SH 4KNPA 3IAVA 3NJBA 5KJPA 2J5GA 4LK5A 3BPTA 4IZBA 5G1QA 3BPPA 3R6HA 5E0SA 3H0JA 4EMPA 1NZYB 3MOYA 4MI2A 3M6MA 1J7XA 2FW2A 3RSTA 2Q2XA 1EF8A 4FNDA 4HDTA 2ZL3A 4B3JA 3TZ3A 3M6NA 4RCNA 3WG5A 5DU8A 1YG8A 3TT6A 2PBPA 5DKPA 2X24A 3PE8A 4QFEA 2FBMA 2VREA 1TYFA 2A81A 1Q51A 3V5EA 3GF3A 4G2RA 5INIA 1WZ8A 3GLMA 4I52A 1VRGA 4MXIA 1PJHA 2X58A 2F6QA 4L6WA 1TG6A 2ZL4A 4OG1A 1WDLA 3PGQA 2BZRA 4ZDCA 5C90A 4F47A 3P5MA 2ZL2A 4OLQA 3HINA 4KPKA 4I42A 1HNUA 1OD4A 3DJAA 3N6RB 4KWBA 1EF9A 5INFA 3T8BA 3MT6A 3BF0A 4JOTA 3VIVA 4IZDA 3TVUA 4WCZA 4U1AA 3Q0JA 3QYRA 3QREA 5FUSA 5C9GA 3K50A 3L3SA 4Q1IA 1N6DA 1WDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP0 A;  2F6I A;  3R9T A;  4FJW D;  3RSI A;  2F9Y B;  2J5I B;  1JXZ A;  3ZW8 A;  4EML A;  2J5I I;  4U18 A;  2A7K A;  4U19 A;  2EJ5 A;  3G64 A;  4JWV A;  3P85 A;  4B3I A;  1YG6 A;  4NEK A;  1PIX A;  1ON3 A;  4K3W A;  3OT6 A;  1FC9 A;  2UZF A;  3ZW9 A;  2ZQQ A;  1XO6 A;  3R0O A;  5DTW A;  3TVW A;  3ZWA A;  1SZO A;  1XNY A;  2DEO A;  1FCF A;  1DUB A;  2WTB A;  4ZDE A;  3STA A;  5DUC A;  4Z0M A;  5E0N X;  2VSU E;  5KDR A;  4HNK A;  1X0U A;  3R9S A;  3IBB A;  2CBY A;  1UYT A;  2J5S A;  3T89 A;  2VX2 A;  3IB9 A;  4JCR A;  3K8X A;  3FF6 A;  3Q7H A;  3DOR A;  4JCQ A;  5KDR B;  3GF7 A;  3KQF A;  3RRV A;  4ELW A;  4GHN A;  1OD2 A;  1Y7O A;  5CTC A;  2Q35 A;  3SLL A;  5CTB A;  1XNW A;  4FNB A;  4K2N A;  4HC8 A;  3H02 A;  4QIJ A;  4EMM A;  1O8U A;  3SWX A;  5DUF A;  4IZC A;  2VSU A;  1RJN A;  4JVT A;  3Q0G A;  3TDC A;  2Q34 A;  1FC6 A;  1W2X A;  2NP9 A;  3QXI A;  2VSS E;  4U0H A;  5G1S A;  2F9Y A;  3P2L A;  2J5I A;  3NJD A;  4KD6 A;  5IKL B;  1N6E A;  3ST9 A;  4WZ8 B;  3U9T B;  4FN7 A;  2CE3 A;  2W3P A;  4FB8 A;  3PZK A;  4ZDB A;  4I4Z A;  5MGB A;  3T88 A;  1N6F A;  2HW5 A;  1ON9 A;  3H81 A;  1WDK A;  5DU6 A;  2VSU C;  1XX4 A;  2VSS F;  1HNO A;  3JU1 A;  4QII A;  3KTJ A;  4JFC A;  2VSS A;  3ZWC A;  1DCI A;  5JBW A;  3OC7 A;  3PEA A;  1Q52 A;  3V5I A;  2FZS A;  1UIY A;  4U0G H;  4Q0G A;  3T3W A;  3H0U A;  4JYL A;  2ZQR A;  2DUB A;  3BEZ A;  3KTI A;  4U0G A;  4MOU A;  5DU4 A;  3GMA A;  