4ZDFA

Crystal structure of yeast enoyl-coa isomerase helix-10 deletion (sceci2-h10) mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
256
Chain Sequence
EIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords 3,2-trans-enoyl-CoA isomerase
total genus 94
structure length 256
sequence length 264
chains with identical sequence B
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zdfA00
5KDRB 3WG5A 4OG1A 2FBMA 4K3WA 3ST9A 2IEXA 4I52A 1JXZA 5G1RA 3KTIA 3LAOA 3IB9A 3H0SA 4L8KA 1WDKA 1Q51A 4B3HA 3MYBA 4FJWD 4NEKA 1N6FA 2D3TA 3STAA 1VRGA 3R6HA 2BZRA 3I47A 4I4ZA 4K29A 1HNUA 4U0GA 4DI1A 2CBYA 2F9YA 4G2RA 2HW5A 3TDCA 3DORA 1WDMA 4JSBA 3IAVA 3TZ3A 4FZWC 2CE3A 3T3WA 3KTJA 4ZDCA 3PGQA 3HRXA 3R9SA 1WZ8A 1EF8A 4L6WA 3TVUA 3V5EA 2ZQQA 3HE2A 4YLHA 3R9QA 1EF9A 3KQFA 1FC7A 1Y7OA 5INIA 4NNQA 4B3JA 3K50A 3Q7HA 1N6EA 4JVTA 1X0UA 1FC9A 3DJAA 3T88A 2F9IA 3T8AA 2J5GA 2Q35A 5DTPA 3TT7A 2WTBA 3PE8A 5C9GA 3M6NA 2J5IA 4F47A 4GHNA 4U18A 5G1SA 2ZL0A 3KTGA 3G64A 4FNDA 4HNKA 3H81A 3VIVA 2J5GD 1TYFA 4U1AA 3RRVA 4JJTA 4FZWA 1RJMA 5DL1A 2ZL2A 5CTCA 3GF3A 4OMRA 2DEOA 4Q1IA 4RYFH 1XNWA 4EMPA 2J5II 2VSSE 4Q0GA 3V5IA 5DU8A 3RSIA 3M6MA 4JYJA 5DU4A 3R9TA 3QREA 5E0SH 4JCSA 3QK8A 3BF0A 3QYRA 1ON9A 4ZDEA 3MT6A 1NZYA 1UIYA 5INFA 4KNPA 4RYFA 5JBXA 5KJPA 2F9YB 4ELSA 2VSUF 3FDUA 4FN8A 4IZDA 3GKBA 1XO6A 5INGA 4U19A 2EJ5A 1K32A 2PPYA 4K2NA 3L3SA 4FB8A 5CTBA 1NZYB 1DUBA 3P5MA 4RCNA 2ZL3A 1K39A 2J5SA 4IZBA 2ZL4A 2FZSA 2X58A 5DKPA 5DUFA 3RSTA 3MOYA 1OD4A 4ELWA 5IKLB 3HP0A 5FIFA 4FNBA 3H02A 2VSUA 1UYTA 4QIJA 2J5IB 4ELXA 3KTHA 4JFCA 5DUCA 3K8XA 5DTWA 1XNYA 3ZW9A 3FF6A 3T8BA 2F6IA 2Q2XA 4HC8A 3ISAA 2W3PA 4KD6A 4JWVA 4U0GH 4IZCA 2DUBA 1YG8A 1DCIA 2UZFA 1UYSA 3SWXA 4FN7A 3QMJA 4B3IA 3GLMA 1XNVA 3QKAA 1MJ3A 3U9TB 2GTRA 4EMMA 4QIIA 4EMLA 4GM2A 1ON3A 3IBBA 3TLFA 3H0UA 2VSSF 4MI2A 1OD2A 4MOUA 4KPKA 5DZKA 1RJNA 1HZDA 3HINA 3R0OA 4JCQA 4MXIA 3TV5A 1Q52A 2A81A 4JCRA 1UYRA 2F6QA 4ASIA 3ZWAA 5FUSA 3Q0JA 3ZW8A 3TRRA 3BEZA 3H0QA 2X24A 1W2XA 3GF7A 4Z0MA 4WZ8B 3U9SB 3Q1TA 1HNOA 1N6DA 1UYVA 4OLQA 3QXZA 4I42A 3MFMA 2VSUC 2FW2A 4JCTA 4KWBA 3P2LA 1SZOA 2Q34A 3OC7A 3ZWBA 