4ZDFA

Crystal structure of yeast enoyl-coa isomerase helix-10 deletion (sceci2-h10) mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
256
Chain Sequence
EIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,2-trans-enoyl-CoA isomerase
publication title Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 94
structure length 256
sequence length 264
chains with identical sequence B
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4zdfA00
3KTKA 5DU4A 3RSTA 4MI2A 3TVUA 4FJWD 3ZW8A 5CTCA 5G1RA 4U19A 3TLFA 1K32A 4L6WA 1ON9A 4ASIA 2BZRA 2VSSF 3ZW9A 1EF9A 2ZL2A 2IEXA 5KDRA 3NJBA 5INGA 1UYTA 4JOTA 4JYLA 3TRRA 3QK8A 4EMMA 4FZWA 4NEKA 4NNQA 2D3TA 2Q2XA 3U9SB 3H0SA 4I4ZA 4MXIA 2J5IB 3IB9A 3TV5A 3NJDA 4KPKA 1WDMA 2VSUA 2VSSA 2FW2A 3M6MA 3PZKA 4L8KA 4LK5A 4I42A 2DEOA 1WZ8A 2C8TA 1Y7OA 3QXIA 1HNUA 4HC8A 2J5II 3KTGA 1W2XA 5G1QA 5DUFA 2PBPA 3LAOA 4OG1A 3VIVA 1N6FA 3HE2A 3Q0GA 1O8UA 1FC9A 1XNWA 4EMPA 3PEAA 4JJTA 5INIA 2CE3A 5G1SA 1X0UA 1FCFA 2VSSE 2ZL4A 3MYBA 4JWVA 3Q1TA 3BPPA 1K39A 1UYVA 3V5EA 2PPYA 3U9RB 3MOYA 5INFA 4JCQA 3OMEA 3H0UA 4GHNA 3T8AA 3BEZA 1OD2A 2ZQRA 4HNKA 1Q52A 3LKEA 2VREA 4JFCA 1XO6A 4ELSA 3P5MA 4K3WA 5KDRB 1DCIA 1YG6A 3ZWCA 2Q34A 2F6QA 4JSBA 3R6HA 4RYFH 2WTBA 5IKLB 1XNYA 2ZQQA 3GMAA 2X58A 1UYSA 2F9IA 4QFEA 2FBMA 1FC6A 4FN8A 4RYFA 2A7SA 3H0QA 2F9YB 3ZWAA 2X24A 5DU6A 4WYOB 3MT6A 1MJ3A 3H02A 3M6NA 3RSIA 2VX2A 4IZCA 2CBYA 4RCNA 4KWBA 4WCZA 3HRXA 3R9SA 4Z0MA 2F6IA 2DUBA 2VSUC 1WDLA 3KTIA 1Q51A 4FB8A 3FF6A 1HNOA 1VRGA 4JCSA 4QIJA 2J5IA 4FN7A 3TT6A 3OT6A 2GTRA 5DU8A 4U0HA 3ZWBA 3TDCA 3KQFA 1N6DA 4OLQA 4K2NA 3T8BA 1HZDA 3Q0JA 3Q7HA 5E0SH 4JCRA 1XNVA 3SLLA 3V5IA 3L3SA 1SZOA 1EF8A 3I47A 3JU1A 4IZBA 1NZYA 5JBXA 4G2RA 3SWXA 1DUBA 1J7XA 3QYRA 2ZL3A 4B3JA 2ZL0A 1XX4A 3P2LA 4JVTA 3R0OA 1TYFA 3WG5A 4K29A 3KTJA 2W3PA 5DUCA 4QIIA 3N6RB 4JCTA 3K8XA 2F9IB 5DZKH 5FIFA 1ON3A 3STAA 4I52A 3TZ3A 3U9TB 2FZSA 1N6EA 2PG8A 4FNBA 5JBWA 5DZKA 3ST9A 3T88A 4DI1A 1YG8A 1OD4A 3IBBA 3MFMA 4ZDEA 4OMRA 2QQ3A 4FZWC 3QKAA 2VSUF 1PJHA 4KD6A 2J5SA 3G64A 3RRVA 1RJNA 3FDUA 5DTPA 1UIYA 3H0JA 3KTHA 4Q0GA 3BF0A 2J5GA 1TG6A 4MOUA 1UYRA 4KNPA 4ZDDA 