4ZE5A

Structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 185
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ze5A00
1B30A 3PTKA 1EQPA 3WF0A 4EAMA 5A6KA 1KR0A 4CU7A 1ZBCA 4MB3A 1H49A 4PSPA 1GUVA 1Y7VA 2DH2A 1HP4A 1NWUA 1C93A 4BQ3A 1SR0A 3GM8A 2YL8A 4F79A 3WUGA 5ABHA 1EDQA 4CCCA 4AWEA 4LQ1A 4CN1A 4AMCA 1SMDA 3ZJ7A 3AMKA 4D6CA 4MDOA 1K9EA 3BMWA 2AOSA 3N04A 3VNYA 4D6GA 4L4PA 4D6HA 4ML4A 1KXQA 3EMCA 3BLPX 3ARUA 3WL1A 1JZ6A 3SUUA 3AZTA 1CTNA 1QI0A 3W26A 1HJQA 1OT1A 1HP5A 1R7OA 2D3LA 1BYBA 5DFAA 4W7UA 1FP9A 3VDAA 1UH2A 1B3XA 2YL9A 1E40A 3K4AA 2G41A 2D3NA 3GZAA 4BS0A 4AZCA 1WP6A 4DWSD 2WK2A 4QLKA 1KGWA 1WZLA 1F4HA 1CDGA 4P8WA 5C71A 4PTVA 1HN1A 2A3EA 4IM4A 4PN2A 4JZ5A 1FOBA 3W6MA 4NI3A 2J7DA 4MPKA 2V3GA 2JE8A 1XCWA 1SMAA 2DSVA 3VIKA 3WQVA 3DC0A 5KEZA 1JG9A 3RO8A 1JF5A 4OOUA 3ZJKA 3SCSA 2V3EA 4C7DA 1EDTA 4H7VA 4IPNB 2BNJA 4HA4A 3ARRA 4MDPA 3AS2A 2V3DA 4P7QA 3BAIA 6TAAA 2VX4A 4TX6A 4MB4A 3UR8A 2FHFA 5A3HA 1OSEA 1V3HA 4HA3A 1BVZA 2ZXQA 3HMCA 3WH8A 4OUEA 1C8YA 4OBSA 2CEQA 4FK9A 3SCUA 1W32A 1E4MM 3M6DA 1VEOA 1DWHM 4M80A 3WF1A 2JEPA 3QGVA 4MB5A 2PWGA 1VRXA 1Q6DA 2GSJA 3T2OA 1C90A 3W82A 1FH8A 1GHSA 1C8XA 3CHEA 3IAQA 2WLZA 3CO4A 2EPOA 4MNJA 3ZIZA 1RD6A 1E43A 3A4AA 1PPIA 4BCEA 3LPGA 3WFZA 1KGXA 2OSWA 5I0DA 3AZRA 2OLHA 4PCTA 3WUFA 4D1JA 1MQRA 2EJ1A 4XV0A 2NSXA 1QVBA 1KB3A 2CNCA 2YOCA 2G3NA 1VBUA 4YPJA 1UH4A 2VOTA 1UKTA 2YL6A 1NH6A 1KBBA 3VIPA 2VRQA 1HJXA 2YLAA 1E4IA 1M04A 3JUGA 4WK9A 3AS1A 1L8NA 2BHYA 5I78A 4U33A 3ZJ8A 4HOWA 4JAWA 3O9NA 2G3JA 5I79A 4OZOA 2WWCA 4W86A 4HOXA 5FL0A 3MMDA 1CECA 2W67A 4M82A 1E6RA 5BROA 4YHGA 4P7RA 2PI6A 1JZ4A 2WHMA 2XFFA 3AS0A 2WVVB 4F8XA 2YDQA 3NSNA 1VFFA 3NDZA 4UQAA 3AIRA 2YDRA 1CYGA 4MNKA 1EA9C 1HJWA 4EE9A 2CHNA 1ISXA 1LJYA 1UKPA 1MFUA 1UWRA 3T0AA 4AIOA 3VU2A 3VIFA 3SIMA 1WNOA 3AROA 4CD8A 4AY1A 5CGMA 4GINA 1N82A 2DIEA 3WNNA 1V03A 1DEDA 1UD2A 3LPPA 1WDQA 3HN3A 4ATDA 4ACYA 4JKKA 5CJ5A 5JBEA 4UOZA 3VINA 3BMVA 1MWOA 1QNSA 1B3WA 1V3KA 4LYRA 2CITA 5IFTA 1ISYA 3CZ8A 5IXEA 4PMVA 2VQTA 1BYDA 1J0ZA 3AYSA 1NWSA 1LL6A 4PSRA 2XVKA 1CPUA 1EHNA 2WW5A 8A3HA 4GZIA 1H1NA 1QNOA 2XM1A 2DPEA 3K8KA 4M8UA 4W7WA 2OSYA 4D6JA 4DUXA 1E6ZA 4JFTA 1E15A 2J79A 1UD6A 2VCCA 4CU6A 4Q22A 3QHMA 4PMDA 4MJ2A 1ODZA 2Y8VA 4UFLA 2PBGA 3BH4A 3GXFA 2NW0A 1ZU8A 3WMCA 3II1A 1UQYA 4PBGA 5M17A 4TXEA 1ECEA 4LYPA 1UD3A 4AZIA 3MUIA 1IZKA 2CKSA 4JFVA 3NDYA 1WDPA 2VZSA 3HU7A 3UEQA 1EOKA 2EPLX 5BRPA 1GW1A 1E4NA 4W84A 5M03A 3M7SA 4PUEA 2JIWA 2OWCA 1WKYA 4AZBA 4UNIA 3MU7A 3RPMA 1V6UA 3CHFA 4U2YA 1ISZA 2DSWA 2BVDA 2X09A 1PBGA 3MKKA 5D8WA 4E8DA 2AMGA 1VFUA 4AIUA 4MTVA 1JZ8A 2YDSA 1WZMA 5E0FA 4PRWA 2IUZA 2VT0A 1VEMA 3GH7A 1JDCA 4MJ4A 4CD6A 3AMCA 3GH5A 1SFSA 4KGJA 2WLYA 3VMNA 2VZVA 1UKSA 1H4PA 1XD0A 1CXIA 3GTNA 4W88A 2VZUA 4CCDA 3CMJA 1PZ2A 2WYSA 3FHQA 4OIFA 3CTTA 4AW7A 3VDBA 4GI9A 3A4XA 1E71M 1BYAA 2VX7A 1M01A 2CBJA 4AC1X 1BPLB 1LL4A 2E9BA 3PZVA 4GZJA 4S3KA 1ISVA 3K46A 3WD1A 3W29A 1CGWA 2Y24A 5I5RA 1XSJA 1EO5A 2QHAA 1LQ0A 5DEZA 1V0NA 1XH1A 5IDIA 3OA5A 2VQUA 3SUWA 3FW6A 3WEZA 4TTGA 4PYSA 5A2BA 5A6BD 5FIPA 2EQDA 4J28A 3N13A 1JXJA 3OBAA 5C70A 2XVLA 1MVYA 2W66A 1AMYA 3FXYA 1H5VA 1G9HA 4NF7A 2VX6A 1JDDA 4H04A 1HIZA 1US2A 3WDIA 3W25A 1JAEA 4HZ8A 3AIEA 1R87A 5A1AA 4AZ5A 4KRUA 3L4WA 3FAWA 4WF7A 2X0YA 2XFYA 1K9DA 3VTRA 1V6VA 3PZ9A 4M81A 1ZBWA 1NOWA 3TTSA 3WH7A 2GJXA 1Q6EA 2QF8A 3SUTA 4CN4A 3SUSA 1PEZA 1D7FA 3BAXA 2XWEA 1UD8A 3WDQA 1UR2A 3VGDA 1W9DM 3K1DA 1CLXA 3CMGA 1H2JA 3W6LA 2XGBA 3TA9A 3WD0A 5CSUA 2XSAA 2PC8A 4WJXA 1QNQA 2YA0A 3T0BA 3WD4A 1I1WA 4J3VA 2F2HA 1K9FA 2W91A 1D3CA 4KRTA 4RE2A 2XJ7A 2ZX6A 1VBRA 2X2YA 2JF7A 4W89A 1J12A 3TP4A 2WVVA 2WAGA 2WZEA 4GPNA 4WKHA 1KCLA 3KL5A 2W4XA 1KXVA 2MANA 3CZEA 3ZO9A 1G94A 1JIBA 1IT0A 1SYTA 6CGTA 4D6IA 1QHOA 5CPTA 1J10A 5BYWA 1XSKA 2D2OA 5FCZA 3A47A 2YLLA 1VEPA 3AIUA 1ZJBA 1W3HA 5DT5A 1VJZA 3POHA 1E72M 1E6XM 1PJ9A 4FLQA 4UOJA 2XHYA 4TVCA 1B2YA 3MO4A 3AYRA 1DWFM 4GQRA 4PTMA 2ZX8A 3ZR6A 3WF3A 5CG0A 3ZOAA 1H3GA 2PBOA 3WSUA 2CYGA 1UKOA 1HJVA 1IZJA 4JFWA 2E8YA 2E9MA 3O2LA 1QPKA 4FF5A 4JCLA 4GKLA 3WH9A 3B9AA 4DM1A 4D6FA 1QBBA 2VNCA 2D23A 1E6PA 2FHBA 2GDUA 4QLJA 4W5UA 3GXDA 1RH9A 1I1XA 2CPUA 2BXYA 4AIEA 1WZKA 3TTYA 4AZGA 3AIVA 1HKIA 4GXPA 4V2XA 3WL0A 5ABFB 3WDRA 2ZUUA 3EBVA 1CXEA 1GQKA 3F5JA 5E70A 2D0HA 4U5IA 2VC9A 4H8VA 5ABEA 5F7UA 2WHKA 1ZBKA 1XH0A 3PZIA 3WUBA 4XUYA 5E6ZA 2WHJA 2BHZA 1XC6A 1O6IA 2VRKA 2ZOXA 1MQPA 4HZ7A 4MADA 5EFDA 3MUY1 3IJ8A 2FGLA 5BWFA 4WSKA 5JIWA 1CZ1A 1YQ2A 2XUCA 1OD8A 3WH6A 2XIBA 3PZOA 2XTKA 2OYKA 2BHUA 1O7AA 2G4FA 2W63A 2XGIA 2J8FA 3SCRA 2YBUA 3WELA 2E9LA 3I3BA 2ZXDA 3BCDA 4ATWA 3WKZA 5I77A 1UWTA 5ECUA 1QI3A 1B3YA 1W9PA 5CLWA 1W3JA 3WN6A 5GPRA 4UFIA 3WD2A 2XWDA 2NT0A 1JAKA 2O9OA 3L2MA 2QLYA 3PZGA 1V3MA 4P7OA 4YN5A 1XCXA 1OBAA 3MUZ1 4KMQA 1XYFA 4EKJA 4PMZA 1BHGA 5CSYA 1E1EA 1YHTA 1U2YA 3ZSSA 3LMYA 1HT6A 3S6TA 4AEFA 4C7GA 2ESCA 1CWYA 4AD1A 1TCMA 4LYQA 2J47A 2CBIA 1JI2A 4EANA 2GK1A 3W81A 4QP0A 1DP0A 5HPOA 2BVTA 3UERA 4W7VA 5A2CA 6A3HA 3EYPA 3AIBA 3CUFA 3OLGA 5A94A 1ITCA 