2A7KA 2NP9A 4WCZA 4LK5A 1J7XA 1FC6A 2A7SA 3TVWA 1PIXA 1TG6A 2PG8A 4JOTA 3H0JA 4WYOB 4QFEA 2VREA 1SG4A 5E0NX 4ZDBA 2ZQRA 4JYLA 3JU1A 3NJBA 3GMAA 5DU6A 3PEAA 3N6RB 2VX2A 2QQ3A 5G1QA 3SLLA 3LKEA 3Q0GA 5DZKH 5E0SA 1FCFA 5JBWA 3OMEA 3T89A 1PJHA 2VSUE 3BPPA 3KTKA 3HLN1 4ZU2A 2VSSA 2PBPA 5KDRA 3P85A 3NJDA 3QXIA 2F9IB 1WDLA 3QWDA 4ZDFA 4ZDDA 1O8UA 3U9RB 4U0HA 3TT6A 1EY3A 5MGBA 3ZWCA 5C90A 1YG6A 1XX4A 2C8TA 3PZKA 3OT6A
chains in the Genus database with same CATH superfamily
5KDRB 3WG5A 4OG1A 2FBMA 4K3WA 3ST9A 2IEXA 4I52A 1JXZA 5G1RA 3KTIA 3LAOA 3IB9A 3H0SA 4L8KA 1WDKA 1Q51A 4B3HA 3MYBA 4FJWD 4NEKA 1N6FA 2D3TA 3STAA 1VRGA 3R6HA 4HDTA 2BZRA 3I47A 4I4ZA 4K29A 1HNUA 4U0GA 4DI1A 2CBYA 2F9YA 4G2RA 2HW5A 3TDCA 3DORA 1WDMA 4JSBA 3IAVA 3TZ3A 4FZWC 2CE3A 3T3WA 3KTJA 4ZDCA 3PGQA 3HRXA 3R9SA 1WZ8A 1EF8A 4L6WA 3TVUA 3V5EA 2ZQQA 3HE2A 4YLHA 4NARA 3R9QA 1EF9A 3KQFA 1FC7A 1Y7OA 5INIA 4NNQA 4B3JA 3K50A 3Q7HA 1N6EA 4JVTA 1X0UA 1FC9A 3DJAA 3T88A 2F9IA 3T8AA 2J5GA 2Q35A 5DTPA 3TT7A 2WTBA 3PE8A 5C9GA 3M6NA 2J5IA 4F47A 4GHNA 4U18A 5G1SA 2ZL0A 3KTGA 3G64A 4FNDA 4HNKA 3H81A 3VIVA 2J5GD 1TYFA 4U1AA 3RRVA 4JJTA 4FZWA 1RJMA 5DL1A 2YJGA 2ZL2A 5CTCA 3GF3A 4OMRA 2DEOA 4Q1IA 4RYFH 1XNWA 4EMPA 2J5II 2VSSE 4Q0GA 3V5IA 5DU8A 3RSIA 3M6MA 4JYJA 5DU4A 3R9TA 3QREA 5E0SH 4JCSA 3QK8A 3BF0A 3QYRA 1ON9A 4ZDEA 3MT6A 1NZYA 1UIYA 5INFA 4KNPA 4RYFA 5JBXA 2F9YB 5KJPA 4ELSA 2VSUF 3FDUA 4FN8A 4IZDA 3GKBA 1XO6A 5INGA 4U19A 2EJ5A 1K32A 2PPYA 4K2NA 3L3SA 4FB8A 5CTBA 1NZYB 1DUBA 3P5MA 4RCNA 2ZL3A 1K39A 2J5SA 4IZBA 2ZL4A 2FZSA 2X58A 5DKPA 5DUFA 3RSTA 3MOYA 1OD4A 4ELWA 5IKLB 3HP0A 5FIFA 4FNBA 3H02A 2VSUA 1UYTA 4QIJA 2J5IB 4ELXA 3KTHA 4JFCA 5DUCA 3K8XA 5DTWA 1XNYA 3ZW9A 3FF6A 3T8BA 2F6IA 2Q2XA 4HC8A 3ISAA 2W3PA 4KD6A 4JWVA 4U0GH 4IZCA 3BPTA 2DUBA 1YG8A 1DCIA 2UZFA 1UYSA 3SWXA 4FN7A 3QMJA 4B3IA 3GLMA 1XNVA 3QKAA 1MJ3A 3U9TB 2GTRA 4EMMA 4QIIA 4EMLA 4GM2A 1ON3A 3IBBA 3TLFA 3H0UA 2VSSF 4MI2A 1OD2A 4MOUA 4KPKA 5DZKA 1RJNA 1HZDA 3HINA 3R0OA 4JCQA 4MXIA 3TV5A 1Q52A 2A81A 4JCRA 1UYRA 2F6QA 4ASIA 3ZWAA 5FUSA 3Q0JA 3ZW8A 3TRRA 3BEZA 3H0QA 2X24A 1W2XA 3GF7A 4Z0MA 4WZ8B 3U9SB 3Q1TA 