1K39 A;  3H0Q A;  3QMJ A;  3I47 A;  1MJ3 A;  1UYV A;  3FDU A;  5JBX A;  3KTG A;  3TT7 A;  2ZL0 A;  4RYF H;  5DZK H;  4JSB A;  3ISA A;  4RYF A;  5DZK A;  1RJM A;  2C8T A;  3QWD A;  2VSU F;  4ZU2 A;  1EY3 A;  4FZW A;  3TLF A;  4B3H A;  5ING A;  2J5G D;  5DTP A;  4JYJ A;  4NNQ A;  1SG4 A;  2PG8 A;  1UYR A;  4ZDD A;  3LAO A;  1HZD A;  1UYS A;  3MFM A;  1XNV A;  4ZDF A;  1FC7 A;  2F9I A;  1K32 A;  2QQ3 A;  4K29 A;  3ZWB A;  3U9S B;  4OMR A;  4DI1 A;  3Q1T A;  3TRR A;  3HE2 A;  3KTK A;  5FIF A;  3QK8 A;  2D3T A;  2A7S A;  4WYO B;  3KTH A;  2IEX A;  2GTR A;  3R9Q A;  4FN8 A;  5DL1 A;  3HRX A;  3MYB A;  4GM2 A;  2PPY A;  3T8A A;  2F9I B;  3LKE A;  3GKB A;  4YLH A;  3OME A;  4FZW C;  4JCT A;  4L8K A;  3QXZ A;  4JJT A;  3TV5 A;  4ASI A;  4ELS A;  3HLN 1;  1NZY A;  3H0S A;  3QKA A;  4ELX A;  3U9R B;  5G1R A;  4JCS A;  5E0S H;  4KNP A;  3IAV A;  3NJB A;  5KJP A;  2J5G A;  4LK5 A;  4IZB A;  5G1Q A;  3BPP A;  3R6H A;  5E0S A;  3H0J A;  4EMP A;  1NZY B;  3MOY A;  4MI2 A;  3M6M A;  1J7X A;  2FW2 A;  3RST A;  2Q2X A;  1EF8 A;  4FND A;  2ZL3 A;  4B3J A;  3TZ3 A;  3M6N A;  4RCN A;  3WG5 A;  5DU8 A;  1YG8 A;  3TT6 A;  2PBP A;  5DKP A;  2X24 A;  3PE8 A;  4QFE A;  2FBM A;  2VRE A;  1TYF A;  2A81 A;  1Q51 A;  3V5E A;  3GF3 A;  4G2R A;  5INI A;  1WZ8 A;  3GLM A;  4I52 A;  1VRG A;  4MXI A;  1PJH A;  2X58 A;  2F6Q A;  4L6W A;  1TG6 A;  2ZL4 A;  4OG1 A;  1WDL A;  3PGQ A;  2BZR A;  4ZDC A;  5C90 A;  4F47 A;  3P5M A;  2ZL2 A;  4OLQ A;  3HIN A;  4KPK A;  4I42 A;  1HNU A;  1OD4 A;  3DJA A;  3N6R B;  4KWB A;  1EF9 A;  5INF A;  3T8B A;  3MT6 A;  3BF0 A;  4JOT A;  3VIV A;  4IZD A;  3TVU A;  4WCZ A;  4U1A A;  3Q0J A;  3QYR A;  3QRE A;  5FUS A;  5C9G A;  3K50 A;  3L3S A;  4Q1I A;  1N6D A;  1WDM A; 
#chains in the Genus database with same CATH topology
