4ZE5A

Structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 185
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ze5A00
2DT1A 2WHJA 3RMEA 7CGTA 5HOSA 5I0DA 3VO0A 2ZUSA 4W8BA 4AEFA 1ZBKA 4KRTA 4D6CA 2BVYA 5A6KA 2WKGA 1PBGA 2UWFA 1BHGA 4U2YA 3WMSA 2W61A 3VIMA 3VNZA 2VCCA 4MAZA 1U30A 1ISZA 1QBBA 1G9HA 4F66A 3K8MA 4MNJA 2VRQA 4S3KA 2IXUA 4X0NA 2G3MA 3CZEA 1MW3A 1ISWA 4CCDA 3AQUA 2PWFA 1FHLA 1V3KA 3E1F1 3ZM8A 5I79A 2BHZA 2WHMA 1B30A 4Z2LA 3W37A 4JHOA 2WHLA 2V5DA 1E43A 3GNRA 3CHDA 4TTUA 1OBAA 1HJSA 3OLDA 4KGJA 4UOQA 3UR7A 3VIJA 1UWRA 4IPNB 5ABGA 1Q6DA 4AIEA 2OWCA 3CUHA 1ZL1A 3SCVA 4NRRA 1JZ7A 1VB9A 1EQPA 2WCAA 1HN1A 5A3HA 3QR3A 4PMYA 2GK1A 3U7VA 4UQAA 1IZJA 3SUVA 4AC1X 4TVDA 2WANA 1KR1A 2WMIB 5E0FA 1VIWA 4QLLA 1WE5A 4Z2JA 3QHNA 2YIHA 4M1RA 5EFFA 4BQ2A 2GK1B 4TVCA 1AQ0A 2XSAA 5BXSA 1UZ4A 3N12A 3UG3A 5D9PA 1RP9A 4ZE4A 1NOUA 3UERA 4QCFA 4PMRA 1Q6FA 4M81A 1TMQA 2J74A 1I75A 1ZB5A 3AYRA 2WVUA 2WC3A 1KCLA 2YL5A 3MMDA 3KL0A 5ABEA 3EMCA 4UNIA 2VCAA 1FHDA 4H8VA 3VD3A 1VENA 1JI2A 1UWSA 1KGXA 2E9MA 3BSGA 2BV9A 4RE3A 3WNLA 2GFTA 1E6NA 2IUZA 1VEPA 1H3GA 1HJXA 5E6ZA 4AMCA 2BXYA 3NCOA 1BVNP 4D6DA 5HPCA 3PZ9A 1V02A 2XVNA 2OYLA 4JAWA 3OG2A 3NUKA 1ZJAA 3THCA 3IJ8A 4QP0A 1W91A 3CO4A 2UY5A 1KCKA 1KGUA 3S2CA 1NM9A 2XTKA 3S6TA 3AIWA 2AMGA 3MMWA 3ZJKA 4U2ZA 5LA1A 2J7BA 1UD3A 1XH0A 4AD1A 2CBIA 1NP0A 3PZQA 5JIPA 3QHOA 1C93A 3W6MA 1GOIA 2D20A 1E0WA 4J3XA 2YL6A 1QHZA 2YBTA 2YL8A 4P8UA 4FLOA 4PN2A 3ZSTA 2O9OA 4AWEA 2WCSA 5CJ5A 3EMZA 2UY2A 4GINA 1K6AA 3W25A 4AZCA 1R86A 1CPUA 1EHNA 3MUAA 1CGTA 3SCSA 1JZ8A 4Z2IA 1XH2A 4AD3A 2YA0A 2G3JA 3UCQA 3D5HA 3RM4A 4JKMA 3VIIA 2DT2A 2D0GA 4GQRA 4A3HA 2G3NA 1L8NA 3PTKA 2ESCA 3HN3A 3W81A 3NDZA 3W26A 1G1YA 1EDTA 2VZVA 3UG4A 2FGLA 1SMDA 1J0HA 3VOCA 4CU7A 1RPKA 2D3NA 4EE9A 2WZEA 2EPLX 3II1A 1HIZA 1NARA 2JIWA 4HZ6A 4D1IA 2F61A 1K9DA 2J7FA 3VGGA 3WUBA 2PF0A 1PX4A 2VTFA 1TA3B 1NH6A 5CZKA 3WF4A 1DWFM 2FHFA 2EO7A 2X05A 5I5RA 5D9NA 3AJ7A 1NWUA 5E9AA 1E40A 2A3BA 2XVKA 3WDHA 1LWJA 3KEHA 3AISA 3VIGA 2E9BA 1MQQA 3OGRA 4D72A 1JYWA 3ZR5A 2VRKA 3WNPA 3DHPA 2DH2A 2QV4A 3HMCA 1J12A 5AC5A 3BAKA 1WDRA 1UR4A 3T0AA 3VGHA 1GCYA 4EK7A 1TFVA 5ABHA 1QNOA 3WEMA 4UZSA 2JE8A 2WMKA 3GXIA 2J25A 4W93A 4ACZA 2XHYA 4P7LA 4GI8A 3FNDA 1SR0A 1JAKA 3IJ7A 2BY0A 4OKDA 1US2A 1GQLA 4WLCA 2CCRA 1OGSA 1CTNA 5HBFA 4H8UA 1QI2A 3OBAA 4ACZB 1FP9A 2ZXBA 2WBGA 1F4HA 3WD3A 1PAMA 3CMGA 1UD5A 1JNEA 2EPNA 2EJ1A 2CITA 3BMVA 1D7FA 3LPPA 3WDJA 3L4UA 1VF8A 1FFQA 4HMCA 2XFYA 5A6SA 1UQYA 3OA5A 4TX6A 3I3BA 1BYCA 4Q7NA 5CLTA 2VCBA 5I77A 1ZJBA 3M6DA 3F5KA 5BRPA 4UFLA 3CMJA 3BH4A 5FIPA 3L4ZA 3SCNA 1M7XA 3BCFA 3VX0A 4LX4A 1GHSA 3VDAA 1W9XA 1VFMA 4HPGA 4ZFMA 1MXDA 2QMKA 1CXHA 4MDPA 2ZIDA 3A3HA 4H7VA 2CHNA 1TVNA 3WBAA 2JIEA 2DSWA 4UQ9A 1MXGA 2X2YA 3G6LA 3OLEA 4UZUA 1MQPA 4AW7A 4TTGA 1BGGA 2DPEA 4JHZA 1UA3A 1B9ZA 2XGIA 3O6AA 1E6ZA 1J0KA 3CGTA 1BFNA 2XWDA 3W38A 4H8HA 2ZWYA 4U5IA 5LYRA 3WH9A 3D3AA 3ARWA 2EXOA 3HU7A 4PTWA 1ISXA 5A95A 1V6UA 1W9PA 3TTOA 2E8YA 4UFHA 3DYPA 1ESWA 1VEOA 3T2QA 1GOWA 2WZIA 4QFUA 2JF7A 3CHFA 1X6NA 3WL1A 1BYAA 1E1EA 1GHRA 3CZJA 1HKMA 1I1WA 2OWWA 3IANA 1B3VA 4OJYA 3WFZA 4LQ1A 1C92A 2XSBA 2VJXA 1LG2A 2GJRA 5I2UA 2BY2A 4HP5A 5BXPA 4J27A 3IK2A 2VX6A 5EMYA 1EDGA 1S46A 4D6IA 5D8WA 4UQBA 3U5UA 4OOUA 1LG1A 5HPOA 1H0IA 1QHPA 4Q22A 1EHAA 1E73M 5BROA 1C90A 3MKKA 4U3CA 5A6BD 3VU2A 1HXJA 1A3HA 2GUYA 4QAWA 2D0HA 2UY4A 4PCTA 3BLKA 1Z32X 1ZBVA 4JFUA 4V28A 4X9YA 5IXEA 2C0HA 1GVYA 3PZUA 4IM4A 3W28A 4CVUA 4OOZA 1XC6A 1EXPA 2W66A 1JF6A 3SCWA 2A3HA 3CZKA 4BQ4A 1KB3A 1ZU8A 3AYSA 1J0ZA 4W8AA 1VFFA 4IUGA 3GH5A 2ZOXA 4NRSA 3AIQA 4E2OA 4AYSA 1B1YA 1M01A 2YA1A 3SCUA 1TCMA 3WDQA 1B2YA 3M7SA 4DWSD 4J3VA 1W1VA 2XIBA 4OBSA 2V3GA 1OM0A 2VO5A 3LPFA 2G3IA 1GJUA 1MW2A 1JIBA 5DO8A 1E72M 4GZEA 3TOPA 1H11A 1W9UA 2Z1KA 2VC9A 3VVGA 3EMQA 4CVWA 2XM2A 4OZOA 1EDQA 1M03A 1E6RA 3PTQA 1KXQA 3TTYA 2G4FA 3WQ8A 4CCEA 2ZUVA 5EFDA 1MVYA 1OGGA 4E8CA 3ARVA 1R87A 3AMKA 4HA3A 2E0PA 2A3EA 1TUXA 4FLQA 4J3UA 1NWRA 5JBDA 5D9MA 1LQ0A 2ZUTA 1YQ2A 4AIOA 3WH6A 1GNXA 1DHKA 5AYBA 1GOQA 3MO4A 1AQMA 2VX7A 1VJZA 4XZWA 5LA2A 1J0YA 1UKQA 3ZT5A 2XVPA 2O92A 4JL1A 4HZ7A 5I6SA 4WF7A 2G8ZA 3POHA 1GPFA 1QI5A 2J7EA 2PB1A 2Q8XA 1G01A 2RGLA 2WAGA 3AFBA 1UWIA 1W2VA 3N11A 1QNRA 4CD5A 1UKSA 1W9BM 2J4GA 3FHQA 3NYDA 4AZ6A 4PTMA 5CPSA 4H41A 1UR1A 3WKZA 3AROA 4KGLA 1RH9A 2WZHA 1LL7A 3GYCA 3WUEA 1HP5A 2W5FA 3N17A 5A8MA 1LWHA 4JCLA 5KZ6A 3I3EA 4PEEA 2W63A 3VKKA 2D23A 3T09A 3WH5A 1CXKA 2X1IA 3RILA 1CXLA 2WMFA 2YBUA 2Y8VA 1CGVA 2A3AA 4A3YA 1UR2A 3RO8A 1PEZA 3O9NA 1E15A 1EO5A 3KZSA 5I23A 1WZKA 5GNYA 2V3FA 1BTCA 1XRVA 3AIRA 4KMQA 2BVDA 2WCGA 3CHEA 3GNOA 1CIUA 2PWHA 2VI0A 1UKOA 4E8DA 3WQVA 4PYSA 1V0NA 1YHTA 6A3HA 2CESA 4ATLA 4H04A 2J75A 3BAJA 1VRXA 3MU7A 2NW0A 1H09A 3RPMA 1L0PA 3WD1A 4LPCA 1V6VA 3SCQA 4BCEA 3QGVA 2V3EA 1OSEA 4P7QA 5A2BA 4PBGA 1UA7A 1H4PA 1BGAA 2JALA 2DH3A 2YDSA 1XCXA 4KRUA 4W7UA 3MMUA 4MB5A 3B9AA 1E6QM 4U5KA 3BAWA 4MDOA 3A4XA 1DWHM 1W1YA 4MNLA 3SUSA 1ITCA 5A8NA 4M29A 3SUUA 1OINA 4W87A 1GONA 3POCA 