4ZE5A

Structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 185
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ze5A00
2NSXA 2O9PA 2O9TA 1OD8A 1OWQA 1W3JA 2A3AA 3SUTA 4U5IA 3GXMA 1EHAA 1VEMA 1B3VA 1O6IA 2FH6A 4D6DA 1J10A 1EIBA 4W7WA 1JZ2A 5I3DA 3AIUA 1DWHM 4UOQA 3VVGA 5D9NA 1H2JA 5ECUA 4QLKA 3MMUA 2DT0A 2YOCA 4B9ZA 4IPLA 2WW5A 2G8ZA 1QW9A 3VM7A 4P8VA 1B1YA 1MW2A 2BNJA 1BGAA 1ZL1A 1VJZA 1CXEA 3DYMA 1FH7A 3L4YA 3MUY1 1U33A 1UWIA 3CZ8A 1E40A 2VR5A 4ZXLA 3N13A 3B9DA 3K8MA 3UG3A 4F8XA 2G3MA 1CECA 2O92A 3DYPA 2WC3A 3OGRA 3VTRA 2D0FA 1RD6A 3QOKA 4M80A 2X8RA 3SUUA 1Q6GA 3FNDA 3ZR5A 3WUEA 3UG4A 3ZSSA 2WHLA 1ZBWA 2WXDM 1PZ2A 4M56A 5A2BA 2ZX6A 4PMYA 4CD5A 4CUCA 4D71A 1ZBCA 3VIJA 3BSGA 4AWEA 2FH8A 4PMUA 1OGSA 2PB1A 3U7BA 1EXPA 5FL1A 6CGTA 2J78A 4CCEA 1BF2A 2VR4A 3ZJ8A 4H7VA 4HZ7A 3U5YA 2V3GA 2J7EA 3WEOA 3N11A 1HP5A 4N0RA 3RILA 2YBUA 4B3KA 1JYNA 4V2XA 1W9BM 2JIWA 2WAGA 1MFUA 1B3WA 3QGVA 4J3TA 1TG7A 3WIJA 3WSUA 4DWSB 3NYDA 2XYLA 4J3SA 1UH3A 2E8ZA 4ZE5A 1UH2A 4Z2GA 2EPNA 1UR4A 3WFZA 2WMIB 1E1EA 3UETA 4V28A 3ZT7A 1H41A 2WMJA 4RL3A 4NZCA 1QI5A 1ZU8A 4H2CA 3WDIA 5FCZA 1WZAA 3PHAA 3AQUA 1IZJA 2EJ1A 4QP0A 4S3JA 5I23A 4YHEA 5LYRA 2ZX7A 1Q6EA 3FAXA 3FW6A 2XGIA 1EOMA 2VX5A 2VUYA 2YL8A 3L2MA 1AQHA 3WBEA 1C8XA 4BQ3A 1C90A 4F9DA 1EDGA 1GHSA 4J3UA 1CGYA 1UWRA 1HKMA 3WF4A 3F4VA 3K46A 2GJRA 1QNOA 4URIA 2JFEX 2ZX8A 4TXEA 1CXHA 3AMKA 3DYOA 4CU8A 1V3KA 2YLAA 5A2AA 3WQWA 6TAAA 3ZMRA 4MNMA 4JCLA 4PSRA 3RPMA 5CGTA 5GNYA 5FD0A 1GVIA 1UR8A 3IJ7A 1UWTA 3MV11 5I78A 2HISA 1HKIA 3AISA 3WH9A 1E6NA 4F79A 1V6XA 2GDUA 4U31A 3CUFA 2XM1A 1J9YA 1SYTA 1WDQA 2DDXA 2X0YA 1OCQA 1YHTA 5GQBA 1H49A 3W53A 2WHKA 2Z1KA 3S2CA 5LA2A 1Y7VA 1BPLB 1D3CA 1XH2A 2W5FA 1KFWA 1M7XA 1BG9A 3W28A 5E0CA 3TTYA 3VNZA 2ZWYA 2ZUMA 4ACYA 1EA9C 1NWSA 1JNEA 4NRSA 1G9HA 1ZBVA 3NJ3A 2CITA 4W5ZA 5IHRA 3WDHA 2OYMA 3VDAA 3VD9A 3W25A 3VDCA 1E71M 1HJXA 4PCSA 1UD2A 4BS0A 1HVQA 3ALGA 3PZ9A 1NH6A 4UQ9A 4OIFA 3N12A 3DECA 3QOMA 4OUEA 3PZOA 1JAEA 2D23A 1WZKA 5D9PA 3A47A 3PZUA 4U2YA 1PJ9A 3AIBA 2QLYA 2EPLX 4HZ6A 1DP0A 1QI3A 4WIWA 3AHXA 3VU2A 1R8LA 2DSKA 3CZEA 4PTWA 5JBEA 1Q6DA 4HA1A 3VIPA 5I5RA 4CU6A 2EPKX 3L4ZA 3DHUA 2X1IA 4AYSA 2J7GA 4AZ7A 1G5AA 1QI0A 3ARTA 2F2HA 4W86A 3HMCA 4PUDA 4NI3A 1KBBA 1KXQA 3CHDA 3U7VA 3PZMA 2ZXAA 1BYBA 1BYAA 1MXGA 1UYQA 2ZOXA 1FP9A 3KWXA 4ACZA 3ECQA 1H0IA 4GO9A 4CCCA 1ZBKA 3AICA 1I1XA 5D8ZA 4PMVA 1CGTA 3WQ6A 3KE0A 5BXTA 3UERA 3SCVA 3FHQA 3ZT6A 1CBGA 1ISXA 1GUVA 3RMEA 2IXUA 1C92A 4MTVA 1CENA 2BHUA 1CGWA 5CPSA 1VAHA 1KCKA 4ZFMA 1N82A 3D5HA 1V6WA 3POHA 3AFBA 5BXRA 2EPOA 5M5DA 1G94A 1US3A 3B8SA 1E6PA 2PWHA 4JHZA 2C0HA 3CUIA 2EEXA 2E0PA 1X6LA 1V03A 2DT1A 1LJYA 1WAWA 2J8FA 3F5JA 1UHVA 2PWFA 4H8UA 3DC0A 2E9MA 2YIHA 2XUCA 5CG0A 3BAKA 3VGGA 4E8DA 2IUZA 3WY1A 1JFHA 3ARXA 3EDEA 2D3NA 1WKYA 3QR3A 4Q7NA 1PZ3A 2XG9A 3VD5A 2OYLA 4X9YA 5BRPA 2F8QA 1NM9A 1TA3B 2YDSA 4CVUA 4KRUA 1DWIM 2WK2A 3CZJA 4UFLA 4W5UA 3ZJ6A 1V6UA 1LWHA 1ISZA 4HPGA 1UD8A 2WVSA 4S3KA 1KGWA 3WEZA 4DUWA 1HJVA 1UZ4A 5A6JA 2G3JA 1BFNA 2VCCA 1G1YA 3SCTA 1EDTA 4FF5A 4D72A 2A3HA 4Z2HA 2CBUA 2WYSA 2PC8A 3AYSA 2A3EA 4PSPA 4PMZA 2YA1A 1XYZA 1KQYA 2VRKA 3CIVA 4N42A 1XV8A 3RJYA 5DF0A 3SIMA 4TVCA 3QHNA 3OIHA 1WP6A 1BTCA 4U5KA 4AZ5A 7A3HA 2XIIA 4WSJA 1MW3A 1UKTA 4PTVA 4JAWA 2WVVA 3BCFA 2WZHA 4F9JA 1KGUA 1KWGA 1GPFA 3VIFA 4AW7A 2GK1A 2CHNA 1NQ6A 4JKMA 3VIIA 4BF7A 1QHPA 5A6KA 2BXZA 2VOTA 4DWSD 1L8NA 3AHYA 3WD2A 4J27A 2XPKA 2Y24A 4TX6A 3ARSA 2O9OA 2WPGA 4H8VA 2DH2A 3A4XA 1BHGA 1GOOA 3GDBA 2VVSA 1H3GA 1OBAA 5CSUA 1DWAM 2W62A 2ZXDA 4P7LA 2J7CA 2VVNA 3ARZA 2XWEA 1HJWA 1V02A 5GNXA 5C8BB 3GZAA 5ABGA 2QF8A 3ARYA 2J75A 3T2OA 5IXEA 3VX0A 3UG5A 2WMGA 1M04A 2YBTA 1Q6FA 1W1PA 4WK9A 4EK7A 1W3HA 4AZBA 1W9PA 2J77A 2V38A 3VIGA 1QHZA 1ITCA 2BVDA 2JEPA 5BYWA 3KL3A 1ZS2A 2XFYA 1NOWA 1K9EA 2WM0A 3ZIZA 2RGLA 2VX4A 3D3AA 3WD4A 1E0VA 1GW1A 2BS9A 1HNYA 5I79A 4HOXA 3WQVA 1UQZA 4M24A 1MWOA 5CLTA 3VIHA 3W37A 1J01A 2V5CA 3BMWA 2DSUA 2ZICA 2D2OA 2A3CA 1LL4A 3AMDA 1EQPA 1B3XA 3WDPP 4CVWA 3WH7A 1E73M 4YN5A 1PPIA 5BCAA 3PZQA 3VPLA 1U2YA 1GOMA 1I75A 1JF6A 3OLDA 1UD3A 2DEPA 4QCEA 2QMKA 1QHOA 1EHNA 4AISA 3I3BA 1LG1A 4GQQA 4EAMA 1J0JA 3GNPA 1XH0A 3LMYA 2UY3A 3NDZA 1R87A 1ZJAA 5D8WA 4P7OA 3VUPA 2W66A 4IUGA 4AD4A 4HMDA 3TA9A 1XHGA 3L4UA 4NF7A 5A6BD 4ATLA 1V0NA 3BAXA 3K4DA 3GH4A 3O2LA 4HPHA 2Y8VA 2JE8A 3NCOA 4NSBA 3MMDA 4UCFA 1NARA 4CU7A 2YL6A 2QHAA 2J7DA 1R85A 3W82A 2J4GA 1PIFA 1KGXA 1DTUA 3CUHA 5E6ZA 4IPNB 3CUGA 4GI9A 3B9EA 2ZUSA 1VRXA 1E6SM 1BQCA 3B9AA 3OLIA 3PZVA 3T2QA 4AZCA 2VTFA 2XWDA 1W9UA 6A3HA 4W8BA 4PMQA 3FN9A 2WWCA 5A8OA 5CQ1A 5M17A 4GINA 4B3LA 3RO8A 1KXTA 1M01A 4UZSA 4AZHA 2O9RA 4D1IA 4UOZA 2WHJA 2ZX5A 3AS1A 4AD2A 2BV9A 3MSGA 4PMXA 4JFUA 3W6MA 4MB1A 1UWUA 1JD7A 2D0GA 2WCAA 3K1DA 4AY1A 3LPOA 5BRQA 3VD7A 1XH1A 4D6HA 2WCSA 1UQYA 4AMCA 3MUIA 4JCMA 5JUVA 2VC9A 