1HNOA 1N6DA 1UYVA 4OLQA 3QXZA 4I42A 3MFMA 2VSUC 2FW2A 4JCTA 4KWBA 3P2LA 1SZOA 2Q34A 3OC7A 3ZWBA 2A7KA 2NP9A 4WCZA 4LK5A 1J7XA 1FC6A 2A7SA 3TVWA 1PIXA 1TG6A 2PG8A 4JOTA 3H0JA 4WYOB 4QFEA 2VREA 1SG4A 5E0NX 4ZDBA 2ZQRA 4JYLA 3JU1A 3NJBA 3GMAA 5DU6A 3PEAA 3N6RB 2VX2A 2QQ3A 5G1QA 3SLLA 3LKEA 3Q0GA 5DZKH 5E0SA 1FCFA 5JBWA 3OMEA 3T89A 1PJHA 2VSUE 3BPPA 3KTKA 3HLN1 5HUQA 4ZU2A 2VSSA 2PBPA 5KDRA 3P85A 3NJDA 3QXIA 2F9IB 1WDLA 3QWDA 4ZDFA 4ZDDA 1O8UA 3U9RB 4U0HA 3TT6A 4J2UA 1EY3A 5MGBA 3ZWCA 5C90A 1YG6A 1XX4A 2C8TA 3PZKA 3OT6A
chains in the Genus database with same CATH topology
5KDRB 3WG5A 4OG1A 2FBMA 4K3WA 3ST9A 2IEXA 4I52A 1JXZA 5G1RA 3KTIA 3LAOA 3IB9A 3H0SA 4L8KA 1WDKA 1Q51A 4B3HA 3MYBA 4FJWD 4NEKA 1N6FA 2D3TA 3STAA 1VRGA 3R6HA 4HDTA 2BZRA 3I47A 4I4ZA 4K29A 1HNUA 4U0GA 4DI1A 2CBYA 2F9YA 4G2RA 2HW5A 3TDCA 3DORA 1WDMA 4JSBA 3IAVA 3TZ3A 4FZWC 2CE3A 3T3WA 3KTJA 4ZDCA 3PGQA 3HRXA 3R9SA 1WZ8A 1EF8A 4L6WA 3TVUA 3V5EA 2ZQQA 3HE2A 4YLHA 4NARA 3R9QA 1EF9A 3KQFA 1FC7A 1Y7OA 5INIA 4NNQA 4B3JA 3K50A 3Q7HA 1N6EA 4JVTA 1X0UA 1FC9A 3DJAA 3T88A 2F9IA 3T8AA 2J5GA 2Q35A 5DTPA 3TT7A 2WTBA 3PE8A 5C9GA 3M6NA 2J5IA 4F47A 4GHNA 4U18A 5G1SA 2ZL0A 3KTGA 3G64A 4FNDA 4HNKA 3H81A 3VIVA 2J5GD 1TYFA 4U1AA 3RRVA 4JJTA 4FZWA 1RJMA 5DL1A 2YJGA 2ZL2A 5CTCA 3GF3A 4OMRA 2DEOA 4Q1IA 4RYFH 1XNWA 4EMPA 2J5II 2VSSE 4Q0GA 3V5IA 5DU8A 3RSIA 3M6MA 4JYJA 5DU4A 3R9TA 3QREA 5E0SH 4JCSA 3QK8A 3BF0A 3QYRA 1ON9A 4ZDEA 3MT6A 1NZYA 1UIYA 5INFA 4KNPA 4RYFA 5JBXA 2F9YB 5KJPA 4ELSA 2VSUF 3FDUA 4FN8A 4IZDA 3GKBA 1XO6A 5INGA 4U19A 2EJ5A 1K32A 2PPYA 4K2NA 3L3SA 4FB8A 5CTBA 1NZYB 1DUBA 3P5MA 4RCNA 2ZL3A 1K39A 2J5SA 4IZBA 2ZL4A 2FZSA 2X58A 5DKPA 5DUFA 3RSTA 3MOYA 1OD4A 4ELWA 5IKLB 3HP0A 5FIFA 4FNBA 3H02A 2VSUA 1UYTA 4QIJA 2J5IB 4ELXA 3KTHA 4JFCA 5DUCA 3K8XA 5DTWA 1XNYA 3ZW9A 3FF6A 3T8BA 2F6IA 2Q2XA 4HC8A 3ISAA 2W3PA 4KD6A 4JWVA 4U0GH 4IZCA 3BPTA 2DUBA 1YG8A 1DCIA 2UZFA 1UYSA 3SWXA 4FN7A 3QMJA 4B3IA 3GLMA 1XNVA 3QKAA 1MJ3A 3U9TB 2GTRA 4EMMA 4QIIA 4EMLA 4GM2A 1ON3A 3IBBA 3TLFA 3H0UA 2VSSF 4MI2A 1OD2A 4MOUA 4KPKA 5DZKA 1RJNA 1HZDA 3HINA 3R0OA 4JCQA 4MXIA 3TV5A 1Q52A 2A81A 