3FAWA 4AXNA 1BLIA 1CNVA 1CLVA 1J9YA 2WVTA 3CUFA 3GXFA 3NSNA 1UKTA 3VX1A 3B9DA 5FL0A 1UD8A 1E5JA 4UQDA 3CHCA 1ODUA 3ECQA 3W29A 1P6WA 5E09A 1MW0A 1ITXA 1E4MM 3MSGA 3ARZA 1W3KA 4HTYA 2DQXA 5A6LA 3EDKA 1JNDA 2EPOA 5E0CA 2V5CA 1TR1A 1WDQA 2E4TA 4HU0A 2WSPA 3AHYA 3ZMRA 2CKSA 1JL8A 3W6LA 1E9LA 4LYQA 1KXVA 3GTNA 2CBJA 4GI9A 4U33A 3RJXA 3F5LA 4YN5A 2WMGA 2F8QA 5GQBA 3AI0A 4HMDA 3AIEA 1HKIA 2YKKA 5CLWA 1KXHA 2D2OA 4UFKA 3ZT7A 2VOTA 4GZIA 3N04A 2JEQA 2J47A 4AZBA 2BHYA 4D6HA 5IFTA 3OGSA 3BLPX 3WDIA 4JCMA 4H2CA 1VBRA 1E71M 1V08A 4BS0A 1R8LA 1UH2A 5A6MA 2D0FA 1FH9A 3EDJA 3WNNA 4AZCB 1UH3A 2DSKA 4PRWA 3ZQ9A 1QNQA 5FOOA 3CZGA 2VUYA 2YA2A 3ALGA 4P8VA 3AMGA 3PZOA 1OIFA 3F5JA 1TE1A 4JL2A 4AZGA 1NQ6A 2PWGA 4E4PA 4URIA 3VDBA 1CXFA 4P8WA 3SUTA 1WNOA 3T2OA 1UQZA 3WDRA 4UTFA 3NSMA 1J0JA 2WW5A 3CUJA 1ZS2A 4PUEA 1CYGA 1VFUA 4BZYA 2RGMA 1WP6A 3BSHA 1SFSA 3U5YA 4MJ4A 1KBBA 2HISA 1QI3A 3OZPA 2XPKA 4GI6A 4GO9A 3AICA 3IAQA 3SCPA 3ARYA 4J3WA 1F4AA 5I24A 1C7SA 3SUWA 1U33A 1C8QA 3WD2A 1JZ3A 1OT2A 3K4AA 4UQEA 3MUZ1 3VIKA 4W7WA 4CGTA 4UQCA 3ARPA 3WDPP 4PMQA 3L4YA 1UHVA 1W32A 1OWQA 2VX5A 1V6XA 1JZ4A 3GH4A 4Z2KA 2FHBA 4AZ7A 1XD1A 3W4RA 5HNNA 3U57A 1FOBA 5TD4A 2DSZA 3AIUA 1OD0A 3RCNA 2XVLA 3QOMA 4EANA 1NP2A 3MV11 4BF7A 5A6BA 2YDRA 5DEZA 3RIKA 1UOKA 5BRQA 3AS0A 4W5ZA 1R7OA 3CBWA 2Y5EA 2DDXA 2ZUUA 3BAYA 3BAXA 5IHRA 3HJEA 1UWQA 1US3A 3EYPA 3GZAA 2BY1A 4P7NA 3WEOA 1V3HA 3A4WA 3JUGA 1Q6GA 5EBAA 5BWFA 3GBEA 1IT0A 1QW9A 1QNSA 1JZ6A 3PN8A 4B9ZA 2XWEA 4JFVA 1XGZA 1CBGA 1I1XA 4WKHA 5FL1A 1UD6A 2W67A 3F4VA 4WK9A 1JDDA 3ARUA 3N13A 1WZLA 2J7HA 1KQYA 1B3XA 3MUY1 4JKLA 3AMCA 5CSYA 4CD4A 1J18A 4NSBA 4W85A 1WZMA 1BG4A 2VZTA 1JF5A 4M82A 2DIEA 4XB3A 5HDRA 3CUGA 3AMDA 1MFUA 3L2LA 2NSXA 2VNCA 3IAPA 3SEPA 1X1NA 3WBEA 1V6YA 2GVYA 1HJWA 3VMPA 3MUIA 4C7GA 4J3TA 1UD4A 1C91A 4GZJA 2DT3A 2WB5A 3WQ4A 4K68A 5BXTA 1HL8A 1SYTA 4Z2HA 2WVSA 1VAHA 3CZLA 1W9VA 4JFSA 4XX6A 1WDSA 4WSJA 2DIJA 4AY1A 1R7AA 1KFWA 1E4LA 1MWOA 4D6JA 4ACYA 2EQDA 3K46A 2CPUA 5A2AA 3VD7A 2FH8A 1DWGM 1JAEA 2EPMX 1EOMA 3WFLA 3K4DA 1KWGA 2J77A 1XCWA 3BXWA 1DEDA 1XSKA 3BC9A 3WD0A 2XFFA 3VMOA 2EBNA 3RM8A 2VZSA 1KR0A 4ZEPA 1LF1A 1UH4A 1DP0A 4WJXA 3MS8A 1NWTA 4LYRA 2CERA 4XV0A 4OBRA 2CHOA 2WWCA 4HU8A 2DSUA 4TVUA 4HMEA 1AVAA 2QF8A 3ZIZA 3SCTA 3ZT6A 1D2KA 1JG9A 5A2CA 3M46A 1JZ2A 5BXRA 2ZICA 7TAAA 5M5DA 4PMXA 4JZ5A 4AD0A 1GZJA 3VILA 4J3SA 2Y24A 3WQWA 4D71A 2YOCA 4HOWA 3ZO9A 1HKJA 3AHTA 3K1DA 1NWSA 4V2XA 5D8ZA 3VGFA 4D1JA 3OB8A 1QBAA 1LJYA 4J28A 4V27A 1ODZA 1OCQA 1E0XA 1V3LA 4CD6A 2ZX6A 1MFVA 1PX3A 4KH2A 4W86A 1W2PA 4M8UA 2WVVA 1XYZA 2VX4A 1PZ3A 4B9YA 5AY7A 1PIGA 4HOXA 5AYIA 3ZSSA 2ZUWA 5F7UA 1HJVA 2VT0A 3MANA 4YPJA 3L2MA 5KEZA 4CUCA 4MTVA 3VINA 3FXYA 2J78A 3VGBA 1E56A 3CUIA 3N1AA 4AD2A 2VRJA 2F2HA 2DT0A 2NT0A 3BGAA 1CGXA 4PSRA 4NZCA 1EIBA 2MANA 1WB0A 5M17A 6CGTA 2YL9A 1UR8A 1KXTA 2E40A 4XUYA 2GDVA 5JIWA 1CXEA 4JFWA 1PX8A 3SURA 2Z1SA 2VVSA 4WIWA 1JZ5A 4F9DA 3DC0A 1E70M 3CTTA 3WF1A 4CN6A 2ZXAA 2ZWZA 2WMHA 2ZXQA 4CD8A 3AIBA 1H0GA 4JKKA 1CDGA 3K8KA 4PMVA 1BYBA 5GNXA 1XD0A 4MJ2A 1HX0A 2PBOA 1HT6A 3AMLA 1BVZA 5C71A 3AZRA 1XSIA 2ZUMA 4HA4A 1QW8A 1B0IA 1CLXA 3EDDA 3WH7A 5A1AA 4P7OA 3W27A 1H41A 4MNKA 1CGWA 3T08A 4GQQA 1JI1A 4HZ8A 2OYMA 1WO2A 1BYDA 5DT7A 1B3ZA 2XJ7A 4FMVA 1Q6EA 3WY1A 4GXPA 1E55A 4NI3A 4ZE5A 3IJ9A 4MADA 4UFIA 2X8RA 3KL3A 2J62A 3N9KA 4YHEA 1A47A 1WZAA 1GVIA 4DUVA 2W62A 3VIOA 3KE0A 3AXHA 1JYXA 4HA1A 2E8ZA 2JFEX 2V38A 4AZHA 4OIFA 4UR9A 2BXZA 2CKRA 1JFXA 3CIVA 4ATWA 2BS9A 4UFJA 3WEZA 2WMJA 1ZBWA 3CPUA 3VGEA 3GXMA 4PMDA 1K9FA 2PWDA 2PBGA 2QPUA 3RM9A 4WKFA 2ZUNA 3OZOA 1UD2A 4AZIA 1CZ1A 2Y2WA 4ZENA 2YLAA 3A47A 5A8QA 4AISA 1C3FA 1C8XA 1JXKA 3PZGA 2WC7A 1FP8A 1TG7A 1VBUA 2JEPA 2WXDM 3W82A 5CG0A 4GO8A 4WKAA 3ZOAA 3PZNA 3UEQA 1FH7A 2VURA 3TA9A 1O7AA 2VZUA 3ARSA 4TUFA 4M56A 3SIMA 3WUFA 1XH1A 1WDPA 1J10A 1FH8A 2AAAA 3N18A 1DTUA 2O9PA 3FW6A 3RJYA 5CSUA 4IISA 3KWXA 4PSPA 1LL4A 5D4YA 2WMIA 3ZJ7A 1TVPA 2QMJA 3BCDA 5ABFA 2GJXA 4R5EA 1PPIA 3VUPA 3DHUA 1WCGA 2DGAA 2E9LA 2ZX7A 3PZVA 4EAMA 4AZ5A 3VD4A 1DWJM 1E4IA 4LYPA 5CGTA 4CKQA 3FAXA 3UG5A 3AHVA 4F8XA 4EKJA 3WNOA 1M53A 4GIAA 5ABFB 2GJXB 3T0BA 2CNCA 4ZXLA 1HVQA 1XSJA 4M80A 5GPRA 1J01A 3VPLA 1FFRA 2W92A 2CIPA 2ZX8A 1C7TA 3AZSA 4RE2A 5A94A 4DM1A 1D3CA 4U31A 1E5NA 4P8XA 5CGMA 4N0RA 1U2YA 2J8GA 4B3KA 3VM7A 3AXIA 1HKKA 1KQZA 3DECA 1QVBA 3WNKA 2A3CA 2O9TA 1CWYA 4QLJA 1UKPA 1R85A 2VQUA 2TAAA 1W3JA 4PTXA 3WSUA 3LPGA 1V03A 5JBEA 3VDHA 3N15A 2V3DA 5JBFA 4HOZA 4OUEA 3VTRA 4PMNA 3VIFA 4CCCA 2CYGA 3OIHA 1G94A 5I78A 4W8LA 3L4XA 4L4PA 5C8BB 2FHCA 4CN1A 5BCAA 1QNPA 1UR9A 1WPCA 1JD7A 1H2JA 2XM1A 1X6LA 3QHMA 4X0VA 5C70A 4RE4A 3UR8A 2WC4A 3ARRA 4KWUA 4FLRA 2OLHA 2OSWA 3AIVA 3EDFA 1JFHA 2WM0A 1J0IA 1UZ1A 5IHSA 4ML4A 1CGYA 3WMBA 4CU8A 2W4XA 4J7RA 4PUDA 5DMYA 2XVGA 3OLGA 5A6JA 4R27A 1OIMA 1WKYA 4ZXOA 4W5UA 3WMCA 3ZJ8A 3W53A 4D6FA 1AMYA 4DUXA 3AS3A 3THDA 3PZTA 3AHXA 3VD5A 1BF2A 1H5VA 3WF2A 4CN4A 3GH7A 3J7HA 4PMOA 4Y7EA 4NF7A 2VMFA 3NIYA 5JUVA 1Q4NX 1C8YA 1V3IA 1EQCA 4JIEA 2B31A 4C7DA 