5CTBA 3HINA 3DJAA 4YLHA 4U0GH 2F9YA 4FNDA 2A81A 4B3HA 1JXZA 4B3IA 4U0GA 3ISAA 3PGQA 3H81A 5MGBA 1EY3A 3TVWA 3QREA 3OC7A 1SG4A 3QWDA 3R9QA 5KJPA 2UZFA 1PIXA 2J5GD 4WZ8B 4ZDCA 3TT7A 3QMJA 2NP9A 4ELXA 4U1AA 4ELWA 5E0SA 3P85A 5FUSA 1NZYB 3GF7A 4ZU2A 3QXZA 3GF3A 3HLN1 4Q1IA 3GKBA 5DTWA 3DORA 4U18A 3HP0A 1WDKA 4GM2A 1FC7A 2VSUE 2HW5A 2Q35A 4F47A 5DL1A 4EMLA 3K50A 3GLMA 2A7KA 4ZDFA 3T3WA 3R9TA 2EJ5A 5E0NX 4ZDBA 3IAVA 4IZDA 3T89A 4JYJA 5DKPA 3PE8A 5C9GA 1RJMA 5C90A
chains in the Genus database with same CATH superfamily
3KTKA 5DU4A 3RSTA 4MI2A 3TVUA 4FJWD 3ZW8A 5CTCA 5G1RA 4U19A 3TLFA 1K32A 4L6WA 1ON9A 4NARA 4ASIA 2BZRA 2VSSF 5HUQA 3ZW9A 1EF9A 2ZL2A 4J2UA 2IEXA 5KDRA 3NJBA 5INGA 1UYTA 4JOTA 4JYLA 3TRRA 3QK8A 4EMMA 4FZWA 4NEKA 4NNQA 2D3TA 2Q2XA 3U9SB 3H0SA 2YJGA 4I4ZA 4MXIA 2J5IB 3IB9A 3TV5A 3NJDA 4KPKA 1WDMA 2VSUA 2VSSA 2FW2A 3M6MA 3PZKA 4L8KA 4LK5A 4I42A 2DEOA 1WZ8A 2C8TA 1Y7OA 3QXIA 1HNUA 4HC8A 2J5II 3KTGA 1W2XA 5G1QA 5DUFA 2PBPA 3LAOA 4OG1A 3VIVA 1N6FA 3HE2A 3Q0GA 1O8UA 1FC9A 1XNWA 4EMPA 3PEAA 4JJTA 5INIA 2CE3A 4HDTA 5G1SA 1X0UA 1FCFA 2VSSE 2ZL4A 3MYBA 4JWVA 3Q1TA 3BPPA 1K39A 1UYVA 3V5EA 2PPYA 3U9RB 3MOYA 5INFA 4JCQA 3OMEA 3H0UA 4GHNA 3T8AA 3BEZA 1OD2A 2ZQRA 4HNKA 1Q52A 3LKEA 2VREA 4JFCA 1XO6A 4ELSA 3P5MA 4K3WA 5KDRB 1DCIA 1YG6A 3ZWCA 2Q34A 2F6QA 4JSBA 3R6HA 4RYFH 2WTBA 5IKLB 1XNYA 2ZQQA 3GMAA 2X58A 1UYSA 2F9IA 4QFEA 2FBMA 1FC6A 4FN8A 4RYFA 2A7SA 3H0QA 2F9YB 3ZWAA 2X24A 5DU6A 4WYOB 3MT6A 1MJ3A 3H02A 3M6NA 3RSIA 2VX2A 4IZCA 2CBYA 4RCNA 4KWBA 4WCZA 3HRXA 3R9SA 4Z0MA 2F6IA 2DUBA 2VSUC 1WDLA 3KTIA 1Q51A 4FB8A 3FF6A 1HNOA 1VRGA 4JCSA 4QIJA 2J5IA 4FN7A 3TT6A 3OT6A 2GTRA 5DU8A 4U0HA 3ZWBA 3TDCA 3KQFA 1N6DA 4OLQA 4K2NA 3T8BA 1HZDA 3Q0JA 3Q7HA 5E0SH 4JCRA 1XNVA 3SLLA 3V5IA 3L3SA 1SZOA 1EF8A 3I47A 3JU1A 4IZBA 1NZYA 5JBXA 4G2RA 3SWXA 1DUBA 1J7XA 3QYRA 2ZL3A 4B3JA 2ZL0A 1XX4A 3P2LA 4JVTA 3R0OA 1TYFA 3WG5A 4K29A 3KTJA 2W3PA 5DUCA 4QIIA 3N6RB 4JCTA 3K8XA 2F9IB 5DZKH 5FIFA 1ON3A 3STAA 4I52A 3TZ3A 3U9TB 2FZSA 1N6EA 2PG8A 4FNBA 5JBWA 5DZKA 3ST9A 3T88A 4DI1A 1YG8A 1OD4A 3IBBA 3MFMA 4ZDEA 4OMRA 2QQ3A 4FZWC 3QKAA 2VSUF 1PJHA 4KD6A 2J5SA 