1I1WA 3BLKA 3T09A 2YDRA 1UWQA 2OLHA 1PX4A 2GJPA 3QHOA 1W3KA 1UR0A 4OJYA 1H11A 1EOKA 3GNOA 3AZSA 1NWRA 3EDDA 1H0GA 2JEQA 2XJ7A 4P8WA 2CKSA 2E4TA 4R27A 4Y7EA 1CTNA 5AC5A 1J18A 1K9TA 4LYRA 5HPCA 1SMDA 3OB8A 1EO5A 1BGGA 2CHOA 3SCOA 3M07A 5KEZA 1TCMA 4MB4A 3CGTA 2ZIDA 3GH7A 3MS8A 1VEPA 2PF0A 1GOIA 2WVUA 1JDDA 4C7DA 1FH8A 5E9AA 4R5EA 3G6MA 1H4PA 3F5LA 3VGFA 3GTNA 1ISVA 1UOKA 5GPRA 4Z2JA 1V08A 1D2KA 1GQJA 4FLQA 2WKLA 4Z2KA 1V0KA 1JNDA 4TX8A 2CESA 1ODUA 4H04A 4LYQA 3L4TA 4WKFA 2WNWA 1HJUA 3MV01 4W93A 4HMEA 1JZ6A 1KR0A 3UCQA 1EH9A 3W26A 2BY0A 1CGUA 2VZUA 2C7FA 3CZGA 4AXNA 1WB0A 4M8UA 1PIGA 3WF1A 1K9FA 2WC4A 4KH2A 3CPUA 3W6LA 4PMNA 3WNPA 3WDQA 4RE2A 4PMDA 3BLPX 4IM4A 3TTQA 1B0IA 1FFQA 2X09A 1BSIA 1E5NA 3PBGA 4DM2A 2TAAA 1W91A 1B3ZA 3N04A 1QNPA 3CHEA 4P7NA 4D6FA 2WANA 4JL2A 2OSYA 1HJSA 4OOUA 2FGLA 5FIPA 1NP2A 3SCNA 1K6AA 3VOCA 1A3HA 2XVLA 2RGMA 1E55A 3WNKA 4DWSC 1SMAA 3S6TA 3OLGA 3HN3A 1WPCA 1HXJA 2CERA 4UQCA 2D3LA 3ARVA 1FFRA 1VBUA 2FHFA 2GJXB 2DGAA 4D6IA 2YL5A 4MNLA 2X2YA 1TVPA 3M7SA 5DEZA 1ODZA 2WMHA 2EO7A 1UKSA 3N17A 1G01A 3II1A 4PTMA 4W84A 4M29A 2BHYA 4HA4A 1W9VA 3PTQA 4JKLA 1HL8A 1JAKA 4D6EA 3M46A 1W9XA 2BXYA 5GNZA 1KXVA 5FKYA 1OIMA 3GM8A 3ZR6A 5BXSA 1GNXA 5E70A 1C3FA 4A3HA 1P6WA 4OKDA 1V6YA 5A1AA 1JD9A 3HJEA 4J3VA 4BQ4A 1VB9A 4AIEA 1W32A 2W92A 3MUAA 4JFSA 1DHKA 1JZ8A 1FP8A 1AMYA 4P7RA 3WD1A 4D6JA 4LXFA 2EQDA 3WMCA 1CXIA 4MNJA 3A6OA 3AHTA 2VNCA 5I24A 1ISYA 4JIEA 3BGAA 1MXDA 3CBWA 1Q4NX 1HT6A 5A8PA 3PZNA 3WKZA 1GOKA 1JIBA 4PEEA 2GUYA 2PWDA 1QBBA 5E09A 1V6VA 3T08A 5BXPA 4UNIA 3BC9A 3SCWA 1QW8A 4UQAA 4KWUA 2ZXBA 2VX7A 2E8YA 2EXOA 5JBFA 4KGJA 4UFIA 1GZJA 2J7HA 4CN6A 4UQEA 2UY5A 5DMYA 2J74A 3BXWA 1FH9A 2B31A 2WBGA 2F61A 2DT2A 3CHCA 3WNMA 1E6ZA 1HL9A 4XV0A 2C8NA 4K68A 2CKRA 1B31A 2FHBA 3THDA 1X1NA 1DEDA 5CPTA 1GCYA 4X0VA 4JFVA 1TR1A 1HKKA 1W9DM 3IANA 4M1RA 3WMSA 3W4RA 2AAAA 4ATWA 4DUVA 5HPOA 1QNRA 2QMJA 1V02E 4GZIA 2E9BA 2GVYA 5A6BA 2AMGA 2J7FA 2VL4A 5I0DA 1IZKA 1AQ0A 1XSJA 5CXPA 1W1VA 3WUFA 4OOZA 2VCAA 1KR1A 3RDKA 3LPFA 3ZJ7A 2CXGA 2XFFA 1AVAA 3VIOA 5JIWA 3L4XA 1LL7A 2EBNA 3L4WA 4TOQA 2G3NA 3MKKA 3OZOA 4YPJA 1J0ZA 3WD0A 1E9LA 1MQRA 4AZ6A 2QPUA 3MU7A 3L2LA 3EDJA 3VINA 4AC1X 1GJUA 3W38A 5KZ6A 1LL6A 4AD1A 4LGXA 5A2CA 3ZJKA 5CZKA 2CBIA 4U3CA 4AD5A 1CIUA 3CUJA 1J12A 2J7BA 3AZTA 4BZYA 4GXPA 1GJWA 1V3HA 5C71A 1C91A 3WH5A 1U30A 1B30A 4QAWA 1VENA 3WDJA 4GZEA 5DT5A 2VT0A 3VDHA 4HA3A 1UKPA 2UY4A 4M82A 5HOSA 1WCGA 1GQIA 4WJXA 3U57A 3WDRA 1UH4A 1GVYA 5BROA 1RH9A 1OSEA 2CNCA 5A6MA 1IT0A 4HOWA 1MYRA 2UY2A 4UFJA 3G6LA 4UQBA 1QOXA 2WB5A 1ECEA 1TVNA 1VIWA 5I77A 4QDMA 2GDVA 1FOBA 4WKAA 5A3HA 3OG2A 2YA2A 2YDQA 1E0WA 2VO5A 2WSKA 5AC4A 4GI8A 5A6AA 2DSWA 3QHMA 3SUWA 3AXXA 4WKHA 3AI0A 4GKLA 3BAJA 3BAWA 3GBDA 1FA2A 1TE1A 2FDMA 2VZVA 1CGXA 3CTTA 4FLSA 1QNSA 2VJXA 4MJ2A 3RJXA 3CLWA 3VX1A 4PUEA 3CZLA 4ZE4A 3WBAA 2OSWA 4CKQA 2XIBA 3EMCA 5ABFB 1JG9A 3RM9A 4CD6A 3VGHA 2OWXA 1BVNP 5CPQA 4M81A 3NIYA 3W29A 2D24A 1KCLA 3A4WA 2V3DA 2ZUVA 2XGBA 1E4IA 3PTMA 1W1YA 1XD1A 8CGTA 2GSJA 3JUGA 3VM5A 1E5JA 1JZ3A 4MAVA 3FY1A 3UEQA 1OM0A 3PTKA 4CN1A 1R7AA 4AD0A 4E2OA 1XYFA 2VQTA 3ARUA 3AS2A 3AHZA 1GQLA 3W0KA 1QI2A 4CD4A 4D6GA 1KXHA 1VFFA 2WZEA 1BLIA 2WMKA 1V0MA 1UA3A 5DFAA 1XCXA 3AIEA 1H5VA 5C70A 1W2PA 3VD4A 4HU8A 5HBFA 2VCBA 1R86A 2OSXA 9CGTA 1A47A 1B9ZA 2V3EA 4F66A 3ARRA 3AIVA 3VKKA 3VMOA 1RPKA 1RP8A 4MPKA 2W4XA 1CGVA 1DWFM 3WQ5A 1CXFA 3MUZ1 3VIMA 4V27A 1V3JA 1C7SA 1MQPA 3WELA 3VMNA 3SCQA 1HJQA 2ZUWA 1VJSA 4C7GA 3PZTA 1DWGM 5D9MA 1MFVA 4PRWA 1PEZA 4XX6A 2VMFA 1V3MA 1OT1A 4AIOA 3FAWA 3AOFA 1OB0A 2WMFA 2ZUUA 4GO8A 3VGDA 3THCA 1JI1A 4QFUA 3WENA 3AIWA 3GXDA 2OYKA 2XVGA 4AEEA 1OINA 2WCGA 2WVTA 3N15A 3LPGA 4EE9A 1PX3A 3WEMA 1HVXA 2ZE0A 2YJQA 3K8LA 4LYPA 1JZ4A 2XSBA 3BCDA 2XTKA 3AMGA 3WNNA 4NRRA 4WLCA 3SUVA 2YKKA 7CGTA 5A6LA 3KL0A 1EO7A 2D22A 1UUQA 3GBEA 1FHDA 1JF5A 1GHRA 3T0BA 4GQRA 3AIRA 2BY2A 1WDPA 4UFHA 4MB3A 3TP4A 1UR2A 2ZUNA 1CNVA 1ITXA 3E1F1 1E1FA 1XD0A 3PN8A 4HOZA 4Z2IA 4PCTA 3HU7A 1CZ1A 3GXFA 5IDIA 4HZ8A 4GIAA 1TFVA 2J62A 1EQCA 2JIEA 2G41A 1VF8A 2QV4A 1E4MM 3OA5A 2QPSA 3WNOA 4QLJA 4BCEA 3CMJA 4DM1A 1JYWA 5DO8A 2EPMX 2D20A 4TUFA 1HKJA 2ZXQA 1NP0A 3MSDA 3WH8A 5E6YA 2DPEA 2VX6A 4W8LA 2YL9A 3O6AA 4PBGA 4AEFA 4FLOA 2IXVA 3T2PA 5FL0A 1LF1A 3TTOA 4B9YA 4U3AA 1E56A 1OT2A 4H8HA 4L4OA 1JGIA 4UFKA 2WKGA 4OZOA 1E3XA 1HN1A 5EBAA 2G3IA 3T0DA 1CPUA 2XHYA 1F4HA 3IAPA 5HNNA 3VD3A 4B15A 2XVNA 4GI6A 3GXIA 2DSZA 1C93A 4PMRA 3WQ8A 4PYSA 4P8XA 3AMLA 1EGZA 1LWJA 4TVUA 1IV8A 5DT7A 1Z32X 4UZUA 1BVZA 1JFXA 5EFFA 4AZIA 4BQ5A 2CYGA 1VFUA 1L0PA 4PTXA 2CPUA 1AQMA 2HVMA 2Y8KA 3APGA 1C7TA 4MB5A 1UR1A 5I6SA 1US2A 3WFLA 1E6QM 4XUYA 4RE4A 3VGBA 1WNOA 1QPKA 1ISWA 5A8MA 1JXJA 3IJ9A 3VIKA 3AS0A 1E4LA 4CD7A 1WZMA 3W27A 1D7FA 2VI0A 2BFGA 1OD0A 4ML4A 3TOPA 2BVYA 3AS3A 1JXKA 1HP4A 1UA7A 1E3ZA 4H41A 1LQ0A 2Y4SA 