4ZE5A

Structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 185
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ze5A00
1KBKA 2CKSA 3SURA 5CLTA 5JUVA 2WSPA 3GXIA 3T2QA 5HPOA 4TXEA 2BV9A 4GXPA 2PWHA 2XSAA 3WKZA 1LG1A 3VDCA 1W2PA 1KXVA 4XB3A 3WNKA 5AYBA 2FGZA 4CCDA 3WSUA 2J7DA 3W25A 3IAPA 3PZ9A 5DF0A 3ZOAA 2XVLA 1A3HA 3AMCA 3QOMA 2WANA 4GI9A 5DT7A 1LF1A 4QCEA 3VNZA 2WCAA 1US2A 1CGWA 1OWQA 3EMCA 3VNYA 3CUGA 2Y24A 3AMDA 4BQ2A 5ECUA 3VGBA 1AQMA 2V3FA 5DT5A 1I1XA 2VOTA 1GUVA 3ALFA 2XFRA 4PN2A 1NOUA 2XIIA 2VC9A 4WSJA 5KZ6A 3AZSA 2EJ1A 2EEXA 2WHJA 4CD8A 2NW0A 2J75A 2OSWA 4Q22A 2WW5A 5I3DA 3THDA 1FH8A 1TVPA 1J10A 4D72A 3BXWA 2XG9A 1QI3A 4K68A 1ZB5A 5C71A 3ARPA 4AZCA 4U31A 1MQRA 3N1AA 4BQ5A 1J0HA 4MDPA 1JYWA 1PJ9A 3CHEA 5BXPA 4UFKA 2XFFA 1MFVA 1WDSA 2YA0A 4J27A 3VIOA 4AIUA 4B9YA 5A8MA 1D7FA 4BZYA 4J3VA 2WZHA 2J7GA 3RO8A 1WE5A 4GI6A 3IK2A 3T2PA 3AIBA 3CTTA 4AMCA 1H0GA 4B3KA 5KEZA 3SUUA 1WPCA 5I79A 5D9MA 1G94A 5E9AA 4AXNA 3L4TA 1E6ZA 4WKHA 1CXLA 1QI5A 3AS0A 1V3HA 1UWSA 2J4GA 3THCA 2Y8VA 2WVVB 4UQ9A 1M53A 1BG4A 3I3BA 1DWIM 3OLGA 2OYMA 1C7TA 1R7AA 1J0IA 3WH9A 2DEPA 1GOIA 2CEQA 2YL8A 2BVYA 3A4AA 2UY5A 4OBRA 1UA3A 3MV01 4H8VA 4DWSA 5C70A 4PTMA 1EQCA 1DP0A 2XFYA 1UA7A 2XHYA 1GOQA 1D3CA 1R86A 3D3AA 2DIEA 1Q6GA 4RE2A 4ZXLA 2D0FA 3NSNA 5CPSA 1TR1A 4IUGA 4PUEA 5LA1A 2VURA 4C7DA 1GQLA 3WEMA 4HOWA 2FGLA 1K9EA 5ABFB 2ZUTA 3L2MA 1TE1A 4CU7A 5EBAA 3ARZA 2G8ZA 3WQVA 1W32A 5A6AA 4AZ7A 1CTNA 3RDKA 3GXFA 4IISA 2JEQA 3BAXA 4J3SA 1E15A 2WVUA 4D6EA 1SR0A 1V6XA 3ZQ9A 1TA3A 2CETA 1K9FA 3MMDA 1VB9A 1UG6A 4U3CA 4W5ZA 5HBFA 3K8KA 2DSKA 2B31A 4R5EA 5A3HA 3WNNA 1GOMA 2PWEA 1C91A 4ZXOA 3I3EA 3WDPP 3BGAA 1KR0A 5JBFA 3WQWA 5DO8A 7A3HA 2NT0A 1XC6A 1CLXA 1V0KA 3N04A 5EB8A 1S46A 1VRXA 4UFLA 1UQZA 5A2AA 1KWGA 4U5KA 4X0VA 9CGTA 1HF6A 4ACZA 3WDQA 1OGBA 3PTKA 3ARVA 2DT3A 3GYCA 2AAAA 1J0KA 3FAXA 1HJWA 1GVYA 2VUYA 3RILA 1W9BM 1MXDA 3BAKA 4B9ZA 4KH2A 3GXDA 4WKFA 3BAWA 1M7XA 4IM4A 2J7EA 1W3JA 3WDRA 1GW1A 2E8ZA 1EXPA 4JZ5A 3I3DA 1HN1A 1JZ2A 4LXFA 1QBAA 4HA3A 1UWQA 5BROA 1OT2A 1GJUA 2ZE0A 2G3JA 3VDAA 4Z2KA 2FH8A 1BGAA 1E0XA 5D8ZA 3N11A 1VENA 1JZ7A 2ZXDA 2E3ZA 4OOUA 1VFMA 3K1DA 1UR8A 5E70A 2W4XA 1Y7VA 1B3WA 3EDDA 2JF6A 3WENA 3SCRA 4JHZA 4W8AA 3L4YA 1V6WA 2EO7A 1EOKA 2QLYA 2UY2A 2WMFA 1MQPA 2YL9A 1JD9A 1RPKA 1HJQA 1HVQA 3UESA 5GNZA 2W91A 1CEOA 4M1RA 3RIKA 3VDHA 5IHRA 2OWWA 3WNLA 1JNDA 4PTVA 1BYCA 1B9ZA 4W84A 3GNOA 3OLEA 2WBKA 1MXGA 4W5UA 4RE4A 3WMSA 3WL1A 1OD8A 1ECEA 2ZX9A 3VIGA 1HP5A 5CGTA 3SEPA 1FP8A 4WLCA 3BAJA 3W6LA 3WNOA 5JBEA 1U30A 3ECQA 4Z2IA 1BVNP 5AY7A 3L4XA 3VD5A 3KEHA 1EIBA 1H49A 3GZAA 1E5JA 3LPGA 3CPUA 3GBEA 5CLWA 3ZT5A 1K9TA 1D2KA 3PZVA 2D0HA 2EQDA 1LL7A 4RE3A 1GOWA 1CGTA 2V5CA 2J74A 5ABEA 4TTGA 4AISA 2PWFA 4JCLA 1UR1A 2PB1A 4TVCA 3AROA 2EPOA 2J77A 5A69A 1W3LA 4MJ4A 4PYSA 1QVBA 4UOJA 3TTQA 1E3XA 1U2YA 3CIVA 3ZJKA 4GPNA 3TTSA 4AD0A 3KL3A 3VINA 4C7GA 4CN1A 1UKSA 3UR8A 3PZIA 2CBVA 4D6CA 4N42A 3JUGA 4U33A 3UETA 3CZ8A 5E0CA 5GNXA 2PWGA 4GZJA 2X8RA 1HKKA 1QI4A 2VMFA 5GNYA 3VD3A 3VM5A 4UCFA 2D3LA 4PMOA 1WDRA 3RPMA 1UR9A 3PZNA 1HJSA 4AEEA 1CGUA 1V6UA 1HJUA 5AYIA 4BQ3A 1UOKA 3W29A 5HDRA 3RMEA 1CXHA 1B3YA 2D2OA 2CKRA 1X6NA 4P7LA 3TONA 2ZUSA 1HXJA 5LA2A 4U3AA 4KWUA 3VIKA 4PEEA 2DQXA 1UWIA 2O92A 2WB5A 1PAMA 2WC4A 1FA2A 1CGYA 4F9JA 3FNDA 1B30A 2BS9A 3UG4A 2EPNA 4L4PA 1M01A 1QHPA 3T09A 1CXKA 3M7SA 1JFXA 2BHZA 2CBUA 4HZ7A 1EHNA 4CU8A 5A6JA 3O9NA 4MAVA 4M56A 1W91A 3WUFA 3FN9A 3CZGA 2JFEX 2CYGA 5IFPA 1WP6A 1HX0A 3AXXA 4L4OA 2FH6A 2YOCA 4H7VA 4CN6A 1VFFA 1FHLA 1YQ2A 4PMQA 4ZE5A 4JKKA 4NRRA 5CSYA 2Q8XA 2ZXBA 3K8LA 4W7WA 3AZRA 4W87A 1DWGM 1XCWA 1G01A 1ODZA 5I2UA 3VOCA 3AMKA 3ZIZA 4P8XA 1KXTA 4P7OA 2VO5A 4HZ8A 5A6BD 4HU0A 2VZUA 2J7FA 3ZT7A 3IAQA 4DWSB 5BRPA 1IZKA 1FFQA 4WKAA 3AZTA 1Q6DA 2EXOA 2YBTA 4HMEA 4NRSA 5D4YA 3AS1A 5CGMA 4MB5A 3OIHA 3VDBA 3WUBA 2O9TA 1NOFA 1OGSA 3NUKA 4PTXA 1VBRA 3TP4A 1DWFM 1DEDA 2G3MA 3PZOA 3RJYA 4AIOA 4PTWA 3WD2A 1V3KA 1K9DA 5FL1A 2CIPA 2WKGA 1H2JA 1VEOA 2WWDA 1J11A 4P7QA 1ZL1A 4UFJA 4KGLA 3BSHA 2ZUNA 1PX8A 1RD6A 4HP5A 2YLLA 2GDVA 3OGRA 4MB3A 1TZ7A 2J7CA 3KL5A 2X09A 4J3XA 1E71M 1DWAM 4P7NA 2MANA 1PBGA 4W89A 4TX8A 2XVKA 3HN3A 3VGFA 3HJEA 1UD2A 3M46A 4DM2A 2EPKX 3CH9A 2J47A 2ZX8A 2IXUA 5CZKA 3OBAA 4LGXA 1ITCA 3QR3A 1ZJBA 1XSIA 3MMUA 4E4PA 2OYKA 3AHZA 3OZOA 1H41A 1UKTA 3EDKA 4XUYA 2V3DA 3IANA 3GH5A 2W5FA 4TUFA 5A95A 2WMGA 2G3NA 4J3WA 3MKKA 2CPUA 3A4WA 4GQQA 4IPLA 1WAWA 3WUEA 3SCTA 1NP0A 1NWUA 2UWFA 4QDMA 1AVAA 2GUYA 1UH3A 4URIA 2WHMA 1BHGA 2QMKA 1JZ5A 1DTUA 3AXIA 2GSJA 1VJSA 2XTKA 2VRKA 5A94A 3B9EA 4F66A 5LA0A 4UOZA 2G4FA 3GDBA 4AD3A 1OT1A 2QPSA 4Q7NA 4D6JA 1J12A 4UFMA 8CGTA 1CDGA 3CZEA 1FHDA 1V0NA 1VF8A 1C8QA 4ZE4A 4DWSD 4MNMA 3BAYA 4U2YA 1CBGA 1ZS2A 1E5NA 2BY0A 3WDHA 1UWUA 1E0VA 4R27A 4BA0A 2HVMA 4JHOA 3KE0A 5HNNA 1CLVA 2FHBA 4PUDA 3ARRA 2J62A 5ABHA 1KCKA 2G41A 1UZ4A 1GCYA 1CGVA 4PMRA 3WEOA 4GINA 4ACZB 1NWTA 4UNIA 5M03A 1W3HA 4HU8A 4PSPA 1BYDA 1JGIA 1ZBVA 4YPJA 1O7AA 1B3ZA 2YDSA 3K46A 4CKQA 4V2XA 1SMDA 6A3HA 2X2YA 