3G64A 3RRVA 1RJNA 3FDUA 5DTPA 1UIYA 3H0JA 3KTHA 4Q0GA 3BF0A 2J5GA 1TG6A 4MOUA 1UYRA 4KNPA 4ZDDA 5CTBA 3HINA 3DJAA 4YLHA 4U0GH 2F9YA 4FNDA 2A81A 4B3HA 1JXZA 4B3IA 4U0GA 3ISAA 3PGQA 3H81A 5MGBA 1EY3A 3TVWA 3QREA 3OC7A 1SG4A 3QWDA 3R9QA 5KJPA 2UZFA 1PIXA 2J5GD 4WZ8B 4ZDCA 3TT7A 3QMJA 2NP9A 4ELXA 4U1AA 4ELWA 5E0SA 3P85A 5FUSA 1NZYB 3GF7A 4ZU2A 3QXZA 3GF3A 3HLN1 4Q1IA 3GKBA 5DTWA 3DORA 4U18A 3HP0A 1WDKA 4GM2A 1FC7A 2VSUE 2HW5A 2Q35A 4F47A 3BPTA 5DL1A 4EMLA 3K50A 3GLMA 2A7KA 4ZDFA 3T3WA 3R9TA 2EJ5A 5E0NX 4ZDBA 3IAVA 4IZDA 3T89A 4JYJA 5DKPA 3PE8A 5C9GA 1RJMA 5C90A
chains in the Genus database with same CATH topology
3KTKA 5DU4A 3RSTA 4MI2A 3TVUA 4FJWD 3ZW8A 5CTCA 5G1RA 4U19A 3TLFA 1K32A 4L6WA 1ON9A 4NARA 4ASIA 2BZRA 2VSSF 5HUQA 3ZW9A 1EF9A 2ZL2A 4J2UA 2IEXA 5KDRA 3NJBA 5INGA 1UYTA 4JOTA 4JYLA 3TRRA 3QK8A 4EMMA 4FZWA 4NEKA 4NNQA 2D3TA 2Q2XA 3U9SB 3H0SA 2YJGA 4I4ZA 4MXIA 2J5IB 3IB9A 3TV5A 3NJDA 4KPKA 1WDMA 2VSUA 2VSSA 2FW2A 3M6MA 3PZKA 4L8KA 4LK5A 4I42A 2DEOA 1WZ8A 2C8TA 1Y7OA 3QXIA 1HNUA 4HC8A 2J5II 3KTGA 1W2XA 5G1QA 5DUFA 2PBPA 3LAOA 4OG1A 3VIVA 1N6FA 3HE2A 3Q0GA 1O8UA 1FC9A 1XNWA 4EMPA 3PEAA 4JJTA 5INIA 2CE3A 4HDTA 5G1SA 1X0UA 1FCFA 2VSSE 2ZL4A 3MYBA 4JWVA 3Q1TA 3BPPA 1K39A 1UYVA 3V5EA 2PPYA 3U9RB 3MOYA 5INFA 4JCQA 3OMEA 3H0UA 4GHNA 3T8AA 3BEZA 1OD2A 2ZQRA 4HNKA 1Q52A 3LKEA 2VREA 4JFCA 1XO6A 4ELSA 3P5MA 4K3WA 5KDRB 1DCIA 1YG6A 3ZWCA 2Q34A 2F6QA 4JSBA 3R6HA 4RYFH 2WTBA 5IKLB 1XNYA 2ZQQA 3GMAA 2X58A 1UYSA 2F9IA 4QFEA 2FBMA 1FC6A 4FN8A 4RYFA 2A7SA 3H0QA 2F9YB 3ZWAA 2X24A 5DU6A 4WYOB 3MT6A 1MJ3A 3H02A 3M6NA 3RSIA 2VX2A 4IZCA 2CBYA 4RCNA 4KWBA 4WCZA 3HRXA 3R9SA 4Z0MA 2F6IA 2DUBA 2VSUC 1WDLA 3KTIA 1Q51A 4FB8A 3FF6A 1HNOA 1VRGA 4JCSA 4QIJA 2J5IA 4FN7A 3TT6A 3OT6A 2GTRA 5DU8A 4U0HA 3ZWBA 3TDCA 3KQFA 1N6DA 4OLQA 4K2NA 3T8BA 1HZDA 3Q0JA 3Q7HA 5E0SH 4JCRA 1XNVA 3SLLA 3V5IA 3L3SA 1SZOA 1EF8A 3I47A 3JU1A 4IZBA 1NZYA 5JBXA 4G2RA 3SWXA 1DUBA 1J7XA 3QYRA 2ZL3A 4B3JA 2ZL0A 1XX4A 3P2LA 4JVTA 3R0OA 1TYFA 3WG5A 4K29A 3KTJA 2W3PA 5DUCA 4QIIA 3N6RB 4JCTA 3K8XA 2F9IB 5DZKH 5FIFA 1ON3A 3STAA 4I52A 3TZ3A 3U9TB 2FZSA 1N6EA 2PG8A 4FNBA 5JBWA 5DZKA 