3NUKA 2WCGA 2X1IA 1UH3A 2VI0A 3RIKA 2WC3A 2OSXA 2EXOA 1H0IA 3WEOA 1GVIA 3AFBA 1QHZA 3PZNA 5A69A 4AEEA 4Z2GA 4A3HA 1DWIM 4B9YA 4P8VA 3OGSA 5JIPA 4WKAA 3QR3A 4CD5A 2BY2A 3W4RA 1CIUA 3W0KA 1DHKA 2WKGA 3AI0A 3F4VA 1B90A 4PTWA 3N1AA 3CIVA 4WSJA 1GCYA 1JZ3A 4PMUA 1RPKA 1VENA 4B9ZA 2XFRA 2J75A 1CXKA 3PTMA 3AHTA 3CBWA 2GFTA 2WMIA 1G01A 2X8RA 4X0VA 2DQXA 3F5LA 2BVYA 1W9UA 4U3AA 4TX8A 5E09A 2B31A 2Y4SA 3VGEA 1JFHA 1UR0A 4KWUA 3VMPA 2XYLA 3KE0A 1E9LA 3QHNA 2PWEA 3L4VA 2DSUA 3SCPA 3MV11 1KGUA 2J7HA 3ARVA 3WNMA 4A4AA 1VAHA 3CGTA 1BGAA 2ZUMA 1EXPA 4ZFMA 4AISA 4Z2KA 1XRVA 2ZICA 3SEPA 3VIMA 4S3JA 1H0GA 1HVQA 4CKQA 3WY1A 3AJ7A 1ZBVA 3VPLA 1CNVA 5D9PA 4D72A 3NCOA 4GI8A 4PMXA 1C8QA 4F9DA 2V38A 3VDCA 1V3LA 4BZYA 2JFEX 1W1TA 4DM2A 3NSMA 2BY0A 4JCMA 2EBNA 4Q7NA 1JYNA 5EB8A 1HJUA 1ZB5A 2ZUNA 1PX3A 2CESA 1XYZA 4R27A 1WE5A 3UG4A 1E3ZA 4ZXLA 3IK2A 3VIIA 1OIMA 2X0HA 3E1F1 1E73M 1BFNA 2GVYA 3DHUA 2XSBA 3VGHA 1WCGA 4AXNA 3OGVA 1MYRA 4X0NA 1GHRA 2VJXA 2FH8A 1H11A 3N12A 3QOKA 3OLEA 1CGUA 3WNKA 3DYPA 4P8XA 1NOFA 3DYMA 1CGXA 4OBRA 2QMKA 3L4ZA 2YBTA 2VX5A 1E55A 1HVXA 2ZUTA 4A3YA 3VIOA 4PUDA 1X6LA 3CUJA 5KZ6A 1UUQA 1CBGA 2WVTA 3BXWA 1NM9A 5A2AA 3AXIA 3VD4A 4LX4A 4GO8A 3W38A 4J7RA 2ZWYA 3VX0A 3ARZA 1JD9A 2DGAA 4DUWA 1UR4A 1UQZA 1KR1A 4UCFA 1QBAA 3GNOA 2VL4A 3OIHA 4PCSA 3GBDA 5AYBA 3ZT6A 2QPUA 5LYRA 3THDA 4HP5A 1MW1A 4QLLA 4M1RA 5IHRA 4AZHA 2CIPA 4DWSC 4W5ZA 1UYQA 4TTUA 3A4WA 4TVDA 2CCRA 4GO9A 5GQBA 2FHCA 1W3KA 2EPKX 4P8UA 1AQMA 1ZS2A 3K8MA 4U5KA 2DT2A 1GOOA 3VUPA 3POCA 3ZJ6A 4B3LA 3MUAA 3WNPA 4CVWA 2EPMX 1UWUA 2DSKA 3IANA 4XX6A 3GXMA 5FD0A 4PMYA 3VD9A 4GIAA 3K4DA 1QI2A 2WXDM 2A3CA 5GNXA 1TFVA 1XSIA 4JHZA 2ZXBA 1JDAA 3N18A 1GJWA 4J3SA 1UR9A 1BF2A 2DEPA 4UZUA 1UWIA 5D8ZA 1ISWA 1HKKA 2CBVA 3U5YA 1VFMA 3I3DA 2VCAA 1Q6CA 2WB5A 1TVNA 3RJYA 2WSPA 3AQUA 4UOQA 3WIJA 4CD7A 3CUGA 4HU8A 2CBUA 3AIQA 1PZ3A 3VX1A 1W9XA 3GNRA 1K6AA 3W27A 2WHLA 3WENA 2VZOA 4XZWA 2V3FA 1JNEA 3HJEA 1CXLA 2Y5EA 1MXGA 1TA3A 2F61A 5BRQA 3DHPA 5AC5A 5LA1A 1J18A 5I6SA 1V0LA 1XD1A 3SCWA 3QOMA 3EDKA 4ZE4A 2YJQA 1PIFA 1KBKA 4IISA 1UD5A 2YKKA 1J0JA 2GK1B 3RJXA 4ZEPA 4V27A 2W5FA 1UWQA 2GJRA 5BXTA 3SCQA 3G6LA 1EDGA 1M7XA 3ZT7A 1QOXA 4ZXOA 2Y2WA 2VUYA 2WNWA 1GOQA 7CGTA 1DWGM 1VJSA 2OYLA 1MXDA 3B8SA 4AD3A 1QHPA 4HMDA 5D9MA 5CLTA 4M29A 5A6BA 4XZBA 1JI1A 1BGGA 1J0IA 1UKQA 4ZE5A 4PMQA 1V08A 1EQCA 3CZLA 1UR8A 2G8ZA 3RDKA 5EFFA 4NZCA 4E2OA 4JKMA 3TTOA 3AZSA 2A3AA 3AHZA 3OGRA 1GQIA 3WF2A 4BQ4A 2E0PA 2J7BA 3CH9A 5A6JA 2JALA 4FLOA 1EO7A 4HMEA 2WZIA 2DIJA 1BYCA 3VMOA 1FH7A 1WO2A 4F9JA 3SCOA 4MNMA 5CPSA 1JGIA 2O92A 4UZSA 1B3ZA 1BG4A 1CEOA 2OYMA 3ZM8A 4WLCA 2BV9A 1TMQA 3PZMA 2AAAA 4D1IA 1CGTA 2X05A 2XVGA 2ZUVA 3AS3A 4GZEA 4NRRA 1FA2A 2UY4A 2WCAA 1CGYA 3WNLA 4W87A 2C8NA 3ZMRA 1R8LA 1HKMA 3GYCA 1J0YA 3SURA 3PHAA 2PWDA 3VM7A 1HX0A 2QPSA 2YL5A 3ARQA 1JD7A 3SCTA 1TVPA 1WDSA 3OG2A 2TAAA 1B0IA 1UR1A 1CXHA 1OGSA 1QI5A 5HXMA 3ALFA 1OB0A 1QNRA 1FHDA 4AD0A 1R7AA 3BAKA 1I75A 2BXZA 4M24A 1EGZA 1LG1A 3FAXA 5A6SA 1PAMA 4MB1A 3W53A 2YIHA 2FH6A 4NSBA 2WMKA 4J3TA 4F66A 1GQLA 3ZR5A 3VILA 1LLOA 5CPQA 1L0PA 1V6WA 5GNZA 4LPCA 2WMFA 2EO7A 5DF0A 2UY3A 3ARSA 5EMYA 1UA7A 3EDDA 1NWRA 3W37A 3BAJA 3ARPA 3WDPP 3KEHA 1X6NA 1CLVA 3AHXA 4UFMA 3TTQA 2WBKA 3QHOA 1LF1A 1B31A 1KXTA 2J62A 1LWHA 1B1YA 1BG9A 5BXPA 3BC9A 4U31A 2GJPA 1RP8A 4UFKA 1KFWA 1V0KA 1JNDA 1NQ6A 2PWHA 3PZTA 1R85A 3WMSA 4H8HA 3BSHA 1H09A 1GJUA 1OM0A 3PBGA 3KL0A 5A8PA 1VB9A 4UQBA 4CGTA 3MSDA 1E56A 1W3LA 2ZX5A 3T2QA 3D3AA 1KWGA 1KCKA 1LL7A 1GOMA 2Y8KA 5AYIA 2E3ZA 1WB0A 3CPUA 1PX8A 3RM4A 1AQ0A 4CVUA 1E1FA 2J7GA 3WBAA 3AHVA 2IXVA 1QW8A 3AMGA 1RP9A 2WPGA 1LG2A 1BVNP 3RILA 3PN8A 4K68A 3WDJA 4WKFA 1JZ2A 5BCAA 3W24A 4D6DA 3CZJA 4OKDA 4X9YA 1GOKA 3I3EA 5D4YA 3CUHA 5A95A 1PIGA 1HNYA 1F4AA 5M5DA 1CGVA 2WC7A 4AZCB 3AXXA 5I2UA 1V3JA 3A3HA 1QW9A 1FH9A 2WZHA 3WUEA 4PMNA 2WVUA 7A3HA 3CLWA 4AD4A 2WMHA 3U57A 3WQ6A 5C8BB 2VVNA 1WPCA 2YA1A 2J74A 4W8AA 4RE4A 2D0GA 3N17A 4J27A 3AISA 2WCSA 2OWWA 3J7HA 4P7NA 3WF4A 1W1PA 5D9OA 4J3XA 1NP2A 1E6NA 4PTXA 5JBDA 3NJ3A 1JZ7A 1OT2A 4ACZB 1B9ZA 2ZX9A 4B16A 4W93A 3FNDA 1MW2A 2VRJA 1HJSA 3B9DA 5TD4A 3VVGA 3U7VA 1WAWA 1C7SA 7TAAA 2FGZA 4AZ6A 3AIWA 2BY3A 4GQQA 5ABGA 3SUVA 4IPLA 4CD4A 4E8CA 4P7LA 1TG7A 3LPOA 1MQQA 3IJ7A 4HU0A 4W8BA 3OZOA 1GOWA 2HISA 1OCQA 2O9PA 1W9BM 2UY5A 1WZAA 2JIEA 2WMGA 1DWJM 2J25A 3ZQ9A 1V0MA 4JKLA 5LA0A 3VO0A 3APGA 3F5KA 5HNNA 4UR9A 3O6AA 1C7TA 1FHLA 3DYOA 3L4XA 3FY1A 2A3BA 5CGTA 4PEEA 1X1NA 1EIBA 3WH5A 2WC4A 2VVSA 5JBFA 1MW0A 2DSZA 2ZX7A 1S46A 4UFJA 5A8OA 4BQ5A 3GNPA 3WQWA 5I23A 1PX4A 2XVNA 4QAWA 5IFPA 4BF7A 3S2CA 5JUVA 4JL1A 3UG5A 1VFOA 1KQZA 3A6OA 4QFUA 1GORA 2DDXA 3ARWA 2CHOA 2GDVA 2WWDA 3VGGA 4H8UA 2XVPA 4D71A 1Q4NX 3RM8A 1OD0A 3RM9A 1JYWA 4UFHA 5A8MA 5AC4A 2W61A 3VD3A 3OLIA 3BLKA 3BCFA 3MSGA 4TUFA 3VIJA 1TE1A 4UQEA 2XG9A 4NRSA 1U30A 1UA3A 3BAWA 1BLIA 1J0KA 1UWSA 3ARXA 5HDRA 4ACZA 2UWFA 3L2LA 1ODUA 1DTUA 4N0RA 4PMOA 2CXGA 2J78A 3WQ4A 4J3UA 4W8LA 4B15A 4DWSB 3UG3A 5BXRA 4JIEA 3LPFA 5A8QA 4TVUA 1W9VA 2A3HA 2D20A 