5A8NA 3WD3A 1V3IA 5F7UA 2VQUA 2JF6A 3BMVA 1E72M 3EDKA 3A3HA 4A3YA 4KRTA 2ESCA 2ZUTA 1GOQA 4JFWA 4FK9A 4EKJA 1UZ1A 1J0HA 2UWFA 1MW0A 4P7QA 3SCRA 3IK2A 4DWSA 1CXKA 3POCA 4UFMA 1HF6A 2PI6A 3EYPA 4MDOA 2MANA 4J3WA 4GPNA 4LPCA 3WUGA 5E0FA 3ZT5A 2X05A 2D1ZA 1WZLA 2WMIA 4MJ4A 4CD8A 4TTGA 2XVKA 5IHSA 3SURA 3WF3A 2OWWA 4W87A 1PX8A 1W2VA 3ARWA 4ACZB 3MO4A 4FMVA 2PWEA 2W67A 3NSNA 3TONA 2ZX9A 2JALA 3KZSA 1H09A 3WH6A 4UR9A 4C7FA 2G4FA 2VRQA 1EDQA 4D1JA 4AD3A 1H1NA 2WHMA 4B16A 2DH3A 3OBAA 4TTUA 2BY1A 4IISA 2BVTA 3VO0A 3MMWA 3MANA 3OGSA 3GNRA 2E3ZA 3EMQA 1FHLA 3SCPA 2ZWZA 5I2UA 1KQZA 1E6RA 2NT1A 3N9KA 2WWDA 3CMGA 5CSYA 3WN6A 4WF7A 4JHOA 2DIEA 1B90A 5A6SA 4XB3A 5EFDA 2J47A 2V3FA 1TZ7A 2PBOA 1RP9A 2FGZA 4YHGA 3A4AA 3N1AA 1SR0A 2V5DA 1B3YA 2Y2WA 3BAYA 4ATDA 1KBKA 3ZQ9A 4UOJA 4P8UA 3N18A 1JYXA 4J7RA 2WBKA 3EDFA 1OGBA 3WF2A 3SCUA 4KGLA 1TMQA 2FHCA 1VBRA 1CWYA 4J28A 1E70M 1NOUA 2YA0A 3ALFA 3BH4A 3BAIA 1JZ7A 3KEHA 4W89A 4XZBA 1WDSA 1JL8A 2VZOA 5D9OA 1B2YA 4U2ZA 2GJXA 4JL1A 4X0NA 4MDPA 1XRVA 1OIFA 2YLLA 3ARQA 1O7AA 4W85A 4CCDA 1J0KA 3UR7A 1QVBA 4JKKA 1CXLA 2J8GA 5HDRA 4HMCA 5IFPA 2W63A 2XVPA 3PZIA 4PN2A 1BYDA 2CETA 1S46A 3WNLA 1E6XM 3NUKA 1J0IA 3ZSTA 2J25A 1G0CA 4EANA 3ZM8A 1OGGA 1M03A 3NSXA 1BG4A 2D0HA 2NW0A 4UQDA 3AMCA 5A94A 1GORA 1JDAA 1E43A 3PZGA 3GYCA 8A3HA 4JZ5A 7TAAA 4W88A 5IFTA 2WVVB 1XSIA 2E9LA 2GK1B 3GH5A 5LA0A 4BA0A 1GQKA 4KMQA 1UD5A 3VNYA 4Z2LA 4ZENA 1J0YA 5BWFA 3KL5A 1J11A 1V3LA 1UR9A 3VGEA 3AHVA 1ESWA 3EMZA 4GZJA 1CEOA 1UKOA 1XCWA 1PAMA 1NWUA 1DWJM 3AYRA 1E0XA 2OWCA 1UD6A 5JIPA 3OZPA 2GFTA 3BSHA 3IAQA 5CLWA 3AROA 4CGTA 1CYGA 3WQ4A 1YQ2A 1QI4A 3VILA 5AY7A 3WF0A 4U33A 1M53A 4MNKA 2WLYA 5CGMA 1WE5A 1X6NA 4UTFA 4W8AA 2Y5EA 1MVYA 1F4AA 3K8KA 3NSMA 4FLRA 2CEQA 5A8QA 2A3BA 1C8YA 1UWSA 1E4NA 4PMOA 4AIUA 4TVDA 1JYVA 3UR8A 3AJ7A 3TTSA 4E8CA 5CJ5A 1E15A 1XC6A 3I3EA 2VURA 1CDGA 2JF7A 3M6DA 2VZTA 3SCSA 3W81A 3CHFA 3RM8A 4MAZA 1W3LA 2Z1SA 3WL0A 5ABEA 4XZWA 3J7HA 2XSAA 2WC7A 2CIPA 1LG2A 2WLZA 3VMPA 4W7UA 3EBVA 3CO4A 1QBAA 2BHZA 3IJ8A 4AZGA 4BQ2A 1HX0A 1PBGA 2DIJA 5ABHA 3OGVA 1R7OA 3SUSA 1WDRA 2XM2A 4HP5A 1TA3A 4CN4A 1JZ5A 1UKQA 2VRJA 3CZKA 1ZB5A 3WMBA 4ZEPA 3ARPA 5AYIA 4QCFA 5JBDA 2BY3A 3OLEA 2Q8XA 3ZO9A 2PBGA 3I3DA 3VDBA 4ZXOA 4MADA 5EMYA 5D4YA 3RIKA 1XGZA 4LX4A 1W1TA 2WSPA 1WO2A 3CH9A 4OBRA 1VFOA 4E4PA 3RCNA 3T0AA 1TUXA 1MQQA 1KWKA 4W7VA 1UG6A 2VZSA 4RE3A 3UESA 1MW1A 4J3XA 4OBSA 3O9NA 1ZJBA 1V0LA 1JDCA 2W91A 2NT0A 2DQXA 2CBVA 2WZIA 3DHPA 3WUBA 4QLLA 4JFTA 3F5KA 3SEPA 3NDYA 3AXHA 3L4VA 2DT3A 2X0HA 2AOSA 4HU0A 2CBJA 1LLOA 3K4AA 1KB3A 3AIQA 4DUXA 5AYBA 3RM4A 5HXMA 1VEOA 5TD4A 1UD4A 1XSKA 4AZCB 4L4PA 5LA1A 2J79A 3AZRA 1GOWA 5A69A 1QNQA 4Q22A 3LPPA 1JI2A 1K9DA 1GONA 2PWGA 2CCRA 3FHAA 4HTYA 4WSKA 1VFMA 1NOFA 2E40A 5M03A 1BYCA 3WL1A 1HIZA 5A95A 4D6CA 4A4AA 3AXIA 3ZOAA 5ABFA 5FOOA 1CLVA 2XFRA 3FXYA 5M3WA 4LQ1A 3W24A 1Q6CA 1NWTA 2W61A 2DSVA 1SFSA 1BAGA 1C8QA 3U5UA 5EB8A 1CLXA
chains in the Genus database with same CATH superfamily
1FCQA 2NSXA 4Q33A 1R6WA 4U5IA 5HMSA 1O6IA 2AKZA 4KBXA 1BF6A 2FH6A 4D6DA 1T6MA 3LLXA 2HROA 3R6IA 1A5UA 1QOPA 1T8XA 4WX2A 3BGGA 1XGDA 5D9NA 4QLKA 1F07A 4B9ZA 3JVAA 4IPLA 5AVNA 3EB4A 2ICSA 4DI8A 2WW5A 3W1RA 2TPSA 3I68A 3IVSA 3HO8A 3S5OA 4DRSA 1FWJC 3VDGA 1ZL1A 3D3FA 2G50A 1FWWA 2OODA 1FH7A 1JUKA 2R1MA 4IGHA 4JNZA 3WLIA 1BKSA 4MY8A 4I90A 3K8MA 6ENLA 1RJPA 1CECA 4F0KA 3URBA 2Z29A 4GY1A 4LCQA 5SWUA 2O92A 1XGEA 3G22A 1OJXA 3L66A 3N2TA 3QOKA 2VUNA 3WUEA 3FGCB 2GVJA 1W5NA 3EXTA 5A2BA 2ZX6A 4IZGA 1TX2A 5BZAA 1BWKA 3S1UA 3BSGA 3R10A 1P6CA 3DXIA 4OVXA 1J96A 3IV3A 1NVMA 1EXPA 1JRBA 3IVTA 4NT0A 6CGTA 5L9FA 4HNOA 1BF2A 2VR4A 3W2KA 3HQ1A 3T7VA 4HZ7A 1QPQA 1SGJA 2J7EA 3N11A 4H9TA 4B3KA 5LIKX 3GG0A 4L9ZA 1W9BM 2WAGA 3WLNA 3CASA 1B3WA 3SAZA 4L6OA 2XYLA 4J3SA 3PPHA 8RUCA 5EMUA 4Z2GA 2EPNA 4A8NA 2XH2A 3UBPC 4CNPA 2H8XA 1A0EA 1DE5A 3G0SA 4G6CA 4XTDA 1L2QA 1FDJA 1VCFA 2FB3A 1W1A1 3UYCA 3GG8A 1H41A 3PFRA 2A1YA 4NZCA 6PTDA 4RKAA 4TQTA 3LBCA 2GL5A 3IACA 3S9YA 4C6LA 3AQUA 2EJ1A 4GY0A 1QPOA 4YHEA 2ZX7A 4H9UA 2AGKA 3CIWA 3LU2A 2YL8A 3L2MA 1UC4A 4RZBA 3I6TA 1C90A 4JTJA 5JMUA 4J3UA 3B04A 1CGYA 4JY9A 3WF4A 1QK2A 2HDJA 4JYDA 1YDVA 3NM3A 3RX4A 4TXEA 3DYOA 3WO8A 4GZ7A 1PYFA 1ZP3A 1EJWC 6TAAA 3C8FA 3LBOA 5HJLA 3W7GA 1TMLA 3VOIA 3RPMA 5CGTA 5GNYA 1JRCA 4H00A 1GVIA 4IFOA 1UR8A 3R25A 4EF8A 5I78A 1HKIA 4CNUA 3WH9A 1XLKA 2W6RA 4F79A 2RH9A 1V6XA 3GDMA 3W00A 3QZEA 3AU6A 1WDQA 4XVDA 2QGHA 4AVFA 1XFCA 1TTJA 4Y8EA 2X0YA 1GEQA 5H6HA 3QV8A 3W7EA 3W53A 2WHKA 4R34A 3S2CA 1NFPA 4ECLA 1O60A 1BG9A 4NZ1A 3W28A 4MSSA 3TTYA 4JYFA 1WXJA 4I9TA 1EA9C 1NWSA 2VFGA 1JNEA 3DZ1A 5BNKA 2NSOA 1FWRA 4OE7A 4IIHA 2PDKA 1RPXA 1FWNA 4PCSA 2Z24A 5AZ0A 3GTFA 4OIFA 4L80A 2WSQA 3QOMA 3PZOA 1MI3A 3G3MA 3KRBA 2D23A 5JU6A 2Z1WA 5LNWA 4JTSA 4RW3A 5FSDC 4XBJA 4X60A 1ZALA 4U2YA 1QI3A 4E3TA 1FCUA 5JBEA 