3ST9A 3T88A 4DI1A 1YG8A 1OD4A 3IBBA 3MFMA 4ZDEA 4OMRA 2QQ3A 4FZWC 3QKAA 2VSUF 1PJHA 4KD6A 2J5SA 3G64A 3RRVA 1RJNA 3FDUA 5DTPA 1UIYA 3H0JA 3KTHA 4Q0GA 3BF0A 2J5GA 1TG6A 4MOUA 1UYRA 4KNPA 4ZDDA 5CTBA 3HINA 3DJAA 4YLHA 4U0GH 2F9YA 4FNDA 2A81A 4B3HA 1JXZA 4B3IA 4U0GA 3ISAA 3PGQA 3H81A 5MGBA 1EY3A 3TVWA 3QREA 3OC7A 1SG4A 3QWDA 3R9QA 5KJPA 2UZFA 1PIXA 2J5GD 4WZ8B 4ZDCA 3TT7A 3QMJA 2NP9A 4ELXA 4U1AA 4ELWA 5E0SA 3P85A 5FUSA 1NZYB 3GF7A 4ZU2A 3QXZA 3GF3A 3HLN1 4Q1IA 3GKBA 5DTWA 3DORA 4U18A 3HP0A 1WDKA 4GM2A 1FC7A 2VSUE 2HW5A 2Q35A 4F47A 3BPTA 5DL1A 4EMLA 3K50A 3GLMA 2A7KA 4ZDFA 3T3WA 3R9TA 2EJ5A 5E0NX 4ZDBA 3IAVA 4IZDA 3T89A 4JYJA 5DKPA 3PE8A 5C9GA 1RJMA 5C90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTK A;  5DU4 A;  3RST A;  4MI2 A;  3TVU A;  4FJW D;  3ZW8 A;  5CTC A;  5G1R A;  4U19 A;  3TLF A;  1K32 A;  4L6W A;  1ON9 A;  4ASI A;  2BZR A;  2VSS F;  3ZW9 A;  1EF9 A;  2ZL2 A;  2IEX A;  5KDR A;  3NJB A;  5ING A;  1UYT A;  4JOT A;  4JYL A;  3TRR A;  3QK8 A;  4EMM A;  4FZW A;  4NEK A;  4NNQ A;  2D3T A;  2Q2X A;  3U9S B;  3H0S A;  4I4Z A;  4MXI A;  2J5I B;  3IB9 A;  3TV5 A;  3NJD A;  4KPK A;  1WDM A;  2VSU A;  2VSS A;  2FW2 A;  3M6M A;  3PZK A;  4L8K A;  4LK5 A;  4I42 A;  2DEO A;  1WZ8 A;  2C8T A;  1Y7O A;  3QXI A;  1HNU A;  4HC8 A;  2J5I I;  3KTG A;  1W2X A;  5G1Q A;  5DUF A;  2PBP A;  3LAO A;  4OG1 A;  3VIV A;  1N6F A;  3HE2 A;  3Q0G A;  1O8U A;  1FC9 A;  1XNW A;  4EMP A;  3PEA A;  4JJT A;  5INI A;  2CE3 A;  5G1S A;  1X0U A;  1FCF A;  2VSS E;  2ZL4 A;  3MYB A;  4JWV A;  3Q1T A;  3BPP A;  1K39 A;  1UYV A;  3V5E A;  2PPY A;  3U9R B;  3MOY A;  5INF A;  4JCQ A;  3OME A;  3H0U A;  4GHN A;  3T8A A;  3BEZ A;  1OD2 A;  2ZQR A;  4HNK A;  1Q52 A;  3LKE A;  2VRE A;  4JFC A;  1XO6 A;  4ELS A;  3P5M A;  4K3W A;  5KDR B;  1DCI A;  1YG6 A;  3ZWC A;  2Q34 A;  2F6Q A;  4JSB A;  3R6H A;  4RYF H;  2WTB A;  5IKL B;  1XNY A;  2ZQQ A;  3GMA A;  2X58 A;  1UYS A;  2F9I A;  4QFE A;  2FBM A;  1FC6 A;  4FN8 A;  4RYF A;  2A7S A;  3H0Q A;  2F9Y B;  3ZWA A;  2X24 A;  5DU6 A;  4WYO B;  3MT6 A;  1MJ3 A;  3H02 A;  3M6N A;  3RSI A;  2VX2 A;  4IZC