3W38A 3L4ZA 2W62A 3WIJA 3WNMA 3ARXA 3L4WA 1CECA 1UD5A 4H8UA 1ESWA 4CCCA 2DPEA 1NH6A 4ZENA 1LWJA 3ARTA 4AC1X 2A3CA 1PZ2A 5FIPA 4PSRA 1EO5A 1TA3B 4GIAA 4PMDA 3PTQA 4JKMA 2EPLX 1WDQA 2ZUVA 3UCQA 3DYOA 3AYRA 1C90A 1Q6CA 4MAZA 3WH5A 2XPKA 3VGEA 1W9PA 3ZSTA 3SCWA 1V08A 3T08A 1PX3A 2RGMA 4DUWA 1JFHA 2XM2A 1J9YA 2XUCA 3UR7A 4WJXA 2Z1KA 1V6YA 2CBJA 4PCSA 4J3UA 1WCGA 3VMPA 1HJXA 4OBSA 3BCDA 2VX4A 5EMYA 1QNOA 4S3KA 2X05A 3MO4A 2OWXA 3BH4A 5FD0A 3BSGA 3OLDA 1C8YA 1R85A 2Y5EA 1PIFA 4ML4A 3EDFA 2A3BA 3WDJA 4B16A 1MYRA 3WMCA 3F5JA 1PZ3A 4HPHA 3MUAA 2GJPA 4UQCA 2VRJA 3K4AA 3DECA 3VPLA 2DT2A 1W1TA 3RCNA 1XYZA 4EE9A 3IJ9A 4AD2A 1J0ZA 3GH4A 3UEQA 3J7HA 5I23A 4QAWA 4XX6A 3K4DA 4AZ6A 3MUY1 3WD3A 4QFUA 1ISXA 1KQYA 1R87A 4J7RA 1VJZA 4LYPA 4HTYA 2CCRA 3W4RA 3B9DA 3POHA 3VU2A 4MNKA 1HJVA 1JAKA 3QOKA 4W93A 3CHCA 2C7FA 1L0PA 3VX0A 5AC4A 3MUIA 4D6DA 1MW0A 4F79A 2V3GA 2VL4A 4KGJA 2C0HA 2ZX5A 2WVVA 1GHRA 2XWEA 3EBVA 1JD7A 3OGSA 5FOOA 3TOPA 3GXMA 1QW9A 1SFSA 1LWHA 3SUTA 3EYPA 1EO7A 5AC5A 2FHCA 2EBNA 3VKKA 3NCOA 2QPUA 2ZICA 3KZSA 3W26A 3VIPA 1WNOA 2V5DA 2DGAA 2NT1A 4F8XA 2BXYA 2BHYA 4P8UA 1E6RA 4FF5A 3PTMA 1OSEA 3OB8A 2ZUMA 3ALGA 4EKJA 4HMCA 3HU7A 4A4AA 4E8DA 2CERA 3WQ5A 4KRUA 1E4IA 4PBGA 3TTOA 2WSKA 2WPGA 1TCMA 2VVNA 1GPFA 2WHKA 3WUGA 3WD4A 2WLYA 4YN5A 1WDPA 1WO2A 3OA5A 5BRQA 5A6BA 3CUFA 3VIJA 2EPMX 4Y7EA 5I78A 3ARUA 1I75A 3CUIA 3O2LA 1QBBA 3PBGA 1UD4A 2WMJA 1EDGA 1WZLA 4AZBA 3ARQA 1FFRA 2ZWYA 1E4MM 4UOQA 1ZBKA 3S6TA 3MU7A 1LQ0A 4M24A 3B9AA 1E9LA 1LLOA 2CNCA 1LL4A 2E9MA 4WIWA 4AWEA 2WWCA 1E4LA 1VEPA 3L2LA 1NOWA 2VRQA 1UKQA 5BXTA 2BY1A 2WHLA 2O9RA 3A6OA 3N17A 3IJ7A 1PX4A 3WY1A 3EDJA 2GJXA 1YHTA 5BXSA 2VT0A 3LPFA 5A6KA 3W82A 2AOSA 4TVUA 4W7VA 3AIVA 7CGTA 1E55A 1UH2A 3D5HA 4XV0A 2J78A 3AFBA 4EK7A 1R7OA 5A2BA 1MW1A 2WC7A 3A3HA 4X9YA 2XIBA 3WBEA 2F61A 2VI0A 4U5IA 3HMCA 3VM7A 3PZMA 4LPCA 3CUJA 4CGTA 4AZIA 2XM1A 3VMOA 1BVZA 2YIHA 4D6GA 1JF6A 1KXQA 4HZ6A 4JFTA 1BFNA 1GQKA 3VGGA 2X0HA 2WVTA 3BAIA 1PIGA 3EDEA 2E0PA 1QNPA 2VNCA 1VAHA 5M5DA 2JIEA 5M17A 2ZUUA 4CUCA 5IDIA 4JFVA 4PMXA 5EFDA 1JL8A 4NSBA 1HVXA 3W37A 1H09A 4UQEA 2CESA 2DT0A 1SYTA 2ZX6A 4ACYA 1AQHA 3SUSA 3SUWA 4CVWA 1QI0A 1VIWA 1Q6EA 5DFAA 2FHFA 2XYLA 4AZHA 2D22A 3PZQA 4ATLA 1GQIA 4MNJA 3WH7A 1B90A 1EDTA 1XHGA 1H11A 4JL1A 4HPGA 3A4XA 2BFGA 1JF5A 3VMNA 3TA9A 3AMGA 1XH0A 5A1AA 3AHXA 3IJ8A 4UZUA 5F7UA 1ISZA 5CPTA 1BGGA 4Z2HA 1QHOA 3N13A 3QHNA 5A8NA 5A6LA 1QW8A 1OIMA 4MB4A 3DHPA 1I1WA 1DHKA 3RM4A 4AD4A 1E40A 1W1PA 4IPNB 1X1NA 2QMJA 2UY3A 1E72M 4J3TA 1ZBWA 1UD8A 1FH9A 1CENA 3VVGA 2VR5A 2ZXAA 1BYAA 3GNPA 4OKDA 1O6IA 4DUXA 1HKIA 5E0FA 5IFTA 1EH9A 1F4AA 2JF7A 4FLSA 1KBBA 1ODUA 3CHDA 3AMLA 3MS8A 4B15A 3VIFA 1JYXA 1W3KA 1MVYA 4TOQA 3VGHA 4AYSA 1E3ZA 2YDQA 4PRWA 3ARSA 4GZEA 5HOSA 4FLOA 4A3HA 2XGBA 1GOKA 3CGTA 2C8NA 2IXVA 3QHMA 3AICA 1NQ6A 2WAGA 4M8UA 2VCAA 1HP4A 1LG2A 4AZ5A 4J28A 2VZTA 2XVPA 1QOXA 3FY1A 1CNVA 3NDYA 2YDRA 1UUQA 3N12A 1M04A 1KR1A 1BQCA 1JZ6A 1JXJA 1CGXA 4UQDA 1G9HA 3AOFA 3EMQA 4M80A 1ISYA 1FH7A 3U5YA 2VTFA 1P6WA 1B1YA 2HISA 1UR2A 2RGLA 3ZR5A 4D6FA 1NP2A 1OBAA 1VBUA 3K8MA 3GM8A 2PI6A 3VIHA 2VQTA 5A6MA 2WMKA 1US3A 1E4NA 2Y8KA 2CXGA 4W8BA 1WZMA 4DUVA 2E9LA 5CG0A 1WKYA 3L4UA 4MDOA 3WFZA 2WYSA 1GZJA 1EGZA 4GI8A 1V02E 1W9VA 2PBGA 3U5UA 3B8SA 3VD4A 4MADA 1L8NA 5D9OA 3DYPA 1V3MA 3SCQA 2ESCA 4UQAA 4JIEA 1WB0A 4MJ2A 1TVNA 1V02A 2OSXA 4W88A 3VD7A 2WK2A 1HKMA 1KCLA 2XVNA 3BMVA 3PZGA 1UKOA 3AYSA 3WN6A 2DT1A 3AQUA 4JFWA 4GZIA 4H2CA 1C7SA 3PZTA 1UR4A 1OCQA 4V28A 1CYGA 1MW2A 2VX7A 3ZJ8A 3BMWA 4BF7A 2ZOXA 5A2CA 4TX6A 2AMGA 1W9XA 1TMQA 2XGIA 3DC0A 4QLLA 5I77A 1Q6FA 1V3LA 4ATDA 1ISWA 1EQPA 4EANA 2A3EA 4CD7A 3W28A 3CLWA 4MNLA 1G0CA 4HMDA 3T0BA 5I24A 1NARA 3CBWA 2YA2A 1HL8A 4H41A 5D9PA 2QV4A 2WCSA 1KB3A 1GHSA 2Y4SA 3FHAA 2J79A 2VZOA 3AS3A 4Z2JA 1BAGA 3VUPA 4WK9A 3NSXA 2OYLA 2QHAA 5E09A 3WQ6A 2CHOA 3AHYA 3DYMA 2YBUA 2W92A 3UG5A 1N82A 1C92A 3CHFA 1JDDA 4TVDA 1W2VA 1CWYA 4ZEPA 2ZIDA 2YL5A 3UG3A 4Z2GA 2VCBA 2WCGA 1JXKA 3W81A 2D24A 1B2YA 1TUXA 4WF7A 3AXHA 3T0AA 3AIQA 5FCZA 4P7RA 5A8PA 3T2OA 1JAEA 5FL0A 1OGGA 3OZPA 1BPLB 2Y2WA 4AIEA 4A3YA 4UQBA 1UKPA 4LQ1A 3RJXA 1ISVA 3FW6A 2XVGA 4KRTA 3VX1A 4WSKA 1GJWA 5HXMA 4AZGA 1UWRA 5TD4A 1E1EA 3UERA 1J01A 1JYVA 4P8VA 1HKJA 2CHNA 1CIUA 3PN8A 3CZKA 3SCUA 5CJ5A 3WMBA 1E43A 4BS0A 1KGUA 5D8WA 1NWRA 1KQZA 2A3HA 1B31A 1ITXA 2JE8A 2X0YA 4CVUA 5A8QA 3NIYA 2WBGA 1R8LA 4OIFA 4ATWA 1QI2A 1JZ3A 3VD9A 4GKLA 2BHUA 4H8HA 1HIZA 1UR0A 4CD6A 1V3IA 3NDZA 4PMUA 3SCPA 1GONA 1E6SM 1JYNA 4D6IA 1ZU8A 1XSJA 1QPKA 1E6PA 2WVSA 1CXIA 3RM8A 4AZCB 2O9PA 2DSUA 2JIWA 4BCEA 1E73M 1XYFA 2VQUA 1JZ8A 3VGDA 4PMZA 1V3JA 1Q4NX 4PMNA 4HA1A 2J8GA 4JCMA 3CO4A 3KWXA 1EDQA 2VX6A 4M82A 1G1YA 2UY4A 1VFUA 3AHVA 3QHOA 2ZUWA 2IUZA 2J7HA 2X1IA 2PF0A 3OLIA 3ZM8A 4H04A 4CN4A 1GOOA 4TTUA 7TAAA 2D20A 3CMGA 3T0DA 3A47A 3S2CA 2WZIA 2GJRA 4M29A 3F5LA 3MV11 1CZ1A 2E4TA 3VIMA 4OOZA 4MB1A 2BY3A 3G6LA 3MANA 3GBDA 2DH2A 1X6LA 2YL6A 3BC9A 2E8YA 5I0DA 3MSDA 1FP9A 5IHSA 5I5RA 1BF2A 3SCVA 4YHEA 1BLIA 4DM1A 2E9BA 5LYRA 