4PMRA 2VURA 2EEXA 3PTQA 5FKYA 4CU8A 3N15A 4JHOA 2V5CA 4U3CA 3VGBA 5GNYA 3M46A 3OZPA 1QNPA 1ZL1A 1NWTA 1MW3A 2CKRA 1TUXA 3L4UA 4LGXA 1XV8A 1DWAM 4EK7A 1UOKA 3EDFA 5CXPA 3D5HA 1WDRA 1OINA 1E6QM 1US3A 3AOFA 3NYDA 3FN9A 2F8QA 2RGMA 2WBGA 4OOZA 4R5EA 3RMEA 2YA2A 2XM2A 4FMVA 2W92A 4QCFA 2ZE0A 3WDHA 2UY2A 4XB3A 3U5UA 1GONA 2C7FA 1QI4A 2D1ZA 1CXFA 1K9TA 1GNXA 4OJYA 1J01A 2VTFA 9CGTA 3VIHA 4LXFA 3OB8A 1B3VA 2IXUA 2D0FA 3IJ9A 3IAPA 2GJXB 1EOMA 5EBAA 4M56A 4UQCA 2PF0A 1OIFA 1BSIA 1E5JA 3ZT5A 1J9YA 1JXKA 1A47A 1V3IA 5BXSA 4RE3A 5CQ1A 1OGGA 3AHYA 1E0VA 1W2VA 3AMDA 2Z1KA 2WSKA 2J7FA 5FL1A 2VO5A 5E9AA 3T2PA 3WEMA 4HA1A 2D22A 1V6YA 1W1VA 4UQ9A 1ESWA 2DT3A 3EMZA 3MS8A 1NARA 4DWSA 4HOZA 4H41A 4QCEA 3VKKA 4DUVA 4BQ2A 2Q8XA 4CN6A 5DMYA 4HMCA 4MAZA 5ABFA 3VD7A 4MAVA 1C91A 5HBFA 1XGZA 1M53A 1XH2A 4UTFA 1AQHA 5A6LA 3WNOA 1KQYA 1R86A 4Y7EA 4Z2IA 1HXJA 1FFRA 2WANA 3ARYA 4U2ZA 1A3HA 2WM0A 1G5AA 2G3MA 2O9RA 1VIWA 4N42A 1BTCA 3B9EA 3K8LA 3N11A 1FFQA 4YHEA 2ZWZA 5E0CA 3UR7A 3EMQA 4AD2A 2W62A 2E40A 2OWXA 1W1YA 2J4GA 4E4PA 3KWXA 1IV8A 1HF6A 3NIYA 3WD3A 2CETA 3TONA 1M03A 4IUGA 4GI6A 2WKLA 4HTYA 1C3FA 1JYXA 4L4OA 2XIIA 4D6EA 2PB1A 2PWFA 1V6XA 5I3DA 3U7BA 1JYVA 3TOPA 3VM5A 4J3WA 3MMWA 4B3KA 4Z2HA 5A6MA 1H41A 1V02E 3M07A 2DT0A 1JL8A 2FDMA 2VCBA 1GOIA 2V5DA 1U33A 1TA3B 1BQCA 3KL3A 3THCA 3UESA 4JFUA 5A8NA 1KWKA 2BFGA 4KGLA 1Z32X 4FLRA 8CGTA 2J77A 2JEQA 3CUIA 1HKJA 1GZJA 1NOUA 1J0HA 2BS9A 1UG6A 4HPGA 1GQJA 1E70M 3OLDA 4CUCA 2GUYA 2EPNA 4AD5A 2O9TA 3SCNA 2J7CA 3NSXA 2BY1A 3PZUA 3VOCA 4AZ7A 5D9NA 2Z1SA 4UQDA 2ZUWA 3DECA 3PZQA 4TOQA 1ITXA 3CZKA 2D24A 1UD4A 4Z2LA 5HOSA 2NT1A 2C0HA 1TZ7A 4KH2A 4QDMA 3GXIA 2VMFA 3RCNA 1P6WA 3VIGA 3VNZA 3KZSA 3GDBA 3BGAA 1HL9A 3AMLA 3CHDA 4HZ6A 2VZTA 1UZ1A 2QMJA 5LA2A 1ZJAA 3BSGA 2ZXAA 3VGFA 1Q6FA 3WBEA 4FLSA 1XHGA 1J11A 3L4TA 4AYSA 4URIA 1E6SM 1D2KA 4MNLA 1GVYA 1G1YA 1TR1A 5DO8A 2XPKA 3WQ8A 1LWJA 3EDJA 4W85A 4C7FA 4ZENA 1JF6A 3ZSTA 2G3IA 4ATLA 2HVMA 4HPHA 4H2CA 3VD5A 3L4YA 3FHAA 3SCVA 3GH4A 3T08A 2E4TA 2QV4A 4BA0A 1AVAA 2J8GA 1OGBA 1FP8A 1HL8A 1MFVA 3BAYA 2WMJA 1G0CA 5IHSA 3N9KA 1NP0A 3G6MA 3AICA 4WIWA 1W2PA 5CZKA 2JF6A 1C92A 3ALGA 3GBEA 3VDHA 3UCQA 1GPFA 1OWQA 2DT1A 1E0WA 2VR4A 3WMBA 1E5NA 2ZIDA 5M3WA 4JFSA 4CCEA 1EH9A 5A6AA 2ZUSA 3CHCA 1EHAA 2VR5A 2DH3A 3MANA 4JL2A 3UETA 5I24A 3EDEA 1UHVA 1Q6GA 3ECQA 5FOOA 1CENA 4RL3A 2CERA 3T0DA 3MMUA 1E3XA 1BAGA 3ARTA 2E8ZA 1E4LA 1V02A 3CZGA 1E0XA 1VF8A 1W91A 3T09A 3WQ5A 2RGLA 3WFLA 2WMIB 3W28A 2J7EA 1KXHA 3AXHA 4Z2JA 1JZ5A 1UZ4A 4V28A 5AY7A 1JFXA 5HPCA 3MV01 5DT7A 5E6YA 2WVSA
chains in the Genus database with same CATH superfamily
3B4YA 3PTKA 1EQPA 3WF0A 3PM6A 1AA1B 1H49A 4PSPA 5HMFA 1GUVA 1GVEA 1Y7VA 1NWUA 2A6LA 1QASA 1PSCA 5LGZA 5XIMA 1W1IE 1EYWA 4MF4A 4CCCA 1O5KA 1EUNA 3ZJ7A 1A4LA 1TMLA 5ENLA 4JTLA 1FXPA 3VNYA 2CWNA 4L4PA 4D6HA 4ML4A 3EMCA 3WL1A 4HK7A 1FCBA 1QI0A 2VWTA 2WJEA 3VOJA 4ZCWA 4WJEA 2FZ8A 3KCJA 5ECVA 1BYBA 1O66A 5IM51 2YL9A 3P67A 2G41A 1WP6A 3CLMA 4LY4A 5C9XA 1KGWA 3QQ1A 1WZLA 2PAJA 4J40A 4Q8MA 4RK8A 4PN2A 4JZ5A 5F4XA 1PTDA 4UMBA 1PXGA 4WY0A 1VYRA 3ES7A 4MPKA 2ON3A 5DANA 3GIQA 1OCJA 2DSVA 1NJJA 3DC0A 1JG9A 4CQ8A 2NZLA 3COTA 1JF5A 3ZJKA 4QNWA 3LTSA 4FX8A 4AX7A 4H7VA 4IPNB 1SO4A 3ZLFA 1F61A 4DELA 2PZNA 2C3ZA 3AS2A 2NUYA 2V8ZA 3G3MA 9RUBA 3ITXA 4TX6A 2VGIA 2VGBA 1PKYA 2XN1A 3NL5A 2FHFA 3CJPA 3SRHA 2A2IA 4JQ1A 1V3HA 4Z17A 4DZHA 1BVZA 2ZXQA 4S3BA 1E4MM 4DO5A 3P82A 1DWHM 4M80A 3QY8A 1EGMA 4MY9A 3QGVA 3GNNA 2GQ3A 5AECA 4L1XA 3H2FA 1NFBA 1FH8A 4HT3A 4LUTB 3TW6A 2EPOA 1RD6A 5T8GA 4BCEA 1ZALA 4MVAA 1FY6A 3TJIA 1UB3A 3PG8A 3P5ZA 2HZGA 2OLHA 2I5IA 3R0KA 4WY0F 4XV0A 2NSXA 2G3NA 3BZJA 4YPJA 5DMLA 1UH4A 3S47A 1UKTA 3TWBA 5DCDA 1XLEA 3DFSA 4GYFA 3VNIA 1XDLA 3W74A 3JUGA 4WK9A 3AS1A 1L8NA 1VP5A 4Q8QA 3ZJ8A 4HOWA 3O9NA 1YE4A 4W86A 1XUUA 4HD5A 1LYXA 3NOEA 1MEIA 2W67A 5BROA 2F6UA 5HK4A 3W1LA 1GYLA 3WLNA 3BG5A 3VZXA 2P88A 2PI6A 2YXGA 1JZ4A 2WHMA 2XFFA 3AS0A 2YDQA 7ENLA 3N2TA 1VFFA 1J6PA 2BOFX 1TSIA 3QY6A 3JVAA 3VKDA 3AUJA 1UROA 4RZBA 4AAJA 2A7PA 2CHNA 5TNVA 4GE8A 3DH7A 4V1XA 1ZHAA 3O05A 1WNOA 3UXLA 5CGMA 3URNA 3MSRA 3V18A 1NDVA 1V03A 3ZLGA 4GJIA 1UD2A 4AF0B 1NAL1 2OX1A 1O1ZA 1R2RA 3BTNA 4L1WA 3GW3A 4E3VA 1B3WA 2CITA 3UPBA 3SN1A 1P4CA 4JIHA 3CZ8A 4NILA 3HIJA 2VQTA 3AU6A 1YYAA 2Z25A 2RJGA 1NWSA 4GY0A 4QBXA 3P8JA 3E0LA 2HBVA 1H1NA 2HRWA 1MNZA 4D6JA 1EPXA 1W5PA 1XLBA 3MHFA 3PFMA 4S3DA 1LUCB 4DHGA 2Y8VA 3NQ2A 3KCOA 3GXFA 3PUDA 4RPPA 1TPEA 3VCCA 3QLLA 1EL3A 4LYPA 4DJDA 1UD3A 1G7UA 3TC7A 2CKSA 3W73A 1OVDA 1HTIA 2PTWA 3EWWA 1IZCA 1UMYA 1EOKA 2EPLX 1G69A 5BRPA 1XBVA 1I9CB 2A7RA 4IJRA 5M03A 3QYQA 2JIWA 4AZBA 3RPMA 4L4LA 3CHFA 4FX7A 3CK5A 3ID7A 3WJWA 2BVDA 1QPRA 3M0HA 2HXTA 5AHIA 4MTVA 1JZ8A 4U4MA 3DFQA 5H8UA 1MDRA 3RF9A 6ENLA 3QZ6A 4ZTYA 5D04C 2IUZA 3W7RA 3GH7A 3LXBA 3C0LA 4MJ4A 1GVFA 3CV1A 1XUZA 1EUAA 2DUXA 3T1GA 2IPFA 1K77A 3K30A 3DI1A 2QUVA 3VKAA 3JU2A 3FYPA 1SFSA 5HQEA 1N55A 2WLYA 1ZCCA 2VZVA 3VMNA 4O52A 3KOFA 1UKSA 3AO0A 1LBFA 4RDYA 4GVIA 4WQ6A 2J6VA 4MJMA 3C56A 4UWMA 4U10A 