4JCRA 1UYRA 2F6QA 4ASIA 3ZWAA 5FUSA 3Q0JA 3ZW8A 3TRRA 3BEZA 3H0QA 2X24A 1W2XA 3GF7A 4Z0MA 4WZ8B 3U9SB 3Q1TA 1HNOA 1N6DA 1UYVA 4OLQA 3QXZA 4I42A 3MFMA 2VSUC 2FW2A 4JCTA 4KWBA 3P2LA 1SZOA 2Q34A 3OC7A 3ZWBA 2A7KA 2NP9A 4WCZA 4LK5A 1J7XA 1FC6A 2A7SA 3TVWA 1PIXA 1TG6A 2PG8A 4JOTA 3H0JA 4WYOB 4QFEA 2VREA 1SG4A 5E0NX 4ZDBA 2ZQRA 4JYLA 3JU1A 3NJBA 3GMAA 5DU6A 3PEAA 3N6RB 2VX2A 2QQ3A 5G1QA 3SLLA 3LKEA 3Q0GA 5DZKH 5E0SA 1FCFA 5JBWA 3OMEA 3T89A 1PJHA 2VSUE 3BPPA 3KTKA 3HLN1 5HUQA 4ZU2A 2VSSA 2PBPA 5KDRA 3P85A 3NJDA 3QXIA 2F9IB 1WDLA 3QWDA 4ZDFA 4ZDDA 1O8UA 3U9RB 4U0HA 3TT6A 4J2UA 1EY3A 5MGBA 3ZWCA 5C90A 1YG6A 1XX4A 2C8TA 3PZKA 3OT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDR B;  3WG5 A;  4OG1 A;  2FBM A;  4K3W A;  3ST9 A;  2IEX A;  4I52 A;  1JXZ A;  5G1R A;  3KTI A;  3LAO A;  3IB9 A;  3H0S A;  4L8K A;  1WDK A;  1Q51 A;  4B3H A;  3MYB A;  4FJW D;  4NEK A;  1N6F A;  2D3T A;  3STA A;  1VRG A;  3R6H A;  2BZR A;  3I47 A;  4I4Z A;  4K29 A;  1HNU A;  4U0G A;  4DI1 A;  2CBY A;  2F9Y A;  4G2R A;  2HW5 A;  3TDC A;  3DOR A;  1WDM A;  4JSB A;  3IAV A;  3TZ3 A;  4FZW C;  2CE3 A;  3T3W A;  3KTJ A;  4ZDC A;  3PGQ A;  3HRX A;  3R9S A;  1WZ8 A;  1EF8 A;  4L6W A;  3TVU A;  3V5E A;  2ZQQ A;  3HE2 A;  4YLH A;  3R9Q A;  1EF9 A;  3KQF A;  1FC7 A;  1Y7O A;  5INI A;  4NNQ A;  4B3J A;  3K50 A;  3Q7H A;  1N6E A;  4JVT A;  1X0U A;  1FC9 A;  3DJA A;  3T88 A;  2F9I A;  3T8A A;  2J5G A;  2Q35 A;  5DTP A;  3TT7 A;  2WTB A;  3PE8 A;  5C9G A;  3M6N A;  2J5I A;  4F47 A;  4GHN A;  4U18 A;  5G1S A;  2ZL0 A;  3KTG A;  3G64 A;  4FND A;  4HNK A;  3H81 A;  3VIV A;  2J5G D;  1TYF A;  4U1A A;  3RRV A;  4JJT A;  4FZW A;  1RJM A;  5DL1 A;  2ZL2 A;  5CTC A;  3GF3 A;  4OMR A;  2DEO A;  4Q1I A;  4RYF H;  1XNW A;  4EMP A;  2J5I I;  2VSS E;  4Q0G A;  3V5I A;  5DU8 A;  3RSI A;  3M6M A;  4JYJ A;  5DU4 A;  3R9T A;  3QRE A;  5E0S H;  4JCS A;  3QK8 A;  3BF0 A;  3QYR A;  1ON9 A;  4ZDE A;  3MT6 A;  1NZY A;  1UIY A;  5INF A;  4KNP A;  4RYF A;  5JBX A;  5KJP A;  2F9Y B;  4ELS A;  2VSU F;  3FDU A;  4FN8 A;  4IZD A;  3GKB A;  1XO6 A;  5ING A;  4U19 A;  2EJ5 A;  1K32 