1H1NA 5BCAA 4UFHA 1IZJA 2D1ZA 3ARYA 3LMYA 3W6MA 3DHUA 1NWSA 3BCFA 1RP9A 3WEZA 2W66A 1B3XA 2OSYA 1H0IA 3FAWA 2E40A 3II1A 4LYRA 1OB0A 1OIFA 1BG9A 1W1YA 4AD5A 4PMYA 1HNYA 1UWTA 3LPPA 4BQ4A 2WM0A 4NZCA 3O6AA 3FHQA 3VTRA 1KFWA 4F9DA 2W67A 2DIJA 3PHAA 3L4VA 4AY1A 2VCCA 4XZBA 1E1FA 2O9OA 3CZLA 4D1IA 2VX5A 3SCOA 2VJXA 3WH8A 4AW7A 2F2HA 4X0NA 5E6YA 2NSXA 3TTYA 3VILA 1LL6A 3N15A 1CPUA 3ZJ7A 4CD4A 5CXPA 2BY2A 3OGVA 4E8CA 1OINA 4ZFMA 1G5AA 3RM9A 1JIBA 1JI2A 3AHTA 1E6QM 2WKLA 3QGVA 4XZWA 3ZSSA 1IT0A 3OG2A 2CBIA 4LX4A 4FMVA 4QLKA 2JEPA 2WXDM 1AMYA 3ARWA 1PPIA 1J18A 4UZSA 1V03A 5DMYA 2W61A 4OJYA 1WZAA 4W8LA 2JALA 2GK1B 2WNWA 1XH2A 1VEMA 1XCXA 5IXEA 2DSVA 1J0JA 2XJ7A 2VZVA 5EFFA 4GO8A 5I6SA 2WZEA 2ZWZA 1QNRA 1KGXA 1JI1A 3AJ7A 4RL3A 2ZX7A 4U2ZA 4W7UA 1DWHM 1DWJM 3WH6A 4CCEA 2VZSA 1MWOA 3M07A 4M81A 3VO0A 5FKYA 3NJ3A 4NI3A 4CD5A 4JFUA 1HT6A 3WELA 4OUEA 3N9KA 3WBAA 5D9NA 4JL2A 4PMVA 3WNPA 4GO9A 4N0RA 3KL0A 4JAWA 3WF3A 1E56A 3MSGA 1M03A 1W9UA 5BWFA 3W24A 4B3LA 5E6ZA 4DWSC 5ABFA 2PWDA 3WF4A 1EOMA 4CU6A 1OM0A 3VIIA 1QNQA 4S3JA 2DH3A 4FK9A 5JIPA 2D23A 2WMIB 1HL9A 5JIWA 3U7VA 1V0LA 2XWDA 1IV8A 3W0KA 5C8BB 2OLHA 1VFOA 2XSBA 3ZMRA 3M6DA 2GFTA 1W9DM 1XSKA 4HA4A 4JKLA 4EAMA 1UD3A 1JZ4A 4W85A 3WF0A 5ABGA 4AD1A 4UTFA 1H5VA 3G6MA 3WQ4A 1E6XM 2BNJA 4PCTA 2W63A 4FLQA 3WF2A 2TAAA 6TAAA 3CMJA 2YKKA 4D1JA 3MMWA 2ZXQA 4E2OA 3WF1A 4HOZA 3AIRA 2QF8A 3F4VA 3WDIA 1BYBA 5M3WA 4MPKA 4JFSA 5DEZA 3CUHA 2CITA 3LPOA 4MTVA 4NF7A 4W86A 5CPQA 1UZ1A 3E1F1 2GDUA 4D6HA 1QHZA 2BVTA 1AQ0A 4V27A 5BXRA 1V0MA 2F8QA 1MQQA 4QLJA 5CQ1A 3ZO9A 4HOXA 3F5KA 1EA9C 1GVIA 1KGWA 2J7BA 4QCFA 3WD0A 4P8WA 1ZJAA 3NSMA 1FOBA 1TFVA 8A3HA 1XD0A 2PC8A 1OD0A 2BXZA 4KMQA 1UYQA 1GQJA 5GPRA 1H4PA 1XH1A 2PBOA 4C7FA 1SMAA 2FDMA 1V6VA 1U33A 1KWKA 1BTCA 1QNSA 1KXHA 2WLZA 4UFIA 3FXYA 2YA1A 1MFUA 3SUVA 1NM9A 1C3FA 1XD1A 3WQ8A 6CGTA 1CXEA 1UD6A 4QP0A 3GH7A 1E70M 4UR9A 3U7BA 3ZJ6A 1RH9A 2DSZA 3AI0A 3BLPX 3CZJA 1C8XA 1GORA 1B3VA 2YJQA 4FLRA 4D71A 2J8FA 3ZT6A 3BLKA 2DSWA 1TG7A 1JNEA 1E6NA 1JDAA 1LJYA 4Z2LA 2WMIA 3AISA 3ZR6A 5BYWA 2A3AA 2WMHA 3AIEA 1UH4A 3AIWA 1W1VA 5HPCA 2V38A 1CXFA 1Z32X 2D0GA 1WZKA 2D3NA 2GVYA 2BVDA 1B0IA 1UHVA 5A6SA 1BSIA 3WD1A 1XV8A 5GQBA 2VVSA 1JDCA 2VR4A 5JBDA 3NYDA 3GNRA 4YHGA 3SCSA 3MUZ1 2YLAA 1EHAA 2J25A 1GNXA 1A47A 1ZBCA 3SCNA 3GTNA 3SIMA 4GQRA 5A8OA 3AS2A 1RP8A 3APGA 1PEZA 3AIUA 3PZUA 3POCA 1F4HA 1XGZA 3W53A 1XRVA 2GJXB 1UQYA 2Z1SA 3U57A 4OZOA 1E0WA 3W27A 1H3GA 2WC3A 2GK1A 3EMZA 3N18A 1JG9A 2OWCA 2G3IA 1K6AA 2V3EA 2DDXA 1MW3A 1J0YA 4LYQA 4AEFA 5CSUA 3WFLA 3WL0A 1C93A
chains in the Genus database with same CATH superfamily
2J24A 3RF9A 1HGWA 3GXIA 4GXPA 4LBRA 3SW6A 3BJFA 1KXVA 4LC6A 5CPNA 5AYBA 4IHCA 4KWVA 3UA4A 4CCDA 3W25A 3RCYA 3HPXA 2XVLA 3T55A 1Z48A 1TSIA 4GGHA 4QCEA 3MHUA 3W7RA 3IS4A 2PTYA 4Y8FA 1IF2A 1OWQA 3EMCA 3MI6A 3ZVHA 4K8HA 2WOQA 2QS8A 3VGBA 1I1XA 2VOTA 4ERAA 2VOMA 2XIIA 2VC9A 5KZ6A 1NFPA 2DZXA 3AZSA 2EJ1A 4ZQOA 2J75A 5FSEC 1DQXA 3L66A 4JTEA 2NV2A 1S1RA 1J10A 3BXWA 5DCBA 4HPJA 1ENUA 4YNGA 1K4GA 4LUTA 3AWNA 4QG6A 4WEVX 1MQRA 5F4WA 4XO6A 4AHOA 1DIKA 4I7WA 1P0DA 4D8ZA 4UFKA 2E09A 1WDSA 1Q6QA 2A1YA 2YA0A 1D7FA 1GVOA 1EGVA 4ADTA 1WE5A 4L7ZA 3W1PA 4QG8A 4F4RA 3F1QA 2V5KA 1KNWA 5AHEA 3AIBA 3CTTA 1MSSA 5B7ZA 1H0GA 4F0HA 3ORWA 3LX9A 3L4TA 4AVOA 1XL9A 2EGZA 4IMDA 1CXLA 5JMUA 1QI5A 5DBUA 2C16A 1J6OA 5TNVA 4UQ9A 1BG4A 3OLGA 4L4MA 3NQDA 3JR2A 3OP2A 2EF9A 1GOIA 2CEQA 1H7OA 4WXYA 1TRIA 3PNUA 4DWSA 5C70A 1UBSA 4EWJA 1DP0A 3PB2A 4XAPA 3Q2DA 2PRLA 4HU4A 2V67A 2X1RA 1GZGA 3D3AA 1Q6GA 2V2DA 4REQA 2D0FA 3C2OA 3W83A 5T8GA 4PUEA 5LA1A 1ZSXA 4AHQA 1RR2A 4Q6JA 3EWXA 1FWSA 4AY7A 2FGLA 2XH7A 4Y9PA 4WVXA 3D47A 2WJEA 1DTNA 3EOSA 2HV5A 3E2VA 3LHTA 5EBAA 3ARZA 2G8ZA 3F2CA 3IACA 3Q37A 3I7RA 4IISA 1SFJA 5D2VA 2JEQA 2I17A 1S39A 1ZALA 1E15A 3D46A 1H51A 3PSVA 5XIMA 3NO5A 2AMXA 1P0KA 3MMDA 3KVMA 4FNQA 4EXBA 2B31A 4G7FA 3DERA 3E2SA 2PWEA 1BD0A 3UXKA 1C91A 4ZXOA 3I3EA 3BGAA 3G1XA 7REQA 2WNNA 3TYCA 5DO8A 4C65A 4JX5A 5G4HC 1FWJC 3C3UA 1V0KA 5EB8A 1J8VA 1UQZA 2OZ8A 2Y5JA 3PF3A 2Z24A 4X0VA 4GX8A 1K1DA 4GH3A 1UJPA 1OGBA 2WM1A 3WDQA 4X2RA 1K8YA 1LOQA 5HNTA 1XLDA 3TSBA 1A53A 1HJWA 1GVYA 4MSSA 1ZLPA 1SU5A 3NQEA 1M7XA 3CH0A 3E0IA 3MVTA 3DBPA 3R0KA 3OVPA 1GG0A 3V4BA 2ZZ5A 1Q3NA 3I3DA 1RCQA 3C2EA 3H12A 3KWSA 3PBMA 4LY4A 1JZ2A 2PLMA 1L6SA 3ZR4A 1GJUA 5HWJA 3F4WA 3V16A 1M5WA 4AWSA 1E0XA 5EMJA 5D8ZA 3W84A 3GQYA 2ZXDA 2E3ZA 3HBLA 1UR8A 4JGDA 4H9MA 1B3WA 3EDDA 1Z41A 2JF6A 3P93A 3SCRA 5DN1A 1PO9A 2QCDA 4UCGA 2QLYA 1FWDC 3WBWA 5E9XA 1MQPA 3NQMA 1HJQA 4HB7A 3UESA 2W91A 4C1NA 3EEGA 3HO8A 3WNLA 3QMRA 1K03A 1AL8A 3SZ8A 1P1XA 3VNKA 1MUCA 4C6EA 3M5XA 4O13A 1H60A 3GNOA 1AG1O 2DORA 4RE4A 1FBAA 3RPDA 4L65A 3WL1A 4B5VA 1OD8A 2VD8A 3BAJA 3W6LA 4E2BA 3S2MA 3KM8A 3W23A 1UIPA 3L4XA 3VKJA 3VD5A 3RXZA 2OVLA 1H49A 3GZAA 3LEPA 1W5PA 1RLCL 3WJSA 3LPGA 4MWAC 1VPXA 2JQXA 3REQB 1D2KA 2YCIX 4NZJA 4AISA 4TVCA 2EPOA 3GG1A 5A69A 4MJ4A 3BLFA 1E3XA 3DFTA 2QXWA 5I3IA 5I3HA 3S2JA 4GPNA 1P0NA 3DFQA 4NASA 1FWHC 2CZEA 2NVCA 4IQDA 