3VIPA 1TA3A 4TOQA 4U3AA 1SMAA 5ECUA 5IDIA 1DWIM 3NSXA 2YDQA 1V3MA 2VZOA 3B8SA 3VM5A 1GOMA 2VVNA 3AS2A 1VJSA 2IXVA 1W3HA 4Z2GA 2DSVA 2CEQA 3BAIA 5FKYA 3FY1A 4PCSA 2XFRA 1CECA 4LGXA 4PMZA 1G5AA 2EEXA 2VR4A 1GQKA 3VNYA 3WN6A 2WLYA 3GNPA 4W88A 4TXEA 4AIUA 1QPKA 2FDMA 1XV8A 1W1TA 2GSJA 4GPNA 3W24A 3WIJA 4MAVA 8A3HA 1PJ9A 1NOFA 2J79A 1JDAA 1O6IA 2NT1A 1HJUA 5A69A 4F79A 3VGDA 3DYOA 1V3JA 3UESA 1GQJA 2AOSA 3TONA 3OLIA 5FCZA 2E3ZA 3PTMA 4ATDA 1CXIA 1H1NA 3WF0A 1Q6CA 1E6XM 5I3DA 2BFGA 1OT1A 1LL6A 3AOFA 4A4AA 3GBDA 3LPOA 5CQ1A 1GUVA 5BYWA 3MV01 3WF3A 1CENA 3T0DA 3WQ6A 4DM2A 3LMYA 3UETA 4FF5A 1XHGA 3G6MA 4FK9A 3TTQA 2YLLA 2PWEA 4LXFA 2CBVA 5E6YA 9CGTA 4UOZA 1RP8A 1JD9A 3L4VA 1MQRA 3GM8A 3O2LA 3VIHA 4C7FA 1G0CA 4BQ5A 2J7GA 4DWSA 4BQ3A 1OB0A 2ZE0A 3M07A 2DEPA 3RDKA 4DUWA 3NDYA 1UUQA 4B3LA 2EPKX 2D22A 2ZXDA 3WELA 4MPKA 3FHAA 3A6OA 4HPHA 5A8OA 3U7BA 1DWAM 4DWSB 1E6SM 1OGBA 1EO7A 2D24A 1CEOA 1K9TA 2G41A 3EBVA 5DF0A 4W84A 4AEEA 3L4TA 1E6PA 2BVTA 3ARXA 7A3HA 1B31A 1IV8A 4D6GA 1GOKA 1KBKA 3TP4A 4F9JA 1CGUA 1QOXA 1HP4A 4D6EA 1XYFA 4IPLA 2O9RA 5LA0A 1BSIA 1EGZA 2PC8A 4CU6A 1ISVA 3WNMA 2VQTA 1B3YA 2OSYA 4JFTA 3SCRA 1AQHA 4QDMA 2BNJA 1PIFA 2VR5A 2JF6A 2WBKA 1H49A 1V0LA 3A4AA 1B3WA 3ZR6A 5GNZA 1JYVA 3ALFA 1E1FA 3CLWA 1MYRA 1UWUA 1JDCA 2XYLA 1K9EA 1W1PA 1BPLB 3QOKA 1JYNA 3GXDA 1W9DM 2WWDA 1TZ7A 3DYMA 4P7RA 1VFOA 3WQ5A 3L4WA 4S3JA 5HXMA 2D3LA 1ECEA 1EH9A 2C7FA 2WKLA 3B9EA 4W89A 2WYSA 3VD9A 3ARTA 1ZBCA 2PI6A 4QLKA 1QI0A 1GW1A 2GDUA 4BA0A 2FH6A 3WENA 4AD5A 2BHUA 2XG9A 4FLSA 1KWKA 3APGA 2OWXA 2YJQA 3ARQA 2OSXA 2J7CA 3EDEA 5D9OA 3VMNA 2OYKA 4B15A 5IFPA 3GDBA 1IZKA 2GJPA 2XIIA 1N82A 4N42A 1UYQA 3AZTA 3PZMA 4QCEA 1MW1A 1BQCA 4MNMA 5A6AA 2C8NA 1HVXA 4WSKA 1E4NA 1JXJA 1BG9A 1FA2A 3AHZA 3CH9A 1EOKA 5M03A 1HJQA 2X0YA 3FN9A 2UY3A 1VEMA 5EB8A 3WD4A 5CPQA 4UFMA 5CXPA 2VL4A 1V0KA 3I3DA 1NOWA 2WVVB 3WH8A 5DFAA 3OGVA 1E3ZA 5E70A 1GQIA 2QLYA 1Y7VA 5A8PA 2W91A 1UWTA 2XUCA 1UG6A 2Y8KA 1GJWA 4W7VA 1V6WA 1BAGA 2Y4SA 3MSDA 2WLZA 8CGTA 1JGIA 3WUGA 1HL9A 1RD6A 4UOJA 1E3XA 1HNYA 1KGWA 1GOOA 1PZ2A 1UR0A 3NJ3A 2WSKA 1GORA 4PTVA 1J11A 4B16A 4DWSC 2J8FA 4CD7A 3PZIA 1B90A 1QHOA 3PHAA 3TTSA 1ISYA 4MB1A 3VDCA 4AD4A 5AC4A 2CXGA 4L4OA 2J7DA 3SCOA 2QPSA 1V02E 3ZJ6A 2WPGA 4TX8A 3KL5A 2HVMA 3CZ8A 2CETA 4XZBA 4YHGA 2D1ZA 2WHKA 4M24A 1M04A 1WAWA 5DT5A 3AXXA 4PMUA 4MB4A 2BY3A 3WL0A 2ZX5A 4UCFA 2X0HA 1V0MA 5FD0A 1E0VA 1QI4A 2XGBA 3PBGA 3W0KA 2ZX9A 5CPTA 3T2PA 3BMWA 2WNWA 2QHAA 1EA9C 2X09A 1W3LA 6TAAA 1HF6A 3K8LA 3AS1A 2CBUA 5M3WA 4MB3A 2FGZA 1LLOA 4GKLA 1OD8A 4RL3A 2WK2A
chains in the Genus database with same CATH superfamily
2DT1A 4AWTA 5C55A 3EOSA 5I0DA 5HOSA 1ZBKA 4JTIA 4F0SA 2BVYA 1KD0A 5A6KA 2INFA 3KS5A 1XPGA 5KMYA 4DBWA 3FIGA 3VNZA 4ZOBA 4MAZA 3KDOA 3W2UA 1DJWA 1ISZA 1QBBA 3K8MA 1I9CB 4BF5A 2VRQA 4ZB0A 2PDXA 2IXUA 3WQPA 3UNDA 3T42A 1RJQA 1O5RA 3AQUA 4FO4A 1V3KA 1QRQA 5I79A 2BHZA 1EX5A 4L1GA 4ZCWA 3I6TA 4IP4A 2AQOA 2C79A 2PP0A 3L0GA 4S3BA 4XO6A 4TTUA 3UR7A 1HJSA 2E5DA 1SGJA 4L64A 2D2HA 3U2EA 1SW7A 6ENLA 1GKPA 2Y1HA 4HHHA 1V77A 4PMYA 2W6RA 4ERGA 3RITA 3U7VA 3GNDA 4M5PA 4R34A 3GG1A 3KVMA 4O1DA 2R94A 5E0FA 1O60A 1VIWA 3OQ8A 4QLLA 1WE5A 3QHNA 5EFFA 4Q8VA 1EXBA 2GK1B 1AQ0A 1LM1A 3UZWA 5D9PA 4GQ0A 1XLHA 5FAGA 1NOUA 4WHBA 4QCFA 3TU9A 1ZNNA 4BI5A 2PLKA 5DMNA 1JVNA 2BOGX 2WVUA 1KCLA 2VCAA 3IIOA 4GFSA 1FHDA 4Q8NA 2DU2A 4B5SA 4H8VA 3UZ5A 1IIGA 3TC7A 1VENA 2BSLA 1JI2A 2BV9A 4NKCA 4Q8PA 1T8XA 4GVIA 3QC0A 5E6ZA 3GC2A 5HPCA 2FPTA 2OYLA 2VEIA 5K7JA 1BSLA 3S5OA 3OG2A 1P7TB 3VKAA 2WV8A 3TV8A 4I9MA 2PZ0A 3R0UA 3N6QA 4AHPA 3INPA 4LEQA 1U1JA 1YBQB 3HPZA 5IOBA 2IPWA 2XSXA 2AMGA 4KFOA 3NQBA 3ZJKA 3PBYA 4LSBA 5AOUA 1UD3A 3LCXA 1A50A 3LK6A 1NP0A 1PVNA 1W5MA 1F2JA 3R13A 4WJ8A 2Y5SA 4QNEA 2YL6A 2HMCA 4JTCA 4GI4A 2WSYA 4FLOA 5CC3A 2QF7A 3RR1A 3EMZA 4LC6A 1OK6A 5KZMA 3FSUA 1ML1A 5LIUX 1HQTA 4DJED 1EHNA 1JZ8A 4LY8A 2YA0A 3Q37A 5CSRA 2ZC1A 3QRHA 4JKMA 3HF3A 3VIIA 2DT2A 2Y8UA 3EPNA 3UY7A 3KHDA 3LOTA 3W81A 3NDZA 1G1YA 2QUTA 1JULA 3E3HA 3EOEA 1OX5A 4NHVA 2AKMA 3VOCA 1RPKA 2D3NA 4RPQA 2EPLX 1TTIA 2Z6IA 2JIWA 1YPXA 4HZ6A 1K9DA 6ALDA 3APTA 3KLKA 1XQLA 2B0MA 1K1DA 1TZZA 2B7QA 4G7FA 2PDUA 4BKNA 3DKJA 5LKYA 1KFJA 1RZMA 3BPWA 3GTHA 2FVKA 2HNEA 4RJEA 1LROA 1Z44A 3DAQA 1XRSA 2CZVA 2HK1A 4PRRA 3GU9A 3AISA 1XBYA 1FDZA 4D72A 1JYWA 4I7VA 1ZHAA 1LT8A 3ME3A 2YXOA 3HMCA 1ZCCA 3BAKA 1NQKA 3ITLA 3VZZA 3T0AA 4JIIX 5HUOA 4ICCX 1QNOA 4UZSA 2JE8A 1ADOA 1GYLA 4AQLA 2DV0A 4GI8A 3FNDA 3R5EA 4K2SA 1P0BA 1DJIA 3IJ7A 1US2A 3QEZA 1YLVA 2CCRA 2C1GA 1CTNA 2ZA2A 4PB5A 1WQ5A 1FVPA 1FWFC 2WBGA 1JCLA 1Z3NA 1PAMA 1JNEA 3WYZA 4XBSA 1D7FA 4HBKA 4QQUA 5A6SA 3CQJA 2YGYA 1OZQA 4G2DA 4TX6A 1OFEA 1WKDA 1ME8A 3H2CA 3B9OA 3CMJA 4Y9NA 4INFA 3BH4A 4Z0SA 1DJZA 4JYFA 2DZBA 3WLHA 2JKAA 4B3ZA 1VFMA 3A23A 1KFEA 3FSTA 1EWDA 4V1XA 2J9ZA 3SGZA 1WUFA 2ZIDA 4GZ7A 1RK6A 4I6VA 3NO5A 3WBAA 1MXGA 1MQPA 2DPEA 5JU6A 4UTMA 5G5IA 3O6AA 3LQLA 5FACA 3OIXA 1OZMA 1QFEA 4KCUA 3DG6A 4U5IA 1EL3A 3PULA 3ARWA 2FDSA 5T9CE 1LRNA 1YE6A 2DZUA 3B0PA 5DCEA 1W9PA 