A;  2PPY A;  4K2N A;  3L3S A;  4FB8 A;  5CTB A;  1NZY B;  1DUB A;  3P5M A;  4RCN A;  2ZL3 A;  1K39 A;  2J5S A;  4IZB A;  2ZL4 A;  2FZS A;  2X58 A;  5DKP A;  5DUF A;  3RST A;  3MOY A;  1OD4 A;  4ELW A;  5IKL B;  3HP0 A;  5FIF A;  4FNB A;  3H02 A;  2VSU A;  1UYT A;  4QIJ A;  2J5I B;  4ELX A;  3KTH A;  4JFC A;  5DUC A;  3K8X A;  5DTW A;  1XNY A;  3ZW9 A;  3FF6 A;  3T8B A;  2F6I A;  2Q2X A;  4HC8 A;  3ISA A;  2W3P A;  4KD6 A;  4JWV A;  4U0G H;  4IZC A;  2DUB A;  1YG8 A;  1DCI A;  2UZF A;  1UYS A;  3SWX A;  4FN7 A;  3QMJ A;  4B3I A;  3GLM A;  1XNV A;  3QKA A;  1MJ3 A;  3U9T B;  2GTR A;  4EMM A;  4QII A;  4EML A;  4GM2 A;  1ON3 A;  3IBB A;  3TLF A;  3H0U A;  2VSS F;  4MI2 A;  1OD2 A;  4MOU A;  4KPK A;  5DZK A;  1RJN A;  1HZD A;  3HIN A;  3R0O A;  4JCQ A;  4MXI A;  3TV5 A;  1Q52 A;  2A81 A;  4JCR A;  1UYR A;  2F6Q A;  4ASI A;  3ZWA A;  5FUS A;  3Q0J A;  3ZW8 A;  3TRR A;  3BEZ A;  3H0Q A;  2X24 A;  1W2X A;  3GF7 A;  4Z0M A;  4WZ8 B;  3U9S B;  3Q1T A;  1HNO A;  1N6D A;  1UYV A;  4OLQ A;  3QXZ A;  4I42 A;  3MFM A;  2VSU C;  2FW2 A;  4JCT A;  4KWB A;  3P2L A;  1SZO A;  2Q34 A;  3OC7 A;  3ZWB A;  2A7K A;  2NP9 A;  4WCZ A;  4LK5 A;  1J7X A;  1FC6 A;  2A7S A;  3TVW A;  1PIX A;  1TG6 A;  2PG8 A;  4JOT A;  3H0J A;  4WYO B;  4QFE A;  2VRE A;  1SG4 A;  5E0N X;  4ZDB A;  2ZQR A;  4JYL A;  3JU1 A;  3NJB A;  3GMA A;  5DU6 A;  3PEA A;  3N6R B;  2VX2 A;  2QQ3 A;  5G1Q A;  3SLL A;  3LKE A;  3Q0G A;  5DZK H;  5E0S A;  1FCF A;  5JBW A;  3OME A;  3T89 A;  1PJH A;  2VSU E;  3BPP A;  3KTK A;  3HLN 1;  4ZU2 A;  2VSS A;  2PBP A;  5KDR A;  3P85 A;  3NJD A;  3QXI A;  2F9I B;  1WDL A;  3QWD A;  4ZDF A;  4ZDD A;  1O8U A;  3U9R B;  4U0H A;  3TT6 A;  1EY3 A;  5MGB A;  3ZWC A;  5C90 A;  1YG6 A;  1XX4 A;  2C8T A;  3PZK A;  3OT6 A; 
#chains in the Genus database with same CATH topology