3TTSA 4AIBA 3KL3A 4DF0A 1HUVA 1L2UA 3UR8A 5D2YA 2PPGA 3MUXA 3PZIA 5E0CA 5GNXA 2PWGA 2X8RA 1QI4A 2VMFA 4C1KA 1Y65A 4PMOA 1E51A 2FZNA 1HJSA 4V1XA 1V6UA 1SW7A 4BQ3A 3N25A 1V7AA 3HG4A 1CXHA 1IEIA 5BU9A 3GIPA 1G6CA 1ME7A 1W5MA 3VIKA 1UWIA 4H6EA 2WC4A 1CGYA 1OABA 4TO8A 4OUIA 3UG4A 2EPNA 4ZL1A 2PRHA 4QE4A 1CXKA 3M7SA 3ZFHA 4K8GA 4O1AA 4DJFD 2AL1A 4M56A 1N7KA 1W91A 1OC5A 3SGGA 3WUFA 1XIFA 3VKCA 1BKSA 4QM1A 2JFEX 2GGIA 4JTCA 4MM1A 1YXYA 3LBOA 1KFJA 4H7VA 4CN6A 4MUZA 3GNDA 1YQ2A 5D2WA 4PMQA 4ZE5A 4FXRA 4WJ8A 4ML9A 1CX9A 1UPPA 2Q8XA 3U2OA 1Y5VA 4W87A 3TW7A 5CEWA 3AYVA 3W7QA 1ODZA 1G4PA 4H83A 2I7GA 5I2UA 1TX0A 4ILSA 4V15A 1Y8BA 3T7VA 2PCEA 3DXIA 1KXTA 4Q33A 2VO5A 1X1ZA 2R8WA 5A6BD 1IZKA 1AH4A 4WKAA 3EEZA 1ZAIA 3QC3A 2INFA 3QPYA 1Q6DA 2YBTA 2CU0A 3FV9A 4MB5A 3VDBA 4ZR8A 3CL8A 4H1ZA 3TP4A 3GLCA 1DEDA 3BARA 2CXEA 3RJYA 4AIOA 4F2UA 5T9BG 1F6YA 2ISVA 4HNOA 4LB3A 4ZTXA 4IIDA 1ZL1A 3JW7A 4GCAA 4UFJA 3UZJA 1G67A 3RITA 1LYXA 2ZUNA 4NAFB 3OGRA 2PE4A 3KL5A 3URNA 1H1YA 1ME8A 2BG5A 1U83A 4A05A 4IMAA 5FJIA 1PV8A 3U6WA 1UD2A 3M0ZA 1W5QA 4HCDA 5AFDA 4GHRA 2PP3A 3OBAA 4LGXA 4X63A 3A23A 3W2LA 3MA8A 2FIQA 3L67A 4Q8TA 5LNUA 3QTGA 5D2XA 1H41A 1UKTA 3N73A 4A2SA 3GH5A 3NL3A 3O6DA 4JIQA 1XBYA 4GQQA 4IPLA 1ZAJA 3SCTA 1NP0A 1NWUA 2UWFA 3G1RA 4QDMA 1AVAA 4DNMA 2FJKA 1JZ5A 3AXIA 2VRKA 2P53A 1LROA 3B9EA 3C56A 3JZEA 2DIKA 3KLKA 4S3DA 3GDBA 3H7UA 1OT1A 5EY5A 3G3MA 2J88A 3I7QA 2V5JA 6XIAA 1T8QA 2J9XA 1C8QA 2IW0A 4DPQA 1F07A 3EWZA 4FS9A 1IEVA 3URBA 1E5NA 2YGYA 1UWUA 4R27A 4F2BA 5CZTA 4LF1A 1NU5A 1YRRA 1VLIA 4AMAA 2YZ5A 5AECA 4XD6A 1CLVA 1PS9A 3AAMA 3B0XA 2FHBA 4PUDA 3NXFA 2NV9A 4B5SA 4J1OA 4HNVA 4WSHA 3N4EA 1GCYA 1CGVA 2V9DA 3HQ1A 3MJMA 4DYKA 4UNIA 3B8IA 1VCGA 1JPHA 5AHFA 1EEPA 1W3HA 4FNTA 2UV8G 1JGIA 1VCVA 1GOXA 3LD5A 4JHMA 1ZBVA 4YPJA 3GKFA 1POKA 1B3ZA 4F0RA 2FLIA 3PBYA 1VYSX 1H7PA 3WQPA 4HSNA 3WIJA 4XG1A 4JTUA 3WG6A 1UD5A 2FFCA 5GJPA 4LY8A 1W5NA 2DPEA 1LQ2A 4ERGA 2A3CA 1PZ2A 2I9UA 5CBIA 1EO5A 1TA3B 4MHBA 2HE5A 4MMWA 2EPLX 4O1CA 3DI1A 1WDQA 3E38A 3BLIA 5U7SA 1EWEA 3DYOA 2Q8ZA 1OCJA 1Q6CA 1H61A 2F6XA 5K9DA 3KTSA 4J2PA 4ZTYA 3ID7A 1GJPA 4C6PA 1PX3A 1JFHA 3UR7A 4WJXA 2Z1KA 1OX5A 5FF3A 1UIOA 3W7JA 4PFMA 2F6UA 2YXXA 2VX4A 3G1SA 4S3KA 1YKWA 2OWXA 3EGJA 1LT8A 1R85A 1PIFA 3EDFA 2A3BA 1IR2A 1MYRA 2NX3A 4DJEC 3F5JA 1KM4A 3G1YA 1W1IE 3ANVA 3WK2A 3WQEA 3RLUA 3MUAA 4TX9A 1O94A 4IP5A 5I3GA 3WBYA 1YTDA 4PUNA 3WBXA 3RCNA 4EE9A 3IJ9A 2HVOA 3R89A 4QAWA 3FKKA 3U8GA 1KQYA 4EVZA 4F3HA 5FJPA 4DLFA 1X98A 3S5ZA 3W4RA 5EA9A 1O12A 1M65A 1PL9A 2X40A 4W93A 2C7FA 4N6EA 5AC4A 2B7QA 3MCOA 1SM9A 1MW0A 4F79A 4KGJA 1KBJA 3RG6A 3LNMA 3EBVA 1QW9A 1HW6A 2RJHA 3KZPA 4V33A 1LWHA 3EYPA 1XYBA 5AC5A 1DORA 3VKKA 4JY9A 1U5JA 3W26A 4NZ5A 1WNOA 2DGAA 2PDKA 5FJRA 4F8XA 4XWUA 4CNTA 3DG3A 4V1YA 3GDKA 1E6RA 4ZQCA 1FTXA 4FF5A 5C9XA 3ITXA 4O17A 1KCZA 2ASHA 1KM3A 3PANA 5MKGB 1C29A 1E4IA 3MSRA 4KRUA 4PBGA 2DJLA 3W00A 2Y7DA 4R7JA 1WQ5A 3WD4A 2WLYA 4YN5A 1R3WA 1YADA 4OE7A 5A6BA 1O1HA 4M6UA 5G1TA 2OT0A 2XINA 3IRSA 2OQLA 3N29A 4S38A 3RYSA 3CUIA 1ZAHA 3CB3A 2YW4A 4B4HA 1UD4A 3T07A 2G95A 3TWAA 1IGSA 2NLYA 1W1B1 4UMAA 7ENLA 1XYCA 3LHYA 3N9SA 4PTDA 1R38A 4EWND 3O3RA 1FFRA 4Z42C 1E4MM 4UOQA 5GJNA 4U28A 3UFYA 1LLOA 4WIWA 2I1OA 3LCGA 3VK5A 1E4LA 3ZWTA 4NNBA 1DQWA 1RK5A 3CAKA 2I56A 5F4SA 1GPWA 3R12A 4TV6A 3A6OA 4AB4A 1EP3A 3EX4A 2A7NA 3IIVA 3BMXA 5EBUA 2VT0A 1JQVA 5A6KA 3W82A 1A4MA 4Q4MA 2BDQA 1TPEA 4OU1A 3P67A 4L9YA 1V79A 5HMEA 2J78A 1R2RA 4JTGA 1P43A 5C2CA 3NL2A 5A2BA 3KDNA 5D2TA 4DYJA 1B3OA 1YXDA 2PUZA 1E9ZB 3NO1A 4OQVA 2FTPA 3PZMA 3LERA 4GUFA 4LRTA 5CCZA 5FEPA 4HHMA 2YFOA 5IBXC 4O28A 4WDWA 4HZ6A 4PL2A 2ZZ3A 2QT3A 1B54A 4K1GA 5A6TC 3TW9A 4LAZA 2VHLA 2Y5SA 3I6RA 1YXCA 3IARA 4BFAA 3TR9A 1P48A 1UC4A 3TXVA 1GT8A 2CESA 3UJSA 1SYTA 3LA4A 5HMFA 4QR6A 3TJXA 4GYPC 3CK5A 2D22A 2PDFA 2BFGA 1FWBC 1XH0A 4WY0F 3GU1A 2Y8UA 3AHXA 3IJ8A 4YLWA 5CZSA 1TELA 3ITGA 1XKJA 5AHIA 3SY5A 5A8NA 4J35A 1QW8A 1DHKA 1W54A 3ENLA 5H91A 2A3LA 4Y90A 1CENA 4J4KA 2VR5A 4NYUA 2HDJA 4LBSA 3NZQA 4JYDA 3TSDA 4OKDA 2Z28A 3CUZA 3MW7A 1KLZA 1XYLA 4JNMA 4PH6A 3FJ4A 1F4AA 3CHDA 1FUYA 2Y89A 1MVYA 3T42A 3BQ5A 3I7SA 2YDQA 1M7JA 1R3RA 3R0DA 3EOLA 2A7PA 3W2NA 2C8NA 2ISWA 1R3TA 1GKRA 3HPZA 4AZ5A 5KMYA 4J28A 1CNVA 3ES7A 4GUIA 1UUQA 1JULA 3O6YX 3WLKX 3CAQA 3EMQA 4CQCA 1ISYA 2DZSA 3GDMA 2ADAA 1B1YA 3O1NA 3KBJA 1UR2A 2RGLA 2PWUA 1M1BA 4D6FA 3PPCA 3TYDA 4NAFA 4IJRA 3EB2A 3EKLA 3O16A 2VQTA 3LXBA 2Q6ZA 1B4KA 2CXGA 4W8BA 1WZMA 3CAVA 3LUTA 4QQUA 4DUVA 3WFZA 2FGBA 3W7EA 2RJGA 4XUGA 3GW0A 3B8SA 3O63A 4MADA 2XIJA 5D9OA 1UASA 5T26A 3SCQA 4JIEA 3BW2A 1WB0A 3W75A 1R2TA 3VD7A 1HKMA 1KCLA 1UUMA 4RDWA 2XVNA 3DG7A 3AYSA 5JH1A 3CQIA 2NUYA 2BOEX 4GZIA 1C7SA 1UR4A 1OCQA 1DIEA 1XRSA 2OKOA 4MYXA 1CYGA 4DXKA 3CS2A 3ZJ8A 3BMWA 2QDGA 2VEKA 1TYGA 7TIMA 4IMCA 2XGIA 5C2GA 1D3GA 3USZA 1Q13A 1Q6FA 1XBZA 4NNAA 1BTMA 4ATDA 4ZQRA 1EQPA 4KT2A 3QPEA 2RFGA 3W28A 1A49A 4GIYA 2QAFA 3KXQA 1QJWA 4DBSA 1QO2A 1TR9A 2QJJA 2YA2A 2I14A 1HL8A 3F2BA 2QV4A 1KB3A 1GHSA 2Y4SA 3FHAA 2J79A 3CQKA 