4ZMGA 2E8YA 4UFHA 1UP2A 1VEOA 4QFUA 3I4KA 2IMRA 1UCWA 3CZJA 4QXIA 2OWWA 3IANA 1B3VA 1DJYA 4Y2WA 1BTMA 1V6TA 5BWAA 2XSBA 2GJRA 5I2UA 2EG7A 5BXPA 4DI9A 4EP8C 4ADSA 4DYKA 4QJ5B 1EDGA 1J8VA 3NFUA 2QPXA 4C6QA 1QK2A 3NXLA 3ONCA 7REQA 4L1WA 4Q22A 1UWAA 3N6JA 1PHQA 3MKKA 3DG7A 1XS2A 3ANUA 4XD6A 2UY4A 2HE8A 5BU9A 4N9CA 3BLKA 4PCTA 1FWSA 1Z32X 1ZBVA 3LUTA 3IV3A 5AB3A 3P5YA 4LUTA 4FNQA 1XC6A 1JF6A 1W1ZA 1EEPA 3G0SA 1KB3A 4HGXA 2VGGA 4W8AA 1VFFA 4NRSA 3L66A 3MB9A 3DN5A 4P2VA 5E1QA 1Y5WA 1DV7A 4Z1YA 1A5SA 4DX3A 3DCPA 3WDQA 1MNSA 2AL2B 3TKFA 1Q3NA 1ZAIA 4HKPA 3P81A 1AH0A 1V51A 4GZEA 4PR4A 4RW3A 3TOPA 1W9UA 2Z1KA 4YJ5A 4CVWA 1CX9A 2IQDA 2EG8A 4QJ3B 1MEIA 1EC8A 3TTYA 3CAKA 1P0EA 5EFDA 1MVYA 1OGGA 3VNDA 2VDIA 2CZFA 2HROA 4L6DA 4GC4A 4GC3A 4H6KA 1V4YA 4U28A 2X1UA 1A80A 5AYBA 1AQMA 3RLGA 1KFCA 2VX7A 4XZWA 4HNLA 4HT3A 4XISA 4Z1CA 5LA2A 3TTEA 3T40A 3CL7A 2O92A 4JL1A 4N6EA 3ZWSA 5C7HA 2G8ZA 3POHA 3UU0A 2WM1A 5FF7A 1QI5A 1P1XA 1F3WA 3KOWA 2WAGA 3AFBA 1TV8A 2QCFA 3GS6A 4FNRA 3KOYA 3KRBA 4AZ6A 4PTMA 5CPSA 3UJFA 3A9IA 2GDQA 1HP5A 1D8WA 3V7PA 2W5FA 1LWHA 1YXDA 4FXJA 2FJUB 3R10A 4KIRA 3VKKA 2P8BA 5FJTA 4PFMA 1O4UA 4B5WA 1CXKA 1CXLA 4R3UA 3UVAA 3GVRA 5AECA 4S3EA 3TEVA 3W7KA 4HNOA 3O9NA 1OG0A 3EX4A 5HJXA 3A21A 1EO5A 1WZKA 4C6NA 4WSHA 5MKGB 4HSNA 3IGHX 3MP4A 1TPC1 3AIRA 4KMQA 5TAOA 3GC5A 5EYWA 3V4BA 1CIUA 5AN7A 2PWHA 3LHTA 4E8DA 5KTLA 2AKZA 1V0NA 1OFOA 2ODOA 3W1AA 2QQ6A 4H04A 2QUNA 1W3NA 1ZP4A 4IMDA 1H09A 3FYPA 2GOUA 1L0PA 2QYGA 5RUBA 1ICSA 1Q85A 4KW2A 1C9DA 3SCQA 4BCEA 1XLLA 3DBNA 4P7QA 2W79A 1QO2A 4PBGA 1AG1O 3F2BA 1PB0A 3N2OA 4KRUA 4MB5A 4B92A 4U5KA 4MDOA 4NIRA 1GKQA 2I9UA 3MBDA 4MM1A 4H01A 2Q01A 1OINA 4W87A 3T9PA 2HBVA 4AAJA 3QBUA 3B3DA 1NDYA 1CNVA 2V63A 3CUFA 4GXWA 3NSNA 1XXXA 2VFDA 1BEUA 3W75A 3G1YA 3B9DA 1TPEA 1UD8A 3GU2A 4LF1A 5K4ZA 4IIFA 4UQDA 4F0RA 3CHCA 3UQNA 1W6TA 1E4MM 1W3KA 3MMTA 2NWRA 1JNDA 4XBJA 4LTSA 2V5CA 3QV7A 3S2LA 2FPVA 2OB3A 2CKSA 1JL8A 3ABRA 4HK7A 1FX6A 1FWTA 3FLUA 1U5HA 3WLRA 4LRSA 2QCMA 3F4WA 4C6BA 3AJXA 4XTDA 1X38A 2F8QA 5BZAA 3VC6A 3AIEA 4GOAA 3BLFA 2FZMA 2OKOA 2R82A 3QTPA 3O6CA 3QY8A 4G1KA 4UC5A 2VOTA 3E0IA 2JEQA 1EUAA 4AZBA 1OHLA 4LY4A 3XIMA 2FZ9A 1XP3A 2DZPA 3DDMA 3W87A 3GFZA 1NDVA 1R30A 4FX7A 3LHUA 1E71M 2G0WA 2W3ZA 3NO1A 4TR9A 1IIHA 3WNNA 4AZCB 2YB4A 2DSKA 2Y0FA 5FOOA 2VUYA 4HMNA 3AUJA 2PRMA 4P8VA 3AMGA 3OHMB 3PZOA 3LSBA 4QEHA 3F5JA 4AZGA 3WK3A 3AALA 4DXVA 2ALRA 1KV5A 1HFBA 3SUTA 1WNOA 3WDRA 4HA0A 5HK4A 3NSMA 2WW5A 1ZS2A 1RY0A 4AX7A 4J40A 2FZNA 1BKSA 4E3VA 1VFUA 1QDSA 2RGMA 1WP6A 2XFWA 1X1OA 5DY3A 3TQVA 1TWZA 3G22A 3LI1A 2WZTA 3IAQA 1DJGA 3S1GA 1F4AA 3GTFA 3HO8A 3IJQA 1UJPA 4ZB5A 1OT2A 3MUZ1 4HN8A 3ARPA 4PMQA 1UHVA 4C6KA 3FEQA 1W32A 1OWQA 4XZHA 1VLIA 1FHVA 2DFAA 4LF2A 3R25A 4Z2KA 3ANYA 4AZ7A 1Q2RA 1XD1A 3W4RA 5HNNA 1EFZA 1FOBA 3AIUA 1OD0A 3RCNA 4N9DA 1VFHA 3UWEA 5A6BA 3E96A 4HNCA 2YDRA 3MYOA 3AS0A 1ZJIA 4EXAA 3U2CA 4KETA 1RXOB 4TV6A 4E2VA 1VFTA 3N4AA 3QZAA 2DDXA 1Y5XA 4KPLA 3EYPA 3GZAA 3TW7A 3RR4A 1Q8JA 1XDLA 4P7NA 3WEOA 2QXWA 2PD5A 3A4WA 4FS9A 4DHGA 3GUWA 2ZZ6A 1QW9A 1QNSA 4CNTA 4WUIA 1JZ6A 3B4UA 4X2PA 1I1XA 3UCDA 2V9DA 1UD6A 1JDDA 4G6CA 1IE7C 1N7KA 3SAZA 2C16A 2J7HA 4JTEA 1M3UA 2AAMA 2ZE3A 2EKGA 1H50A 4NSBA 4XK2A 1T7LA 4W85A 3GG7A 1JF5A 1HO1A 4GIRA 1L6YA 1XLCA 4L4LA 1LLZA 3NPUA 4FF7A 2YCIX 2VNCA 3IAPA 3EPOA 5DXYA 1F76A 2GVYA 3H2MA 3SDOA 3GG0A 4C7GA 4QDWA 4J3TA 1EYWA 2GZXA 2DT3A 4K68A 3DZ1A 2P88A 1EB3A 1R3YA 1S2UA 1WDSA 4WSJA 2DIJA 4MGGA 1E4LA 4C6EA 2EQDA 5A2AA 1SFJA 1KWGA 5HR7A 1EF2A 1TO3A 3DX5A 4ZEPA 1A5UA 1MUCA 5A5WA 4WJXA 3MZ2A 1J6OA 2DSUA 3S46A 2QF8A 3ZIZA 2R1MA 3P80A 3W9ZA 3W83A 3EEGA 4FP1A 2ZICA 7TAAA 4C91A 2Y24A 3BG5A 1HKJA 3K1DA 5D8ZA 1TPUA 2WO5A 3VGFA 4D1JA 4J28A 6XIMA 2CXEA 1V3LA 4QGCA 5CKSA 4I5RA 5GJNA 2X2GA 1MFVA 3ITTA 4H9XA 3PAOA 1AJ2A 2OKTA 4NZ5A 1N8FA 3ZSSA 5F7UA 2HXTA 1DL3A 3MANA 4V1YA 5KEZA 3VINA 2J78A 3CUIA 4RXFA 3HJZA 5HMDA 1FKWA 4ZQOA 3RG6A 3N19B 1S2WA 1CGXA 2ZDRA 2OGYA 5FJRA 1VHNA 4BJHA 3CEUA 2H6RA 3M0LA 1HTIA 2E40A 2GDVA 5EU9A 3SURA 2Z1SA 1A5CA 1ZQ5A 1FWHC 5C7VA 3MWCA 5HINA 3CUZA 2ZXAA 3RLUA 5EMMA 5F4SA 4JKKA 3LNMA 1K8XA 3W1UA 3IUDA 1XD0A 2FFCA 5L6UA 1HX0A 5C71A 1BVZA 1XC4A 3FVDA 4PE8A 2IPJA 3PS7A 2NV2A 3HIJA 3WH7A 5A1AA 2E6FA 1XX1A 3HG4A 4MZYA 1QAPA 4GQQA 4HZ8A 2OYMA 2OOFA 3H24A 1BYDA 1QXLA 3UF9A 4A35A 5EA9A 3KBJA 1B3ZA 4W4QA 2P8CA 3FGCB 1C9WA 4DELA 3IIXA 5LZLA 4ZE5A 4C6PA 1X8CA 3KL3A 2Q6ZA 4V33A 2C71A 2OMAA 4OU1A 2E5CA 1A47A 4UR7A 2P3ZA 2QULA 3W23A 1TPDA 4DUVA 5K9XA 1D7KA 3AXHA 3CL6A 3SJ3A 5CEWA 1SUXA 1UUMA 4IT1A 2XIMA 4EIVA 2EAWA 2OO0A 4AZHA 4E3TA 2OZ0A 2BXZA 4QNWA 3B8DA 1S5NA 3HZ3A 1MMFA 1ZBWA 2QS8A 1NELA 3GXMA 2PBGA 1MO0A 2ZUNA 3OZOA 4GHRA 1CZ1A 2YFNA 2YLAA 4MF4A 3N29A 4Q7IA 2JEPA 1VBUA 4GO8A 4WKAA 3UEQA 2E09A 1E9YB 3ARSA 2DJXA 4M56A 2PGFA 1RD5A 3UYIA 4R7JA 3P0WA 1K3UA 5TF0A 3E0LA 4PSPA 5D4YA 3UZJA 3GNNA 5ABFA 4XD5A 3S1XA 4JGDA 2Y7DA 4M6VA 1PPIA 4EAMA 3M6YA 4AZ5A 3MUXA 4CKQA 1IF2A 3URAA 3AHVA 3M9YA 4JHMA 3RUBL 1B5TA 4GIAA 2GJXB 5HMFA 4ZXLA 4X60A 4CQDA 1XSJA 