4KEMA 1Q6DA 3AALA 1OEPA 3S6OA 3DHUA 3N19B 1EB3A 4GCAA 1KRCC 1MEHA 1G5AA 2F2HA 1S2VA 3HGJA 1KXQA 3CHDA 3ATZA 4DJDD 1BXCA 3GS6A 2ZXAA 2OEKA 2ZOXA 1ZGDA 3ECQA 1H0IA 1HL2A 3UWUA 3AICA 5D8ZA 3L9CA 4O12A 5MKGB 4PMVA 3GTIA 3O0KA 3FX4A 3SCVA 5EA9A 5IDZA 2UV8G 3FHQA 1CBGA 1T0OA 2FFIA 1CGWA 4JICA 5MF5A 4JQ4A 4WOQA 2QW5A 5FJUA 2FVMA 3LRKA 3POHA 3AAMA 2WNZA 3L5LA 1E6PA 2PWHA 3RHGA 3CUIA 4HCLA 4LF1A 2DJXA 4QXIA 2ZVRA 4JN7A 4EPDC 1WAWA 4YVPA 2NUWA 2YIHA 2XUCA 1DBTA 3BAKA 3GTHA 1YMYA 1N55A 2E6YA 2IUZA 3WY1A 1JFHA 3EDEA 4Q7NA 3U2EA 2NX9A 2YCIX 4R9OA 4MPQA 2ABAA 2X40A 2WJZA 2YDSA 1KFJA 4DJFD 4K1GA 4NAFA 1DWIM 4UFLA 3XISA 3FEQA 3REQB 4FR1A 1UBPC 4PUMA 3EWUA 4DZ5A 2NVAA 3MKVA 3FDGA 5HANA 2PAJA 1HJVA 1UZ4A 1BFNA 3SCTA 4FF5A 1FRBA 2A3HA 4QEHA 5LIUX 3QW3A 3EEGA 5KITA 4MYXA 3GVQA 2VRKA 2HE8A 4PH6A 4LV4A 3M0VA 3KCJA 4IICA 2I5QA 1WP6A 1BTCA 2MNRA 2WM1A 2A5HA 5XIAA 4AZ5A 7A3HA 4N4PA 2Q3OA 1F6KA 4DAFA 3MMTA 2DVTA 5DANA 4F9JA 1Q2RA 1YPFA 1GPFA 3JRKA 4AW7A 2YYTA 4LVBA 4A21A 4QG9A 1Z48A 2OLSA 2VOTA 4DWSD 3KFTA 5AVHA 1W31A 2QDHA 3TYAA 1R46A 4S2BA 3EAUA 4TX6A 2VFIA 2WPGA 4H8VA 1GOOA 1H1ZA 1OFEA 2X30A 3EKLA 5D05A 3CMFA 2O56A 5KTLA 3IWPA 3OEXA 1AZ2A 2POTA 5GNXA 4KIRA 1FCVA 5C8BB 2INEA 3OIXA 4RPPA 3BK0A 4JHMA 3H7UA 4WK9A 4JTEA 1JCMP 1W3HA 3TJ4A 4AZBA 2J77A 1AJ2A 1OCJA 3NQ7A 2XIOA 2XIQA 1FWHC 1ZJIA 2ZRUA 3KL3A 2WM0A 3DESA 3VNKA 1EC9A 3OBEA 3NYZA 1TPFA 3WD4A 4JNYA 3WQVA 1UQZA 5CLTA 3VIHA 2RJGA 3N29A 4PUKA 4HHLA 1Q8AA 1R2TA 1LL4A 6TIMA 4PR4A 3NGJA 1J2WA 3WDPP 3WH7A 1E73M 1PPIA 4OWGA 5BCAA 4LNCA 3PZQA 3VPLA 4ZB0A 1GOMA 1I75A 1P7TB 4QTGA 2PDCA 3OW1A 3OLDA 3FYPA 5CPMA 1QHOA 4QBXA 3MBDA 1RQEA 1L6FA 1XH0A 3LMYA 2PDBA 4ROQA 4YYCA 4RX0A 4AD4A 4HMDA 5AFDA 2RHGA 3BAXA 4XSMA 3K4DA 4B4FA 3NQVA 3W85A 4HPHA 3WLMA 4IIDA 4NJGA 2YL6A 4GX9A 1R85A 2J4GA 1DTUA 3GQYA 1FWSA 1BEUA 2ZZ3A 4LFYA 5E6ZA 4DJED 3BWWA 4YJ5A 4GI9A 3B9EA 3QR0A 4FNQA 3EEZA 3LGEA 2FPTA 5CEWA 2VKZG 1PL9A 2XWDA 1D3HA 1V5XA 6A3HA 3GKAA 3FN9A 1RR2A 1M5WA 4G7EA 5A8OA 5M17A 3L12A 3PB0A 5HWMA 4GINA 3PVFA 3RF9A 2ZA3A 1WBJA 2QF7A 3UY8A 1M01A 4RCXA 2PWVA 1PXGA 4D1IA 1QTWA 4LAZA 2OQYA 3SQLA 2E28A 3MVTA 2D0GA 2WCAA 3MSRA 2J66A 4D6HA 1GW9A 3CM4A 2YDRA 3PBMA 1EUAA 3QHOA 2DV0A 1SQ7A 2GPTA 4OJYA 1NFBA 2B7PA 1SW7A 1Y65A 3HOJA 1Z3NA 1V6TA 1F6YA 3ANUA 3W87A 1HGWA 5I3GA 2XJ7A 4TR9A 4R7OA 3H22A 4KWWA 1HFBA 5CZJA 1CTNA 4LYRA 4UIOA 4PCPA 4ZCWA 3M07A 3I4EA 3WK3A 1TCMA 3PJWA 5CG7A 1DHPA 3CGTA 4OUIA 4UR7A 1TTQA 4QS5A 2PU0A 1GOIA 2WVUA 4DYKA 4PB4A 1R9YA 3WLJA 1IIGA 3U2OA 1JDDA 2ZRXA 2P3ZA 2BGQA 1QU4A 2DZPA 1JUBA 1VCVA 3WLQA 1V08A 1W17A 2JKPA 3KP1A 2X1RA 3VKDA 4TX8A 3NQ2A 4F0MA 4AY7A 4Q4QA 2YXXA 1ODUA 2EPHA 2Y1HA 6XIAA 3M0KA 2ZVIA 2DZXA 4HJFA 2AQWA 3EOOA 4EXAA 1KR0A 3H70A 3NO5A 3NPWA 2HZGA 3DENA 3W1UA 3W75A 1UIOA 2X2GA 1DYSA 3SR7A 4ICCX 1KM1A 4MWAA 1R2SA 4HHPA 1K9FA 2ZTJA 4GG9A 2OJPA 2F6UA 3WDQA 1HUVA 4RE2A 1KC7A 3BLPX 4IM4A 1XBZA 3TTQA 3H24A 1FFQA 3HQNA 4PEKA 3PBGA 4NILA 4EACA 4MG4A 3LGDA 6ALDA 2ZTKA 3QC3A 4OOUA 1YNPA 1TRDA 3EXSA 5FIPA 3EWXA 3VOCA 3M5YA 1A3HA 1P4CA 3TLQA 2Y63A 1B4KA 3WNKA 4C5YA 1SMAA 1WPCA 3W7JA 2CERA 3K13A 2BG5A 3H21A 1F2JA 1VBUA 2GJXB 2OOFA 2YL5A 3M0ZA 2X2YA 3DKLA 4XD3A 5FJOA 1ZSXA 1JCJA 4Q8MA 4W84A 2BHYA 4HA4A 1HL8A 1W9XA 3L0GA 3W1NA 4EX4A 1C3FA 2Z26A 4RNFA 4US5D 3HJEA 2WPBA 2Z2BA 3GAYA 1FKWA 5I3JA 4GY7A 4NZ5A 3B8UA 3PF3A 2BXVA 2W92A 3MUAA 3JS3A 4JFSA 4P61A 3R5EA 3ZVHB 1NTHA 1AMYA 4R53A 4KIEA 4LXFA 3A5VA 3EOEA 4FNPA 5DMNA 1RVGA 5I24A 3LV5A 4LBSA 5BOOA 1Q7QA 3VKBA 3W22A 2ON3A 3PZNA 1GOKA 4JX6A 4PEEA 4QE4A 4PRTA 4XISA 4FXJA 3SB0A 5E09A 3H7VA 3W71A 3FYOA 3QYSA 5BXPA 4UNIA 4RDYA 1QW8A 4H1ZA 2ZXBA 1ZAJA 4B5NA 4P2VA 3UJEA 2EXOA 3WBYA 4AWUA 4UFIA 2J7HA 3P81A 1ONXA 1YKWA 2ASHA 2UY5A 1KNWA 5DY3A 2J74A 1VS1A 2B31A 4H9XA 2DT2A 2IPGA 1B31A 1QMLA 2PTXA 3S1XA 1LP6A 1TJPA 1Q66A 5CPTA 1UPPA 4JFVA 1TR1A 3CWNA 1HKKA 3WMSA 1TPVA 1A5OC 2C0AA 1TPUA 4OHQA 4DUVA 5HPOA 3DFOA 4HBKA 1V02E 1O5KA 2E9BA 2QCHA 5A6BA 2J7FA 4N9BA 4Q8VA 3E49A 5CXPA 1W1VA 3GXNA 3RDKA 3ZJ7A 2AL1A 3RLVA 1EJRC 4QSFA 2EBNA 3VNJA 3L4WA 2B0MA 3PR2A 9XIMA 1J0ZA 2AAMA 4AZ6A 3OODA 2OZTA 2QPUA 3EDJA 3VINA 1E1CB 4ORMA 4N4QA 3UXIA 5KZ6A 1LL6A 5REQB 4LGXA 2I16A 2PLCA 3ZJKA 4U3CA 4AD5A 4MMWA 2VELA 7ENLA 3ELFA 1GJWA 4I5UA 3LENA 4IX0A 4ZB2A 1U30A 2E09A 3KOZA 1B30A 4I8YA 2DUXA 4GIEA 4GZEA 2CZDA 3GUGA 2VT0A 4IMFA 5GJPA 2DZUA 1MZHA 5HOSA 2H9AB 3U57A 3G1DA 4LW7A 1OHLA 2FGBA 3ABQA 1RH9A 1K8XA 3PM6A 4MF4A 1IT0A 3SJ3A 4UFJA 1YLVA 5TNVA 3G6LA 1PIIA 3GC2A 1XDMA 3NZGA 4GBUA 2OELA 4ERAA 4IXHA 2VFDA 4A8RA 3FEMA 4HNVA 3G18A 1IXQA 4UTMA 5LIWX 2Y7DA 2YDQA 2BGNE 2P0IA 1E0WA 2VO5A 1XLIA 5AC4A 4FOUA 1O66A 3TQPA 3KOYA 3SUWA 1XXXA 2Y7FA 4WKHA 3AI0A 3NWRA 3BAWA 3GBDA 4YTTA 1QNSA 4MJ2A 3CLWA 1Q13A 1J79A 4MJMA 4UNLA 3WBAA 4ZSUA 5ABFB 4CD6A 3VGHA 3T40A 3HV9A 3DGBA 1AFSA 2POZA 1TQXA 3NDOA 4Q8PA 1KRAC 