 3HP0 A;  2F6I A;  3R9T A;  4FJW D;  3RSI A;  2F9Y B;  2J5I B;  1JXZ A;  3ZW8 A;  4EML A;  2J5I I;  4U18 A;  4J2U A;  2A7K A;  4U19 A;  2EJ5 A;  3G64 A;  4JWV A;  3P85 A;  4B3I A;  1YG6 A;  4NEK A;  1PIX A;  1ON3 A;  4K3W A;  3OT6 A;  1FC9 A;  2UZF A;  3ZW9 A;  2ZQQ A;  1XO6 A;  3R0O A;  5DTW A;  3TVW A;  3ZWA A;  1SZO A;  1XNY A;  2DEO A;  1FCF A;  1DUB A;  2WTB A;  4ZDE A;  3STA A;  5DUC A;  4Z0M A;  5E0N X;  2VSU E;  2YJG A;  5KDR A;  4HNK A;  1X0U A;  3R9S A;  3IBB A;  2CBY A;  1UYT A;  2J5S A;  3T89 A;  2VX2 A;  3IB9 A;  4JCR A;  3K8X A;  3FF6 A;  3Q7H A;  3DOR A;  4JCQ A;  5KDR B;  3GF7 A;  3KQF A;  3RRV A;  4ELW A;  4GHN A;  1OD2 A;  1Y7O A;  5CTC A;  2Q35 A;  3SLL A;  5CTB A;  1XNW A;  4FNB A;  4K2N A;  4HC8 A;  3H02 A;  4QIJ A;  4EMM A;  1O8U A;  3SWX A;  5DUF A;  4IZC A;  2VSU A;  1RJN A;  4JVT A;  3Q0G A;  3TDC A;  2Q34 A;  1FC6 A;  1W2X A;  2NP9 A;  3QXI A;  2VSS E;  4U0H A;  5G1S A;  2F9Y A;  3P2L A;  2J5I A;  3NJD A;  4KD6 A;  5IKL B;  1N6E A;  3ST9 A;  4WZ8 B;  3U9T B;  4FN7 A;  2CE3 A;  2W3P A;  4FB8 A;  3PZK A;  4ZDB A;  4I4Z A;  5MGB A;  3T88 A;  1N6F A;  2HW5 A;  1ON9 A;  3H81 A;  1WDK A;  5DU6 A;  2VSU C;  1XX4 A;  2VSS F;  1HNO A;  3JU1 A;  4QII A;  3KTJ A;  4JFC A;  2VSS A;  3ZWC A;  1DCI A;  5JBW A;  3OC7 A;  3PEA A;  1Q52 A;  3V5I A;  2FZS A;  1UIY A;  4U0G H;  4Q0G A;  3T3W A;  3H0U A;  4JYL A;  2ZQR A;  2DUB A;  3BEZ A;  3KTI A;  4U0G A;  4MOU A;  5DU4 A;  3GMA A;  1K39 A;  3H0Q A;  3QMJ A;  3I47 A;  1MJ3 A;  1UYV A;  3FDU A;  5JBX A;  3KTG A;  3TT7 A;  2ZL0 A;  4RYF H;  5DZK H;  4JSB A;  3ISA A;  4RYF A;  5DZK A;  1RJM A;  2C8T A;  3QWD A;  2VSU F;  4ZU2 A;  1EY3 A;  4FZW A;  3TLF A;  4B3H A;  5ING A;  2J5G D;  5DTP A;  4JYJ A;  4NNQ A;  1SG4 A;  2PG8 A;  1UYR A;  4ZDD A;  5HUQ A;  4NAR A;  3LAO A;  1HZD A;  1UYS A;  3MFM A;  1XNV A;  4ZDF A;  1FC7 A;  2F9I A;  1K32 A;  2QQ3 A;  4K29 A;  3ZWB A;  3U9S B;  4OMR A;  4DI1 A;  3Q1T A;  3TRR A;  3HE2 A;  3KTK A;  5FIF A;  3QK8 A;  2D3T A;  2A7S A;  4WYO B;  3KTH A;  2IEX A;  2GTR A;  3R9Q A;  4FN8 A;  5DL1 A;  3HRX A;  3MYB A;  4GM2 A;  2PPY A;  3T8A A;  2F9I B;  3LKE A;  3GKB A;  4YLH A;  3OME A;  4FZW C;  4JCT A;  4L8K A;  3QXZ A;  4JJT A;  3TV5 A;  4ASI A;  4ELS A;  3HLN 1;  1NZY A;  3H0S A;  3QKA A;  4ELX A;  3U9R B;  5G1R A;  4JCS A;  5E0S H;  4KNP A;  3IAV A;  3NJB A;  5KJP A;  2J5G A;  4LK5 A;  3BPT