 5KDR B;  3WG5 A;  4OG1 A;  2FBM A;  4K3W A;  3ST9 A;  2IEX A;  4I52 A;  1JXZ A;  5G1R A;  3KTI A;  3LAO A;  3IB9 A;  3H0S A;  4L8K A;  1WDK A;  1Q51 A;  4B3H A;  3MYB A;  4FJW D;  4NEK A;  1N6F A;  2D3T A;  3STA A;  1VRG A;  3R6H A;  4HDT A;  2BZR A;  3I47 A;  4I4Z A;  4K29 A;  1HNU A;  4U0G A;  4DI1 A;  2CBY A;  2F9Y A;  4G2R A;  2HW5 A;  3TDC A;  3DOR A;  1WDM A;  4JSB A;  3IAV A;  3TZ3 A;  4FZW C;  2CE3 A;  3T3W A;  3KTJ A;  4ZDC A;  3PGQ A;  3HRX A;  3R9S A;  1WZ8 A;  1EF8 A;  4L6W A;  3TVU A;  3V5E A;  2ZQQ A;  3HE2 A;  4YLH A;  4NAR A;  3R9Q A;  1EF9 A;  3KQF A;  1FC7 A;  1Y7O A;  5INI A;  4NNQ A;  4B3J A;  3K50 A;  3Q7H A;  1N6E A;  4JVT A;  1X0U A;  1FC9 A;  3DJA A;  3T88 A;  2F9I A;  3T8A A;  2J5G A;  2Q35 A;  5DTP A;  3TT7 A;  2WTB A;  3PE8 A;  5C9G A;  3M6N A;  2J5I A;  4F47 A;  4GHN A;  4U18 A;  5G1S A;  2ZL0 A;  3KTG A;  3G64 A;  4FND A;  4HNK A;  3H81 A;  3VIV A;  2J5G D;  1TYF A;  4U1A A;  3RRV A;  4JJT A;  4FZW A;  1RJM A;  5DL1 A;  2YJG A;  2ZL2 A;  5CTC A;  3GF3 A;  4OMR A;  2DEO A;  4Q1I A;  4RYF H;  1XNW A;  4EMP A;  2J5I I;  2VSS E;  4Q0G A;  3V5I A;  5DU8 A;  3RSI A;  3M6M A;  4JYJ A;  5DU4 A;  3R9T A;  3QRE A;  5E0S H;  4JCS A;  3QK8 A;  3BF0 A;  3QYR A;  1ON9 A;  4ZDE A;  3MT6 A;  1NZY A;  1UIY A;  5INF A;  4KNP A;  4RYF A;  5JBX A;  2F9Y B;  5KJP A;  4ELS A;  2VSU F;  3FDU A;  4FN8 A;  4IZD A;  3GKB A;  1XO6 A;  5ING A;  4U19 A;  2EJ5 A;  1K32 A;  2PPY A;  4K2N A;  3L3S A;  4FB8 A;  5CTB A;  1NZY B;  1DUB A;  3P5M A;  4RCN A;  2ZL3 A;  1K39 A;  2J5S A;  4IZB A;  2ZL4 A;  2FZS A;  2X58 A;  5DKP A;  5DUF A;  3RST A;  3MOY A;  1OD4 A;  4ELW A;  5IKL B;  3HP0 A;  5FIF A;  4FNB A;  3H02 A;  2VSU A;  1UYT A;  4QIJ A;  2J5I B;  4ELX A;  3KTH A;  4JFC A;  5DUC A;  3K8X A;  5DTW A;  1XNY A;  3ZW9 A;  3FF6 A;  3T8B A;  2F6I A;  2Q2X A;  4HC8 A;  3ISA A;  2W3P A;  4KD6 A;  4JWV A;  4U0G H;  4IZC A;  3BPT A;  2DUB A;  1YG8 A;  1DCI A;  2UZF A;  1UYS A;  3SWX A;  4FN7 A;  3QMJ A;  4B3I A;  3GLM A;  1XNV A;  3QKA A;  1MJ3 A;  3U9T B;  2GTR A;  4EMM A;  4QII A;  4EML A;  4GM2 A;  1ON3 A;  3IBB A;  3TLF A;  3H0U A;  2VSS F;  4MI2 A;  1OD2 A;  4MOU A;  4KPK A;  5DZK A;  1RJN A;  1HZD A;  3HIN A;  3R0O A;  4JCQ A;  4MXI A;  3TV5 A;  1Q52 A;  2A81 A;  4JCR A;  1UYR A;  2F6Q A;  4ASI A;  3ZWA A;  5FUS A;  3Q0J A;  3ZW8 A;  3TRR A;  3BEZ A;  3H0Q A;  2X24 A;  