3FHQA 1H1YA 2VR2A 1TV7A 3VDBA 1E71M 2VX7A 2CBJA 1K70A 1LL4A 2E9BA 3PZVA 4NXKA 1ISVA 3KOZA 3K46A 1KRCC 4ZBCA 4C6LA 4IPJA 4CQAA 1EO5A 2OTDA 2PU0A 3NFUA 3FJLA 5DEZA 3MMTA 1ITQA 4HU4A 4PYSA 1RR2A 3WJZA 5A6BD 5FIPA 2EQDA 2B81A 1AL7A 4PUUA 1AMYA 5DY3A 3FXYA 1V7YA 2R1LA 1B3OA 4M3PA 1FCQA 1G9HA 5K9CA 2VX6A 2F9RA 1HIZA 2ATMA 4JN7A 3W25A 3PANA 4OE7A 3H4XA 2FB3A 1TX0A 1BKSA 2OJPA 3O3RA 3L4WA 3N6QA 2X0YA 4KKXA 3V35A 1TELA 3SGGA 4M81A 4YWIA 4O15A 3SUSA 1XLJA 1D7FA 2XWEA 3HG5A 1CLXA 4QE5A 2XSAA 2G0WA 4E38A 2PC8A 2HK1A 4G1KA 2YA0A 3WD4A 2HQAA 2AQVA 5EMUA 3U9IA 4MYXA 5DCBA 4IIBA 4JNMA 3W1TA 5G1TA 4RE2A 3HJZA 1FWSA 2XH7A 2JF7A 1BXCA 1J12A 2WVVA 4M7TA 4JBRA 1S5TA 1W1B1 3QV7A 3KL5A 2V2CA 2W4XA 3UJRA 3QPEA 1B4EA 2E77A 1IT0A 1SYTA 3OZYA 4D6IA 4DO7A 2GZXA 1OK4A 4PFHA 5CPTA 1NELA 1GYNA 5BYWA 2D2OA 4K3ZA 4ADUA 2ZDRA 2DZBA 3AIUA 3DC8A 2P76A 3CH0A 1ZJBA 2O4QA 1TZ9A 1E6XM 3MCMA 1ZJIA 2EPHA 3TSBA 1JCLA 1B2YA 4YVPA 3NZRA 3UG8A 3R10A 4NJGA 5CKSA 4ICCX 3WF3A 5K7JA 3ZOAA 1PIIA 2PBOA 3S1XA 2CYGA 2QW5A 1IZJA 4JFWA 2I56A 2YCLA 2E9MA 4WHBA 1ZSXA 1JPIA 4JCLA 3WH9A 4D6FA 2YX0A 2VNCA 2KX9A 4H83A 2FHBA 2ZCGA 3VCRA 1RH9A 4WEVX 2CLLA 2CPUA 1RQEA 4AIEA 3V75A 3TTYA 1P0DA 1HKIA 3WL0A 1IWAA 4AWUA 5ABFB 2Y5SA 4L9ZA 1NU5A 5CGQA 3WK1A 1AJ2A 3LHTA 2FFCA 2NVAA 5ABEA 3NL6A 5F7UA 2DZXA 4KEUA 3PZIA 5C5YA 4FIRA 5E6ZA 4O10A 1I2PA 5AVNA 2VGFA 1F2JA 1XC6A 1O6IA 2VRKA 1QFEA 1MQPA 2PP0A 4MADA 3WLJA 1LP6A 3IJ8A 4QS5A 5BWFA 1EEXA 4WSKA 3TZNA 2JGQA 4CNPA 1Y5XA 3WH6A 3PZOA 1SPQA 3TR2A 2RDTA 2G4FA 5DRCA 1K4GA 2X42A 1YBQA 3WELA 1K8YA 3OW1A 4PGLA 3P7YA 1VYSX 4RR4A 2VDHA 2YCKX 4MKSA 1ML1A 3QMSA 5HJXA 4ATWA 3L0KA 4HU3A 4HA0A 5CZSA 5I77A 1UWTA 2PDFA 3KXQA 4UFIA 1Q5MA 2XWDA 1IWPA 4X9SA 3B0UX 1JAKA 5BOFA 4JQ2A 2QLYA 2VWSA 3PZGA 4Z1DA 4YN5A 4PMZA 3KRSA 4LALA 2PDQA 4IICA 1YHTA 1U2YA 1SZNA 2ASHA 1ICSA 3PC0A 4INFA 5K4ZA 3A23A 4DO4A 3P80A 2OQHA 3LD5A 4AD1A 1SU5A 4LYQA 2J47A 1UR3M 4XBJA 4EANA 4Q7BA 3T7VA 4QP0A 5HPOA 2BVTA 3UERA 6A3HA 4WD0A 3AIBA 3A21A 1D8CA 2WCGA 4F0HA 4UTKA 2VI0A 2OSXA 3QV6A 4NNAA 3AFBA 1QHZA 3W7EA 2FZBA 4IH3A 4B3ZA 4P8VA 3FSUA 3PPGA 3TYDA 4CD5A 2BY2A 4R9OA 3W4RA 4AXKA 3ZXWA 3W0KA 3N1AA 3M9YA 3CIVA 4Q4PA 1JZ3A 4PMUA 4FR6A 1VENA 2EG6A 1FKXA 1CXKA 1JCJA 2Q71A 3C2YA 1UP3A 1G01A 2R1NA 4U3AA 2B31A 3VGEA 1TV3A 1JFHA 4OTKA 2XYLA 2V81A 5AHFA 4EWND 1O60A 1VCFA 3S1VA 2H9AB 4NAFB 3SDOA 1VAHA 3CGTA 2D2HA 4QTGA 3H2OA 3HGSA 2W27A 4TU1A 1HVQA 3KS6A 4CKQA 3WY1A 3EWXA 2I5QA 3CT7A 4YTUA 3P74A 3VPLA 1CNVA 5D9PA 1TJ0A 5CEWA 2FKPA 4IIDA 4XBKA 5A6TC 1C8QA 3VDCA 2VKZG 2QCNA 4IJCA 3G5EA 3I7RA 4KWWA 2NV1A 4DM2A 2ZZ4A 3NYZA 1VYPX 3T81A 3T42A 3TN6A 4LCQA 2ZUNA 4BJHA 1QRQA 2ACSA 4K6AA 1GQNA 1O1HA 1WE5A 1E3ZA 1OIMA 3KW3A 1BFNA 2HS6A 3XISA 3H24A 3LHVA 3ABZA 8XIAA 3GVGA 1CGUA 3VKBA 3QLDA 1VR6A 4J2MA 3QMRA 2PDXA 1NOFA 4OBRA 2C0AA 2QMKA 2X0SA 1H7NA 2ZA3A 1SO6A 5CBIA 3OP2A 4PUDA 1MRQA 2BOGX 1EEPA 2BP1A 4IMCA 3VD4A 1Z8AA 4L1GA 4LX4A 3SY5A 3GVVA 3W38A 1FQ0A 2DY3A 2ZWYA 4DJDC 3UCDA 1K3UA 3BW2A 3H12A 1EX1A 2BOEX 4MLRA 4NASA 4OGZA 4UCFA 3EX2A 1QBAA 5K3VA 4NVTA 2VUNA 3OIHA 4PCSA 3THDA 4PH6A 1PWMA 2YXOA 4GUFA 4M1RA 4RNHA 4RDZA 1TR9A 3VNKA 1E9YB 3K13A 5IHRA 3S5YA 1MDLA 4US6A 2ISSA 3RXZA 4W5ZA 1DJWA 4GO9A 2C14A 3R25A 4NL1A 4P8UA 3E2SA 4C6FA 2X1SA 1GOOA 3ZJ6A 3GC5A 4B3LA 3LXAA 1UWUA 2PDNA 4PMYA 1CB7B 1QI2A 4PTDA 5L6UA 5GNXA 1TFVA 4KCVA 2ZXBA 4M7SA 3SADA 1JDAA 2DEPA 5D8ZA 1ISWA 1HKKA 2CBVA 2CLOA 1VFMA 3I3DA 4ZSUA 1Q6CA 1TVNA 1EZ2A 1TRDA 3RHGA 1AH4A 2INFA 4I6VA 2V0TA 2CBUA 3P14A 1W9XA 3QC3A 1TWSA 4H6KA 3UJEA 3NR0A 3W2NA 4GFIA 3WENA 3P2VA 4G2DA 2ZRZA 2PA6A 1JNEA 3HJEA 1CXLA 1MXGA 1QXLA 3QQ0A 4MZ1A 3DHPA 4F48A 5CC5A 3TLLA 4TV5A 4N9DA 3UYCA 2VEKA 4ZE4A 1SJAA 4LUJA 1SFTA 3BLIA 4IISA 1L6GA 4QDPA 3RJXA 3SCQA 1EDGA 3G24A 1M7XA 3ZT7A 4Q8VA 1QOXA 1LLZA 2V5KA 4ZXOA 2DJXA 4E2VA 3Q58A 3M64A 3KOXA 1XIEA 2VD8A 2I17A 2D73A 1JEZA 3B8SA 4AD3A 3LGEA 1T6MA 4FOUA 5A6BA 5BWAA 1UKQA 4ZE5A 3QRHA 3S2LA 2GDQA 1V08A 4LNYA 3HOJA 4S3CA 5LZLA 3LXCA 3M47A 4FAMA 4KQNA 5EY5A 3KTXA 5FJOA 4AHPA 2PCEA 3GXPA 1PUDA 3V4BA 2OKTA 3K5XA 1YW1A 3VMOA 1FH7A 4OFCA 2QJGA 2FTYA 3GDLA 3TA6A 4F9JA 4PEKA 3MBFA 4H7CA 1BG4A 2BV9A 1CLKA 1CGTA 2QPXA 1W37A 1FA2A 2PDLA 4G8TA 1PZ1A 3GYCA 1YDYA 3PAOA 3VM7A 3PS7A 4KPLA 4Q8PA 1FWBC 2YL5A 5CC7A 3G2GA 3OG2A 2G4JA 1B0IA 4JTHA 2BVWA 5HXMA 3ALFA 2GGIA 2E5DA 1EP3A 6XIAA 4HNTA 3BJSA 3EB3A 3OIXA 1E1CB 2IPGA 3GUWA 5A6SA 3W53A 3KOWA 2FH6A 2WMKA 4F66A 3QEZA 2YW4A 4AUBA 2E68A 3SGUA 2VOMA 5CPQA 1YXDA 5GNZA 4BHYA 2WMFA 1SM9A 2EO7A 1LT8A 3NL3A 4UMAA 5JMUA 3BLOA 1YPXA 3DFOA 1X6NA 3TFCA 3E0FA 3TTQA 3GU9A 1AUSL 4I9TA 1WKDA 4DI9A 2PDUA 4H8NA 1LF1A 1AJ0A 3CO8A 2DUAA 1BG9A 5BXPA 2F38A 4U31A 1RP8A 3GU2A 1V0KA 3SJNA 4GRSA 2X41A 1NQ6A 2PWHA 1R85A 3DUGA 1KW1A 3EPOA 1H09A 4P5UA 1OM0A 5JVLA 5HANA 4K8EA 1TO3A 4CGTA 1RVKA 2Q09A 1E56A 4GGHA 1E0UA 4XZHA 2Y70A 5E1QA 4EPBC 1GOMA 4AX6A 4LS1A 4NAEA 1PX8A 3OVPA 3S9YA 3N19B 5AN7A 4H6RA 1DKWA 3AHVA 1PHQA 4ZGYA 2QV5A 4WZHA 1RP9A 1P6CA 1BVNP 5GVJA 3GTIA 1W54A 3PN8A 2QGYA 5D30A 3QMTA 4X9YA 