A;  4IZB A;  5G1Q A;  3BPP A;  3R6H A;  5E0S A;  3H0J A;  4EMP A;  1NZY B;  3MOY A;  4MI2 A;  3M6M A;  1J7X A;  2FW2 A;  3RST A;  2Q2X A;  1EF8 A;  4FND A;  4HDT A;  2ZL3 A;  4B3J A;  3TZ3 A;  3M6N A;  4RCN A;  3WG5 A;  5DU8 A;  1YG8 A;  3TT6 A;  2PBP A;  5DKP A;  2X24 A;  3PE8 A;  4QFE A;  2FBM A;  2VRE A;  1TYF A;  2A81 A;  1Q51 A;  3V5E A;  3GF3 A;  4G2R A;  5INI A;  1WZ8 A;  3GLM A;  4I52 A;  1VRG A;  4MXI A;  1PJH A;  2X58 A;  2F6Q A;  4L6W A;  1TG6 A;  2ZL4 A;  4OG1 A;  1WDL A;  3PGQ A;  2BZR A;  4ZDC A;  5C90 A;  4F47 A;  3P5M A;  2ZL2 A;  4OLQ A;  3HIN A;  4KPK A;  4I42 A;  1HNU A;  1OD4 A;  3DJA A;  3N6R B;  4KWB A;  1EF9 A;  5INF A;  3T8B A;  3MT6 A;  3BF0 A;  4JOT A;  3VIV A;  4IZD A;  3TVU A;  4WCZ A;  4U1A A;  3Q0J A;  3QYR A;  3QRE A;  5FUS A;  5C9G A;  3K50 A;  3L3S A;  4Q1I A;  1N6D A;  1WDM A; 
#chains in the Genus database with same CATH homology
 3HP0 A;  2F6I A;  3R9T A;  4FJW D;  3RSI A;  2F9Y B;  2J5I B;  1JXZ A;  3ZW8 A;  4EML A;  2J5I I;  4U18 A;  4J2U A;  2A7K A;  4U19 A;  2EJ5 A;  3G64 A;  4JWV A;  3P85 A;  4B3I A;  1YG6 A;  4NEK A;  1PIX A;  1ON3 A;  4K3W A;  3OT6 A;  1FC9 A;  2UZF A;  3ZW9 A;  2ZQQ A;  1XO6 A;  3R0O A;  5DTW A;  3TVW A;  3ZWA A;  1SZO A;  1XNY A;  2DEO A;  1FCF A;  1DUB A;  2WTB A;  4ZDE A;  3STA A;  5DUC A;  4Z0M A;  5E0N X;  2VSU E;  2YJG A;  5KDR A;  4HNK A;  1X0U A;  3R9S A;  3IBB A;  2CBY A;  1UYT A;  2J5S A;  3T89 A;  2VX2 A;  3IB9 A;  4JCR A;  3K8X A;  3FF6 A;  3Q7H A;  3DOR A;  4JCQ A;  5KDR B;  3GF7 A;  3KQF A;  3RRV A;  4ELW A;  4GHN A;  1OD2 A;  1Y7O A;  5CTC A;  2Q35 A;  3SLL A;  5CTB A;  1XNW A;  4FNB A;  4K2N A;  4HC8 A;  3H02 A;  4QIJ A;  4EMM A;  1O8U A;  3SWX A;  5DUF A;  4IZC A;  2VSU A;  1RJN A;  4JVT A;  3Q0G A;  3TDC A;  2Q34 A;  1FC6 A;  1W2X A;  2NP9 A;  3QXI A;  2VSS E;  4U0H A;  5G1S A;  2F9Y A;  3P2L A;  2J5I A;  3NJD A;  4KD6 A;  5IKL B;  1N6E A;  3ST9 A;  4WZ8 B;  3U9T B;  4FN7 A;  2CE3 A;  2W3P A;  4FB8 A;  3PZK A;  4ZDB A;  4I4Z A;  5MGB A;  3T88 A;  1N6F A;  2HW5 A;  1ON9 A;  3H81 A;  1WDK A;  5DU6 A;  2VSU C;  1XX4 A;  2VSS