2C1HA 4M81A 4GFIA 3N14A 2D24A 3H23A 3H2AA 3QQ0A 2ZUVA 3WJYA 2XGBA 3GVWA 1XD1A 3BJFA 3JUGA 3RO6A 3IJIA 3O6CA 3SQSA 1GEHA 2XN0A 1JDFA 3UW6A 2C3ZA 3FY1A 1I0BA 4Q4RA 1NIUA 4FX6M 4AD0A 5CPLA 5TF0A 3WJZA 1QPRA 1SR9A 3DAQA 5D33A 3W0KA 1FWEC 1SO6A 1KXHA 2WZEA 3LRLA 4Y9NA 3NZRA 3BG9A 3NEVA 4MLJA 4K3ZA 2OSXA 4QDPA 3CV2A 2QQ6A 2VFFA 1RUSA 5F1UA 3L5MA 3U3HA 1DKWA 4BEQA 2H3BA 1ICQA 3EB2A 1RP8A 2W4XA 3HFYA 3TN5A 4S3EA 3N3MA 4IHCA 2I57A 2B81A 3O3RA 1QXLA 1A0CA 2HV5A 2R1KA 5FJIA 5HR7A 2VMFA 1V3MA 3BV4A 3FAWA 4IPPA 1NDWA 3USBA 1JPIA 1XICA 3FA3A 2ZE3A 1UC5A 2H3DA 2PCEA 2AKMA 3TR2A 3BOXA 2XN1A 1JI1A 4QFUA 2KX9A 3N2XA 4AMAA 1XDLA 4ZOCA 2WVTA 4HPJA 4NNCA 3TJXA 1ZLPA 2ZE0A 4GC4A 4MKNA 2XSBA 1R3SA 2XTKA 3ES7A 2Z7KA 1LQ2A 2YKKA 3ITXA 3KL0A 1XRSA 1EO7A 3GBEA 4PMJA 1P0NA 3TV8A 1IEIA 3OO2A 4L7ZA 2BY2A 4NVTA 3PB2A 1UR2A 2QZRA 3SFKA 1CNVA 5I3HA 4HHMA 4XG1A 4HK7A 1CT5A 1CZ1A 1A4MA 5IDIA 1OG0A 3PWAA 1EQCA 3PSWA 4ADUA 5CKSA 1PZ0A 5C9XA 5HNUA 1VF8A 4BCEA 4QLJA 2R8WA 4CCZA 2OKTA 2D20A 4TUFA 3P61A 3MSDA 5E6YA 2XISA 4FPSA 3DBNA 2DPEA 1RVKA 3UWEA 3O6AA 1DIDA 1RBAA 1SW3A 3R89A 3C0SA 4FLOA 2IXVA 1XIFA 3DG6A 5FL0A 1H1YA 4Z1AA 3FK4A 3H4XA 4U3AA 4UMAA 4YNGA 1OT2A 4L4OA 4H9MA 4OZOA 2EF9A 1OFQA 5EBAA 5D2WA 1FBAA 3GG1A 2F9RA 1EEPA 3LHTA 2XHYA 2CLMA 1F4HA 2TRSA 3IAPA 5AZ1A 2FFCA 3AJXA 3O05A 3N73A 3R8HA 4UC5A 2QNEA 4PYSA 4P8XA 2OLAA 3UJSA 1IV8A 3URAA 1K77A 1VBGA 1Z32X 3WLPA 3LHUA 3GWQA 5EFFA 2F2KA 2HVMA 1J4EA 2VP8A 3E2RA 3LHYA 5I6SA 2YFNA 4XUYA 4LC6A 3T42A 1QPKA 1ISWA 4FXSA 3IJ9A 4MGGA 3TZFA 2NQ5A 3VIKA 4Q4MA 2PLJA 4YWSA 4JEJA 2E1DA 4JD4A 4S1FA 2RDTA 3PPCA 1P48A 1EWDA 4LS0A 4DLFA 1M7OA 1E3ZA 1LQ0A 3ZFHA 5A8NA 3HQOA 3CIXA 1W5OA 3EDKA 4A3YA 4HA0A 4WUIA 3Q58A 4GOAA 4B5VA 1GOQA 1XINA 1UZ1A 8XIMA 1J0HA 5AHMA 4AWSA 4NL1A 3SCRA 1F3TA 2PI6A 1FWTA 4QITA 2MANA 3MCNA 2FQIA 3BJSA 1HO1A 4ML9A 2FJUB 3LSBA 2NLYA 5IHSA 4GACA 3SURA 2OWWA 2NWRA 2B7OA 4FMVA 3NSNA 3USZA 1RV8A 2ZX9A 2OPJA 4DBUA 2QCDA 5T91A 4IGNA 1TJ0A 4AD3A 4D8AA 3RN6A 4QE5A 2RFGA 1LBLA 2YCLB 1H61A 3PSVA 1LQAA 2IKHA 4QJ3B 2BY1A 3CEUA 4FALA 1AA1B 2P3EA 3C5QA 3GNRA 3KWSA 2QJMA 1JEZA 1FHLA 2ZWZA 3N9KA 2WWDA 2FLIA 5CSYA 3WN6A 4WF7A 4JHOA 4XZ9A 3KS6A 3T1GA 1XIMA 3IVUA 3F4WA 2PBOA 1DXFA 3M43A 3ZQ9A 3P67A 4BF9A 5CBJA 3LM3A 4KESA 3CUZA 1YNQA 1W37A 1XLEA 4HJWA 3IUHA 4H7ZA 2FHCA 3MWAA 3VC5A 4NYYA 3FJ4A 5J8LA 1JL8A 1Z7AA 2VZOA 2Y8UA 3ERPA 2TMDA 3HPAA 4ZO9A 4U2ZA 2FZBA 5DRCA 4HGXA 2YLLA 1Q65A 1WDDA 3TU9A 3UG8A 4W85A 4QJ4B 3RGTA 1SZFA 3UR7A 2PC4A 4DQWA 2TYSA 1MDRA 3MJYA 4JKKA 5HDRA 1Q6QA 2Q8ZA 1RHCA 1ITQA 4EPBC 4PB3A 1IR2A 4DBSA 4PN2A 2CETA 3PG8A 4DXKA 2V5LA 1XIHA 1VP5A 2XH7A 2IPWA 4H3DA 4FHAA 4EANA 1RALA 3BURA 3WQEA 4DXXA 1BG4A 1WXYA 3NQ6A 4UQDA 2NQJA 4JIIX 4X2RA 4JDBA 1EWEA 5FF4A 4GKTA 1R47A 3KVMA 7TAAA 4DX3A 5IFTA 2VDGA 5G4HC 1V7AA 1XSIA 3N2BA 5DMMA 5LA0A 4BA0A 1GQKA 2JGQA 4N2YA 2ISSA 3VE7A 1AODA 1J0YA 1ME9A 5BWFA 3KL5A 1J11A 4K37A 3STGA 1DORA 5I03A 1UR9A 3AHVA 3T07A 5CSSA 1UKOA 4I6KA 4LBRA 3E12A 3QZAA 5JIPA 2GFTA 4L64A 3IAQA 4IIGA 5CLWA 1UW9A 5K9DA 3WQ4A 4FB7A 4WHBA 4U33A 1M53A 1XBXA 2VENA 3KRSA 5CGMA 1WE5A 2J9ZA 2ACSA 1F4AA 3K8KA 1JULA 1E4NA 3RX2A 5FEZA 3C56A 5HK4A 1S2UA 4IFKA 3AJ7A 5D2YA 3CL7A 2A0NA 1L8PA 1E15A 1XC6A 2VURA 4H6QA 2VFHA 3W81A 3CHFA 2YFOA 1YX1A 3VYLA 1UUMA 3IIZA 1W3LA 1EP1A 2DZWA 7XIMA 3IJQA 1MRAA 3Q37A 1TIWA 2J27A 3R79A 4M6PA 4GUIA 1XRTA 3TKFA 2XH0A 1QBAA 2VWTA 4HPXA 2DIJA 3OGVA 4NX0A 4YTQA 1TWSA 1WDRA 1PKMA 4MZ8A 1OFAA 5IRPA 4CN4A 4QROA 3C86A 1S39A 3CZKA 4DEFA 1ZB5A 3UY7A 4X61A 3ARPA 3EWWA 2P10A 3VNLA 5M2FX 3STEA 2Q8XA 4J40A 3I3DA 1O94A 1VQTA 3K1GA 4ZXOA 4MADA 4XZNX 5EMYA 5D4YA 3URNA 2NVCA 2WSPA 4I7WA 4OBRA 1VFOA 4DHGA 4E4PA 3RCNA 2VZSA 3UESA 5LNSA 3DEQA 4OBSA 3O9NA 3W7NA 3TAOA 3VCRA 1JDCA 3W1PA 1OK6A 1GG0A 4QLLA 3SEPA 3F5KA 4ZVJA 3AXHA 2GJNA 2AOSA 1RQBA 4JTHA 2HVNA 1KB3A 3VA8A 1RK5A 3QN3A 2DFAA 1XDJA 3EA1A 1TREA 1VEOA 5TD4A 4HCHA 2A3LA 5LA1A 3OYZA 4ADTA 2J79A 1K6WA 1GOWA 2PS2A 1Q5MA 5L6UA 1KM6A 3W7KA 2GSEA 1BYCA 5A95A 1HIZA 4D6CA 1X1OA 4LQ1A 4Z1CA 3H7RA 2DSVA 1S2WA 5E1QA 2BOGX 2BTMA 1PHWA 1KTBA 3QMSA 4GNVA 3FLUA 2O9TA 1OD8A 2YR1A 1OWQA 4R85A 2A3AA 4RXFA 3HPFA 4G2DA 2GQ3A 3HGSA 2CZEA 1J10A 2PGWA 4HU4A 1EIBA 4LANA 4DF1A 3ENLA 5I3DA 3N2CA 1DWHM 3VVGA 1H2JA 5ECUA 1ZCCA 3LHWA 3N6QA 4I7UA 3EKGA 2YOCA 3BANA 1XLHA 1B1YA 1GVSA 1PSCA 3QFWA 3OQEA 3WLOA 2HMCA 4H6EA 2RDUA 1TWWA 3G77A 8TIMA 3MUY1 4JTLA 3A13A 1UWIA 2OT1A 3CZ8A 4GD0A 3GIPA 1E40A 2VR5A 4LWWA 1ZCOA 5TAOA 2G3MA 3TEVA 4O16A 2OB3A 3OGRA 2D0FA 1RD6A 2V5KA 1Y5WA 4LH8A 3SUUA 3FNDA 3G1FA 1I6NA 5DY2A 1LCOA 3ZSSA 2WV8A 3OVGA 3I7QA 4M56A 1G6CA 1YPIA 4CUCA 3QPEA 1EX5A 4EIVA 5FI8A 2FVLA 1AW5A 2PRHA 4NJJA 2XU2A 4AWEA 2CLEA 2FH8A 2PB1A 3G1YA 3T4CA 3U7BA 4F0RA 5FL1A 2QAPA 4DF0A 1T99A 5HMDA 4KFPA 4H7VA 4ZQRA 4JPGA 1SSGA 2YYUA 1FHUA 3B8WA 2FTPA 1MFUA 2XN2A 1Z9AA 3WSUA 4O1CA 