4O11A 1Q66A 2R24A 5T26A 4POCA 3GSMA 5U7SA 4LT9A 4S1FA 1HNYA 2WC7A 5AHEA 5BZAA 1XLLA 4AZCB 4PRTA 4N02A 1KM6A 1W17A 5HR7A 3A3HA 2WZHA 4FPSA 2JKAA 4B5SA 1PE1A 1KTBA 2YA1A 4WDUA 2CLKA 4J27A 4B5TA 3E2VA 1N8IA 2Z26A 3CYJA 2X1UA 1TWWA 1E6NA 2NQZA 1SVDA 1OT2A 1Q3NA 3LHZA 4W93A 1MI3A 3PBUA 4IXXA 1YE6A 4Q4OA 1VJIA 4PTNA 4RXFA 3BOLA 5EMKA 1WAWA 2FGZA 3QKZA 3HZ3A 4AZ6A 1Z9AA 1IEVA 3PUOA 3AIWA 4IPLA 2C19A 4NX5A 3TCEA 2NSOA 1A53A 3W7OA 4FXRA 1MQQA 4W8BA 4HU0A 3OZOA 2HISA 3SAZA 1Q8AA 2O9PA 1WZAA 2JIEA 4H01A 2J25A 3IGUA 3VO0A 3APGA 3H7VA 3KRZA 2NWRA 1X1NA 4XIMA 1EJUC 2NX9A 1LOSA 4CQ9A 1M9HA 2FMOA 2DSZA 3LCGA 2ZX7A 3S2JA 4IPPA 4E4UA 4BQ5A 3PB0A 2V6AA 4QAWA 4C6KA 3W23A 3UG5A 1ZENA 3DG7A 1UMLA 1G7VA 1Q4NX 1OD0A 1Z69A 3KDOA 4D8AA 1SW3A 1H63A 3W00A 1CW2A 3BLKA 3G8RA 2INZA 1TE1A 2WPBA 2NLYA 3GUGA 2TYSA 3LRMA 1UA3A 2PWUA 1UWSA 3B9OA 3N73A 4DF0A 4ICNA 4PMOA 3ABQA 3INPA 3HPSA 4B15A 4A2RA 4DWSB 3WLKX 5A8QA 3MCNA 4TVUA 2PD5A 4QSHA 5REQA 4PMRA 3Q45A 4K7YA 5AZ0A 1ZUAX 1LOLA 4CU8A 2ZDSA 4EX4A 4JHOA 2V5CA 3VGBA 1NEYA 3LY0A 1J93A 3M46A 5D05A 3DGBA 2ZRYA 4LGXA 2V30A 2ZA2A 3OBKA 5LNWA 3EWZA 4NIRA 1OFPA 3BJTA 3N29A 5CXPA 3LEPA 3Q2DA 4GQ0A 1WDRA 1E6QM 3AOFA 3NYDA 2OLSA 3W22A 4GIRA 2WBGA 2TSYA 4OWGA 2XM2A 2W92A 3W2MA 1S1RA 3LZ5A 4QCFA 1FWCC 3WDHA 1RQBA 2UY2A 4YYFA 3CUZA 1GONA 2ABAA 2D1ZA 1GNXA 4WX2A 5I7GA 4AYGA 4NP7A 1W5OA 4JIIX 9CGTA 1D7KA 3EWBX 2HNEA 1AQFA 3OHMB 4O8AA 4WOQA 3N4AA 2H6RA 4GYPA 2D0FA 1I60A 4LC6A 3IAPA 3B8WA 2GJXB 3IRDA 3SFWA 2R9RA 4GH3A 1IGSA 3OQ8A 3GTXA 3WLHA 1BSIA 5BMWA 3CWOX 3UZWA 1A47A 1OX4B 3SBFA 4JNZA 1DJZA 3FV9A 5BXSA 3P81A 4RE3A 5A8GA 4Q8TA 5CQ1A 3AHYA 1E0VA 5KZDA 4JEQA 2WSKA 2J7FA 2CZFA 5FL1A 4V33A 3T2PA 3WEMA 1FDYA 2F6XA 2D22A 1V6YA 3G3DA 2IKJA 3MO7A 1FWGC 4QS6A 2CWXA 4QCEA 4DUVA 1F07A 4BQ2A 3M0KA 2Q8XA 1GZGA 5DMYA 2VYOA 3XIMA 1C91A 1GK8A 2OGYA 5HBFA 1F6YA 3OOQA 1F76A 2FTPA 2AAMA 3A12A 3QKEA 3R8GA 3QW3A 1A3HA 3VC5A 8RUCA 2O9RA 1VIWA 4I8YA 1BTCA 3W07A 3S83A 4F0MA 1ELSA 2AL1A 2J9XA 3USZA 2OMAA 1W5NA 2CETA 4GI6A 4HTYA 3MI2A 4I9MA 4Q4MA 2B7OA 1IHIA 3NQBA 2HROA 4D6EA 3RYSA 3R8RA 2PWFA 5I3DA 3U7BA 1JYVA 4XAYA 5D37A 2QCEA 2QJIA 5HNUA 6XIMA 3KCLA 2QS8A 4Z2HA 3QJAA 5CBBA 4GHRA 1SJBA 1V02E 4GNJA 3GLCA 2P3EA 2Q8ZA 2FDMA 4MOZA 2V5DA 1OJXA 1KWKA 2V68A 3VNLA 1P7TB 8CGTA 2JEQA 3CUIA 4A2SA 1J0HA 1UG6A 3O6CA 3OLDA 1YTEA 4CUCA 2EPNA 3SCNA 5CBJA 1RQHA 1QK0A 3NSXA 2BY1A 3RG6A 3D6NA 1OHLA 1QO5A 3SECA 2Z1SA 2ZUWA 3DECA 3N6JA 1RHCA 3L5AA 3PZQA 4IQDA 3CZKA 6REQA 4M6QA 2D24A 1JR1A 3TKFA 1OFEA 5HOSA 1YNYA 2C0HA 4QDMA 3F03K 2QQ6A 4FNSA 3W9ZA 1H5YA 1EX5A 3VNZA 3KZSA 4QHRA 3GDBA 4HNCA 2CHRA 1GG0A 2WNNA 4KS0A 3P6LA 3AMLA 3CHDA 3URQA 5MKGA 1UZ1A 2E67A 2ZXAA 3W7GA 4IIHA 1O94A 1XHGA 2ZRUA 1J11A 3UZ5A 3FFSA 3O07A 2E6DA 4PMJA 1D2KA 3LBCA 4MNLA 1XW8A 3LGGA 3V0TA 4UTMA 2WJDA 2ZVIA 1BXBA 1KC7A 3UWYA 4GC4A 1DJQA 2QVHA 4HPHA 1WOAA 4H2CA 3L4YA 3TQVA 3GDTA 4BEUA 2DVUA 4O1DA 1AVAA 4GNVA 1FP8A 1HL8A 3W76A 1WV2A 2WMJA 1G0CA 1AJZA 5IHSA 3LLXA 3N9KA 4MWAA 3W7CA 3S9ZA 2ACRA 2PS2A 1AH0A 3E5PA 3AICA 3VAVA 1KFCA 4ECLA 2WQDA 1S39A 1OADA 4JD4A 3ALGA 4GVGA 1GPFA 2VR4A 3C52A 3BMXA 1EH9A 5C9UA 2Z7GA 1TUFA 1H60A 4WJ8A 4LW7A 2DH3A 2INEA 2NUWA 2QF7A 3UETA 5I24A 3QFEA 1XLIA 2EG8A 1CENA 3GRIA 1HFBA 3MMUA 4R33A 3ARTA 5CZJA 4PFMA 4OHQA 4IFOA 2E8ZA 3CZGA 3IUIA 1RCOB 3EOEA 2RGLA 4UNKA 5J5RA 1O4UA 4L61A 4N2YA 2MUCA 5C54A 3AXHA 2BB0A 4QXIA 4X22A 4V28A 4O8RA 4JTFA 5CPNA 2GQ9A 1B30A 3P0WA 4EAMA 4CU7A 1ZBCA 4MB3A 3NQGA 2DH2A 3GE7A 4AVNA 5CCZA 1HP4A 4RE0A 3H23A 3CAVA 1SR0A 3GM8A 2YL8A 4A05A 2Y89A 1GG1A 5PTDA 2Y7EA 4TQTA 4ZR8A 1X8CA 4LQ1A 4RXGA 2PC4A 3LM3A 3TDFA 3WMLA 1DORA 4MDOA 4F2UA 1KO0A 1K9EA 3BMWA 2AOSA 2H90A 1XG3A 1IE7C 1QOQA 2PZ0A 1NF0A 1PCKA 3I6EA 1Z41A 3CPRA 1JZ6A 3SUUA 3PP7A 1HP5A 3CEUA 2D3LA 3HF3A 1FP9A 1UH2A 1B3XA 1E40A 5EBUA 1QT1A 1XR2A 2D3NA 4QG9A 4AZCA 3V5FA 1QOPA 2WK2A 4QLKA 1G4PA 3IARA 1NF7A 1F4HA 4FOJA 3L65A 3WQPA 5C71A 1FWFC 4PTVA 1HN1A 5C9ZA 1EJVC 3GR4A 2PUZA 3AYTA 1FOBA 1DL3A 4CQCA 1UP2A 2CFFA 3FJNA 1R2TA 2V3GA 4MSSA 3L23A 4ZO8A 3VIKA 5KEZA 2QCHA 4EXQA 3RPTA 4AB4A 3NZPA 2FVLA 1VPYA 1BEUA 4HA4A 3HPZA 4MWAE 3C3NA 5H91A 1A5OC 3RO6A 3FVMA 4E3TA 1T99A 4MDPA 2V3DA 3BAIA 1RCXB 2VGGA 2EJAA 1KKOA 3QXBA 5A3HA 1OSEA 2P8CA 1FWRA 4HN4A 4DZ5A 4MUZA 3HB9A 4HA3A 2JKPA 3PWAA 2BLEA 5DCEA 1P48A 1C8YA 1KTNA 1V8EA 4FK9A 3SCUA 3M6DA 3TYEA 4BY3A 4HB7A 1Q65A 2Q01A 2YDAA 2JEPA 1P0NA 4I7UA 2Y61A 2PWGA 2E1DA 9XIMA 3H22A 4YNGA 3W82A 1RBAA 4UR7A 1GVOA 3FYOA 3GHRA 1C8XA 1NDZA 3CHEA 4HHHA 4Y90A 4MNJA 1E43A 4GI4A 3UU0A 3M5YA 3EX1A 1M6JA 2OSWA 3R13A 3BLEA 4D1JA 2EJ1A 2WOQA 3LOTA 2YOCA 4ZQMA 2CNCA 5C6MA 3TVAA 4IMEA 1GTHA 1F8MA 4ZO9A 1NH6A 3FJ6A 1SO5A 3RX2A 2ZZ2A 1AD4A 2PFHA 4JIQA 4GBDA 3G1XA 5AYXA 3DXIA 3MMDA 2ZRVA 4M82A 1FDZA 1DIDA 4P7RA 1LLWA 1GJPA 2PF8A 3C3UA 2WVVB 2DU2A 7ODCA 3NDZA 2PU1A 3AIRA 3ITCA 1MNSA 4TO8A 2YDRA 2ZKMX 3M16A 1EA9C 4EPEC 4WGHA 4G7EA 2CLPA 5AFDA 4C1KA 1PL9A 1QR7A 3T0AA 1WXZA 4Z08A 3E5BA 4GNKB 3WNNA 2Y0FA 2Q3RA 1TKKA 1DEDA 4ZFCA 2I7GA 3WBXA 4ZQNA 4H4IA 2YYTA 