3HGSA 3VPLA 2W92A 2ZA3A 1K7XA 2CIPA 3TCSA 3DFNA 5A94A 3G2GA 1PTGA 5J04A 4DM1A 4O11A 5LSMA 1LCOA 2X16A 3RPTA 3SBFA 1E5NA 4P8XA 5C9ZA 3S6OA 4AFYA 5HQEA 1M7JA 4U10A 1UKPA 4AXKA 1SW0A 4DNHA 1R85A 4TU1A 1P7TA 2A85A 4RCXA 1W3JA 4PTXA 1M1BA 4S39A 2VGIA 3F03K 2GGGA 3QV8A 4MWAB 3L21A 5HQMA 2GGEA 3PBWA 1YBQA 3ISIX 4O50A 4H7ZA 3QQWA 2HCVA 1SO4A 1UP3A 4TMCA 1XLDA 2X1RA 2FKPA 1LUCA 1P0NA 3L4XA 4JX5A 1SZGA 5BCAA 4D2JA 1UR9A 1WPCA 1X6LA 3QHMA 4IL2A 1I6NA 4EF9A 2OR2A 3BW2A 3QZEA 1U22A 1XCFA 2OLHA 2EHHA 3FA5A 4Y8FA 4ZGYA 1J0IA 1UZ1A 4IJRA 3UBPC 4ML4A 2PDHA 3NQEA 3KZPA 4CU8A 3DENA 3ITVA 2PRHA 1WAUA 4PUNA 5A6JA 3O7UA 5H91A 4R27A 4ZXOA 4W5UA 3DFOA 3W53A 1AMYA 1QCWA 3REQA 3GG8A 4J35A 3TFCA 3AHXA 2I1OA 1SSGA 1G7VA 2NV1A 3W76A 2YYTA 2J9YA 2VMFA 4NJJA 1Q4NX 4JIEA 1EQCA 2YCJA 4LUJA 1XIIA 4ZQRA 2NUYA 1DWIM 3NSXA 1V3MA 3VM5A 2DW7A 3PFMA 3AS2A 1TR9A 5DQPA 3W88A 4UXDA 1A5AA 2YB1A 3QPYA 2CEQA 5FEZA 3FY1A 4YMZA 2V69A 4PMZA 1YNQA 2EEXA 3ITYA 4NZJA 1CB7B 4Q4SA 4AIUA 3OA3A 3RF9A 2J24A 1Q6QA 3FEMA 4H6QA 1AQFA 3W24A 5C6MA 1XLMA 8A3HA 4NJHA 1NOFA 1RSCA 2J79A 3QMSA 4XSLA 1O6IA 2NT1A 2XN2A 1R0MA 2YCKX 2Y61A 3AC0A 3VGDA 1VCGA 4UTTA 3DESA 4AIBA 1F3EA 3TJIA 1H1NA 3OBKA 2Q8LA 1Q6CA 1E6XM 5I3DA 3LPOA 5CQ1A 5HANA 3PSWA 1CENA 5XINA 2NWSA 4FI4A 4O17A 4DM2A 4XZMX 3UETA 4FF5A 1XHGA 3G6MA 2Y70A 5B7ZA 1RK5A 1KNWA 4LBUA 4RPPA 3QXBA 4O14A 1MQRA 2RUSA 4BHYA 2OODA 3VIHA 3BWWA 4C1KA 1G0CA 3ABZA 4BQ5A 4DWSA 1XG3A 4HCLA 2UBPC 2CZDA 4DUWA 4XAGA 4M7SA 1UUQA 2EJAA 5T8GA 2EPKX 2D22A 4JTHA 4MPKA 4J4KA 2PDNA 4HPHA 2OGJA 3LRMA 2NVCA 1T8QA 3NVDA 3TCEA 4JS3A 2Y5JA 1YPFA 3G5EA 4AEEA 2F84A 3QPEA 7A3HA 7TIMA 4D6GA 1DJXA 1GOKA 3MCOA 4F9JA 3N9SA 1I8JA 5CC7A 2FZBA 4M6PA 3W1XA 1TQXA 1MSSA 3SCRA 1AQHA 2NLYA 2VR5A 2JF6A 4I3GA 1S3HA 2HVOA 4O1AA 4WGXA 5GNZA 1ZY9A 1JYVA 1H7RA 1UWUA 3N2MA 2PTXA 1BPLB 3QOKA 1OG6A 3MI2A 1JYNA 4Z1AA 3MJYA 1W9DM 1LDCA 2PDYA 3M0HA 4QISA 3DYMA 4PCPA 3MHGA 1L8PA 5GJPA 5DANA 4YVVA 2WYSA 3ARTA 4DN1A 1X1ZA 4NJGA 4IQLA 1FXPA 3R8RA 4AD5A 1XIJA 3PUEA 3A22A 3GVQA 3D3FA 1EJVC 1W8GA 1VQTA 1KLYA 3EDEA 4C6JA 1J4EA 1T5AA 4GUGA 3EWZA 4GIEA 2OYKA 2V6AA 3H7VA 4LRTA 2F6XA 2X40A 2VWTA 2PLMA 4ROQA 1P5BA 1N82A 4N42A 1UYQA 3PZMA 3VOFA 4OT7A 3SSZA 4MNMA 3M7WA 4FOJA 4GWEA 1YTDA 1JXJA 2PDLA 4RUBA 1BG9A 1FA2A 1Q65A 3OZMA 1UPPA 3EB2A 4L5ZA 1HJQA 2UY3A 5G4WA 4NQ1A 1AL8A 5EB8A 1F5ZA 4X61A 6PTDA 4PULA 4UFMA 5CXPA 4JNMA 4ZO9A 1CCWB 3I3DA 5DFAA 3EOLA 2AL2A 3IRSA 1GQIA 3A3WA 1DBTA 1PTAA 4ZQCA 2QV5A 2XUCA 1LP6A 1XDMA 5MF5A 4NJKA 4DJFA 1V6WA 2Y4SA 3MSDA 2WLZA 4MWAE 1RD6A 2GJNA 4PBEA 1DHPA 4NZFA 3NDOA 3NJ3A 1GORA 5DBTA 3TMQA 1Z48A 2VEMA 2WNQA 1KBLA 4Q6JA 3WLTA 3PHAA 1XIDA 4AD4A 1JJKA 9XIAA 4FNSA 2J7DA 2VD9A 1NDWA 2R1LA 2QPSA 3OVQA 3W7RA 1JUEA 3W6YA 2WPGA 3ITOA 3KL5A 2HVMA 2OU4A 3ZLHA 3CZ8A 5AZ0A 3TWAA 3QTGA 3FKRA 2WHKA 4QSFA 4XVDA 3WL0A 3B8UA 4UCFA 2X0HA 2ASHA 1WDDA 2ZX9A 1KFBA 5JMUA 3P14A 1EA9C 3RPDA 1W3LA 4ASTA 4GH1A 3LGGA 1FWRA 3AS1A 3T78A 3M0KA 2VC7A 3EX6A 2I17A 1EJSC 1OD8A 2QCHA 4YTRA 3QV6A 4J5NA 3SY5A 3PNZA 7CGTA 2ZUSA 4W8BA 3OEXA 2HS8A 2WKGA 2ZKMX 1BHGA 2W61A 3CB8A 3VIMA 2DY3A 3L65A 4GLEA 1XG4A 4MNJA 1DKWA 3KCLA 4X0NA 3MP5A 2G3MA 1TMLA 5I3FA 2I5IA 1FHLA 3PPCA 1NY1A 5C2CA 4RNJA 3ZM8A 3GKAA 1RPXA 4L56A 4GCXA 3JU2A 4Z2LA 2REQB 1GKRA 4YIWA 3R89A 2V5DA 3TN5A 2E68A 2YCLA 4JN7A 4O12A 3NPVA 1AJZA 4KGJA 4UOQA 1UWRA 3LCFA 4IPNB 1M68A 1FCUA 1Q6DA 3JW7A 3PBVA 1A5BA 3RRAA 1ZL1A 3BOXA 1JZ7A 3BQ5A 3P5ZA 1TTQA 1GTEA 1TX2A 5DELA 1XYBA 2AL1A 3HG3A 1ZP3A 3BSMA 1IZJA 1DIKA 2WANA 1KR1A 1EPVA 4Z2JA 3NQMA 1WDWA 5BXSA 3N12A 5I06A 4ZE4A 4GMEA 4M19A 4FXSA 3KBSA 3DEQA 3KCOA 2J74A 1I2OA 4HTBA 3C52A 3GIQA 3KP1A 3EMCA 2A1YA 2TRSA 1IT7A 4JTTA 3WQCA 3VD3A 2QAFA 3CH0A 3K30A 1TX0A 2GFTA 1E6NA 2IUZA 4DAIA 1H3GA 1HJXA 3UGRA 4AMCA 3TLQA 3NCOA 1BVNP 3PZ9A 1TZ9A 3D6NA 3LTPA 2XVNA 3GFXA 2MUCA 4JAWA 4Q4MA 3O1NA 1O1ZA 1EZWA 3P0XA 4MKSA 2YR1A 1ENUA 1EBHA 2FPYA 4WY0B 1KCKA 3QW3A 1PCKA 1JPIA 9XIMA 3W1PA 4TQTA 3AIWA 4FXFA 3W74A 4A29A 2BVWA 3MMWA 2Z1VA 3HFYA 5LA1A 2J7BA 1XH0A 2NQLA 4UCGA 5JIPA 3QHOA 3IPWA 3W6MA 4J3XA 1FUYA 1QHZA 4CEXC 1QNVA 3XINA 2TMDA 4AWEA 4AY7A 1XM3A 4AZCA 1K6AA 2WSQA 1B57A 2QCEA 2NQJA 3MUAA 2G3FA 1CGTA 1FWJC 1W1A1 2E67A 2DZWA 3M1ZA 4DAFA 3R6IA 3RM4A 4GVFA 2VFEA 8TIMA 3PTKA 2A7RA 4DQWA 1ZJHA 4YVPA 2ESCA 3W26A 2VZVA 4MYXA 4HNTA 5A8GA 2FGLA 4JICA 3C8NA 3VE9A 4ORMA 4R85A 4CU7A 3FXGA 3O15A 5CPOA 3P2VA 3URNA 3VGGA 2PF0A 1TA3B 3CUXA 1V7YA 5CZKA 1DWFM 1JRCA 3AAMA 2D2GA 4A3QA 5D9NA 1NWUA 3OHIA 4RW5A 2A3BA 3WLLA 1JQVA 1P43A 3QY7A 1YADA 3IUHA 3MSRA 3OGRA 2JGYA 4FOUA 1RJPA 5E0KA 3LTSA 1H7XA 1O1HA 2VRKA 3PUGA 5TBOA 1J12A 1A5LC 3W86A 1HL2A 5AC5A 5C9XA 1R3TA 3G8EA 4G9PA 1XIFA 2BTMA 3S2MA 3CQKA 5I3GA 4LVBA 4QEEA 4JEQA 1TFVA 3NQAA 5I00A 2WMKA 3PJXA 3UJRA 2J25A 4NZ3A 3KTSA 4ACZA 2XHYA 4XAYA 3E5PA 1A3WA 3GR8A 1A0CA 1E9IA 3W2NA 3S6DA 4HK5A 1OGSA 2ZZ4A 5E5CA 5HBFA 3E2SA 1QATA 1QI2A 3OBAA 1R47A 4QG6A 4JD4A 3WD3A 3OYXA 1DOSA 4DF1A 3CMGA 3GE7A 3RK8A 1QPNA 5I7GA 4A21A 2IQ0A 1M7PA 3LPPA 1W0MA 5FEWA 4IJBA 1VF8A 4HMCA 