F;  1HNO A;  3JU1 A;  4QII A;  3KTJ A;  4JFC A;  2VSS A;  3ZWC A;  1DCI A;  5JBW A;  3OC7 A;  3PEA A;  1Q52 A;  3V5I A;  2FZS A;  1UIY A;  4U0G H;  4Q0G A;  3T3W A;  3H0U A;  4JYL A;  2ZQR A;  2DUB A;  3BEZ A;  3KTI A;  4U0G A;  4MOU A;  5DU4 A;  3GMA A;  1K39 A;  3H0Q A;  3QMJ A;  3I47 A;  1MJ3 A;  1UYV A;  3FDU A;  5JBX A;  3KTG A;  3TT7 A;  2ZL0 A;  4RYF H;  5DZK H;  4JSB A;  3ISA A;  4RYF A;  5DZK A;  1RJM A;  2C8T A;  3QWD A;  2VSU F;  4ZU2 A;  1EY3 A;  4FZW A;  3TLF A;  4B3H A;  5ING A;  2J5G D;  5DTP A;  4JYJ A;  4NNQ A;  1SG4 A;  2PG8 A;  1UYR A;  4ZDD A;  5HUQ A;  4NAR A;  3LAO A;  1HZD A;  1UYS A;  3MFM A;  1XNV A;  4ZDF A;  1FC7 A;  2F9I A;  1K32 A;  2QQ3 A;  4K29 A;  3ZWB A;  3U9S B;  4OMR A;  4DI1 A;  3Q1T A;  3TRR A;  3HE2 A;  3KTK A;  5FIF A;  3QK8 A;  2D3T A;  2A7S A;  4WYO B;  3KTH A;  2IEX A;  2GTR A;  3R9Q A;  4FN8 A;  5DL1 A;  3HRX A;  3MYB A;  4GM2 A;  2PPY A;  3T8A A;  2F9I B;  3LKE A;  3GKB A;  4YLH A;  3OME A;  4FZW C;  4JCT A;  4L8K A;  3QXZ A;  4JJT A;  3TV5 A;  4ASI A;  4ELS A;  3HLN 1;  1NZY A;  3H0S A;  3QKA A;  4ELX A;  3U9R B;  5G1R A;  4JCS A;  5E0S H;  4KNP A;  3IAV A;  3NJB A;  5KJP A;  2J5G A;  4LK5 A;  3BPT A;  4IZB A;  5G1Q A;  3BPP A;  3R6H A;  5E0S A;  3H0J A;  4EMP A;  1NZY B;  3MOY A;  4MI2 A;  3M6M A;  1J7X A;  2FW2 A;  3RST A;  2Q2X A;  1EF8 A;  4FND A;  4HDT A;  2ZL3 A;  4B3J A;  3TZ3 A;  3M6N A;  4RCN A;  3WG5 A;  5DU8 A;  1YG8 A;  3TT6 A;  2PBP A;  5DKP A;  2X24 A;  3PE8 A;  4QFE A;  2FBM A;  2VRE A;  1TYF A;  2A81 A;  1Q51 A;  3V5E A;  3GF3 A;  4G2R A;  5INI A;  1WZ8 A;  3GLM A;  4I52 A;  1VRG A;  4MXI A;  1PJH A;  2X58 A;  2F6Q A;  4L6W A;  1TG6 A;  2ZL4 A;  4OG1 A;  1WDL A;  3PGQ A;  2BZR A;  4ZDC A;  5C90 A;  4F47 A;  3P5M A;  2ZL2 A;  4OLQ A;  3HIN A;  4KPK A;  4I42 A;  1HNU A;  1OD4 A;  3DJA A;  3N6R B;  4KWB A;  1EF9 A;  5INF A;  3T8B A;  3MT6 A;  3BF0 A;  4JOT A;  3VIV A;  4IZD A;  3TVU A;  4WCZ A;  4U1A A;  3Q0J A;  3QYR A;  3QRE A;  5FUS A;  5C9G A;  3K50 A;  3L3S A;  4Q1I A;  1N6D A;  1WDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...