3HN3A 4GYJA 4ACYA 4JKKA 4UOZA 2CU0A 3OG3A 3BMVA 3LCHA 1V3KA 3IJQA 3ZYZA 1ISYA 3VFCA 5IXEA 2QCGA 1BYDA 4GQGA 4J1OA 4KFNA 4PSRA 2GSHA 1CPUA 1EHNA 2OQYA 1XIBA 1XC4A 4GZIA 3K8KA 3SO7A 4KEMA 2BGSA 4EP8C 4GBUA 4JFTA 1UD6A 4UTLA 4DEFA 3QHMA 4PMDA 5C2XA 3A9IA 1ODZA 4XZIA 3E0IA 3MPGA 3E12A 4AY8A 1EJTC 5DLCA 5FF0A 1ZU8A 4NHVA 3WX7A 4F2BA 4ICMA 1TTJA 1UQYA 4XAFA 4G6CA 3AUOA 4GYKA 1QW7A 3M4HA 1AG1O 4JTRA 4ZQRA 2VZSA 3UEQA 1XGEA 1GW1A 3BJFA 1UJQA 1R9YA 2DJLA 2POZA 4UNIA 1V6UA 2OPJA 2EF9A 3EPNA 3LBMA 3KAOA 2DSWA 4DX3A 5TF0A 4AIUA 4NNBA 4YCOA 2NX1A 3LRLA 1WZMA 5E0FA 3BPWA 1JDCA 2FFIA 2NV2A 4CD6A 4ZSTA 5I3GA 3MP5A 4GKTA 2DVTA 4A8IA 3GH5A 4YTSA 3G77A 3IGSA 1KKRA 1Q7QA 2H8XA 1F3TA 3DKJA 2FPVA 2ZZ1A 1RBOB 3FA5A 3B4UA 1I6NA 2PDMA 2WYSA 5LGXA 3DFPA 2ZYFA 4JDYA 1XLFA 3IGXA 4HK5A 3KBVA 4H9MA 3A4XA 1BYAA 1TJRA 2CLFA 2HDJA 3M0LA 4ZO6A 3WD1A 3W29A 1CGWA 1TPC1 3MW7A 2Y24A 4DJED 4IG2B 4BWLC 3GYEA 3WFAA 1AW2A 2HE8A 5IDIA 5FEWA 3DEQA 3FW6A 1X96A 1GVSA 1T40A 5I3HA 4M1BA 3C0JA 2XGZA 5C70A 3W7JA 4C6IA 1H5VA 3GG0A 2XU2A 4ZMGA 4H04A 5GJPA 4LBSA 3UP8A 1US2A 2FZDA 1JGMA 1JAEA 1OY0A 3P5YA 4JR5A 3ES8A 3N2XA 3WLPA 1QPQA 1R87A 1SZFA 4KRUA 3RLVA 2Z0IA 1K9DA 3HM7A 3PZ9A 3ITGA 1Q6EA 2QF8A 4UIOA 4C6BA 1BVWA 3PPFA 2DW7A 3CAKA 1TPDA 5G2HA 3UT0A 3WDQA 1P5BA 4DBSA 3CMGA 1H2JA 3W6LA 2P3ZA 4O13A 1OYBA 1SSGA 3H54A 1XINA 4GX8A 3TZFA 4UBPC 5CSUA 4KERA 3NPUA 1QNQA 1R9XA 3WBWA 4MHBA 1VS1A 3LSBA 3UXIA 3TJLA 2NVCA 2RDWA 2FZNA 2WJZA 4J3VA 4O1EA 3P3BA 4XD4A 4DJEC 1TYGA 1WYIA 3W88A 4KRTA 3G8EA 4UTJA 4LUSB 2ZX6A 1VBRA 4LSBA 2FIQA 3K2GA 3KP1A 1PCWA 3FKKA 2WZEA 5DXXA 1KCLA 1PO9A 2MANA 1W3TA 2JQXA 3ZO9A 3KVMA 4MIMA 3H2AA 5G4EA 4EVZA 3W2JA 1QHOA 3GFZA 4OUIA 1IIGA 1R3TA 1EC7A 1TTQA 1J10A 1C9WA 1XSKA 4Q6JA 2YLLA 1BXNA 3TMQA 3TOYA 1S1PA 3QF0A 1W3HA 3N14A 4LC8A 1E72M 1PJ9A 4UOJA 3LENA 3H6OA 3MJYA 4JTSA 1XYBA 3UA3A 1DWFM 4R9XA 1GGOA 2PRMA 3RK8A 3RITA 3B05A 3S8HA 3CQKA 3WSUA 1I2NA 2E28A 4WRHA 4JYFA 4RUBA 1UC5A 5GJMA 4OQVA 4E2BA 4DM1A 3ZR4A 1QBBA 3ZZ1A 1I1XA 1OF8A 2PTXA 1V77A 4C6EA 4QIUA 2G96A 3PBMA 1C9DA 4GXPA 5FF7A 3WDRA 5DY2A 3WBYA 1CXEA 5E70A 4B90A 4C6CA 2VC9A 4H8VA 3PPHA 1XH0A 4RW3A 1Z89A 2WHJA 3C2RA 2QJNA 5BOEA 2BHZA 3L12A 1XLCA 4R3UA 2ZOXA 1R0MA 5M2FX 1WAUA 4IL2A 3EKZA 2WNQA 3MUY1 4FNRA 4G56A 2FGLA 3CB8A 1JPMA 1BSLA 4DPQA 1CZ1A 1JQXA 2PTZA 1H62A 2XIBA 2BHUA 5AB3A 1O7AA 3TXZA 4YTTA 5AOUA 3H8AA 3UWQA 4AEOA 3L21A 3NQAA 1B9BA 4F4RA 1UP0A 5HJLA 2XIQA 3PFRA 2ZXDA 4IMDA 4H9YA 4X2RA 3AWOA 3WKZA 1NDWA 1EJWC 5ECUA 1QI3A 3G1AA 3ITYA 1LQAA 4LTSA 5EGRA 1XIFA 3NQCA 1F3XA 4S3FA 1OBAA 3MUZ1 4KMQA 4EKJA 1LROA 1EGVA 1K02A 4DUOA 3ZSSA 3A9BA 2NXIA 3LMYA 4LVFA 4AEFA 1UZHA 4LAKA 4J35A 4C7GA 3NEHA 3Q67A 4X2PA 1TCMA 2HV5A 3NZ1A 5H8MA 5I03A 1P0EA 3MQTA 1DP0A 2OVLA 3FDGA 5D09A 3EYPA 5A94A 3OLGA 3FSTA 1THFD 1VFLA 1ITCA 1ZCOA 4RZ6A 3WK2A 1DIKA 3I7QA 3LI1A 3RIKA 2SFPA 5HMDA 3UY8A 2YFOA 3NEVA 5A69A 3ELFA 4AEEA 1D3GA 2I9EA 4GUGA 1WA3A 4LVBA 4B9YA 5MKGB 5JIPA 1WQ5A 3CYVA 1QO2A 4PC8A 3W7IA 3TUUA 5DELA 4QISA 3V5OA 1FWTA 1CIUA 1DHKA 2WKGA 3ABOA 3EA1A 5FEPA 3UGRA 5LXXA 8TIMA 1GCYA 2DFAA 1RPKA 4B9ZA 2C16A 2XFRA 3PTMA 4IUOA 3TN5A 3PTDA 3CBWA 3TLQA 5M1TA 1TV8A 4X0VA 3F5LA 2BVYA 4JYEA 1FCVA 4HPJA 3GTFA 3BK0A 4KWUA 4JY9A 3VMPA 1E9LA 1XM3A 2R1KA 1VCVA 1SFLA 1X7FA 3STEA 5FJPA 2J66A 1BQGA 3UJFA 4PRRA 5JH1A 2ATSA 1BGAA 3B0PA 4AISA 1G4EA 2ZVRA 3EEZA 2FPYA 4S3JA 5F2GA 3EA2A 2EHHA 1H7WA 3G18A 3S1GA 1OEPA 3G1DA 3BURA 2JFEX 4WUIA 1U5VA 1A0EA 3GHSA 1RUSA 3GHTA 3LNPA 4XG1A 2I5GA 3BE7A 4KEVA 3O15A 4MMWA 1XYZA 2P5NA 4O12A 5T91A 3VIIA 3GDRA 2GVYA 3SY8A 5FA5A 5EMLA 3R12A 1FWEC 3EKGA 1GHRA 3KS5A 3OLEA 4YXGA 3DYPA 2XN2A 4P8XA 3SZ8A 3LCLA 1OFQA 3L4ZA 3ONBA 1DJXA 3VIOA 2ZC1A 4HYVA 1X98A 3TK7A 2JK2A 1CBGA 1XKJA 1M3UA 1H61A 3BV7A 2E6YA 4WXYA 1XISA 3GG7A 4MG4A 2PDKA 4I7VA 1JD9A 2DGAA 1UQZA 4Z0SA 3GNOA 3QPZA 3L9CA 3GBDA 3ZT6A 2QPUA 2PEVA 4PUJA 5FF2A 4I9JA 3VYLA 4AZHA 2CIPA 2QUTA 1TX2A 1UYQA 2O56A 3B97A 2Y88A 3LA4A 3A4WA 4W4QA 2C6QA 2CCRA 5GQBA 1VC4A 1W3KA 1VBHA 3C2OA 1ZS2A 1EA0A 4IL0A 2GPTA 4UMCA 3VUPA 3POCA 2REQB 3NQDA 3WNPA 4CVWA 3PAJA 4DQWA 4XX6A 3HURA 1BD0A 4MWAC 5CPOA 2PLMA 3VD9A 2TRSA 1T8XA 2NQ5A 2QNEA 4LEQA 2A3CA 1L8PA 4JHZA 1TB3A 3NL2A 1RPXA 4QNEA 4UZUA 1UWIA 3A5FA 1U22A 2VFIA 3N4EA 2WB5A 2AMXA 4ERGA 3RJYA 2WSPA 4UOQA 2NUXA 4CD7A 3SRFA 4HU8A 4HCLA 3VX1A 3NURA 5I00A 3GNRA 5CG7A 4A21A 2X40A 2VP8A 2BXVA 2WHLA 3ITOA 4O1BA 3AU2A 2Y5EA 2J9YA 2YZRA 2F61A 5AC5A 1J18A 1V0LA 3TN3A 2YJQA 3TJXA 2C13A 3RCMA 2D2JA 1UD5A 2FLIA 2YKKA 3WQGA 3PSVA 4IG2A 3WLSA 1VPXA 4ZEPA 4V27A 3L0NA 1ADSA 3W1MA 2GJRA 3LV6A 2CLEA 3WJYA 3BOXA 7CGTA 2E5CA 3F2DA 1S3HA 5HAOA 1KV5A 4PBEA 2XZ9A 3D46A 5D9MA 5CLTA 2NWSA 4M29A 4X63A 4K38A 1XIMA 2CXEA 1JI1A 1J0IA 4RZ5A 1K7FA 1UR8A 4N4PA 4V15A 3F2CA 3VNMA 5EFFA 4NZCA 4E2OA 3TTOA 3AZSA 4K8GA 3MP4A 1GW9A 1XIDA 2A3AA 5EL1A 2QJJA 2WKJA 2WSQA 2GOKA 3CV2A 2ACUA 2E0PA 3M5XA 5A6JA 2A1YA 3KLLA 3EXSA 4FLOA 1P43A 4HVXA 4EAYA 4N4QA 1WO2A 4ES4A 1T5AA 3SCOA 2G50A 1I0BA 3SR7A 1PYMA 4I9AA 4PUNA 5D32A 3UD6A 1B3ZA 1CEOA 