2XFYA 3RXZA 1Q7QA 1KW1A 3SY1A 1H7NA 3I3BA 4Q7NA 5LIKX 5I77A 5BRPA 2C6QA 5EMLA 3LLFA 1E1CA 1KC7A 4B91A 1R3VA 5FF0A 4GUIA 2IKHA 1M7XA 4BF9A 3VX0A 4LX4A 1G7UA 1GHSA 2B7OA 1Q4WA 2XH0A 3B0YA 3G0XA 1D9EA 4LUYA 4LB3A 4MDPA 4S3CA 4H1ZA 4H7VA 4IQDA 4PCNA 4N9BA 3MZNA 4UQ9A 1PHWA 3G6LA 3IJLA 4UZUA 4F2UA 3ZLGA 1V93A 3FDGA 1UA3A 1NDZA 1N8IA 1IXNA 1WYIA 2C18A 5G2IA 1BFNA 4FB7A 3RU8X 3UP8A 5ENLA 2ZWYA 3OVPA 3PB0A 4F40A 1WA3A 2EXOA 3B0VC 3HU7A 1IT8A 3LCWA 1L6WA 1MRAA 1ONEA 3STGA 4AH7A 1Q7MA 4TV5A 8XIAA 1KTCA 3T2QA 3LLDA 3L68A 4M51A 2JF7A 3CHFA 3WL1A 3Q65A 1GHRA 2AQVA 1O12A 1HKMA 4XWUA 2PDQA 4PCFA 3V0TA 1TJPA 4LVAA 3PPHA 3LG3A 5C2GA 1LG2A 4H2HA 3HQPA 4J27A 3IK2A 2VX6A 1IEWA 1FWCC 1L6GA 3W7OA 4E4FA 4D6IA 4O15A 3FOKA 3PJUA 4OOUA 1LG1A 5HR6A 1H0IA 4ADTA 3O07A 1E73M 1C90A 4DUOA 3VNKA 4UTTC 4U3CA 5A6BD 5LIYX 1JCXA 1HXJA 1RUSA 3NQ7A 3H22A 2GUYA 2DVTA 2J9XA 4QAWA 7REQB 3RFAA 4JTQA 3WBXA 5CJMA 1GGOA 4X9YA 5IXEA 4MHBA 3CTLA 3PZUA 4IM4A 5HJLA 4CVUA 5F2LA 3HMJG 3WG6A 4GKTA 2W66A 3CZKA 4X22A 4Q4KA 5I3KA 3ENLA 3AYSA 3W22A 2ZOXA 3AIQA 3BGGA 2CW6A 4AYSA 3BLOA 4L9ZA 3NOEA 3SCUA 3W7LA 2E5BA 3GU1A 2WKJA 2B7PA 3SADA 1KM0A 4FR1A 2BG5A 1SU5A 1Q8AA 1OCNA 3T0TA 2WOQA 1H11A 3EMQA 4BEUA 2XM2A 4HZMA 3TSDA 3E0FA 4YNGA 3U2ZA 1EDQA 3PTQA 2VGFA 4JX6A 3WQ8A 1EJRC 2ZUVA 4E8CA 2NX1A 3ARVA 3AMKA 4HA3A 2A3EA 3UR5A 1TUXA 4LU0A 1X7IA 4FLQA 3N2BA 4J3UA 2GWGA 2NQHA 5JBDA 4PZVA 1ICQA 3LY0A 4AIOA 1GNXA 1GOQA 3AXMA 2HV5A 4RZ6A 3B97A 5CSSA 2YPIA 5I09A 1J0YA 4B2DA 1GW9A 4O8AA 3ZT5A 2XVPA 4LH8A 4C6IA 5I6SA 3BLIA 3N73A 1REQB 4WF7A 1QWGA 1GPFA 5EMJA 4PUJA 4PH6A 1MXSA 5HJYA 1G01A 2GYIA 2RGLA 4MIMA 3S2NA 1W2VA 2OVLA 3N11A 1QNRA 2V0TA 3UA3A 1MDRA 2J4GA 3TW9A 2VEFA 3T0CA 4MY9A 1QT1A 3Q4DA 5U4NA 4R9XA 1WXZA 3GYCA 1PS9A 4KFNA 3WUEA 3N17A 5A8MA 3THUA 4XG1A 5KZ6A 3MI3A 4PEEA 1XLAA 3LM7A 2QUVA 2F2KA 5JQ9A 3M44A 4K8GA 2A3AA 3R0DA 3V5FA 1PEZA 3D47A 1F6KA 3L0KA 4KIEA 3VXGA 1E15A 2QGYA 1PZ0A 3KZSA 5I23A 3EWDA 2XIQA 5AYYA 2V3FA 3BV7A 1XRVA 2YZ5A 4O16A 3YPIA 3EA1A 3TMLA 5AFDA 3GNOA 3CYJA 4JTDA 3GK0A 1YHTA 2CESA 4PL2A 1LRQA 4DB7A 1I2NA 4S3AA 2J75A 2Z25A 1W5NA 1VRXA 3MU7A 3COTA 3S5YA 2QAPA 3H23A 3P74A 3WD1A 4LPCA 1BXBA 1V6VA 3TAKA 3L5MA 1P6CA 3TOYA 1GWJA 3H7UA 2ZDSA 3U9IA 1QO5A 4GYKA 1E0TA 2JALA 2HPIA 3OQEA 5I3JA 1MDLA 3WLPA 4AF0B 5FJOA 2PDKA 4DF2A 1HGYA 1R9XA 4DJFC 5B7YA 3BAWA 4UMAA 5CBIA 1JPMA 3B03A 3KOXA 2PP1A 3STPA 2V68A 2PDJA 4JR5A 3GY1A 3QC3A 3S1WA 5LXXA 4NX0A 1BLIA 3LCIA 4ONVA 1FWEC 2A2IA 3G3MA 2E6DA 1B4KA 4HJWA 5C9UA 3PR2A 5FL0A 1E5JA 4DZIA 1YRRA 1BQGA 1PE1A 2X41A 1KRMA 2J13A 3TE9A 3LENA 5E09A 1MW0A 4H8NA 3SI9A 4NU7A 4GX9A 3G1AA 4HTYA 3EDKA 4OV4A 1YX1A 5IRPA 2HRWA 2AQWA 3F2CA 1WDQA 3E74A 1AZ1A 4Z1BA 2WSPA 1S2CA 1E9LA 1XDJA 4LYQA 3WK0A 1R3SA 3GTNA 2CBJA 3OZYA 4GI9A 1A5OC 2BBFA 4YTSA 2XH4A 5GQBA 1NF7A 3AI0A 4HMDA 4PGLA 4QAIA 2Z6JA 4KWVA 4YXGA 1R9ZA 1KXHA 4ERIA 3ZT7A 3F4NA 2BMBA 4J3ZA 4KWOA 4MJMA 3SRHA 2HNHA 3OGSA 5LNUA 5FAJA 5G2HA 4H00A 1DPMA 3QLDA 4H2CA 4QR6A 1RA0A 1V08A 1W3IA 7ENLA 3NAVA 5A6MA 4S3GA 3CC1A 1FH9A 3EDJA 1F3XA 3GHSA 3W00A 4PRWA 3CZGA 3SGUA 2YA2A 4D8LA 3B8TA 5D32A 4L80A 4I7UA 3QM3A 2RDWA 3MJMA 1OYAA 4E4PA 2H3BA 4KBXA 3NEVA 4UTWA 1CXFA 3V1PA 4P8WA 3T2OA 4ICNA 1JUKA 4EACA 1YKWA 4KRZA 3UWZA 5J5DA 4F48A 3G77A 3I4EA 2I56A 4MY1A 2ZRUA 3NXFA 2OZ8A 3C86A 1SFSA 3IJ6A 3SQLA 1DE5A 1I45A 3TYUA 1QI3A 1W5OA 4RK8A 4K7YA 2XPKA 4GX8A 4GO9A 4JTUA 5D05A 3SCPA 3ARYA 5J8LA 1TJ1A 1XF0A 5EBUA 3G1HA 3WJSA 3SUWA 1U33A 4GVHA 5F2IA 1JZ3A 1BWKA 3K4AA 4ADUA 1LYXA 3MA8A 3WDPP 4ZODA 2XU2A 3B05A 2FMOA 1XBZA 1A3XA 4GJ1A 1JZ4A 2OELA 2FHBA 3D46A 4XBKA 2D73A 3BW3A 5TD4A 2AMXA 3AU2A 2XVLA 1DORA 4AEOA 5DEZA 3RIKA 4HSHA 1JDFA 5BRQA 2V30A 3HA1A 5DN1A 3CBWA 5AYXA 3HFTA 5H1WA 3CV2A 1CLKA 1FY6A 2C13A 4LAMA 1US3A 3LXAA 3I65A 4Q8WA 2BY1A 1KBJA 1BF6A 1THFD 1V3HA 2R6OA 3S0CA 5D2XA 3JUGA 1YDVA 5BWFA 1IT0A 3PN8A 4CNOA 2XWEA 3PNUA 4US5D 1XR2A 2ZTKA 2A79A 4IH3A 4Q8QA 4WKHA 1JCYA 3EWXA 7XIMA 4NJIA 2VKZG 3MUY1 3C3UA 1TV7A 2GQ9A 1R2SA 2V81A 1RLCL 1CW2A 3A4JA 3QW4B 4WOZA 4XB3A 3IGXA 5HDRA 1R46A 4K37A 1MFUA 5HWMA 2Y89A 4GFIA 3TN3A 4DBSA 1YIXA 1P4CA 2HK0A 3P3BA 1YW1A 1V6YA 2OG9A 1HJWA 2V82A 1ITQA 2POZA 1NEYA 4ALDA 4B5NA 2X1TA 2PTWA 1SYTA 3CZLA 1W9VA 4JFSA 1DTNA 1KFWA 2P5NA 1OFDA 4Y9PA 1G4EA 2ZC8A 4LCRA 3WK2A 1XQKA 2CPUA 2FH8A 3ONBA 1Z69A 2J77A 1XBVA 3TROA 1S5MA 1UH4A 2Q3OA 1XIMA 1AH4A 1OC6A 3GTIA 1NWTA 4LYRA 2CERA 4XV0A 4MKNA 3C56A 1HKVA 4HMEA 3KDNA 1AVAA 2PC4A 4O18A 2GQ3A 4O0KA 2ONEA 1NIUA 3BG9A 5AKQA 1FHUA 2ZA1A 5A2CA 3M46A 4IQEA 1Q7ZA 1ITUA 4PMXA 1GZJA 1RA5A 1M6JA 2P50A 5T91A 3C2VA 4XKYB 2YOCA 3QYQA 3MPGA 2RAGA 3AHTA 4Q4RA 4C1NB 3STEA 3OB8A 1S3TC 4V27A 1ODZA 1OCQA 3ORWA 4H9TA 3HPSA 4JTKA 5AHIA 1POJA 2OT0A 5DLCA 4IICA 3ITXA 5I3HA 1VHCA 1W2PA 1XYZA 1PZ3A 3GD6A 4B9YA 5FF3A 4HOXA 5AYIA 5BOOA 2ZUWA 1TPH1 2V5LA 2P10A 4QE4A 4LALA 3SY8A 3L2MA 3KAOA 2PSNA 4CUCA 1UBSA 4MTVA 2RJHA 1E56A 3N1AA 2R1PA 4AD2A 2F2HA 1TJ0A 1W5QA 2QT3A 5TQLA 4NZCA 4JIPA 2MANA 1XYMA 4DPPA 3TSBA 3O06A 5M17A 1JCMP 3DXIA 2ATMA 5JIWA 3IIVA 