1YDNA 2GL5A 3VUPA 2CHOA 3AHYA 5D30A 5HNUA 4S1FA 3MBFA 3DYMA 3WLJA 1W2VA 2C1HA 4UNLA 3DKJA 4ZEPA 2ZIDA 3GO2A 2EG6A 4E2DA 4N6FA 5B7YA 1R30A 4GGBA 3TA6A 1XBXA 3W81A 1LOLA 1B2YA 2HMCA 4IQEA 1Q45A 4IG2A 5FCZA 2EHHA 1HG3A 3T2OA 2MNRA 4O10A 2Y2WA 4UQBA 3H23A 4LV4A 3DOPA 1SJCA 3GS6A 1ONWA 1TVLA 4RE0A 1ZFJA 3PWIA 2R82A 5HMSA 4GUHA 1JYVA 1U1JA 2RDWA 4B90A 3GVVA 4B92A 1T41A 4GQ0A 5I06A 2X16A 1EJ7L 3CC1A 1KQZA 3LLFA 4KFPA 1S2CA 5FI8A 2JE8A 5A8QA 4MFDA 4DQWA 2DVTA 1EEXA 3NIYA 2WBGA 1R8LA 4O57A 3RU6A 2BHUA 4H6KA 1UR0A 3UF9A 5K9XA 3SCPA 3KHJA 1E6SM 3GHTA 4XAZA 3R94A 1ZU8A 3MP4A 3ZLGA 2WVSA 1O60A 1CXIA 2PC4A 3CJPA 2O9PA 1R9XA 3I4KA 2E28A 2JIWA 3W07A 4BCEA 1E73M 5MKGA 2PDNA 3V0SA 3VCCA 3CO4A 2DZWA 1EDQA 3LGGA 3UG8A 4XD4A 1VFUA 3AHVA 3C2FA 2Z2AA 3FK4A 2C1IA 2ZUWA 2PF0A 2Z6JA 3OLIA 4XZLX 3ZM8A 3QLDA 5CAKA 2D20A 2ICSA 1LRTA 1VBJA 2QEZA 1YMYA 2WZIA 2GJRA 4M29A 3MV11 4OOZA 1FWCC 1IHIA 2Z0IA 2V5BA 1IIGA 3GBDA 5PTDA 3QRHA 4IPJA 2DH2A 3U2EA 1IEXA 3SCVA 3IVSA 4ALDA 3W22A 2E9BA 3VNLA 1IZJA 2P0IA 3LMYA 3DBNA 1BRLA 2BOGX 3EA2A 1RP9A 1FCQA 4HPXA 1TJ0A 3WEZA 4Q8PA 2V68A 2E40A 5FJTA 3II1A 4BK9A 1H1ZA 4AD5A 4XTIA 2WM0A 5AZ0A 1UZHA 3O6AA 3UWZA 4Q4SA 5HJYA 1A4LA 4OBTA 3VTRA 3FDGA 3PHAA 3DCPA 3NPWA 2O9OA 2ISSA 4D1IA 1Z44A 2VJXA 3W1XA 3WH8A 2YXGA 4BI6A 2R1LA 4LU0A 3VILA 5C0QA 4IG2B 1Q6RA 4DXXA 4O1FA 1EGMA 4CD4A 3MB9A 2RH9A 3ELFA 1KM0A 4AWUA 3TXZA 3NPVA 1E6QM 2WKLA 1TRDA 2VEIA 3OG2A 3B97A 1VFSA 5TF0A 3PPFA 4IP4A 1Z6KA 4FMVA 4PA8A 4QLKA 4O8AA 5BOOA 4MJZA 1J18A 1XLEA 4OJYA 4W8LA 3QFWA 3W85A 2O0TA 2GK1B 1XH2A 1EJVC 1UUOA 4FOKA 1IGWA 5IXEA 3DAQA 3PWGA 2VZVA 5EFFA 5I6SA 2WZEA 1QNRA 1JI1A 3AJ7A 4Q4OA 3NQBA 4CCEA 2GOKA 4JTKA 3NJ3A 3ITLA 1HT6A 3NL6A 5D9NA 5MHBA 4S3AA 3WNPA 4DEFA 4N0RA 3HOJA 2INZA 4Q4RA 2PDGA 5E6ZA 1JCYA 4WUIA 5ABFA 4WR3A 4NQ1A 5JIPA 3VOHA 4GNVA 2XWDA 3W0KA 4LUSA 2QVHA 4YTQA 2Y70A 1XCFA 4YXGA 1W9DM 1XSKA 4HA4A 4JKLA 4PEKA 1UD3A 1E9IA 5IOBA 4WCJA 2OG9A 1XG3A 3W1RA 1X38A 4UTUA 3RHGA 2OELA 2F38A 3SFKA 2AAMA 2JKPA 3CMJA 2Z00A 2PU1A 3P5YA 2ZXQA 2VC7A 4AX6A 2QF8A 3F4VA 3KUMA 5JQ9A 1QFEA 1RJPA 1SR9A 1S1PA 4IL2A 4OVXA 5DX7A 4RZ5A 5LIXX 4FOJA 5M1TA 5CPQA 4H9YA 1RBOB 2A0NA 4IMEA 2EPHA 3BLOA 4V27A 3NQCA 3W1AA 1MQQA 2P3EA 3F5KA 1EA9C 4C6LA 1AW1A 3EKGA 3W7DA 1ZJAA 2VFHA 3NSMA 4CQAA 3N14A 1TFVA 1DE5A 1SW0A 3KX6A 1OD0A 2BXZA 4DBUA 2IKHA 1THFD 4F0LA 1V6VA 4PZVA 3CWNA 1BTCA 2HSAA 3RU8X 5G1YA 2WLZA 4FP1A 3ZVIA 2VKZG 4B2DA 1MFUA 4PGLA 1C3FA 1HO1A 1XD1A 3Q65A 3OVGA 1G4SA 1CXEA 4YTRA 1E70M 5C7HA 3U7BA 4WDTA 1RVKA 3AI0A 3CZJA 3I4EA 1C8XA 4GQBA 4K8EA 3ZLHA 4FLRA 2WKJA 1XG4A 5H8MA 3BLKA 4G7EB 5I03A 2DSWA 3L5LA 1JNEA 1E6NA 1JDAA 1L6YA 3CU2A 4AVFA 4Z2LA 2WMIA 4JQ2A 4UTIA 3KRBA 3AISA 3NYZA 2E5CA 3EA3A 2WMHA 4JIPA 4I7UA 4I6KA 2QYGA 1OG6A 2V38A 1CXFA 3V75A 2D0GA 3FGCB 2GVYA 2BVDA 1B0IA 1XV8A 5JBDA 1GK8A 4K37A 3BVJA 1MRAA 3AYTA 3G2GA 4YHGA 2YLAA 2J25A 1GNXA 2DV0A 1OX6A 4KWOA 1A47A 5FJOA 1SZFA 3RMJA 1VP5A 4GQRA 5BWAA 1U5HA 2C79A 1JRCA 1ZPTA 4QS6A 1GWJA 3NZRA 3USBA 3IJQA 4KWSA 1UQYA 2EKGA 3UQNA 1E0WA 3W27A 3BTNA 3MC5A 4F2TA 5G2HA 2XU2A 3N18A 2I5QA 1G4EA 4C5YA 4UNKA 1UC5A 5CSUA 2FZ9A 3WL0A 5I3JA 3N3TA 2H6RA 1KBKA 2CKSA 2PDQA 5CLTA 3T2QA 5HPOA 4TXEA 2PODA 3KTXA 3FLUA 4R7OA 2E5BA 3V18A 4C6OA 4XB3A 2FTYA 2FGZA 3JVAA 2J7DA 3KOZA 5DF0A 4HTBA 4ZSUA 1SZRA 3AMCA 4XSLA 3PJXA 5G4WA 4G8TA 3KRSA 1YBQA 2PGFA 3H7VA 2PF8A 3QTPA 2YSWA 1AQMA 2C15A 4Y9AA 3T6CA 1ALDA 2XFRA 4PN2A 2BGQA 1PDYA 3PBVA 3UR5A 2WHJA 2EEXA 3K30A 3MTWA 4ZBCA 2BB0A 2NW0A 1BRLB 4Q22A 4UTLA 1HQTA 3O7UA 3RRAA 5C71A 3SB0A 3ARPA 3GG7A 3W01A 5JXQA 4E3TA 1JCXA 1QCWA 3N1AA 3OEXA 3URQA 3OHIA 2CZDA 4IX2A 1S2UA 1PJ9A 3RX4A 5BXPA 1GYNA 4J27A 4AIUA 4FOUA 4J3VA 4FNUA 2J7GA 1TTIA 4GI6A 5H8UA 4O14A 5CBBA 2Q3RA 5KEZA 3WLQA 5KINA 1GEHA 5I79A 5D9MA 3W74A 6PTDA 1G94A 1KRBC 4HPNA 4E4UA 1AJ2A 4FNPA 1D8WA 2J4GA 4FALA 2WVVB 4YL2A 3B8VA 1DJZA 1DWIM 3CQJA 4EIVA 3QZAA 2OYMA 4GBDA 4NVTA 1C7TA 3BPWA 1RK6A 4GUJA 4L9XA 1J0IA 3A21A 3VYLA 1MMFA 1Y0EA 1TMHA 2UY5A 3UT0A 4OBRA 2WNZA 2RHGA 4H8VA 3CXOA 3TQKA 1UA7A 3LBMA 1VIZA 1D3CA 5XIAA 4PBEA 2DIEA 4XZIA 2QJHA 1TR1A 4GY0A 2HVNA 3D0CA 4L6OA 3DDMA 5ENLA 3WEMA 1H5YA 4HOWA 1D7KA 4RNIA 3GAKA 1K9EA 1OCBA 3L2MA 1ITUA 1FCBA 1JRBA 1VCFA 5C9RA 1ADOA 1WBHA 3E5PA 4J3SA 2WVUA 4D6EA 1ZCOA 1AD4A 3ZQ9A 4GH1A 1TA3A 2CETA 1K9FA 2XH2A 3K8KA 3MSYA 3E6EA 2DSKA 4R5EA 3LNPA 3WLHA 8TIMA 1A5UA 5A3HA 4UBPC 3EWCA 1GOMA 5LIWX 3SAZA 3IJ6A 3WDPP 2Y88A 1A5SA 5H6HA 2QJNA 5JBFA 1NDVA 4HGXA 3IIZA 1CT5A 2GLKA 3V7PA 1XC6A 3W7LA 4TR9A 1VRXA 2BXVA 3QSTA 4UFLA 9CGTA 1HF6A 1LUCB 3BLLA 2DT3A 3OG3A 1S38A 4NP7A 3N34A 3UGVA 2C71A 1TPC1 4CNNA 3EXRA 1BWLA 3VNIA 3FA4A 4KH2A 4KERA 3GXDA 3BAWA 1OY0A 1NDYA 2V69A 3PTDA 4YMZA 4LXFA 1UWQA 1JCTA 2ZE0A 3NM3A 3VDAA 1BGAA 5K4XA 4ZO7A 1VENA 4O0ZA 3W2UA 3LRMA 2XIQA 1I8JA 4PRRA 3K1DA 4AWTA 4W4QA 2W4XA 5FAGA 5C5YA 3ISIX 3TN5A 4S3CA 4JHZA 3PNZA 2XIOA 2O4QA 4DUOA 4BI5A 2O7QA 3B03A 2B7NA 4LCSA 2GSEA 3W7HA 4I9JA 3W86A 3RIKA 1H7NA 2J8TA 1F7BA 1WA3A 1TIMA 1JCMP 1JNDA 5CG7A 1B9ZA 4L1WA 3WMSA 1AQFA 