A;  2CBY A;  4RCN A;  4KWB A;  4WCZ A;  3HRX A;  3R9S A;  4Z0M A;  2F6I A;  2DUB A;  2VSU C;  1WDL A;  3KTI A;  1Q51 A;  4FB8 A;  3FF6 A;  1HNO A;  1VRG A;  4JCS A;  4QIJ A;  2J5I A;  4FN7 A;  3TT6 A;  3OT6 A;  2GTR A;  5DU8 A;  4U0H A;  3ZWB A;  3TDC A;  3KQF A;  1N6D A;  4OLQ A;  4K2N A;  3T8B A;  1HZD A;  3Q0J A;  3Q7H A;  5E0S H;  4JCR A;  1XNV A;  3SLL A;  3V5I A;  3L3S A;  1SZO A;  1EF8 A;  3I47 A;  3JU1 A;  4IZB A;  1NZY A;  5JBX A;  4G2R A;  3SWX A;  1DUB A;  1J7X A;  3QYR A;  2ZL3 A;  4B3J A;  2ZL0 A;  1XX4 A;  3P2L A;  4JVT A;  3R0O A;  1TYF A;  3WG5 A;  4K29 A;  3KTJ A;  2W3P A;  5DUC A;  4QII A;  3N6R B;  4JCT A;  3K8X A;  2F9I B;  5DZK H;  5FIF A;  1ON3 A;  3STA A;  4I52 A;  3TZ3 A;  3U9T B;  2FZS A;  1N6E A;  2PG8 A;  4FNB A;  5JBW A;  5DZK A;  3ST9 A;  3T88 A;  4DI1 A;  1YG8 A;  1OD4 A;  3IBB A;  3MFM A;  4ZDE A;  4OMR A;  2QQ3 A;  4FZW C;  3QKA A;  2VSU F;  1PJH A;  4KD6 A;  2J5S A;  3G64 A;  3RRV A;  1RJN A;  3FDU A;  5DTP A;  1UIY A;  3H0J A;  3KTH A;  4Q0G A;  3BF0 A;  2J5G A;  1TG6 A;  4MOU A;  1UYR A;  4KNP A;  4ZDD A;  5CTB A;  3HIN A;  3DJA A;  4YLH A;  4U0G H;  2F9Y A;  4FND A;  2A81 A;  4B3H A;  1JXZ A;  4B3I A;  4U0G A;  3ISA A;  3PGQ A;  3H81 A;  5MGB A;  1EY3 A;  3TVW A;  3QRE A;  3OC7 A;  1SG4 A;  3QWD A;  3R9Q A;  5KJP A;  2UZF A;  1PIX A;  2J5G D;  4WZ8 B;  4ZDC A;  3TT7 A;  3QMJ A;  2NP9 A;  4ELX A;  4U1A A;  4ELW A;  5E0S A;  3P85 A;  5FUS A;  1NZY B;  3GF7 A;  4ZU2 A;  3QXZ A;  3GF3 A;  3HLN 1;  4Q1I A;  3GKB A;  5DTW A;  3DOR A;  4U18 A;  3HP0 A;  1WDK A;  4GM2 A;  1FC7 A;  2VSU E;  2HW5 A;  2Q35 A;  4F47 A;  5DL1 A;  4EML A;  3K50 A;  3GLM A;  2A7K A;  4ZDF A;  3T3W A;  3R9T A;  2EJ5 A;  5E0N X;  4ZDB A;  3IAV A;  4IZD A;  3T89 A;  4JYJ A;  5DKP A;  3PE8 A;  5C9G A;  1RJM A;  5C90 A; 
#chains in the Genus database with same CATH topology