1CXEA 1J79A 1PX8A 4WIWA 1JZ5A 1Q6RA 2RKXA 5SWUA 4AUBA 2ZRYA 2ZXQA 3AIBA 1H0GA 4LANA 2CFFA 3K8KA 3U8GA 3Q45A 4PMVA 1TIMA 3RLHA 2OQLA 2PBOA 3AMLA 1XSIA 1TTPA 2IQTA 4QITA 1QW8A 3W27A 3NEHA 4KCWA 1H41A 3CAWA 3IGUA 5D02A 3NM3A 2I9EA 2PODA 5DT7A 1OY0A 2XJ7A 2EG6A 3BVJA 1M65A 1RQHA 1Q6EA 3BJSA 3C2OA 2B7NA 4GXPA 3NQCA 1E55A 4NI3A 1R2TA 4B4HA 3IJ9A 4MADA 1VBHA 1TJRA 5GVJA 1GYNA 2J62A 3CV7A 4YHEA 4UMCA 2VDGA 3GXPA 3QFWA 1XKJA 4R7WA 4QE1A 3G3DA 1UC4A 2W62A 1FDJA 2BXVA 3IRDA 1FBAA 4UTIA 2V38A 4QHRA 1EWEA 2Z00A 3G1FA 3QKZA 2QIWA 2REQA 1I2PA 3I7QA 3M47A 3P93A 3WEZA 4IIEA 1PDYA 4GA8A 3RM9A 5D2YA 4HYRA 4JN6A 4HCHA 5D2TA 3GIPA 4OBTA 2XINA 1C8XA 1JXKA 3PZGA 3ABQA 1FP8A 1TG7A 3N4EA 2WXDM 4LBRA 1WOBA 3PJTA 5DCDA 5I3IA 2VURA 1OCBA 3SIMA 1FH8A 2FB3A 1IEQA 1ZENA 1Q2SA 2P1FA 3VI2A 3HBLA 5CCZA 3VUPA 3DHUA 1OK4A 1TPB1 1WCGA 4MMWA 3VD4A 2BP1A 4AVNA 3UG5A 3RYSA 4LEFA 5AHNA 5ABFB 1OYCA 5EL1A 4PA8A 1HVQA 4JQAA 4M80A 5GPRA 1FFRA 5KINA 1GZGA 2DZSA 1KRCC 1XRTA 1T6MA 1BXNA 1QW7A 3G0UA 4Y96A 1UMLA 4A22A 4XAPA 5CGMA 3RHGA 1EJUC 1U2YA 2ZQ0A 1P6BA 3AXIA 1HKKA 1KQZA 3DECA 2DJLA 1QVBA 2ZRZA 4ZTYA 1WXYA 4QLJA 2VQUA 2TAAA 3NGFA 4NILA 5JBEA 4WY0A 4I9TA 2GVGA 4JEJA 4DI8A 3W1LA 4HOZA 4OUEA 3NNTA 5ECVA 3FJLA 1UW9A 1UIOA 3OIHA 7ODCA 2VD8A 1R3RA 2A4AA 3CPGA 5C8BB 4UMBA 3SO7A 1QNPA 1JD7A 4HU3A 1MNZA 2C15A 3NGJA 1LUCB 4FLRA 4MVAA 5LXEA 2OSWA 3EDFA 1XGEA 4J2MA 1AMKA 2J6XA 1W8SA 5AVHA 2WPBA 1FWGC 5DMYA 1K6WA 2XH7A 1AL7A 1OIMA 2YYUA 4GVGA 4JTGA 4GY7A 1UJQA 1UBPC 3THDA 4YYCA 4HHLA 3ES8A 4QSHA 5CGQA 1BF2A 3NZGA 1H5VA 3WF2A 2WNZA 4CN4A 3GH7A 3J7HA 2PLCA 2QGHA 1PV8A 2CLLA 3LCHA 1C8YA 3REQB 2ACUA 4C7DA 1TA3A 4GH3A 3HGOA 2GSHA 1SMAA 5C0QA 3B8SA 4K6AA 2IPGA 2IXVA 3S4TA 1PCWA 2QVHA 2VENA 4PCSA 3I6RA 1P48A 3KBNA 3MDUA 1XLIA 1AZ2A 1GQKA 3WN6A 3W1NA 3EWWA 1K7FA 1QPKA 2E25A 1Q13A 2ACQA 3WIJA 4MAVA 3DUGA 1HJUA 3B40A 4DWDA 1AW5A 2CLFA 1V3JA 1VD6A 4Q4QA 1GQJA 3OLIA 4ATDA 2F7FA 3TJXA 3BO9A 4V15A 2BFGA 5T9BG 1LL6A 3AOFA 4A4AA 3B8WA 3GO2A 4MWAC 3BOLA 1GUVA 5BYWA 3MV01 3ABOA 1GT8A 4N9EA 3L9CA 3WF3A 2DZTA 1Y8BA 1O5QA 3T0DA 4GY0A 2OQYA 3UXAA 4FK9A 2YLLA 4MZ8A 2CBVA 9CGTA 4UOZA 1RP8A 3VKCA 3GM8A 3O2LA 4RDWA 5EGRA 4C7FA 3RNDA 3G1DA 3XISA 3EWCA 1OC5A 1OB0A 3UFYA 3O3RA 2ZE0A 2DEPA 3TC3A 4IG2A 3LEPA 1OYBA 3NDYA 1YTEA 3WELA 3T81A 4FEZA 5AC8A 5AC7A 1W1IE 3NQ6A 3M0YA 4DWSB 2IKGA 1E6SM 1EO7A 2D24A 1CEOA 1K9TA 2G41A 3EBVA 3GDTA 1LLWA 2QUUA 3L4TA 1H1YA 4HHPA 4IMEA 4AX6A 3C3NA 2QR6A 4TX9A 3LA4A 4D6EA 2Y7EA 5E9XA 4G5DA 4CU6A 2VQTA 3OJGA 2OSYA 2BNJA 4CNPA 2WBKA 1E51A 3OU8A 4S38A 4H9UA 4R53A 2NXIA 3CLWA 2PUZA 1MYRA 3N2XA 1JDCA 3S9IA 4UTWC 1W1PA 1LBFA 2DVUA 2OX4A 3LCGA 1DIEA 4P7RA 1XLFA 1A4MA 3N25A 3EXSA 3L4WA 1JUBA 4XUGA 1ECEA 1EH9A 4JQ4A 1TSIA 3B9EA 3VD9A 2PI6A 4QLKA 3DKLA 4BA0A 2BHUA 2XG9A 3LERA 4AWSA 3NWRA 1KWKA 1DXEA 3M64A 1X39A 2YJQA 3GKFA 5D9OA 2VUNA 4DLMA 2ABBA 3W70A 4B15A 4DO5A 3LHZA 2FJKA 5IFPA 3WLOA 3CQIA 3DHDA 1UOZA 3AZTA 2QEZA 2VFGA 2QDGA 4RDZA 5EMKA 1E4NA 1RCXB 4YLWA 2QNEA 3AHZA 1OF6A 3CH9A 3LYEA 5M03A 4DJDA 4JDYA 4Z42C 3K1GA 1XLJA 2TSYA 1VEMA 4WX2A 3AUOA 2V2DA 3WD4A 2VL4A 2WVVB 5CZSA 3OGVA 1I4NA 2P0OA 3T6CA 1KTBA 1Y7VA 5A8PA 3E5BA 4JBRA 2VELA 3CT2A 4HPNA 1UG6A 2Y8KA 1KV8A 3KTCA 4EPKA 1VZWA 3WUGA 2YW4A 5CZ0A 3UXIA 2JBMA 1LBMA 3THAA 3CO8A 4PTVA 4B16A 5D37A 2J8FA 4CD7A 2Y88A 2HSAA 3PZIA 1B90A 1QHOA 2V2CA 3W2JA 5IM51 3TTSA 4S23A 2CXGA 3E0VA 4O54A 4MUPA 1V02E 5CAKA 4KCTA 4IIBA 4J9JA 2HJPA 2CETA 2D1ZA 2R9RA 3EOUA 1QOPA 1UASA 4PMUA 5AHFA 1QI4A 2XGBA 1REQA 3PBGA 4X63A 3BMWA 2WNWA 1KKOA 1NFGA 1PWLA 2XIJA 2V5JA 3PUOA 4LFYA 4GGBA 4IPIA 1R3WA 1SR9A 3TQKA 1IYXA 2FGZA 3EWUA 5LNSA 4RL3A 2WK2A 4M6QA 5JH1A 3RMEA 1YNYA 2E28A 3Q94A 3BTNA 4AEFA 1EC9A 4KRTA 4D6CA 1DXIA 4ZSTA 5BW6A 2GWNA 1MEWA 2NVAA 2OT1A 2ZBTA 1L2UA 1H7OA 6XIAA 4O13A 4ZB2A 1RQEA 2VCCA 3MVIA 1G9HA 4F66A 3QR1A 3E0WA 2V67A 3ZS4A 3CZEA 1MW3A 4CCDA 5D30A 2D69A 2H3DA 2J88A 5LIWX 4DPQA 2PPGA 3UVIA 1XRFA 2HDJA 3EGJA 1FWAC 3GNRA 2IW0A 1LORA 2Z1XA 3GW3A 1OBAA 1S2TA 3OLDA 2ZYFA 3VIJA 3GQYA 1ZAJA 3M0XA 5D2WA 4AIEA 4JQ3A 2OFJA 4XKMA 1VPQA 3VCCA 3MCMA 2DQWA 2YCLB 1VPYA 2WCAA 5A3HA 3QR3A 3ZLFA 4H83A 4AF0A 1VGAA 4H9YA 1YNPA 3M0VA 4UQAA 3UYCA 4TVDA 3PPGA 4G56A 2WMIB 4TIMA 4WJEA 3S1VA 2YIHA 2CZ5A 1DQXA 4GBUA 2OJPA 2XSAA 1RP9A 3GDKA 1VBJA 2QJGA 3UERA 3W7MA 4PMRA 3CLMA 4NG3A 1Q6FA 4M81A 4ZO8A 4R88A 1I75A 3VA8A 2WC3A 2YL5A 3KL0A 5ABEA 2RH9A 4UNIA 3VDGA 1VPXA 3WO8A 5AHEA 1BWLA 1UWSA 2E9MA 1RVGA 3CAVA 1RBAA 3BLEA 4A2SA 2YX0A 2VDHA 2BXYA 4A8IA 3M5ZA 4IGMA 3U0HA 5F2MA 3T44A 4B5VA 3W7NA 1ZJAA 3THCA 3VOHA 3IJ8A 3NYZA 4K39A 3CO4A 3FV9A 1VCFA 1NM9A 1TPVA 2XTKA 3S6TA 1D3GA 2ISFA 2GGHA 3LZ3A 3W02A 4F0LA 3DOPA 3M43A 1DVJA 1QMLA 4N4PA 4U2ZA 1GG0A 4AD1A 2CBIA 3PZQA 4UTLA 1AJ0A 1EGVA 2KX9A 5K9DA 1F6YA 2D20A 5M1TA 5U7SA 3BURA 1IZCA 3K5XA 1HUVA 4XTIA 5AC6A 2WCSA 3BANA 2HVNA 3TWBA 3BCJA 3L7RA 2UY2A 3W25A 1ICPA 2PDBA 3TYAA 4WY0F 3I10A 3UWYA 4IQJA 3H55A 4AD3A 4NNBA 3UCQA 1SO3A 3D5HA 2VFIA 4G1NA 1OJXA 2D0GA 4GQRA 1OF8A 4A3HA 2G3NA 3M16A 4GD0A 1QASA 2QCGA 