1W2X A;  3GF7 A;  4Z0M A;  4WZ8 B;  3U9S B;  3Q1T A;  1HNO A;  1N6D A;  1UYV A;  4OLQ A;  3QXZ A;  4I42 A;  3MFM A;  2VSU C;  2FW2 A;  4JCT A;  4KWB A;  3P2L A;  1SZO A;  2Q34 A;  3OC7 A;  3ZWB A;  2A7K A;  2NP9 A;  4WCZ A;  4LK5 A;  1J7X A;  1FC6 A;  2A7S A;  3TVW A;  1PIX A;  1TG6 A;  2PG8 A;  4JOT A;  3H0J A;  4WYO B;  4QFE A;  2VRE A;  1SG4 A;  5E0N X;  4ZDB A;  2ZQR A;  4JYL A;  3JU1 A;  3NJB A;  3GMA A;  5DU6 A;  3PEA A;  3N6R B;  2VX2 A;  2QQ3 A;  5G1Q A;  3SLL A;  3LKE A;  3Q0G A;  5DZK H;  5E0S A;  1FCF A;  5JBW A;  3OME A;  3T89 A;  1PJH A;  2VSU E;  3BPP A;  3KTK A;  3HLN 1;  5HUQ A;  4ZU2 A;  2VSS A;  2PBP A;  5KDR A;  3P85 A;  3NJD A;  3QXI A;  2F9I B;  1WDL A;  3QWD A;  4ZDF A;  4ZDD A;  1O8U A;  3U9R B;  4U0H A;  3TT6 A;  4J2U A;  1EY3 A;  5MGB A;  3ZWC A;  5C90 A;  1YG6 A;  1XX4 A;  2C8T A;  3PZK A;  3OT6 A; 
#chains in the Genus database with same CATH homology
 5KDR B;  3WG5 A;  4OG1 A;  2FBM A;  4K3W A;  3ST9 A;  2IEX A;  4I52 A;  1JXZ A;  5G1R A;  3KTI A;  3LAO A;  3IB9 A;  3H0S A;  4L8K A;  1WDK A;  1Q51 A;  4B3H A;  3MYB A;  4FJW D;  4NEK A;  1N6F A;  2D3T A;  3STA A;  1VRG A;  3R6H A;  4HDT A;  2BZR A;  3I47 A;  4I4Z A;  4K29 A;  1HNU A;  4U0G A;  4DI1 A;  2CBY A;  2F9Y A;  4G2R A;  2HW5 A;  3TDC A;  3DOR A;  1WDM A;  4JSB A;  3IAV A;  3TZ3 A;  4FZW C;  2CE3 A;  3T3W A;  3KTJ A;  4ZDC A;  3PGQ A;  3HRX A;  3R9S A;  1WZ8 A;  1EF8 A;  4L6W A;  3TVU A;  3V5E A;  2ZQQ A;  3HE2 A;  4YLH A;  4NAR A;  3R9Q A;  1EF9 A;  3KQF A;  1FC7 A;  1Y7O A;  5INI A;  4NNQ A;  4B3J A;  3K50 A;  3Q7H A;  1N6E A;  4JVT A;  1X0U A;  1FC9 A;  3DJA A;  3T88 A;  2F9I A;  3T8A A;  2J5G A;  2Q35 A;  5DTP A;  3TT7 A;  2WTB A;  3PE8 A;  5C9G A;  3M6N A;  2J5I A;  4F47 A;  4GHN A;  4U18 A;  5G1S A;  2ZL0 A;  3KTG A;  3G64 A;  4FND A;  4HNK A;  3H81 A;  3VIV A;  2J5G D;  1TYF A;  4U1A A;  3RRV A;  4JJT A;  4FZW A;  1RJM A;  5DL1 A;  2YJG A;  2ZL2 A;  5CTC A;  3GF3 A;  4OMR A;  2DEO A;  4Q1I A;  4RYF H;  1XNW A;  4EMP A;  2J5I I;  2VSS E;  4Q0G A;  3V5I A;  5DU8 A;  3RSI A;  3M6M A;  4JYJ A;  5DU4 A;  3R9T A;  3QRE