2Y62A 4XZNX 5KTLA 4UTKA 3DG6A 3H6OA 2V2CA 2ZX9A 3VIGA 2QPXA 4KCVA 4XKYB 3VNDA 4Z2IA 1O66A 1U22A 2VEMA 1HL2A 2ZZ4A 1XLLA 2X1TA 2GVJA 3KEHA 4HMNA 4QROA 5DLCA 1L2QA 3T44A 5CLWA 3ZT5A 1K9TA 3GHRA 1CGTA 3EWDA 2V5CA 2J74A 1UR3M 2QCFA 5ABEA 4MG4A 2PB1A 3OZMA 1E1CB 3AROA 2J77A 1W3LA 4PYSA 3N4FA 1M68A 1U2YA 3CIVA 4GXMA 4IGMA 4L61A 3ZJKA 4BHYA 4AD0A 1SW3A 3DENA 4YWSA 1F8MA 5HK4A 3MKVA 3VINA 4C7GA 4F0KA 4ZSTA 3VZZA 2CBVA 3JUGA 3FDKA 1EX5A 2OLAA 3A64A 5GNYA 3VM5A 4DJDC 3W7CA 3G24A 3EOOA 1UR9A 4MWAE 3NXLA 5M2FX 2NXGA 2X42A 1UOKA 3T81A 3W29A 4ORIA 2F2KA 4LFYA 1DJIA 3S83A 1J5SA 3ABRA 1ZUAX 4JN8A 2D2OA 3QV8A 2CKRA 2ZUSA 1SUXA 4KWUA 2QJGA 3WQOA 3NQAA 2G96A 1FA2A 3BV4A 3GNXA 2FDSA 3FNDA 2BS9A 4K7YA 1M01A 2GWNA 2HCVA 2Z1BA 3LYEA 2BHZA 4HZ7A 5AYZA 4MAVA 3Q4DA 4I8YA 4YVVA 1SVDA 1OX4B 1V93A 3CZGA 3LCLA 2Y63A 3WJZA 1XFBA 1WP6A 3IJLA 5I7GA 2P1FA 2FH6A 1XPGA 2YOCA 7PTDA 4LVDA 1ZJHA 4H8NA 1XRTA 3K8LA 5GVJA 1IXOA 1OG0A 1QATA 1H63A 1ZZMA 2YYTA 4O1EA 2TYSA 4HK6A 4FXFA 4RZ6A 3AMKA 3LCIA 4P7OA 4HZ8A 3W87A 2VZUA 3IAQA 4M3PA 1GVSA 3MP3A 5CGQA 2F6KA 4A35A 2POZA 2ZQ0A 1BXCA 4PBFA 7XIMA 1SZNA 1KM2A 2F7FA 1A5AA 5H1WA 5D4YA 3UYIA 2W6RA 2IKIA 5CGMA 1ZP3A 3P82A 5LNWA 3RRXA 4H9XA 1OGSA 2G3MA 3P74A 4H19A 1W3IA 5D37A 4PTWA 2VDIA 2PDCA 5FL1A 2CIPA 1H2JA 2WWDA 4IIEA 3UNTA 3AXKA 4P7QA 3PK7A 1X7FA 3CPGA 3BDKA 4GG9A 4AF0B 1AJ0A 4MB3A 2E67A 2J7CA 1QNVA 3PAJA 1RJQA 5FF4A 4J3XA 4P7NA 1XLHA 4W89A 4TX8A 4JDBA 3HJEA 3M46A 3B3DA 4DM2A 2EPKX 2I57A 2J47A 5H2ZA 4C1NB 4YVXA 1ITCA 3H22A 2NWRA 3MMUA 2OU4A 3STGA 1TPWA 2OYKA 1FWRA 1L6WA 2V3DA 5F1UA 4R53A 3T05A 4TUFA 1Q7MA 2AKMA 2PD9A 3MKKA 2B81A 1O95A 1UCWA 1WAWA 3WUEA 1PYMA 2HQAA 4NJHA 4LWWA 2E25A 1R3QA 3UWVA 1DTUA 3M44A 4FXJA 1VJSA 5CPMA 5A94A 1H50A 2ZBTA 4UOZA 4AD3A 1G7VA 5D09A 1W3NA 4BR1A 4D6JA 2W79A 5JVLA 1R5YA 3WQCA 4FX8A 1V0NA 4ZA0A 4MIMA 1ICQA 4I8DA 5GJMA 2HZGA 4MNMA 4U2YA 4OFCA 2KZHA 2BY0A 1KFBA 2DUZA 3WZ0E 4BA0A 2HVMA 3EWYA 3KE0A 2QW5A 1RVGA 3R8RA 5AVNA 2Y7EA 1KCKA 2G41A 1LUCA 1ML1A 1WUFA 3WEOA 1NWTA 2E6AA 4PSPA 3FYPA 1QPQA 3ABSA 4DIAA 2GGEA 1F2JA 4H9ZA 1O7AA 1PHWA 2PDUA 5RUBA 2YDSA 5C55A 3K46A 3E0FA 3FXGA 3W38A 2DU2A 3L4ZA 2W62A 4N02A 3E0LA 3TJ4A 4JN6A 5FIPA 3QV9A 1JUKA 2ABBA 3UXIA 4PMDA 5FA5A 3W7NA 2ZUVA 3UCQA 3AYRA 4MAZA 1VFTA 4H3DA 2J66A 5CSSA 2HK1A 3HPAA 3NQ6A 2RGMA 1J9YA 4EXQA 1V6YA 3HGRA 3PJTA 4GI4A 5DY2A 4J3UA 1WCGA 2FZMA 3HQOA 4I9AA 3KBWA 3MWAA 1YLVA 4KS0A 5EMYA 1TV8A 3K2GA 3IIOA 3A9BA 4P2VA 4GYFA 3LXAA 4PUMA 3NQ8A 3WMCA 1CB2A 3TW6A 2UBPC 4HPHA 5DBTA 2ZFAA 4GWEA 5LHFA 3ERPA 3DECA 3FKRA 3VPLA 4JNYA 1RSCA 3TTEA 4FIQA 4AD2A 4IGNA 2PFHA 3K4DA 3MUY1 3SGUA 4QFUA 4LRSA 1QUMA 2AGTA 5DMLA 4EPDC 4J7RA 4LYPA 3P3BA 3SRKA 3B9DA 5REQB 1V6TA 1Q6OA 4AUBA 4MNKA 2JKEA 1HJVA 1JAKA 1BVWA 4S3FA 4MY9A 3KW3A 3LG3A 2BX7A 1TV5A 2VFGA 4BJHA 1GW9A 3MUIA 4D6DA 1CLKA 4IGSA 5D32A 4DO6A 2CWXA 2CLEA 3H4WA 3W2KA 2WVVA 3WJYA 2VUNA 4MY1A 1V7YA 3EX1A 3P84A 2BBFA 1SFSA 2BP1A 4KRZA 1DJNA 4H9TA 3NR0A 2FHCA 4Z0JA 4GD0A 4US6A 2VELA 3N2BA 3H4GA 4NXSA 2QPUA 2ZICA 3KZSA 2VDGA 1KM5A 2QDDA 2BHYA 1F8IA 5HQLA 2SFPA 3PTMA 4L1XA 1QPOA 1OSEA 3ABZA 5J8LA 2TRSA 1NAL1 6REQA 1UWAA 2P76A 5HNRA 4A4AA 1EJSC 1HKWA 2CERA 4WRHA 3ZLFA 1S2WA 3DESA 1N8WA 1C9DA 1VHNA 1PKLA 1GPFA 3OA3A 4IUOA 2V30A 2Z1VA 1WDPA 1WO2A 3PUEA 3TV8A 3LZ5A 3VIJA 2Y1HA 1YEYA 3S5SA 1VYRA 4Q8VA 2CFFA 4JTQA 1I75A 3H26A 3RN6A 4WX2A 1EDGA 4WD0A 1WZLA 3S6TA 5DMNA 2OXNA 1YYAA 1E9LA 2D73A 4AWEA 1LL4A 2E9MA 2PMQA 2WWCA 3HJZA 1NOWA 2VRQA 3KCJA 3T8QA 4DZHA 1R47A 2J13A 3WFAA 2WHLA 4RDZA 2O9RA 1YPFA 1EJUC 4FNSA 2PZNA 4ZOAA 1X8FA 1YHTA 4TQTA 5SWUA 2AOSA 4TVUA 2QIWA 3V35A 1GVFA 3AIVA 2ZRUA 5DRCA 3TYAA 4J2MA 1E55A 3D5HA 1DJXA 4XK2A 3W71A 3D3FA 5CC3A 3AFBA 5DMMA 1RCXB 1P4CA 1XUZA 4N9CA 3LTYA 4NIRA 1T99A 1MUWA 1OQFA 3AU6A 2WC7A 1DXEA 4JX4A 4LS0A 3GB6A 1A5CA 2NQJA 2ZKMX 1FWWA 3TDFA 3TEVA 4XTDA 2VI0A 3HMCA 2FZBA 3VM7A 2RDUA 3CUJA 3FX4A 1MDLA 3UPBA 1QTWA 4RK8A 4CGTA 4AZIA 4GY7A 3L65A 1MEHA 1V51A 2ZYFA 4JFTA 3MHGA 1GQKA 1JUBA 4M7SA 5HWNA 2WVTA 4LVBA 3DZ1A 1I2QA 3BAIA 3EDEA 3ITYA 2C6QA 1RXOB 2JIEA 2ZUUA 1Y5WA 1FWNA 4JFVA 4PMXA 1JL8A 3O05A 3GNNA 4QG9A 1Z9AA 3RUBL 1F3TA 1DIOA 4NYYA 4U10A 3RLGA 2OZTA 4CVWA 1FVPA 4ICCX 3S47A 3B40A 4WQ6A 5DFAA 1TPDA 2XYLA 2GWGA 4DZIA 3OVQA 3PZQA 2QR6A 1RY0A 4ATLA 3WH7A 1B90A 1BXNA 4AC7C 1H11A 5DQPA 3CAWA 4HHLA 1XBVA 1Q65A 3TA9A 3AMGA 4C6NA 2IKJA 3BSMA 5I07A 3RO6A 5F2MA 1ISZA 1YPXA 3IV8A 2VP8A 5DRIA 3N13A 3QHNA 4A2RA 5A6LA 1L8PA 1I1WA 9XIMA 1F9CA 3BWWA 4AD4A 1W1PA 3SN1A 1JUEA 2UY3A 4CQ9A 4HQVA 1E72M 1RY8A 1VHCA 2WSQA 3E74A 4NU7A 3VVGA 1RQEA 3C8NA 3MP5A 4GX9A 3GVWA 4K2SA 3QMSA 2DQWA 5AHNA 2ZZ2A 1BYAA 1NDWA 3GNPA 3LRLA 2NVDA 1O6IA 2NQLA 3QFEA 1HKIA 5E0FA 5IFTA 2ZRXA 1W1ZA 2JF7A 4FLSA 4D8LA 1KBBA 3AMLA 4B15A 3VZYA 3G77A 2HTMA 1W3KA 1Z42A 3KVLA 3ITVA 4UTWC 3VGHA 1ITQA 4PRWA 4GZEA 4JOMA 2PWVA 4FLOA 4G6CA 4ZO9A 1SJAA 3WCZA 3GTHA 3QHMA 2WAGA 3FCPA 5EU9A 4B2DD 1HP4A 1LG2A 1YNPA 3QPZA 3NDYA 4O1BA 1HO4A 4CNPA 3N12A 4O4WA 1KFEA 4DWDA 1BQCA 1JZ6A 2Y0FA 1JXJA 1CGXA 3QM3A 5BOEA 