5K4XA 3P6LA 4O57A 4B5XA 1OX6A 3HN3A 1EDTA 3UG4A 4WDUA 1H60A 4F0MA 4FSAA 1SMDA 4GNJA 4EE9A 2WZEA 3SJNA 5FJUA 4KWWA 3GVGA 1HIZA 1NARA 4D1IA 1JCNA 1F07A 3WUBA 1PX4A 4YU1A 2ZRWA 1NH6A 3E38A 1JRBA 4N02A 4UBPC 2PAJA 3AJ7A 3KRSA 5E9AA 2IKJA 3M5VA 1LWJA 3KEHA 1GVFA 2E9BA 3B9NA 3CXOA 2GJLA 3PANA 2C3ZA 3ZR5A 2BOEX 2CWXA 2DH2A 2QV4A 4S3DA 3P67A 5G1YA 3PWGA 4ZFCA 3G1VA 4KEZA 1A53A 3LNPA 1WDRA 2X7WA 2WSRA 1XWYA 3VGHA 1M41A 1JCTA 3FYYA 3W7IA 3HPAA 1PKYA 4EK7A 5HA7A 4MWAD 3BW4A 3U4AA 4W93A 4DZHA 4M7TA 4P7LA 3V16A 2A6NA 1JAKA 4OKDA 3URBA 1GQLA 4WLCA 4IGHA 1WKFA 1UPMB 4ACZB 1FP9A 4FIRA 1EYEA 3C2FA 1TV2A 4RX0A 2EPNA 3ANVA 5D2VA 3WZ0E 3EWBX 1TWSA 3L4UA 2ZZ1A 1FFQA 1KFLA 1TQJA 1BYCA 5CLTA 4KEVA 1SO5A 4M1BA 1IXOA 1ZJBA 3F5KA 4UFLA 1O5KA 1XIBA 1FCBA 1T41A 4UIOA 2FIQA 3SCNA 3BCFA 5HWNA 3CV6A 1Q5MA 3PG8A 3VDAA 4HPGA 5FA5A 1MXDA 3LHWA 1TRDA 3LLXA 1E1CB 2HZGA 2QMKA 1CXHA 3KRUA 3MVTA 2CHNA 1TVNA 3ZZ1A 3CS2A 1QR7A 1RY8A 3MY9A 2DSWA 1UZHA 4HN4A 3GSMA 1F9CA 4JHZA 2A5HA 3C6CA 3MI6A 1J0KA 4C65A 3U3HA 3CGTA 2XWDA 2GVJA 4RKAA 4GJJA 4LWWA 5LYRA 1KM4A 3WH9A 3SZ8A 2C14A 2FYMA 3CPRA 3FKKA 4F0HA 1ISXA 2NSOA 3NVTA 4AYGA 2Z2AA 3TTOA 3UXDA 1KM3A 1ESWA 4JYEA 3T55A 3UW6A 1X6NA 4GE8A 3V0UA 1BYAA 1JGMA 1E1EA 1WX0A 3R7MA 1I1WA 3UCCA 3RO6A 2VP8A 1ME7A 1ZSXA 4G8TA 3UJSA 2OOGA 4LQ1A 3H4XA 5FJPA 4ORIA 4XZ9A 2BY2A 1QU4A 4Z1DA 4DZ5A 3DHFA 3S9YA 3F1QA 1QTWA 1WUEA 3RU6A 4Y9MA 2QCLA 4XKYA 3BGJA 1MZHA 4C1NA 1OQFA 2I7GA 1EHAA 1NF0A 2PLJA 5BROA 3VNJA 4LB4A 5HUPA 3VU2A 5LHFA 2EF9A 1RCQA 4I8DA 3PVFA 1IXPA 3EXRA 1S1PA 3BK0A 4V28A 2C0HA 4XZIA 1GVYA 4O53A 2Z29A 1GYMA 4OOZA 4NT0A 1EXPA 2A3HA 4IFRA 1KCXA 1XLEA 4M3PA 4DLFA 2NZLA 4AHOA 4LC8A 1J0ZA 3CQHA 3GH5A 5TIMA 1PXGA 1I0DA 1F7BA 1B1YA 1TCMA 1Z7AA 1B2YA 4LUSA 5LNRA 1UP0A 1W1VA 4OBSA 2V3GA 1QJWA 4NYUA 3LPFA 1HG3A 2G3IA 1GJUA 3R8GA 1MW2A 3R79A 1S2AA 1E72M 3VVGA 3IVSA 2OXNA 1X6UA 1XFBA 4N2YA 4JN8A 3G8RA 3TW6A 1LWIA 4MLRA 4OZOA 4IMCA 1BVWA 1E6RA 3WLNA 3DERA 1VFLA 1T99A 3GR4A 1Y65A 4CCEA 5C9RA 3LX9A 2E0PA 2QJHA 3QH2A 3OVRA 1H1ZA 1XI3A 1XLBA 3W73A 1MUMA 5D9MA 2ZUTA 3WH6A 1DHKA 1XIHA 1UKQA 4RDYA 4GK8A 4HZ7A 3LS9A 2FQIA 2J7EA 2PB1A 1FKXA 5XIMA 2Q8XA 3JZEA 1Q6OA 1UWIA 3EX2A 1JPDX 2PF8A 3HOJA 4CD5A 3SGGA 1NTHA 3NYDA 4H41A 3WKZA 4KGLA 1RH9A 1UR3M 2WZHA 1IWPA 1LL7A 1QWKA 2J27A 4JCLA 3I3EA 2XZ9A 1ZALA 3WH5A 3NL6A 1UB3A 1TUFA 4UB9A 5LNWA 3RILA 1UR2A 5IBXA 4PEKA 5TNVA 3SRKA 4L61A 3KBMA 3QVQA 1W56A 3CEPA 3L12A 4IIGA 4MY8A 3WJZA 2R14A 2BVDA 1YDNA 3SFKA 3CHEA 3GDRA 3VAVA 5K3VA 1M9HA 3WQVA 4Y90A 4DJDC 3V5OA 2J66A 3M0IA 3WLJA 4UTHA 3Q58A 4HSOA 3RPMA 1YPIA 1Z41A 1N8WA 4IMGA 3QGVA 2V3EA 1OSEA 4FZIA 4HJFA 5A2BA 1SW3A 4AVOA 2DH3A 3MMUA 3B9AA 4RZ5A 1E6QM 4FNPA 1W1YA 4G7EB 3DU0A 3SUSA 1ITCA 5A8NA 4M29A 3PC0A 5C2XA 3POCA 3VUSA 4CQ9A 4AXNA 2F6KA 2ON3A 1SZRA 1CLVA 1J9YA 3KBWA 1SZNA 3GXFA 1A0EA 2OLSA 1G4SA 1UKTA 4UR8A 3VX1A 4WOQA 2ISDA 1HKWA 3V35A 3AYVA 3F4CA 1ODUA 3QGKC 3DC8A 1OEPA 3ECQA 3S2JA 4R33A 3W29A 1BRLA 1P6WA 3BUVA 2DP3A 4Q33A 3O8AA 3ICJA 3MSGA 2I16A 3ARZA 5GJMA 3VNIA 1P1MA 3NZRA 2EPOA 1XBXA 1TR1A 4ROPA 4HU0A 4EOUA 3E12A 3AHYA 3ZMRA 2PS2A 3W6LA 4X9SA 3QFEA 3ZFHA 3EB4A 2X1SA 4U33A 5HAOA 3RJXA 3F5LA 1ZPTA 3WLMA 2R24A 2WMGA 5H8UA 3C0SA 2NQ9A 2GLKA 1SPQA 1OADA 4IMFA 3NOYA 1HKIA 4UFKA 4NZ4A 3VOIA 2IS7A 3N3MA 4GZIA 2QCNA 1XYAA 5IFTA 3BJFA 5LGZA 4B4FA 1PSCA 4C1LA 3P60A 3C4UA 4CNNA 4DY1A 2H9AB 2DZVA 3QR0A 4JCMA 1VBRA 3B04A 1UH2A 2D0FA 1VCVA 1LQAA 2VYOA 4NXSA 1UH3A 1EJ7L 2Y6ZA 3ZQ9A 1NJJA 3Q67A 1Z42A 4Q4OA 1Z6KA 1Q6LA 1W31A 4KQNA 1NQ6A 2PWGA 4URIA 1W37A 1H63A 4GABA 1UQZA 3CYVA 2R91A 4O1CA 1J0JA 3W7PA 3CUJA 4PUEA 1CYGA 3H54A 4BZYA 1KM2A 4LJ3A 3W7GA 3PJWA 3EA3A 2V5KA 1R6WA 4S2BA 3E2QA 3U5YA 4K3ZA 1EF3A 2HISA 2A6LA 3I6EA 2PDWA 1VFSA 1O95A 1H61A 4GI6A 3AICA 4D9PA 4J3WA 1ONRA 4XSMA 5I24A 1C8QA 2OQHA 1U5JA 3JZUA 4UQEA 2FMNA 3VIKA 2CLEA 4W7WA 2FGBA 4CGTA 4UQCA 2G97A 3VKBA 3CIWA 3ERPA 4E2BA 3FYOA 3S42A 3IV8A 1V6XA 2VX5A 1KCZA 2VM8A 3GH4A 3MDWA 4RXGA 4MKVA 5BRBA 1SSDA 3NO3A 2G50A 4IHCA 2BWGA 4O1EA 3QOMA 1PDZA 3BDKA 3IVTA 4BF7A 3USBA 1FQ0A 1RHCA 4Z08A 4W5ZA 2NX3A 4PC8A 1PUDA 1R7OA 3N2TA 1MUWA 2ZUUA 3BAYA 3HJEA 1YMYA 3A13A 4O1FA 2ZVIA 3N9RA 3SIZA 2HBXA 2E7FA 4YCOA 3PWAA 4FOKA 1H5YA 1Q6GA 3GBEA 4BI6A 5CBBA 3N2CA 2A21A 2CLOA 1XGZA 4QG8A 4GNVA 4LS1A 3SQMA 4WK9A 3ARUA 5E93A 1I60A 2A0NA 2PCQA 5CSYA 4CD4A 2VEKA 3A12A 1IWAA 1CB2A 1WZMA 3C61A 1BG4A 4HB7A 4IFKA 4JTLA 1H51A 1T0OA 4M82A 2Z1BA 1HZYA 1A5NC 4IPPA 3CUGA 4MG4A 4PFHA 1Q45A 3PPFA 2PWVA 3WBEA 3FJ6A 4JYDA 4WXZA 3SRFA 1UD4A 2Y63A 4PBFA 4GZJA 2WB5A 3WQ4A 3QQ0A 4DXKA 1F8IA 1SZFA 1LZOA 4CQAA 1VAHA 3L5LA 4XX6A 3E2RA 1K7EA 4JTJA 2BOFX 3BV4A 4E6MA 1GJPA 1ZCOA 4FNUA 1JAEA 2Z2UA 3G1XA 4GQBA 1EOMA 3K4DA 5LHEA 4DO6A 1XCWA 1XSKA 2XFFA 4EPDC 2O0TA 4ZQPA 3QQ1A 1KR0A 4F0KA 4XAZA 4BR1A 1Z9AA 4L4MA 1DP0A 2QJNA 3MS8A 4FPSA 2JGQA 4OBRA 1K4GA 3ITCA 4MFEA 1U5VA 2B4GA 1IWBA 1D2KA 2XGZA 1JG9A 3FJ4A 1JZ2A 3H2EA 5H2ZA 4JZ5A 4AD0A 4L9YA 1L2QA 5LGXA 3WQWA 4BK9A 2XH2A 3QZ6A 3ZO9A 1NWSA 1ZGDA 1WKEA 3GVVA 1QBAA 3BQ6A 3TJ4A