A;  5E0S H;  4JCS A;  3QK8 A;  3BF0 A;  3QYR A;  1ON9 A;  4ZDE A;  3MT6 A;  1NZY A;  1UIY A;  5INF A;  4KNP A;  4RYF A;  5JBX A;  2F9Y B;  5KJP A;  4ELS A;  2VSU F;  3FDU A;  4FN8 A;  4IZD A;  3GKB A;  1XO6 A;  5ING A;  4U19 A;  2EJ5 A;  1K32 A;  2PPY A;  4K2N A;  3L3S A;  4FB8 A;  5CTB A;  1NZY B;  1DUB A;  3P5M A;  4RCN A;  2ZL3 A;  1K39 A;  2J5S A;  4IZB A;  2ZL4 A;  2FZS A;  2X58 A;  5DKP A;  5DUF A;  3RST A;  3MOY A;  1OD4 A;  4ELW A;  5IKL B;  3HP0 A;  5FIF A;  4FNB A;  3H02 A;  2VSU A;  1UYT A;  4QIJ A;  2J5I B;  4ELX A;  3KTH A;  4JFC A;  5DUC A;  3K8X A;  5DTW A;  1XNY A;  3ZW9 A;  3FF6 A;  3T8B A;  2F6I A;  2Q2X A;  4HC8 A;  3ISA A;  2W3P A;  4KD6 A;  4JWV A;  4U0G H;  4IZC A;  3BPT A;  2DUB A;  1YG8 A;  1DCI A;  2UZF A;  1UYS A;  3SWX A;  4FN7 A;  3QMJ A;  4B3I A;  3GLM A;  1XNV A;  3QKA A;  1MJ3 A;  3U9T B;  2GTR A;  4EMM A;  4QII A;  4EML A;  4GM2 A;  1ON3 A;  3IBB A;  3TLF A;  3H0U A;  2VSS F;  4MI2 A;  1OD2 A;  4MOU A;  4KPK A;  5DZK A;  1RJN A;  1HZD A;  3HIN A;  3R0O A;  4JCQ A;  4MXI A;  3TV5 A;  1Q52 A;  2A81 A;  4JCR A;  1UYR A;  2F6Q A;  4ASI A;  3ZWA A;  5FUS A;  3Q0J A;  3ZW8 A;  3TRR A;  3BEZ A;  3H0Q A;  2X24 A;  1W2X A;  3GF7 A;  4Z0M A;  4WZ8 B;  3U9S B;  3Q1T A;  1HNO A;  1N6D A;  1UYV A;  4OLQ A;  3QXZ A;  4I42 A;  3MFM A;  2VSU C;  2FW2 A;  4JCT A;  4KWB A;  3P2L A;  1SZO A;  2Q34 A;  3OC7 A;  3ZWB A;  2A7K A;  2NP9 A;  4WCZ A;  4LK5 A;  1J7X A;  1FC6 A;  2A7S A;  3TVW A;  1PIX A;  1TG6 A;  2PG8 A;  4JOT A;  3H0J A;  4WYO B;  4QFE A;  2VRE A;  1SG4 A;  5E0N X;  4ZDB A;  2ZQR A;  4JYL A;  3JU1 A;  3NJB A;  3GMA A;  5DU6 A;  3PEA A;  3N6R B;  2VX2 A;  2QQ3 A;  5G1Q A;  3SLL A;  3LKE A;  3Q0G A;  5DZK H;  5E0S A;  1FCF A;  5JBW A;  3OME A;  3T89 A;  1PJH A;  2VSU E;  3BPP A;  3KTK A;  3HLN 1;  5HUQ A;  4ZU2 A;  2VSS A;  2PBP A;  5KDR A;  3P85 A;  3NJD A;  3QXI A;  2F9I B;  1WDL A;  3QWD A;  4ZDF A;  4ZDD A;  1O8U A;  3U9R B;  4U0H A;  3TT6 A;  4J2U A;  1EY3 A;  5MGB A;  3ZWC A;  5C90 A;  1YG6 A;  1XX4 A;  2C8T A;  3PZK A;  3OT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...