3EB2A 1TMQA 5IRPA 1A5NC 5G4WA 4D1IA 5HULA 2X05A 2HTMA 2XVGA 3F4CA 2Z24A 2QUUA 4RDVA 1FWDC 4GZEA 4NRRA 1XLKA 2WCAA 1CGYA 3WNLA 3STCA 4IJBA 1R8LA 1HKMA 4B2DD 1J2BA 1FDJA 2NQ9A 1HX0A 3W1QA 5D2WA 3QY7A 2Z1VA 1D3HA 1WDSA 1XLGA 4IMFA 6REQB 1L2QA 1CXHA 1FHDA 2O7QA 3BAKA 1L9WA 2BXZA 2HNHA 1EGZA 1ECQA 3GXTA 1LG1A 2JKEA 1PAMA 4MB1A 3E6EA 3U2ZA 4IZGA 4H9XA 3PJXA 2P0OA 3EOLA 4Z0JA 4L9XA 5DF0A 2UY3A 3ARSA 1K8ZA 3W84A 5CPMA 2Q3OA 1LUCA 3BAJA 2P1FA 3ARPA 3KEHA 1I8JA 3BOFA 3AHXA 4UFMA 4AWSA 3NZQA 3KVLA 4XSMA 1KXTA 4LY8A 1LWHA 5L9FA 3CUXA 4E5TA 3BDKA 3VZZA 4O57A 1Z6KA 3KL0A 4K37A 1UZDA 4UQBA 1JUEA 3S2MA 3MSDA 3EEGA 5KITA 4DBDA 5LIWX 4GX9A 3UXKA 1KCKA 4PB5A 3SW6A 5AYIA 2GJLA 4LCSA 3IJ6A 4DRSA 1AQ0A 1P6BA 2OEKA 3VFLA 4CVUA 3WBAA 3UWZA 3AMGA 5FESA 3I7SA 1X1OA 4C6PA 4I5XA 3WYZA 4XVDA 3BG9A 3F4WA 1JZ2A 3GS6A 4TR9A 4D6DA 3RU6A 2WNZA 4C60A 4ROQA 5A95A 1JDFA 1PIGA 2Y8UA 3WQEA 3OJGA 1F4AA 1MO0A 1EYEA 5H1WA 1XLDA 5F2LA 1VFTA 1W3NA 3GFXA 3AXXA 1FWIC 1RLCL 3BLFA 3NQ6A 4AD4A 2WMHA 3LLFA 5C8BB 2PGEA 3JW7A 2D0GA 3OYZA 2AKZA 3N17A 3AISA 3ANYA 2OWWA 3WF4A 4O28A 3GC2A 1ZAHA 1SW0A 4LUIA 3W1AA 2IPWA 1WX0A 3SI9A 3PUEA 5CJNA 1NP2A 4PTXA 3LCXA 2P8BA 1HJSA 3TYUA 2WM1A 2AQOA 5H2ZA 3U7VA 2QEZA 5D33A 4LYKA 7TAAA 2RUSA 3P84A 1VBJA 5F4WA 2BY3A 4GC3A 3ZWSA 3KBWA 2X16A 4P7LA 2PPGA 1Q13A 3HMJG 1RBLA 1GOWA 4F0SA 1OCQA 2QULA 1W9BM 2UY5A 2WMGA 2HE5A 4JKLA 3KTSA 1Q7ZA 2DIKA 1C7TA 1FHLA 3FA4A 4LV9A 1XLAA 1XS2A 4PEEA 1QDSA 3GR7A 1YRRA 4BF5A 5JBFA 5I3FA 3OYXA 4UFJA 4H9TA 3GNPA 5HMSA 3V5CA 4A8NA 5I23A 2PTYA 4ADSA 1IEWA 1O12A 1SZGA 4JL1A 4H9ZA 2Y63A 2OKOA 1X7IA 3BQ6A 4H8UA 2XVPA 4D71A 2OO0A 1BWKA 1JYWA 5T9BG 1MEHA 3OLIA 1AZ1A 4TUFA 3MSGA 4DO6A 5G2WA 3TYZA 3CV6A 3T44A 1U30A 1KM0A 2DZWA 1DTUA 5CZ0A 4N0RA 1KFEA 4C91A 3GVRA 3WQ4A 2P10A 4HCHA 1RZMA 2HVOA 1UIPA 3LPFA 1JDEA 2QAFA 2BZNA 3PTQA 5FKYA 3OBEA 1L6YA 4QJ5B 1XJBA 3T4CA 4U3CA 3S3GA 3FJ4A 2FMNA 1QATA 4C6OA 3T05A 1R5YA 2CKRA 2IKGA 2PGFA 1XV8A 4EK7A 4M19A 3EDFA 3D5HA 4Y9NA 4AQLA 4S3AA 3FLUA 4YMZA 3TYCA 4YTQA 4ERAA 2F8QA 3BLLA 1U5JA 5HUOA 1GVQA 4XB3A 3NQ8A 2GQAA 3IS4A 1LRNA 1J01A 3VIHA 4WR3A 2IXUA 5DBUA 1ZFJA 3VC6A 2P53A 4XWUA 1PV8A 1EOMA 3ATZA 4BR1A 1OIFA 1OZQA 3ZT5A 1JXKA 4O1AA 2AL2A 4JGDA 3MVIA 1RXOB 4JQ4A 1W2VA 2GVJA 3N4FA 1K7XA 3HV8A 1Q2RA 5JU6A 3NXLA 3UWWA 3PR2A 3H2CA 4HA1A 1OCBA 1W1VA 4QJ3B 4WDTA 1PYFA 4UQ9A 1ESWA 2DT3A 1NARA 4HOZA 5U4NA 3R58A 2OO6A 4HKPA 3EWYA 2WZMA 7REQB 4JHMA 3SRKA 3DERA 1EJXC 5LKYA 4GG9A 2Q6ZA 3A13A 4CN6A 4HMCA 1B4KA 5ABFA 3L68A 5G1YA 3VKCA 3C8FA 4UTFA 1AQHA 1KCZA 1KM5A 4FXFA 1OFRA 2OX4A 4DJEA 4Y7EA 4ZA0A 1HXJA 1FFRA 3ARYA 1A3XA 1OZMA 1PS9A 3H21A 3SM0A 3DESA 3O7UA 2QVNA 3N11A 1FFQA 2FDSA 3H55A 2ZWZA 2BMBA 5E0CA 2OWXA 1W1YA 2J4GA 4E4PA 8XIMA 1ME7A 1HF6A 3UR2A 2YYUA 3NIYA 3WD3A 1M03A 1ZLPA 4GUJA 1ZP4A 1C3FA 1JYXA 3M5VA 2XIIA 2ZRWA 4M6VA 1BKHA 1V6XA 3NGJA 4DYKA 2Q8LA 3ITLA 3TOPA 3VM5A 3SSZA 4NJKA 4C6JA 1AZ2A 5A6MA 5JH2A 1H41A 3MB9A 4KWVA 2ZC8A 2NXHA 1A5SA 2HBXA 3OA3A 1DJIA 2XZ7A 3URBA 1TVLA 3G1RA 2VCBA 1KFJA 4PA8A 3L0GA 3THQA 1U33A 1BQCA 3KL3A 3THCA 3QZAA 4KGLA 3ZWTA 2E6FA 1Z32X 5LHFA 1FXQA 3LUTA 4O4WA 1UIOA 3HQNA 3DU0A 4IPIA 2BWGA 3H2MA 4HPGA 2E5BA 4K39A 1GQJA 3ZVIA 1Y8BA 5AYZA 4NZJA 2F6KA 4RKAA 4AD5A 3PZUA 1DOSA 3VOCA 4AZ7A 4UQDA 4DWDA 4H6QA 1ITXA 2V69A 4JTKA 1FHVA 1XQKA 4FP1A 1UD4A 4IFKB 1T8QA 1OG6A 3N3TA 5RUBA 4KH2A 3RCNA 3PWGA 4J3ZA 3VI2A 3WLTA 1MSSA 3AAMA 1Q6FA 1DV7A 3L4TA 4AYSA 1E6SM 1HW6A 1SW7A 2ZA1A 1H7OA 4EXBA 5D2VA 4JIPA 4J9JA 2XPKA 1I45A 2FQIA 1S2TA 1PB0A 4WXZA 1DPMA 4W85A 4C7FA 1JF6A 1XRSA 3HV9A 3ZSTA 3VD5A 4AH7A 3GW0A 3T08A 2E4TA 3BG3A 1ZZMA 3QQWA 1MFVA 1HKVA 1Y5VA 4LRTA 2QJHA 3KRUA 4AWTA 3S5NA 2GGGA 2R1MA 1R3RA 1XL9A 3SQMA 1PZ0A 1C92A 3E9AA 2J27A 1YADA 1Q6LA 3RNDA 4JY8A 4PL1A 4GY7A 3I6RA 3UFYA 1OWQA 3TQ0A 3KVJA 5M3WA 2F2KA 4CCEA 2C1IA 4AVOA 4XKYA 3LG3A 3CHCA 1SJCA 3FA3A 1A0CA 3GB6A 1XIJA 3MANA 3EDEA 1Q6GA 3ECQA 5FOOA 1ONXA 3LB0A 2CERA 4RL3A 1PHWA 1E3XA 1BAGA 2VC7A 1XFBA 3M1ZA 4LBUA 5AC6A 3MA8A 4IGHA 4S3EA 3G1SA 1V02A 2RFGA 1E0XA 1QK2A 4H19A 3ABRA 3T09A 1RK6A 2EKGA 3W28A 4ILSA 4KIEA 4EOUA 1KXHA 1B57A 3OHIA 1JZ5A 1R46A 1UUOA 4L5ZA 1UZ4A 2A21A 1JFXA 3JZEA 3CIWA 1NSJA 5E6YA 2YFNA 3T8QA 2OT1A 1KR0A 1JCYA 1WBJA 2BG5A 3CAWA 4Y8EA 1X8FA 4BQ3A 3WUGA 1EDQA 3DENA 4AWEA 3R0DA 2PP1A 4AMCA 4IQEA 4HPNA 3G1FA 4E0CA 3IV3A 3AMKA 4D6CA 2VFDA 4NG3A 3OODA 3N04A 3BV4A 4D6GA 1YNQA 1OQFA 2AGKA 1KXQA 1IEIA 1U1UA 2J13A 3BLPX 4CNSA 3W26A 4LVDA 1R7OA 3LK6A 3DFHA 4W7UA 3VDAA 3RN6A 3UZZA 3DAQA 4I90A 3GZAA 4BS0A 3S0CA 4OT7A 3LCWA 1IT8A 4D8ZA 3USBA 1CDGA 3R1ZA 4PULA 1QCWA 2A3EA 4IM4A 5C9WA 1A4MA 1TPUA 4QG8A 3DZ1A 4AY7A 3W6MA 1LBLA 3VCNA 1SO3A 4NI3A 1MRAA 4REQB 4O4VA 4UUIA 1V7AA 1XCWA 4GD0A 1SMAA 4Z1YA 2FB2A 4LANA 1Q4WA 4C65A 2R8WA 1KTCA 2WSYA 3ARRA 1WXJA 3EX3A 1K8XA 4RX0A 1IWBA 3KWSA 5LSMA 4DI8A 1JQVA 3GNDA 3MT1A 1EF3A 3WH8A 1W5MA 4OUEA 2O4MA 4NI8A 1QPOA 2DUZA 1KM2A 1XG4A 2I57A 3S1WA 3WF1A 4EPDC 1GYMA 1XIIA 3TEVA 4MB5A 1BWLA 3V36A 2J88A 1VRXA 2FJKA 2GSJA 3GC4A 2PGWA 1C90A 3KLKA 3IIXA 1R3YA 