4HVXA 2E8ZA 3M5VA 1ALDA 5GJMA 1O68A 4BI6A 4WGXA 2WMIB 2HS8A 1SJBA 1YE6A 3BLLA 4FNTA 4DJFC 4RL3A 2QJJA 4H2CA 3WDIA 2R6OA 2MUCA 4HN4A 5FCZA 4R7JA 5I23A 1JR1A 4O1FA 3CJPA 1TPWA 2XGIA 1TRIA 4RNHA 3V1HA 2EHHA 7ODCA 3TC3A 2Y88A 3PG9A 1C8XA 1XYBA 4M6VA 1EDGA 3VCCA 1HKMA 1PCKA 2ZZ7A 5HWNA 2GJRA 1EP3A 1UUOA 3QJAA 3BSMA 4CU8A 2YLAA 3FKKA 4KWOA 1Q3NA 2QCFA 4MY1A 3ZMRA 4MZ1A 4LVAA 1LBFA 3TMQA 1UB3A 2Y7GA 3IJ7A 2CLKA 2HISA 1E6NA 3N6HA 5D03A 3HPZA 3CUFA 2XM1A 2BP1A 5DXXA 4UTTC 1REQA 1SYTA 3G1VA 3N25A 1OCQA 3W23A 5GQBA 3W84A 2HCVA 3S2MA 1Q6LA 2VEPA 2CU0A 3PJXA 1Y7VA 4MM1A 1OCBA 1U1JA 4ZA0A 2W5FA 3V5OA 3C2EA 3VNZA 1O4UA 2ZUMA 1AL8A 4GJ1A 1SZRA 4HU3A 4WQ6A 3TXVA 3NJ3A 4XUGA 3WDHA 1IGSA 3VD9A 3W25A 2E5BA 4XSLA 2FTWA 1LRNA 4FNRA 4D2JA 3M6YA 3PZ9A 4LCSA 1NH6A 1X6UA 4JTAA 3DECA 4JQ1A 2Q6ZA 3V18A 3E0VA 3BE7A 5D9PA 4IT1A 2ZDSA 5DXYA 5AN7A 3SSZA 4JTIA 1H7NA 1PJ9A 2QLYA 1FDYA 2EPLX 3BV7A 1DP0A 4KWVA 4BFAA 3NR0A 3AHXA 1P43A 3CXOA 2GWNA 1BSLA 4PTWA 5I5RA 1G4EA 3CS2A 4H9YA 3MI3A 4CU6A 4OV9A 4JTUA 2GOUA 3K4WA 4L9YA 2X1IA 4AZ7A 1QI0A 4CQ8A 2DVUA 4PUDA 2IQDA 4DZHA 1BYBA 2HK1A 1UYQA 5D04C 1FP9A 4ACZA 3UCDA 4PA8A 5U7SA 1ZBKA 3C3UA 1I1XA 4C6DA 3HM7A 3T6CA 3WQ6A 3KE0A 5BXTA 2VHLA 2X7VA 2R1NA 3QW4B 3UERA 5DLCA 3ZT6A 5E5CA 3PUDA 3RMEA 2IXUA 1CENA 3B05A 1F6PA 4O1DA 4C6FA 5H8MA 2VGFA 5CZ0A 1XCFA 5CPSA 1K03A 2PDIA 4CQCA 2TODA 3ZVHA 3F4NA 5AHNA 4DBDA 1V6WA 4RPQA 3U8GA 1VD6A 2EPOA 5M5DA 1KTCA 1G94A 1US3A 3QYQA 1QK0A 2ZA2A 4AF0B 1V03A 1SZNA 4ZO7A 2PP1A 1YE4A 1LJYA 4L6DA 2J8FA 3R2GA 4ZQOA 3EPOA 4H8UA 4DJEC 1AG1O 1I2QA 5CC5A 3ZWTA 1H7XA 2Y0FA 3ARXA 1QR7A 3GC5A 2ZZ6A 1TPB1 1PZ3A 2XZ7A 2XG9A 4KF1A 1RBLA 2OYLA 3HFTA 3U6WA 3IIPA 3TH6A 5FEWA 4GABA 4KRUA 1PTGA 1SUXA 4GUHA 1D7KA 5ENLA 4ENLA 2PE4A 5HJXA 1KGWA 3PJTA 3NOYA 3TW7A 3H4WA 1G1YA 3W73A 4DIAA 4D72A 1K7XA 2P76A 1A5SA 4B3ZA 4PSPA 4PMZA 4HNNA 3IARA 3HQPA 1XWYA 1XS2A 4N42A 1PDZA 1XV8A 3B0UX 3SIMA 5FACA 3QHNA 3K2GA 4U5KA 2QIIA 1VRDA 1KFEA 4NZFA 3UVIA 4WSJA 2HTMA 3KTSA 2WVVA 4B4HA 1KWGA 2FYMA 4LNYA 3VIFA 5LHEA 4NASA 1IWAA 2GK1A 3LUTA 1S5TA 1QHPA 2BXZA 4WDTA 3INPA 2D2JA 2O9OA 4OV4A 2FDSA 5HUPA 1BHGA 2QEZA 2VVSA 3HPXA 1OBAA 5TBOA 1DWAM 3UWYA 3LSCA 2W62A 3F2BA 2J7CA 2VVNA 3LK6A 3ME3A 2REQB 3TOYA 4ZO8A 5AYZA 3U9IA 1DJIA 2BGSA 2QF8A 1AZ1A 3ARYA 3AXMA 2J75A 3T2OA 3VX0A 2WMGA 1M04A 1B3OA 2YBTA 1Q6FA 1S3HA 1L6GA 1PKLA 5HULA 2QDGA 3HV8A 1YDYA 5A8GA 1W9PA 1SZEA 3VKJA 4CNNA 3VK5A 2Z6IA 4LRSA 1ITCA 1N8FA 3NG3A 2JEPA 3PWGA 3GW3A 5BYWA 2W9MA 1ZS2A 2XFYA 1NOWA 3EB3A 2YCKX 3PBYA 3PUEA 2VX4A 3MDUA 1EYEA 1LRTA 4MUZA 2BS9A 1HNYA 5I79A 4EAYA 4HOXA 4M24A 3W37A 3LLDA 1J01A 2V5CA 4FP1A 4KCVA 2D2OA 5T26A 1TSIA 3DFSA 1UP3A 4GVHA 3PFMA 3T8LA 3UU0A 1KM0A 2I56A 4GYJA 4JTRA 3SADA 3LRMA 1U2YA 3TYBA 3NPXA 2ZQ0A 2SFPA 5C2XA 2DEPA 3DU0A 1BKHA 1EHNA 3BLIA 3MPGA 1O95A 4GQQA 4EAMA 1J0JA 3GNPA 4QIUA 3SN0A 1ZJAA 4GLEA 3VUPA 4IUGA 3F4DA 4ADSA 3P93A 4NF7A 4ATLA 1KM5A 4K7VA 1DIKA 4CU7A 1NARA 4IQDA 4JTKA 9RUBA 3HTWA 3QFEA 3VNIA 2QCCA 2J7DA 2Q02A 3OZYA 1KGXA 5HR6A 4IPNB 1GVOA 3CUGA 2ZUSA 1VRXA 1I2RA 1BQCA 4XO6A 1VBJA 5A5WA 2WOQA 3T2QA 4AZCA 2Q09A 1W9UA 4M19A 3PY2A 4PMQA 1XQKA 4Z0SA 5BOFA 3RRAA 1OYBA 3RO8A 4A3UA 3CT2A 4ZOBA 4WJEA 2BSLA 3N2MA 4UZSA 4DJDA 4UOZA 1DOSA 4XKYB 3NQBA 1N8IA 4PMXA 2OEJA 2C91A 4WY0B 3MDWA 4OGZA 4ZODA 3QEZA 1G7VA 3K1DA 4KCTA 4AY1A 5K4ZA 2OOGA 3VD7A 2IPJA 1UQYA 4AMCA 3MUIA 4JCMA 3T55A 1PKNA 2AMXA 3C61A 1X7IA 5LGZA 3NURA 1X7FA 2GJPA 1W3KA 2GJLA 2JQXA 4LUIA 3P62A 2R9RA 4JEQA 3KUMA 3SN1A 1EOKA 3GNOA 3LERA 2NLIA 1NWRA 2PRLA 3MYPA 2NWSA 4ZTXA 2JEQA 4P8WA 1AW2A 2CKSA 2ZA1A 2E4TA 3LCXA 4XD6A 1D9EA 4Y7EA 3W7PA 5HPCA 1KW1A 1SMDA 1EO5A 3CLMA 1XIJA 1BGGA 3SCOA 4H83A 4MB4A 4LUSB 3MS8A 3BUVA 5IOBA 6REQB 4V1YA 1OADA 1FH8A 5KZEA 1T5AA 4DJFA 3UJFA 1ISVA 3FDKA 3W1XA 2QIWA 1NF0A 2PWUA 4A3RA 4AFYA 2CESA 4M6QA 2VD8A 2ZRVA 3M64A 1XIIA 4H04A 1NDVA 3SFWA 3MV01 3WCZA 4W93A 3CPGA 1IEQA 2C1IA 1RY0A 1EH9A 4LOCA 4KCUA 1ZY9A 1FWIC 1F9CA 2HXTA 2BY0A 1CGUA 2VZUA 5AOUA 5XINA 3TW6A 2C7FA 3CZGA 4AXNA 4LSBA 3DG7A 4HYVA 4RZ5A 3TFXA 4C6PA 1PIGA 3NPUA 3KCLA 3CPUA 4KH2A 1VLWA 1B0IA 2ZZ4A 2X09A 1BSIA 4DM2A 3DIPA 4GJIA 3CQHA 5B7ZA 3UPWA 2PDYA 3MKCA 3CHEA 4P7NA 4JL2A 3G0UA 2W3ZA 2PUZA 4IMDA 3QH2A 4UTTA 3OLGA 1FTXA 3G24A 3WQCA 3R13A 3DFQA 3ARVA 3MBFA 2FHFA 1VYSX 4MNLA 2OEMA 3NPVA 1AH0A 2WMHA 2EO7A 3AUJA 1UKSA 3N17A 2V2HA 3II1A 4PTMA 4BI5A 3M1ZA 4M29A 1KRMA 2I1OA 1W9VA 4RZ4A 4JKLA 3W7LA 1OX6A 1LWIA 2X1SA 4UR8A 1KXVA 1OIMA 1PE1A 1TV2A 1J6OA 1KCZA 4OKDA 1NSJA 5A1AA 2QUMA 3H54A 3TYDA 4BQ4A 1C9WA 4AUBA 4AIEA 3GDRA 2FB2A 2O7SA 1RLDA 1W32A 4XD4A 1JZ8A 2CLPA 4GBDA 3SRHA 4PUJA 3WD1A 3GHTA 3L2IA 3WMCA 3FJ6A 3UWWA 4MNJA 1Q2SA 3AHTA 1GQNA 2VXNA 2YXOA 3M5ZA 4QX4A 1OFBA 1FQ0A 3DI1A 3WKZA 1ADSA 2GUYA 3GVVA 3GR7A 4G56A 1QBBA 2BASA 2EG6A 3KW3A 1Y5XA 3SCWA 3W2JA 3UP8A 3HG5A 3UCCA 7REQB 2VX7A 2P53A 