1G9HA 4KQNA 2GDQA 3AOFA 1K8XA 1NELA 3GC2A 2EG8A 4DY1A 1KBLA 2VTFA 1DBTA 3G3DA 2TPSA 3HQNA 3H55A 5CSRA 1W1A1 1O5RA 4RDYA 1V5XA 3VIHA 1RQBA 4IMGA 2X0SA 2Y8KA 4Q8WA 5FJJA 3TN6A 1SJBA 4WGHA 1SZEA 2QUVA 2WYSA 4JTFA 4GNJA 1GZJA 3WLIA 2PBGA 2VFEA 1KM6A 2VFDA 4JTAA 3DYPA 4JTTA 1V3MA 2GQ8A 4PC8A 2ESCA 4UQAA 3MMTA 5AZ1A 3GHUA 4MJ2A 3CIWA 3WLRA 1BF6A 3MHFA 1PB0A 1U5VA 3UD6A 5FESA 4H2CA 5HUPA 2HBXA 4HKPA 1SPQA 1OZQA 3DH7A 2Y7FA 2BODX 2VX7A 2ZOXA 4I3GA 5A2CA 3LI1A 2AMGA 3LSCA 4HIBA 3HG2A 1LOSA 4GMEA 4Z08A 5FACA 2E68A 3T0TA 2PDHA 3BOLA 1Z7AA 3M1ZA 4JYFA 4DO5A 3QYQA 3PM6A 3T0BA 1G0CA 4ZGYA 5I24A 3PJUA 4YCOA 1TWSA 4KEMA 4H41A 1EZWA 2BTMA 1RALA 3IGXA 3IWPA 1BAGA 3UWWA 1AJZA 3LRKA 1VPYA 4FR6A 1G7UA 3VNMA 2VM8A 4ZFCA 2YBUA 4Q7IA 4MKNA 4TVDA 3W7PA 5BOFA 2YL5A 3PFRA 4Y6GA 1JXKA 2VXNA 1O4UA 2E5DA 4WF7A 3AXHA 4ECLA 4P7RA 5A8PA 1JAEA 2WV8A 4S3GA 4GY1A 4AIEA 1UKPA 3H2OA 5IDZA 5HUOA 1XKYA 4KF1A 1SO3A 2ODOA 1ZGDA 5HXMA 3GR4A 1UWRA 3QY6A 4UR8A 5TD4A 1E1EA 1FDJA 3KS5A 4P8VA 4LAKA 1CIUA 2AQOA 3CZKA 4NNCA 3WMBA 1RPXA 1E43A 3BE7A 3H2FA 2P5NA 3LMZA 1TB3A 1XLMA 3EKZA 2A3HA 1VJIA 1FRBA 2X0YA 3VKDA 4HK5A 5C6MA 3UW6A 3EPOA 3CL7A 5K7JA 3BZGA 1QI2A 1JZ3A 2QIIA 2A6LA 4H8HA 4L9ZA 3O6CA 1JYNA 3T8LA 1YNYA 4IF2A 1XYMA 2PA6A 3VCRA 3RM8A 5CKSA 3LBCA 2FB2A 2REQB 4E4FA 1JZ8A 4OECA 2ZZ7A 4PMZA 1V3JA 3UZZA 1Q4NX 4PMNA 3W7MA 2J8GA 3QW3A 2QJMA 1XP3A 5T91A 4M82A 5AYYA 2UY4A 3QHOA 2HXUA 4RW3A 3CMGA 3T0DA 4H6QA 4C90A 4MWAD 4DF2A 2E4TA 4A21A 1S3HA 3OHMB 4PUKA 5C9UA 4H00A 3OJGA 5I5RA 5F4XA 2P10A 5J5RA 2OGYA 5LYRA 3NWRA 4UFHA 2D1ZA 3ARYA 2Q01A 3W6MA 3DHUA 3IJIA 4DI9A 2V0TA 2W66A 2X30A 3LLDA 4Q8UA 4LUJA 3QY8A 2PP1A 1RD5A 1BG9A 1TPH1 1W1YA 3STFA 3N6QA 5DY3A 4M5PA 3PG8A 3CPRA 1KFWA 4F9DA 2DIJA 5AC6A 1DJHA 2X7WA 3KBVA 2VCCA 4XZBA 1UMLA 2DY3A 3M16A 4IIGA 2QCMA 1NF0A 3CZLA 3HTWA 4YWIA 2QCEA 3R79A 4NX0A 1AD1A 1S2AA 2OEJA 5E6YA 1T6MA 1CPUA 1A80A 3ZJ7A 3GDTA 3F4CA 5LIUX 1WAUA 3OGVA 1JIBA 1AH3A 3NFUA 3V5FA 3ZSSA 3B0YA 3GFYA 4XD3A 1IQ8A 5FJUA 3OQEA 3K1GA 1DE6A 3NO3A 2RUSA 3A9IA 2WXDM 3ARWA 4ZODA 1PPIA 2PSNA 4R88A 3S1UA 5DMYA 2W61A 3B0UX 3UWEA 4HD5A 3MYPA 2JALA 4XBKA 5TQLA 3TC7A 3V0TA 2NX1A 4C6KA 2XJ7A 3QKZA 4NHVA 3E02A 3Q58A 1KGXA 1KRMA 2RKXA 2HS6A 5K3VA 4W7UA 3WH6A 3SR7A 2GYIA 5J04A 3URAA 2ZRYA 4BEQA 4JFUA 1WDWA 4WHBA 4NJKA 2DZPA 2NQ5A 3HM7A 2FVMA 4JL2A 1M41A 4GO9A 1XX1A 4RPPA 3EX3A 3WF3A 1W9UA 3W24A 3FGCA 1AMKA 2VENA 2PWDA 4GACA 4CU6A 1OM0A 3IEBA 3CB8A 2DH3A 4FK9A 3KRUA 2VEGA 1SFTA 2YFNA 3L68A 4MOZA 4QS5A 1XIHA 2OLHA 4ZB0A 4LTSA 4MJMA 4MWAB 2G97A 4EAMA 3WJWA 4W85A 4PUWA 4OT7A 2QF7A 1E6XM 3FVMA 4HSOA 3C6CA 1U1UA 2YKKA 4NZ3A 3MMWA 3U4FA 3WMLA 3L23A 4HOZA 3TLQA 1D8CA 3WDIA 3QVQA 5M3WA 5DEZA 3CUHA 2DZTA 4HHHA 4MLJA 4MTVA 3T4CA 4W86A 1SGJA 3BK0A 3KVJA 2GDUA 2IPWA 1QHZA 2ANUA 3EZ4A 2A4AA 3S3GA 5BXRA 4X22A 1XJBA 2PTZA 1F74A 4KFOA 3P8IA 2QCDB 3ZO9A 1GVIA 1QWKA 2J7BA 3WD0A 1FOBA 3U4AA 4GVGA 3W72A 1XD0A 4GK8A 1DJYA 2A85A 5GPRA 4LYKA 1FWEC 4IJCA 1XH1A 2PBOA 3S1VA 2XZ7A 2XSXA 1PCKA 1SMAA 2A2IA 1U33A 3GU2A 1W31A 1QNSA 1XI3A 1QOPA 4RV3A 1KXHA 2D2GA 1Q8AA 4UFIA 5AKQA 3TAOA 2YA1A 4DAFA 1VFLA 3WQ8A 6CGTA 1UD6A 4ZOCA 4QP0A 1XFCA 4UR9A 2RDXA 3IGUA 4EPEC 3PP7A 2CZFA 1RH9A 1M9HA 1J6PA 2IQ0A 4HN4A 4UXDA 4LUSB 3P62A 1PKMA 2J8FA 4DJED 3L2IA 3ZT6A 2XH4A 3VUSA 1Q7ZA 4JQ1A 4DZAA 4XBJA 3ZR6A 3AIEA 1IEWA 4XIAA 3DX5A 4ROPA 4Z17A 4INFA 2R6OA 1OYCA 3KOYA 3AO0A 4AHPA 1UHVA 3KBMA 5A6SA 2PGRA 4UR7A 1BSIA 4JTRA 5GQBA 2VVSA 3NYDA 1TWZA 5C9WA 1S5WA 3SCSA 3SJ3A 3MUZ1 4LBUA 1EHAA 1T0OA 4G9PA 2PU0A 1Z69A 1ZBCA 3GTNA 5A8OA 3M5VA 3APGA 1PEZA 3PZUA 1XDLA 1XGZA 2NXHA 1XISA 4DN1A 1XRVA 1TV7A 1Y5XA 2J6XA 3U57A 1J4EA 1PZ0A 4OZOA 1X1OA 2HXTA 4HK7A 4O12A 3O0KA 6TIMA 4DPPA 2OLSA 1ICPA 5TAOA 4XSMA 3LLXA 2QDHA 2CWNA 1TREA 3NQVA 2H3BA 3H2NA 1K8ZA 2YCLA 3UP8A 1GVQA 3SURA 3H2CA 5JUVA 2WSPA 4CNUA 4IIBA 1U1HA 2PTXA 4GBUA 3SIZA 2PWHA 3WKZA 1BKHA 1LG1A 1QXLA 3H24A 3VDCA 1W2PA 1XDJA 3WNKA 1GVEA 4NJJA 1OFOA 3IAPA 3MKCA 3ZOAA 1XF0A 1PYFA 1A3HA 3LM7A 3IV3A 3EXTA 5DT7A 1GGOA 1WXZA 3VNZA 2WCAA 3BW3A 3GUWA 4LNCA 3VNYA 1EBGA 2GQAA 3AMDA 4PCNA 5E0KA 5ECUA 3TNOA 3TC6A 2V3FA 5DT5A 2RDTA 1FDZA 3ALFA 4GVIA 1DOSA 1NOUA 1FCVA 4WSJA 3PUOA 3DHDA 2OSWA 1Q66A 3THDA 1TVPA 1KTNA 1EPXA 1QI3A 3GDRA 3GTIA 3F4DA 4K68A 3W7OA 2ZTKA 1ZY9A 1J0HA 3M5YA 2YYUA 4FZIA 1B4EA 5EPDA 5C7VA 2XFFA 4Q8MA 4GZ7A 5F2IA 4O16A 4JTDA 2EJAA 3RO8A 3FA3A 2UZ9A 3MCNA 3TJIA 4DNHA 1WKDA 4QITA 3CLMA 3SUUA 1WPCA 4RW5A 4AXNA 3LN3A 2OR2A 4C6CA 4M6VA 1AUSL 1KM1A 3BQ6A 4N2YA 5K2ZA 2PD5A 3THCA 2PDWA 2Y8VA 4ONVA 2XFWA 1M53A 1MEIA 3R5EA 5IBXA 2FKPA 1LBFA 3AXMA 3CMFA 1LTDA 3KVKA 3G0XA 1ZCCA 1QPRA 1P0EA 3MDUA 3OOQA 1FHUA 3CNYA 2DEPA 5LGXA 1GYMA 3UXDA 2YL8A 2BVYA 4LSBA 3E12A 4NZ4A 2ZZ6A 4PTMA 1OC6A 1TQXA 5HATA 3ATYA 1IR1A 4EAYA 3UNDA 1R86A 4RE2A 3NSNA 3MQTA 1GQLA 4K7VA 1TV3A 5ABFB 3V1PA 1TE1A 4CU7A 5DCDA 4U4MA 1W32A 3BL3A 1OFBA 5T9CE 5HWMA 3QQWA 3TYEA 1SR0A 3UJEA 3NGFA 3CWOX 1V6XA 3N6HA 3GG8A 4IFKA 4U3CA 1VB9A 5HBFA 3SSJA 1J79A 3MDWA 4IMFA 1KKRA 4QISA 4I90A 2BWGA 3G8EA 2OB3A 