2GUBA 3HQOA 2WLZA 2CZ5A 3CO4A 4L6OA 5EU9A 3A4AA 3B8UA 5LXEA 1PPIA 3TQPA 3EPMA 3WFZA 1KGXA 5I0DA 3AZRA 2Y85A 3WUFA 2NVDA 1MQRA 4LUYA 1GKQA 4LVAA 1QVBA 4J2PA 5B80A 1VBUA 4K8HA 2VOTA 1M7OA 5GJNA 3KX6A 3VIPA 2VENA 1A5LC 4WDWA 2YLAA 1M04A 4LB4A 1DIEA 5I78A 4MFEA 4B5UA 4K1GA 2G3JA 4EIVA 5I79A 2YZ5A 3UJ2A 1IT7A 4P2VA 5FL0A 1CECA 4LBRA 1E6RA 2WQPA 3GO2A 4UTTC 4LU0A 4S23A 3N2MA 3KFTA 4L9YA 4R53A 4UQAA 4JPGA 4Q6XA 1TRIA 1IEXA 4L64A 4FA3A 4O19A 1M65A 3ME3A 4MNKA 1W3IA 1KRAC 3IWPA 4EE9A 3GNXA 4HGXA 4RNJA 4ZODA 4AIOA 1KLYA 3SIMA 4UTWA 1X97A 3AROA 4CD8A 4GINA 1N82A 2DIEA 4FEZA 3M0ZA 5IBXA 2C18A 2R82A 1WDQA 4QJ4B 3LTYA 5XINA 4ATDA 3LYEA 1UW9A 5BNKA 5CJ5A 5JBEA 1I2QA 3VINA 2W6RA 4GYPC 1VKFA 3LCFA 1K1DA 1QNSA 3O16A 2Y1HA 4ZO7A 4YL2A 5IFTA 4N9CA 2A0NA 4PMVA 1L6SA 4HSHA 3I4EA 1J0ZA 3AYSA 1XLMA 4O1CA 1V51A 3U0HA 2NLIA 1KM4A 1A49A 2WW5A 8A3HA 4W7WA 1DQWA 2XM1A 4M8UA 2OSYA 1E6ZA 4BF9A 1E15A 2CLHA 2VCCA 2R14A 4Q22A 1TJPA 1R3SA 4MJ2A 3GZ3A 2XINA 4A3RA 2PBGA 4UTWC 4H3DA 1YX1A 3II1A 1Q6OA 1ECEA 3MUIA 1QWGA 4JFVA 3BWWA 2VHLA 3V1HA 2ISFA 3FX4A 2ZE3A 5A5WA 1XIHA 1GT8A 4JEJA 2OB3A 3AALA 4BKNA 2XFWA 3M7SA 1F5ZA 3MU7A 1XF0A 4U2YA 1F05A 3U4FA 4MUPA 4I7WA 2VEMA 1PBGA 4B92A 3W1RA 1VFUA 5E0KA 3TU9A 2YDSA 2B7PA 3ICJA 5H8PA 1JPKA 4PRWA 3TSDA 2VT0A 1VEMA 1LQ2A 4IX2A 4R88A 3AMCA 2ISVA 5HQMA 1S2UA 4AHOA 1YNPA 5KZMA 2GUUA 3QSRA 3SIZA 4ZB2A 3OVGA 3MKCA 1ZPTA 1XD0A 1YXYA 2CZEA 3NTYA 4IXHA 2DVXA 3GTNA 3GDMA 3W75A 2VZUA 5K2ZA 4CCDA 3HTWA 1PDYA 2XH4A 3BW3A 3CMJA 2WJFA 4DY1A 5KETA 3R89A 3KM8A 1QNVA 3HQ1A 1PZ2A 3UNDA 3NA8A 1I0DA 4AW7A 3REQA 4LOCA 4GI9A 1M01A 4AC1X 4O1FA 4GZJA 4S3KA 2Z2AA 3IJIA 5I5RA 2QHAA 1LQ0A 2VFEA 1V0NA 3PBWA 3FXGA 2Z1BA 3SUWA 3U2CA 3KTCA 2QT3A 3QR1A 3GFYA 3N9SA 3QFWA 1JXJA 5CC3A 6ALDA 1MVYA 4ZOAA 1S3TC 3LERA 1OYAA 4ALDA 1JDDA 3G0UA 2G5WA 4JN6A 4LAZA 3F7JA 2AKMA 4HZ8A 1KFLA 1FUYA 3AIEA 4JTTA 4UXDA 2ZZ3A 4NZFA 3FAWA 4WF7A 2XFYA 3C61A 3VTRA 1V6VA 1HUVA 3KHJA 3TTSA 4HIBA 4PB3A 3SUTA 4CN4A 5DMMA 4CNTA 4GJ1A 3MWAA 3VNDA 1UD8A 3EOUA 4O0KA 3K1DA 1A5MC 2XGBA 3WD0A 1BF6A 2Z6JA 1EBGA 1W1ZA 1QMLA 3V1PA 4WJXA 3S5SA 1QTWA 3U4AA 3CASA 1VRDA 3NPXA 3TR9A 1K9FA 3W71A 1SGJA 3UQNA 2X2YA 4Y9MA 3TP4A 4GK8A 3C4UA 4A6GA 3UZJA 4GPNA 3STFA 4WKHA 3TNOA 1ME9A 1KXVA 3UPWA 1RALA 2PODA 3IIZA 4NZ5A 4JX6A 3CZEA 4YJ5A 5I06A 6CGTA 4KFOA 1PDZA 1UWAA 5FCZA 3PULA 3GX9A 1WXYA 3KVKA 4US5D 4HZMA 1EC9A 3MHUA 4FS9A 3OVRA 4CNOA 3HG3A 4PCNA 1VJZA 5AHLA 2OXNA 4TVCA 3MO4A 2F7FA 1TPB1 3AYRA 4GQRA 2BSLA 4PTMA 5AHMA 2ZX8A 1IQ8A 3R6IA 1F3WA 2ISWA 5CG0A 1R47A 3B0XA 2DZUA 1NFPA 4O14A 4HCDA 5AHNA 1UKOA 1EIXA 4KETA 1QPKA 2VD9A 3DG6A 1QPNA 4FF5A 2R6OA 4GKLA 3R11A 5EA9A 3M0IA 2GDUA 4QLJA 4W5UA 3QGKC 3GXDA 5KINA 1Q8JA 2ISDA 3G0XA 2BXYA 3PNZA 1WZKA 1F73A 5FJIA 4AZGA 3AIVA 3H7RA 3IIVA 4V2XA 4S2BA 1GQKA 4HHPA 3C6CA 4HN8A 4G7EB 2D0HA 2OLAA 4LUSA 4MLJA 2WHKA 4RZ4A 2B0MA 3WUBA 4XUYA 1SJDA 1BRLB 2OZ8A 3ZLHA 1RJQA 1HO1A 4K2SA 4YTRA 1KM3A 1G4SA 5EFDA 2QCFA 5CSSA 4FB7A 4IGSA 3C86A 1YQ2A 4ZZ9A 2XUCA 2R94A 3P8IA 4AFYA 4S38A 1GTEA 3HBLA 3SCRA 3XINA 5MHBA 3C2EA 4HTBA 4XAPA 3AXKA 2UZ9A 3I3BA 1XPYA 5K4XA 4GGBA 4KIRA 5EMMA 4JTEA 1H7XA 1MZHA 1UC4A 3TNBA 3N2OA 1B3YA 4HYWA 1W9PA 1W3JA 5GPRA 4NJJA 3QV8A 4MFDA 2NT0A 4IMGA 2O9OA 5BW6A 3L2MA 1V3MA 4P7OA 1XICA 3SSJA 1XYFA 1BHGA 5CSYA 1P0KA 4HSOA 3JS3A 2QKFA 3T07A 1MUWA 4RW5A 3D0CA 1HT6A 1S2VA 1V6TA 1LWIA 1FHUA 3MY9A 1CWYA 3O1NA 3APYA 4UTHA 4XK2A 2CBIA 1ONEA 1S5WA 3E3HA 2TODA 2GK1A 1DVJA 4ZOBA 4UTTA 5A2CA 2O7SA 3CUFA 2X1IA 3WLIA 4CCZA 1H1ZA 2EXOA 1H0IA 4HNVA 1GVIA 3LSCA 4IOTA 1Q2SA 2ZBTA 4Z2GA 4Q33A 1DWIM 5B7ZA 4TMBA 1N7KA 1XQLA 4YCPA 4WKAA 5D2XA 3QR3A 1TREA 3W3OA 1P1XA 3AI0A 3F4VA 3PJWA 1B90A 4PTWA 5IBXC 1FWNA 3DBNA 4FIQA 1FKWA 4YWSA 2J75A 1FWWA 1CI1A 4ZQPA 2GFTA 2PDYA 3DHFA 1S2AA 1O68A 4LF2A 2X8RA 5H6HA 3VA8A 1HGWA 5FJRA 3WQDA 1W9UA 4J4KA 4TX8A 5E09A 2Y4SA 3WLOA 4YIWA 1UR0A 2X2GA 1XI3A 3KE0A 2PWEA 3L4VA 2DSUA 3SCPA 3W7DA 2GOUA 2Z27A 4LAUA 2J7HA 3OU8A 1SZEA 2D69A 3WNMA 3VKJA 2E25A 3NO3A 3QV9A 3URAA 4O0QA 1XRVA 2ZICA 3SEPA 4DJFD 3VIMA 1L6FA 4GA8A 4BK9A 1ME8A 4DN1A 3AJ7A 3M6YA 1I4NA 4Q32A 4PMXA 4HSNA 1RD5A 3LQGA 4NT0A 2PLCA 1W1TA 1VPQA 1M1BA 2GGHA 3NPVA 3NSMA 2BY0A 4M6UA 4JCMA 4GUIA 4Q4KA 1QU4A 5EB8A 1JUKA 4Q8WA 4DYJA 1PX3A 1EWEA 1K6WA 4AHQA 3EKLA 4I5RA 4ZXLA 3QM3A 4O16A 3IK2A 2QUNA 3E1F1 3QTGA 3DHUA 3EX4A 4XQ6A 2XSBA 3VGHA 4AXNA 5CPLA 3OGVA 3S9IA 1RAKA 2FH8A 3QOKA 3WNKA 1IYXA 3LHUA 3UA4A 1AMKA 2VFHA 3NG3A 1CGXA 3AXMA 3UW6A 1XWYA 1HGYA 4BI5A 2VX5A 4C6MA 1E55A 1IXPA 4LCRA 4E8GA 3CUJA 4GH1A 1LZOA 2AL2B 3PBVA 3BXWA 3AXIA 3BVJA 4HBKA 4GO8A 4J7RA 5J5DA 4JYDA 3NVTA 2IQ0A 5DX7A 1UR4A 2PDHA 3W01A 1SSDA 2NQHA 3DOPA 4S39A 1Q6RA 3HGOA 3R79A 2GJNA 4HNOA 2QCLA 4QJ1A 3TAKA 2BTMA 4HP5A 1MW1A 4QLLA 3CWHA 3STPA 2A7NA 3N2BA 3VABA 4DWSC 1ZP3A 4B5WA 4ZL1A 4TTUA 3UGVA 4F0KA 4YU1A 4CEXC 4TVDA 5LIYX 1TE6A 2OR2A 7PTDA 1AQMA 4U5KA 3K8MA 2DT2A 3MUAA 3EXRA 3RX4A 2C91A 3A22A 2EPMX 1EWDA 3IIPA 2Y62A 3U2EA 3IANA 3GXMA 1NDYA 4MGGA 1HZYA 1TJ1A 2WXDM 4CQBA 1ADOA 4RLIA 4OBTA 3B8DA