2E8YA 4JIPA 3M47A 4DYJA 2GOKA 3O8AA 4KGJA 3Q65A 2QPXA 5DMYA 1XJBA 1FH9A 1G4PA 2WBGA 2F61A 4Q6JA 1B5TA 4WOZA 4XV0A 2C8NA 2CKRA 4E2DA 3THDA 2ZZ2A 3TX9A 1R30A 1A3WA 3GIQA 3UZZA 1W9DM 4M7SA 1XUUA 3MHUA 4H4IA 2FMNA 3STPA 1XLDA 4ZQNA 4K8GA 3KHJA 2E6FA 3F2DA 2AMGA 5I0DA 1IZKA 3OA3A 4R9XA 2RAGA 2CXGA 1AVAA 3HURA 5JIWA 4MY9A 3L4XA 3DFTA 2G3NA 1DJQA 1OK4A 4DJEA 3MWCA 4YPJA 4FF7A 1E9LA 3NXFA 3KZPA 1KD0A 1LUCB 4AC1X 1GJUA 2X1UA 1A5MC 3W38A 2ACRA 3N6JA 4NQ1A 1MMFA 2NQZA 5CZKA 5EPDA 3S3GA 1YTKA 4AIBA 3FCPA 4OTKA 4BZYA 1JCTA 4GISA 1HGYA 1V3HA 4XIMA 3NQ8A 3PJUA 3WH5A 2WQDA 4QAWA 4Y9AA 2AQVA 3CWHA 1UMYA 2QUTA 4HA3A 2NQ9A 5HNTA 4M82A 3OQ8A 1PO9A 1WCGA 2BMBA 3WDRA 4GWEA 1UH4A 1IF2A 5BROA 1S5NA 1OSEA 1CI1A 3S4TA 4HOWA 1VYRA 5FESA 2WB5A 1ECEA 1VIWA 5I77A 4KRZA 4QDMA 3S8HA 3PPGA 4QJ5B 2Q01A 3B4YA 2PEVA 1R3VA 4LV9A 5A3HA 1U1UA 1IYXA 4F2BA 2GGIA 3JZUA 3AXXA 2W79A 5I09A 2CLIA 3B9OA 3QPZA 5FF0A 4Y9PA 4OBTA 2ZRZA 1KFLA 2FDMA 2VZVA 5G2HA 1M65A 4IUOA 1Q7MA 3CZLA 4A3QA 4Q7IA 4CKQA 1SW0A 2QJIA 3EMCA 3RM9A 1GTHA 5C55A 5CPQA 3TROA 3NIYA 3NGFA 1VKFA 3A4WA 2V3DA 3QVQA 3URQA 1W1YA 2GSJA 4LT9A 1R3TA 3TSDA 5HQMA 3VM5A 3N2OA 3LM7A 2V68A 3UEQA 3PTKA 2HXUA 3PBVA 1W3TA 4E2OA 3NAVA 1TV3A 3AHZA 3KDOA 4JY8A 1XL9A 3RCMA 3B0PA 4Z0JA 5LKYA 3GD6A 3OHIA 3LDVA 1D8WA 1BLIA 5I07A 3MYOA 3P2VA 2NXIA 1XCXA 3FXGA 4BF5A 2YSWA 2VCBA 1R86A 1JUEA 3B0XA 3IIOA 1A5CA 1B9ZA 2VEGA 2V3EA 4XAFA 5D37A 4EWJA 3ARRA 3AIVA 4JTDA 4JIHA 5HJYA 3VMOA 3E5PA 1CGVA 3S5YA 3OTRA 1DXEA 3P5ZA 1FHVA 4TMCA 1C7SA 2NX1A 1TB3A 2F6XA 3B4UA 1HJQA 4C60A 2WJFA 1VJSA 4C7GA 3PZTA 4Y9MA 5EBUA 5D9MA 4HHHA 2PDFA 4XX6A 2AL2B 3T05A 3AOFA 3WQOA 2WMFA 2ZUUA 1QT1A 3PUGA 4US5A 3NA8A 3KBNA 4GO8A 4Y9OA 1SO5A 2HWGA 3GXDA 3NZPA 2E7FA 2VDIA 3QQ1A 3B40A 3UWVA 3KRUA 1KV8A 2HE5A 3P60A 3CQ0A 2PTZA 4NG3A 4MWAE 1JZ4A 3ZVIA 3BCDA 4UUIA 2ZCGA 3ZXWA 2PP3A 3SUVA 1G7UA 4Z1DA 3T0BA 4GQRA 3V5CA 2PDXA 3AIRA 4IXXA 2CZFA 4NP7A 4PUWA 4Q8WA 3NQCA 4J4KA 3GVRA 3P84A 3LGGA 1ITXA 3E1F1 5KETA 3VFCA 4YCOA 3M0YA 3F1QA 4HZ8A 4WJ8A 2J62A 3NNTA 5KINA 5CSRA 2JIEA 1TV4A 1PTAA 3G1RA 2RDXA 1I2PA 2QV4A 5CJMA 2R94A 2QPSA 1BRLA 3CMJA 4MOZA 4DM1A 1ME7A 1NQKA 1QATA 3W1TA 1NP0A 1VBHA 2VX6A 7PTDA 4GX8A 2YL9A 4AEFA 2OO0A 4CEUC 3ABXA 4DYEA 3KVLA 2YBVA 1GKPA 3HIJA 2O55A 3W1QA 1NDYA 4GVIA 1LF1A 3TTOA 4B9YA 1ITUA 3AU2A 1E56A 4H8HA 1DQWA 4ROPA 2WKGA 1XUZA 4ERIA 2G3IA 4O8AA 4LUTA 5F2GA 1OY0A 4PRRA 3P3BA 1P1MA 1KBJA 2PZ0A 3VD3A 4B15A 3ZS4A 3L23A 3ANVA 4GVFA 4PMRA 1DJNA 1LWJA 4GQGA 1Q6OA 4TVUA 1EC7A 1HZYA 3ITTA 4BQ5A 2CYGA 1VFUA 4K36A 2CPUA 1AQMA 3APGA 2ISDA 1VC4A 3T8QA 1ZAIA 4M3PA 1EBHA 1US2A 3V36A 4RLIA 1E6QM 3FA5A 1H7WA 4RE4A 3L5AA 4LY4A 4JIRA 4MZYA 4XZLX 1C29A 1Q85A 3ITOA 1E4LA 2B7QA 4BKNA 4CD7A 3W27A 2UBPC 5JXQA 4DELA 2BFGA 1DIOA 1ECQA 4J35A 3TOPA 2BVYA 4IP5A 4LAMA 1K1DA 1WKEA 4C6IA 4YCPA 4H41A 2Y4SA 1SO3A 2W27A 3A9IA 4Y6GA 5F7UA 3PAOA 2VQUA 2BZNA 2JF6A 4INFA 3BMVA 3L21A 4XZIA 4GYPC 1JJKA 3H26A 4KRTA 3W07A 4MFDA 1OZMA 4DUOA 4N9EA 4JFWA 4FK9A 1RJRA 3LCWA 1MW0A 4P7QA 1CXKA 4JTGA 3POCA 1DXIA 4LVDA 4J3WA 3MP4A 1YPXA 1DQXA 4NKCA 4LPCA 3WUGA 3ZT5A 2PDGA 5CPOA 2WMIA 2X7WA 4N9CA 1JCXA 4TTGA 4NAEA 1THFD 5H2ZA 1PWMA 1ELSA 3CQKA 3E0WA 3WF3A 3MI2A 4I7VA 4W87A 1DJZA 1FWBC 3MO4A 4UMBA 4D9PA 4AYGA 5C7VA 3GDKA 3WH6A 1X96A 4W9TA 4UR9A 3BZGA 2R82A 2VRQA 2WHMA 3IJDA 1MUMA 5D2VA 3GNDA 3RLGA 3W7QA 3SJNA 4BWLC 3MANA 3BW4A 2I9UA 2ZADA 5HAOA 3CQJA 4IOTA 4HNLA 2NT1A 3TR9A 2NUXA 4POCA 4YVXA 3EPNA 4XB3A 1RP9A 4YHGA 3JW7A 1SR0A 1B3YA 3BAYA 3TW9A 4PBEA 5B80A 3S46A 4UOJA 5F2IA 3UJRA 2GQ9A 2YZRA 5CBBA 4J7RA 1OGBA 3SCUA 4GVGA 1TMQA 1VBRA 3ATYA 4J28A 2Z0IA 5DMLA 4D8ZA 3HA1A 3BH4A 3ALFA 3KOFA 3KEHA 4W89A 2OZ3A 4XZBA 4F0HA 4S3GA 4CEXC 4NAFB 5D9OA 4AG0A 1OF6A 1B2YA 3B3DA 1DTNA 3MZNA 4X0NA 4MDPA 4AX7A 1XRVA 1OIFA 3ARQA 3IUDA 2WJDA 3S5ZA 3FSTA 5BOEA 4DWDA 1J0KA 5E9XA 3GNXA 2PU1A 2V5BA 2OGJA 1CXLA 4GRSA 3KVJA 2W63A 3QV9A 3S47A 2XGZA 3NVTA 3PZIA 1T7LA 3LMZA 1BYDA 3FVMA 3WNLA 5IBXC 1A5AA 1LLWA 3NOEA 1G0CA 1RA0A 1YXDA 5E93A 2D0HA 2EKCA 4PGLA 5C54A 1GORA 1E43A 4ZR8A 4YIWA 1DJXA 4QE1A 4TV5A 3W3OA 5BU9A 4RDZA 4W88A 2CLHA 3OVQA 4ASTA 3A9BA 3P5YA 1U5JA 3NL2A 3WZ0E 4IL0A 5FJTA 5CC6A 2Z7GA 1B9BA 1V3LA 3N9SA 3BL3A 1ESWA 3EMZA 4UTLA 1CEOA 1NWUA 1DWJM 4S2CA 2OWCA 1TUFA 3G2GA 4JYEA 1AQFA 3FVDA 3R7MA 1TR9A 5F4XA 2YGYA 5AHLA 4G9PA 4N02A 1QI4A 3VILA 5AY7A 1B57A 2C71A 1XYLA 4DNMA 4OECA 4WGHA 1ICSA 1KV5A 4W8AA 1L6YA 1MVYA 4I9JA 5LXEA 3NSMA 2CC0A 2WJEA 4FLRA 5A8QA 2A3BA 1UWSA 1ZAHA 4PMOA 2VC6A 2TSYA 2B7NA 3TTSA 3TK7A 1K8ZA 2ISVA 3COTA 5CJ5A 2VC7A 1CDGA 4IMCA 3W74A 3IS4A 4O0ZA 4GA8A 4MAZA 4PFHA 3SRDA 1GJPA 2WC7A 5AYXA 1LG2A 2WLZA 4W7UA 1KKOA 2GGJA 2BHZA 4PCNA 4JOMA 5AC7A 1HX0A 1PBGA 2IQ0A 3TYUA 4C5ZA 5LIXX 2WNNA 4FA3A 1WV2A 1L6SA 2ODOA 2F38A 2H6RA 3NQEA 5JBDA 2BY3A 3ZO9A 2PBGA 1J2BA 3VDBA 1SSDA 4C6NA 2PDMA 3RIKA 1XGZA 4LX4A 