 3KTK A;  5DU4 A;  3RST A;  4MI2 A;  3TVU A;  4FJW D;  3ZW8 A;  5CTC A;  5G1R A;  4U19 A;  3TLF A;  1K32 A;  4L6W A;  1ON9 A;  4NAR A;  4ASI A;  2BZR A;  2VSS F;  5HUQ A;  3ZW9 A;  1EF9 A;  2ZL2 A;  4J2U A;  2IEX A;  5KDR A;  3NJB A;  5ING A;  1UYT A;  4JOT A;  4JYL A;  3TRR A;  3QK8 A;  4EMM A;  4FZW A;  4NEK A;  4NNQ A;  2D3T A;  2Q2X A;  3U9S B;  3H0S A;  2YJG A;  4I4Z A;  4MXI A;  2J5I B;  3IB9 A;  3TV5 A;  3NJD A;  4KPK A;  1WDM A;  2VSU A;  2VSS A;  2FW2 A;  3M6M A;  3PZK A;  4L8K A;  4LK5 A;  4I42 A;  2DEO A;  1WZ8 A;  2C8T A;  1Y7O A;  3QXI A;  1HNU A;  4HC8 A;  2J5I I;  3KTG A;  1W2X A;  5G1Q A;  5DUF A;  2PBP A;  3LAO A;  4OG1 A;  3VIV A;  1N6F A;  3HE2 A;  3Q0G A;  1O8U A;  1FC9 A;  1XNW A;  4EMP A;  3PEA A;  4JJT A;  5INI A;  2CE3 A;  4HDT A;  5G1S A;  1X0U A;  1FCF A;  2VSS E;  2ZL4 A;  3MYB A;  4JWV A;  3Q1T A;  3BPP A;  1K39 A;  1UYV A;  3V5E A;  2PPY A;  3U9R B;  3MOY A;  5INF A;  4JCQ A;  3OME A;  3H0U A;  4GHN A;  3T8A A;  3BEZ A;  1OD2 A;  2ZQR A;  4HNK A;  1Q52 A;  3LKE A;  2VRE A;  4JFC A;  1XO6 A;  4ELS A;  3P5M A;  4K3W A;  5KDR B;  1DCI A;  1YG6 A;  3ZWC A;  2Q34 A;  2F6Q A;  4JSB A;  3R6H A;  4RYF H;  2WTB A;  5IKL B;  1XNY A;  2ZQQ A;  3GMA A;  2X58 A;  1UYS A;  2F9I A;  4QFE A;  2FBM A;  1FC6 A;  4FN8 A;  4RYF A;  2A7S A;  3H0Q A;  2F9Y B;  3ZWA A;  2X24 A;  5DU6 A;  4WYO B;  3MT6 A;  1MJ3 A;  3H02 A;  3M6N A;  3RSI A;  2VX2 A;  4IZC A;  2CBY A;  4RCN A;  4KWB A;  4WCZ A;  3HRX A;  3R9S A;  4Z0M A;  2F6I A;  2DUB A;  2VSU C;  1WDL A;  3KTI A;  1Q51 A;  4FB8 A;  3FF6 A;  1HNO A;  1VRG A;  4JCS A;  4QIJ A;  2J5I A;  4FN7 A;  3TT6 A;  3OT6 A;  2GTR A;  5DU8 A;  4U0H A;  3ZWB A;  3TDC A;  3KQF A;  1N6D A;  4OLQ A;  4K2N A;  3T8B A;  1HZD A;  3Q0J A;  3Q7H A;  5E0S H;  4JCR A;  1XNV A;  3SLL A;  3V5I A;  3L3S A;  1SZO A;  1EF8 A;  3I47 A;  3JU1 A;  4IZB A;  1NZY A;  5JBX A;  4G2R A;  3SWX A;  1DUB A;  1J7X A;  3QYR A;  2ZL3 A;  4B3J A;  2ZL0 A;  1XX4 A;  3P2L A;  4JVT A;  3R0O A;  1TYF A;  3WG5 A;  4K29 A;  3KTJ A;  2W3P A;  5DUC A;  4QII A;  3N6R B;  4JCT A;  3K8X A;  2F9I B;  5DZK H;  5FIF A;  1ON3 A;  3STA A;  4I52 A;  3TZ3 A;  3U9T B;  2FZS A;  1N6E A;  2PG8 A;  4FNB A;  5JBW A;  5DZK A;  3ST9 A;  3T88 A;  4DI1 A;  1YG8 A;  1OD4 A;  3IBB A;  3MFM A;  4ZDE A;  4OMR A;  2QQ3 A;  4FZW C;  3QKA A;  2VSU F;  1PJH A;  4KD6 A;  2J5S