3MZNA 2G3FA 1KR0A 4LS2A 2D2HA 3WQWA 7A3HA 1DPMA 3PSWA 1MDRA 2P8CA 3N04A 3OU8A 1S46A 2P8BA 1R3SA 3LOTA 5A2AA 3D6NA 4A8IA 3GYCA 1V8EA 3LK6A 1J0KA 1WKFA 1Q8JA 1YDYA 3FAXA 3RILA 1W9BM 3KHDA 2GQ9A 2AQWA 3S2LA 4CNOA 1W56A 3BAKA 3W1LA 2QGHA 1J93A 1O5QA 2NUWA 3WDRA 1GW1A 1EXPA 4GIRA 3NL5A 4JZ5A 1EZ2A 4N9DA 1QBAA 1EWDA 3E2QA 5BROA 1R2SA 1WBJA 2DVXA 1R9ZA 4ASTA 2E1DA 2V8ZA 3SDOA 3VE9A 3N11A 3M0MA 1JZ7A 4FNRA 1LBLA 1XINA 3HPFA 3UZWA 3FEQA 4OV4A 5E70A 2EKCA 1SSGA 1IXQA 4ZOBA 4TMCA 1I2PA 2H9AA 3WLSA 2EO7A 4YYFA 1EOKA 1AW2A 1EL3A 2OODA 2UY2A 5BMWA 3TFCA 2WMFA 2YL9A 1JD9A 1ONEA 3HV8A 1HVQA 5GNZA 1ZNNA 2GQ3A 4RCXA 2X2GA 3QY7A 4N4QA 5IHRA 2OWWA 3GG0A 4UIOA 2YCEA 3UZXA 1BYCA 2NSOA 3H7RA 3T1GA 3OLEA 2WBKA 4NZ1A 2BASA 1ECEA 1VS1A 4RNJA 5CGTA 3U2ZA 3SEPA 1FP8A 4WLCA 2PZ0A 3WNOA 5JBEA 4AF0A 2I5IA 1GG1A 3FSUA 3UWQA 5AY7A 4FSAA 2P50A 3DI0A 2ISDA 4LOCA 1KO0A 3XIMA 1EIBA 4YJ5A 4AYGA 3IJDA 4B91A 1K7FA 3GBEA 1SSDA 1SJDA 1XXXA 3WLNA 4BKNA 3PZVA 2EQDA 1LL7A 2G50A 4RE3A 1GOWA 4PTNA 3C61A 4TTGA 5AOUA 1ICSA 4JCLA 1UR1A 1IZCA 2NX9A 2QQ6A 3TTQA 2PDBA 4OTKA 3GW3A 1AK5A 4IXXA 3P61A 4FR1A 1AH0A 4GFSA 4RXGA 1AL7A 2OEKA 2WJFA 1CW2A 3CM4A 5L6UA 4M51A 3CZ8A 3OIXA 4GZJA 4GABA 2E6DA 4UCFA 4PODA 5D05A 1LP6A 2TSYA 4Q8QA 1UP2A 1LBMA 4KFNA 4AEEA 1CGUA 1DIDA 1HFBA 1HJUA 4A22A 5FF0A 1G69A 1B3YA 1X6NA 4P7LA 3OPSA 3TONA 2NV1A 3H21A 3LV6A 4PB4A 5LA2A 4U3AA 5CJNA 4PEEA 2WB5A 1SO5A 1PAMA 1REQA 3TMLA 2FVLA 3P8JA 4F9JA 3LTSA 1B30A 4Z1DA 2C14A 2OOGA 4OV9A 1QHPA 3BICA 1NDZA 3T09A 1K77A 2B7OA 2YB4A 1JFXA 2CBUA 4GVFA 3SRFA 2ALRA 3MJYA 2VR2A 1M3UA 3KS6A 3BV7A 3FN9A 2POTA 1XS2A 3FYOA 1WKEA 3HGSA 4YVPA 1XR2A 5IFPA 3SRHA 4GNKB 1HX0A 3AXXA 1VFFA 3MI2A 4JKKA 5CSYA 4R9XA 5D04C 2G5WA 2G0WA 1X8CA 3CO8A 1DWGM 3B0VC 4O50A 6ENLA 1QO5A 1QW7A 1OFDA 3VOCA 3FS2A 2OO6A 3FJ6A 2ACSA 4P8XA 4I5UA 4K39A 2J9ZA 4HU0A 4DWSB 3TNBA 3WQDA 1Z89A 1XICA 3HFTA 4RKAA 1XPYA 2QUUA 3GFZA 3GDLA 4NRSA 3I65A 3WUBA 4PTXA 1NOFA 4M6QA 3NUKA 3O0FA 3A12A 2F84A 1DWFM 3GAYA 3PZOA 3A4JA 4B3ZA 3DFHA 1QDSA 2NVAA 4Q3MA 1V3KA 1VEOA 1KFKA 1N55A 2ABAA 2HROA 1J11A 1FWIC 5AVHA 4QNEA 3BSHA 4IT1A 2W27A 1PX8A 2YLLA 2GDVA 4AXKA 2WZMA 3LI0A 2X09A 1LLWA 3IPWA 1E71M 1DWAM 1PBGA 1NFGA 2V2HA 3HN3A 3VGFA 4FHAA 3CH9A 2R1PA 3TCEA 4GJJA 4RDVA 3IIPA 5LXEA 2IXUA 5CZKA 3QN3A 3QR3A 4YU1A 5HR6A 4E4PA 5EL1A 3AHZA 3OZOA 1J2BA 2ZRVA 3LM3A 4XUYA 2PDXA 3WJXA 2H8XA 5FEZA 2O4MA 4UTWA 2BMBA 1MZRA 3BGGA 2AGKA 2H9AB 4EPKA 5A95A 2GGJA 2WMGA 3HV9A 4HYVA 2E6YA 4P61A 3SBFA 4CEXC 2CPUA 3P80A 3BURA 1EX1A 2DFAA 1FXPA 1CB7B 2GUYA 3NZPA 4MZ8A 1UH3A 4MUPA 4QIUA 4URIA 2WHMA 1BHGA 2QMKA 2ZRWA 2XTKA 4R34A 3ZVHB 2IPJA 4B5TA 5LA0A 4DO4A 2GVEA 2G4FA 3M9YA 2QPSA 4Q7NA 1YE4A 3GR8A 5AHLA 3P0XA 4HBKA 5HA7A 1CDGA 4UMBA 1UBPC 3UR2A 1KLYA 3AC0A 3W2MA 4ZOEA 4DWSD 2ALDA 2ZVRA 3ME3A 1CBGA 1ZS2A 3BCJA 4PB5A 3WDHA 1QOQA 2PCQA 3TR2A 4US5D 3RK8A 3S6OA 5HNNA 3BJTA 4RXFA 3THAA 3GSMA 5ABHA 2J62A 4I5RA 2GVLA 2VGIA 3CUXA 1F73A 1UZ4A 1XIDA 4GINA 4ACZB 4ENLA 3U48A 4QDWA 3L5AA 4KCWA 1BYDA 2HPIA 3LY0A 3B4YA 1J5TA 4FX6M 4QSFA 4C6MA 3P5ZA 2CLOA 3ANUA 3C2VA 4QBXA 2ZTJA 2AKZA 1SMDA 3LGEA 6A3HA 4S2BA 5KSWA 3WNMA 3ARXA 3M41A 3L0KA 3L4WA 3M0LA 1ESWA 1I2NA 1NH6A 3H4XA 3ARTA 1TKKA 4IFKB 4PSRA 3PTQA 4JKMA 3SQSA 3LQLA 2Z1WA 5C54A 3THUA 1KFCA 4A6GA 3QV7A 3E96A 2ISFA 1C90A 3WH5A 2OZ0A 4PCFA 3ITTA 1KTCA 5G2IA 1AZ2A 3S1XA 3AJXA 4C6FA 1V08A 3T08A 4DUWA 1D3HA 2XM2A 1AODA 1JPIA 1EBHA 4WY0A 4BY3A 1SO6A 3W1MA 2Q8LA 4REQB 4G56A 1BWVA 1HJXA 4R7WA 3W9ZA 1QNOA 3MO4A 5FD0A 3BSGA 3OLDA 1S5TA 2Y5EA 1TQJA 5LXXA 4C60A 1VPQA 5CC6A 3GVQA 2XIMA 2PDIA 4IX0A 3SM0A 3WDJA 5I3FA 4OGZA 3W73A 3L12A 1TJRA 3PC0A 4UQCA 1GKPA 3K4AA 2DT2A 4TIMA 2ACUA 3O07A 2R24A 1XYZA 4GYJA 3LHZA 1DQUA 1J0ZA 3GH4A 4JIRA 1TJ2A 4WDUA 3FA5A 4M7TA 4JX6A 1MEWA 4MFEA 4G2DA 3WD3A 1ISXA 2GUBA 4L56A 4GXWA 1R87A 2NZLA 3UPWA 1VJZA 3BG9A 2CLHA 4A8NA 2KAUC 2QCLA 3POHA 3VU2A 1PE1A 4WOZA 1JEZA 3EA1A 4GUGA 4DF1A 2TMDA 4LF2A 4S39A 3QOKA 3CHCA 5C2XA 3VX0A 4O1DA 3HGJA 2C0HA 3M7WA 2W9MA 4AVNA 3VOJA 2ZA1A 2XWEA 1JD7A 3C5QA 3VDGA 4A3UA 3FJNA 3JS3A 3NAVA 3SUTA 3NOYA 3SO7A 3QLLA 3LCFA 2INEA 3DFOA 3S4TA 3NOEA 5DXYA 3EB4A 1FDYA 4HNUA 2V5DA 2NT1A 2BXYA 5LNSA 1BQGA 3QH2A 5EMLA 3OODA 4FAMA 3TWBA 4QAIA 3EOUA 2PGEA 2ZUMA 4MKSA 3RR1A 4HMCA 3HU7A 4EKJA 4PR4A 3TTOA 3WLMA 4NT0A 2WPGA 4DRSA 2VVNA 4UTTC 3W02A 2WHKA 4FIRA 1TZ9A 3WUGA 3OA5A 5BRQA 3CUFA 2Z1XA 2EPMX 3ARUA 4Z1YA 3O2LA 1QBBA 3PBGA 4EXAA 2ZA3A 2WMJA 4H9UA 1PHQA 3UCDA 3CV7A 2HS8A 4AZBA 1VBHA 3ARQA 2ZWYA 3VZXA 4M24A 3MUCA 3PAOA 2CNCA 2H3DA 1NTHA 4F0SA 1Z8AA 1VEPA 4A29A 2ZRZA 1NEYA 4UTMA 5BXTA 4ICNA 5IM51 4ZQPA 1EP1A 4YCPA 3FJLA 3O8AA 3N17A 3WY1A 3EDJA 2DUAA 2GJXA 2QVNA 5BXSA 3LPFA 3CQHA 1W5OA 4W7VA 1NF7A 7CGTA 3ITCA 4XV0A 4KPLA 2OT1A 3KTCA 3NQGA 1H7RA 1VKFA 1QMLA 5BMXA 1PCWA 4X9YA 2AL2A 2XIBA 3UJRA 3UVIA 1RAKA 3M47A 4WXZA 5HJXA 2V81A 4L5ZA 1REQB 2QGYA 2FMNA 2CW6A 2VGBA 1LRQA 4LPCA 4RZ4A 3THQA 2NQZA 1ECQA 2QV5A 3NPXA 4C6DA 4K36A 1KXQA 4HYWA 4ERIA 3AUOA 1RBLA 1XYAA 2OOFA 1BFNA 3P0WA 1P7TB 4I9TA 4JDYA 4O8RA