A;  3G64 A;  3RRV A;  1RJN A;  3FDU A;  5DTP A;  1UIY A;  3H0J A;  3KTH A;  4Q0G A;  3BF0 A;  2J5G A;  1TG6 A;  4MOU A;  1UYR A;  4KNP A;  4ZDD A;  5CTB A;  3HIN A;  3DJA A;  4YLH A;  4U0G H;  2F9Y A;  4FND A;  2A81 A;  4B3H A;  1JXZ A;  4B3I A;  4U0G A;  3ISA A;  3PGQ A;  3H81 A;  5MGB A;  1EY3 A;  3TVW A;  3QRE A;  3OC7 A;  1SG4 A;  3QWD A;  3R9Q A;  5KJP A;  2UZF A;  1PIX A;  2J5G D;  4WZ8 B;  4ZDC A;  3TT7 A;  3QMJ A;  2NP9 A;  4ELX A;  4U1A A;  4ELW A;  5E0S A;  3P85 A;  5FUS A;  1NZY B;  3GF7 A;  4ZU2 A;  3QXZ A;  3GF3 A;  3HLN 1;  4Q1I A;  3GKB A;  5DTW A;  3DOR A;  4U18 A;  3HP0 A;  1WDK A;  4GM2 A;  1FC7 A;  2VSU E;  2HW5 A;  2Q35 A;  4F47 A;  3BPT A;  5DL1 A;  4EML A;  3K50 A;  3GLM A;  2A7K A;  4ZDF A;  3T3W A;  3R9T A;  2EJ5 A;  5E0N X;  4ZDB A;  3IAV A;  4IZD A;  3T89 A;  4JYJ A;  5DKP A;  3PE8 A;  5C9G A;  1RJM A;  5C90 A; 
#chains in the Genus database with same CATH homology
 3KTK A;  5DU4 A;  3RST A;  4MI2 A;  3TVU A;  4FJW D;  3ZW8 A;  5CTC A;  5G1R A;  4U19 A;  3TLF A;  1K32 A;  4L6W A;  1ON9 A;  4NAR A;  4ASI A;  2BZR A;  2VSS F;  5HUQ A;  3ZW9 A;  1EF9 A;  2ZL2 A;  4J2U A;  2IEX A;  5KDR A;  3NJB A;  5ING A;  1UYT A;  4JOT A;  4JYL A;  3TRR A;  3QK8 A;  4EMM A;  4FZW A;  4NEK A;  4NNQ A;  2D3T A;  2Q2X A;  3U9S B;  3H0S A;  2YJG A;  4I4Z A;  4MXI A;  2J5I B;  3IB9 A;  3TV5 A;  3NJD A;  4KPK A;  1WDM A;  2VSU A;  2VSS A;  2FW2 A;  3M6M A;  3PZK A;  4L8K A;  4LK5 A;  4I42 A;  2DEO A;  1WZ8 A;  2C8T A;  1Y7O A;  3QXI A;  1HNU A;  4HC8 A;  2J5I I;  3KTG A;  1W2X A;  5G1Q A;  5DUF A;  2PBP A;  3LAO A;  4OG1 A;  3VIV A;  1N6F A;  3HE2 A;  3Q0G A;  1O8U A;  1FC9 A;  1XNW A;  4EMP A;  3PEA A;  4JJT A;  5INI A;  2CE3 A;  4HDT A;  5G1S A;  1X0U A;  1FCF A;  2VSS E;  2ZL4 A;  3MYB A;  4JWV A;  3Q1T A;  3BPP A;  1K39 A;  1UYV A;  3V5E A;  2PPY A;  3U9R B;  3MOY A;  5INF A;  4JCQ A;  3OME A;  3H0U A;  4GHN A;  3T8A A;  3BEZ A;  1OD2 A;  2ZQR A;  4HNK A;  1Q52 A;  3LKE A;  2VRE A;  4JFC A;  1XO6 A;  4ELS A;  3P5M A;  4K3W A;  5KDR B;  1DCI A;  1YG6 A;  3ZWC A;  2Q34 A;  2F6Q A;  4JSB A;  3R6H A;  4RYF H;  2WTB A;  5IKL B;  1XNY A;  2ZQQ A;  3GMA A;  2X58 A;  1UYS A;  2F9I A;  4QFE A;  2FBM A;  1FC6 A;  4FN8 A;  4RYF A;  2A7S A;  3H0Q A;  2F9Y B;  3ZWA A;  2X24 A;  5DU6 A;  4WYO B;  3MT6 A;  1MJ3 A;  3H02 A;  3M6N A;  3RSI A;  2VX2 A;  4IZC A;  2CBY A;  4RCN A;  4KWB A;  4WCZ A;  3HRX A;  3R9S A;  4Z0M A;  2F6I A;  2DUB A;  2VSU C;  1WDL A;  3KTI A;  1Q51 A;  4FB8 A;  3FF6 A;  1HNO A;  1VRG A;  4JCS A;  4QIJ A;  2J5I A;  4FN7 A;  3TT6 A;  3OT6 A;  2GTR A;  5DU8 A;  4U0H A;  3ZWB A;  3TDC A;  3KQF A;  1N6D A;  4OLQ A;  4K2N A;  3T8B A;  1HZD A;  3Q0J A;  3Q7H A;  5E0S H;  4JCR A;  1XNV A;  3SLL A;  3V5I A;  3L3S A;  1SZO A;  1EF8 A;  3I47 A;  3JU1 A;  4IZB A;  1NZY A;  5JBX A;  4G2R A;  3SWX A;  1DUB A;  1J7X A;  3QYR A;  2ZL3 A;  4B3J A;  2ZL0 A;  1XX4 A;  3P2L A;  4JVT A;  3R0O A;  1TYF A;  3WG5 A;  4K29 A;  3KTJ A;  2W3P A;  5DUC A;  4QII A;  3N6R B;  4JCT A;  3K8X A;  2F9I B;  5DZK H;  5FIF A;  1ON3 A;  3STA A;  4I52 A;  3TZ3 A;  3U9T B;  2FZS A;  1N6E A;  2PG8 A;  4FNB A;  5JBW A;  5DZK A;  3ST9 A;  3T88 A;  4DI1 A;  1YG8 A;  1OD4 A;  3IBB A;  3MFM A;  4ZDE A;  4OMR A;  2QQ3 A;  4FZW C;  3QKA A;  2VSU F;  1PJH A;  4KD6 A;  2J5S A;  3G64 A;  3RRV A;  1RJN A;  3FDU A;  5DTP A;  1UIY A;  3H0J A;  3KTH A;  4Q0G A;  3BF0 A;  2J5G A;  1TG6 A;  4MOU A;  1UYR A;  4KNP A;  4ZDD A;  5CTB A;  3HIN A;  3DJA A;  4YLH A;  4U0G H;  2F9Y A;  4FND A;  2A81 A;  4B3H A;  1JXZ A;  4B3I A;  4U0G A;  3ISA A;  3PGQ A;  3H81 A;  5MGB A;  1EY3 A;  3TVW A;  3QRE A;  3OC7 A;  1SG4 A;  3QWD A;  3R9Q A;  5KJP A;  2UZF A;  1PIX A;  2J5G D;  4WZ8 B;  4ZDC A;  3TT7 A;  3QMJ A;  2NP9 A;  4ELX A;  4U1A A;  4ELW A;  5E0S A;  3P85 A;  5FUS A;  1NZY B;  3GF7 A;  4ZU2 A;  3QXZ A;  3GF3 A;  3HLN 1;  4Q1I A;  3GKB A;  5DTW A;  3DOR A;  4U18 A;  3HP0 A;  1WDK A;  4GM2 A;  1FC7 A;  2VSU E;  2HW5 A;  2Q35 A;  4F47 A;  3BPT A;  5DL1 A;  4EML A;  3K50 A;  3GLM A;  2A7K A;  4ZDF A;  3T3W A;  3R9T A;  2EJ5 A;  5E0N X;  4ZDB A;  3IAV A;  4IZD A;  3T89 A;  4JYJ A;  5DKP A;  3PE8 A;  5C9G A;  1RJM A;  5C90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...