1W1TA 3CPRA 1FDZA 1WO2A 3R8RA 1MQQA 4W7VA 4RE3A 1WX0A 1MW1A 5E0KA 1ZJBA 2G97A 2NT0A 2DQXA 2CBVA 1WUFA 2WZIA 3DHPA 3WUBA 2V82A 3E9AA 1F3WA 3AC0A 1OX4A 5LNUA 2PGFA 4HU0A 3DCPA 1LZOA 4DZAA 1S2AA 1KM2A 2ADAA 3K4AA 4E2BA 4QGCA 5AYBA 2NV1A 5HXMA 2BDQA 1TV8A 1UJQA 3O6DA 1UD4A 4IIFA 4I5XA 4FXRA 4IPJA 3W6YA 4G7EB 2V5JA 4LEFA 2ZFAA 1QNQA 1GONA 2PWGA 4JDYA 2CCRA 3FHAA 1MSSA 4HTYA 2YW3A 1VFMA 1NOFA 1M68A 1EC8A 4DO5A 3MP3A 3WL1A 3VKCA 3ZOAA 4PUNA 1TPC1 2XFRA 1XG3A 4FZIA 2W61A 4A22A 4XD5A 2KAUC 3U5UA 3YPIA 5FF7A 1TO3A 3IK4A 5HWJA 3GXMA 1EHAA 1VEMA 1U83A 3P7YA 3KXQA 1VPYA 2Y5SA 1QUMA 4QEEA 4AU0A 4W7WA 2FZ9A 1JZ2A 1JPKA 4XAZA 2DQWA 4DN1A 2PLKA 2CZ5A 4C65A 3MMUA 3BLOA 1UP0A 2A85A 3AYTA 4FNUA 3IUIA 1F73A 2JGYA 1QW9A 2XH4A 3G1AA 1YRRA 3VM7A 1MW2A 1XRFA 1U1HA 2BNJA 1OFDA 1BGAA 3L0NA 4RXGA 2NUYA 1OFPA 3RMJA 3Q94A 1AW1A 3DYMA 2H90A 2VEMA 1U33A 4C6BA 4XQ6A 2E5CA 1DV7A 4JX5A 2KZHA 4IMEA 3G8RA 3BQ5A 4R88A 4O14A 4ZXLA 3N13A 2FZNA 1LOQA 3C2YA 4S39A 1OC7A 2WC3A 3VTRA 4I9AA 3W88A 4L1XA 4IG2A 3FOKA 3G0XA 1CLKA 3ZR5A 2FIQA 1LT8A 3UG4A 2HS6A 2WHLA 1ZBWA 3TLLA 4C1NA 1R3QA 1PZ2A 2DW7A 4D71A 3BCJA 4MWAB 4DXVA 1X8FA 4YL2A 1R3RA 1P6BA 3N4EA 3W7RA 3LHZA 4MKVA 1FXQA 4PMUA 5K3VA 1OGSA 4F3HA 4WXZA 3UZ5A 4IP7A 2J78A 4CCEA 4PTNA 3ZJ8A 4ZOAA 3U5YA 3BOLA 2V3GA 4LVGA 3N3TA 1HP5A 2Z1VA 2YBUA 4Y90A 1JYNA 5BU6A 3GAKA 3TSBA 1OFRA 1TG7A 3WIJA 4LVFA 3NYDA 1WAUA 1UH3A 5D30A 3H8AA 3NQGA 4B5SA 1UR4A 3I4KA 4IFRA 3WFZA 3C8NA 4LJ3A 4NY2A 1E1EA 3GU2A 4IIEA 1EL3A 3ITCA 1OX5A 1QI5A 5TIMA 5I3KA 4GK8A 3PHAA 3LY0A 1Z41A 1IZJA 4S3JA 4QNEA 5LYRA 1Q6EA 4S3FA 4B2DD 1JQVA 3IEBA 1S5MA 1NEYA 3DG3A 4LUJA 4AB4A 1F8MA 1EOMA 1CX9A 1AQHA 3WBEA 1KBLA 5CZTA 3BARA 3OG3A 5GJNA 3EGJA 4F9DA 3WLHA 1UWRA 2WQPA 1E9YB 1WUEA 3F4VA 3K46A 4GYPA 3FA4A 1QNOA 3FIGA 3R11A 2JFEX 2ZX8A 1CXHA 3AMKA 2DP3A 3MY9A 3TTEA 1TWIA 4CQ9A 5A2AA 3WQWA 4MNMA 3LCFA 3SI9A 1VJIA 1UWTA 3MV11 3W7MA 3ITGA 2VM8A 3DHDA 1US0A 1QPNA 4U31A 3ITVA 2XDFA 1DE6A 1J9YA 2PGRA 3V5FA 2DDXA 2WO5A 1YHTA 1W3IA 1EGMA 5LA2A 1BPLB 2FKPA 2QDDA 4FI4A 1M7XA 1X1ZA 4IMGA 1QOQA 1U22A 3W1MA 3P8JA 2VYOA 4NRSA 2C13A 4L4LA 3VDCA 5J5DA 1E71M 3LOTA 3LLFA 4BS0A 3ALGA 1OG6A 2I17A 4H01A 5FA5A 3FFSA 3N12A 3QGKC 2IMRA 3GTXA 4OUEA 2YDAA 1KCXA 4Q4SA 4GGHA 4UTJA 3S2LA 3LEPA 4S3CA 2NVDA 2Z2AA 3PZUA 2CHRA 4J2MA 3AIBA 4HZ6A 4UTWC 3M4HA 3PNUA 2DSKA 3GVGA 3CZEA 3VIPA 4HA1A 2EPKX 2QGYA 1X38A 4AYSA 1YADA 1EJ7L 3ARTA 3WQFA 4MFEA 4W86A 1TWDA 1KBBA 3H2CA 3U7VA 5I02A 3PZMA 1ZPTA 1BYAA 4JN6A 3E6EA 3SQMA 1JCLA 4GO9A 1XLMA 4CCCA 5RUBA 1BTMA 1RD5A 2ZRYA 2EAWA 3QKEA 2EKGA 4ICNA 4G5DA 1C8VA 2C15A 3FS2A 4XAYA 4BJHA 2CLFA 4WD0A 5FAGA 8XIAA 1KLZA 1KCKA 4U28A 1N82A 3D5HA 4NUWA 2JKEA 4AY8A 1MEWA 1YTDA 3B8SA 3MSYA 2PDLA 4JHZA 2EEXA 3S1WA 2E0PA 3ANYA 1X6LA 2DT1A 2J6VA 3LXCA 2Q8LA 4CQBA 3DC0A 4DO7A 4YMZA 3H53A 5CG0A 4E8DA 1SU5A 3MC5A 3VXGA 1WKYA 1XF0A 3H6OA 3QXBA 3VD5A 1TZZA 2VC5A 4X9YA 5BRPA 1NM9A 1TA3B 1EF2A 4CVUA 3QBUA 2E6DA 3CZJA 1V8EA 4NNAA 1TJ2A 4KFOA 1TV7A 4NHVA 1DPMA 2E68A 1ISZA 4HPGA 1YBQA 2IW0A 2BB0A 5C5YA 4AHPA 4S3KA 3TAKA 1LM1A 3I7SA 3WEZA 4WZHA 4DUWA 2R91A 5KSWA 5BMXA 4Z2HA 2NXHA 3UZWA 5CH9A 3AYSA 2PC8A 4G8TA 3WK2A 4ZFCA 3LQLA 4X2PA 4FO4A 3QSRA 4L61A 4X63A 3CIVA 3FYYA 2J13A 1HW6A 2V9DA 2DZAA 2XZ9A 3PPFA 5DF0A 3RJYA 4TVCA 4ZL1A 4JQ2A 3IGXA 3A3XA 3F4CA 1T40A 4IQEA 1MW3A 1UKTA 1W5PA 3QTPA 4C90A 2RDWA 1A5KC 1KGUA 1X8CA 4Y96A 2D2HA 2FZ8A 3UA4A 2FJKA 4JKMA 1UPMB 5C7HA 3RLUA 2PTYA 1MXSA 1V51A 1FX6A 2DY3A 1L8NA 2NQLA 2R24A 1GKQA 2Y24A 2DH2A 3O0FA 4DB7A 4BI7A 1H3GA 5CSUA 3KLKA 5C9ZA 2DU2A 4YVVA 4KCWA 2XWEA 1HJWA 2CWNA 1EF3A 3GZAA 5ABGA 1EFZA 4Y2WA 4AQLA 3UG5A 5HATA 1W1PA 4LUYA 4N9DA 4EK7A 3M16A 4FR6A 1V93A 3BPWA 4JQ3A 4RDVA 5FF3A 2V38A 3VIGA 2GGGA 3W7DA 4D8LA 2BVDA 4E2VA 1A49A 1K9EA 3ZIZA 1I0DA 4FS9A 3D3AA 3WLSA 1E0VA 1GW1A 3PUOA 3BG5A 3WLLA 3LTSA 4A8LA 4GJJA 1MWOA 2I14A 2FTYA 3BMWA 3H2EA 3BMXA 2DSUA 4A8IA 2A3CA 1EQPA 3ID7A 3C6CA 3KBVA 1A4LA 5EGRA 2OX1A 1CW2A 4CVWA 4YN5A 2Y85A 1JF6A 4O11A 1UD3A 3IV8A 3R58A 3OJGA 1KM3A 1B4EA 4V33A 4QCEA 2QMKA 3E3HA 4REQA 3AUOA 3UXLA 1LG1A 3E0LA 4O28A 1EIXA 2UY3A 1R87A 4XVEA 5D8WA 4P7OA 3APYA 2ZZ5A 1XHGA 3GFYA 6XIMA 4HCDA 4ZGYA 1B54A 3GH4A 3O2LA 3RU8X 1EPXA 2JE8A 3NCOA 3O07A 4NSBA 3MMDA 4UCFA 3ZLHA 4UTIA 2QHAA 3W82A 1PIFA 3CUHA 2OFJA 1F3EA 4B5WA 1PB0A 3PZVA 3S42A 3NL5A 4C6KA 3IIXA 1N8WA 3LS9A 3RITA 3M0IA 2FZMA 1KXTA 2DJLA 2O9RA 5EMMA 2G37A 2ZX5A 3AYVA 2PD9A 3MSGA 3S6DA 3W6MA 4MB1A 1JD7A 2X42A 2AL2A 3P8IA 3EX4A 2QKFA 3HGOA 3LPOA 3W1AA 3BLKA 3T09A 5PTDA 2GWGA 2F84A 2OLHA 3BW2A 4E4FA 3W02A 4KEVA 2VGBA 1WKDA 1UR0A 1XI3A 4I3GA 1XFBA 4M6UA 4BR1A 4FNSA 3UNDA 1JGMA 1WKFA 4KERA 4RV8A 3C52A 2GSHA 3NO3A 3EDDA 1H0GA 3VFLA 5G1MA 1MO0A 3NM1A 2NV2A 1J18A 1K9TA 2CHOA 1NELA 5J04A 5H8UA 2ZIDA 1NJJA 3FJLA 2GYIA 3T4WA 4DAIA 4UTHA 2PF0A 3PBWA 1P0DA 4FOKA 4R5EA 3G6MA 3VGFA 1YEYA 2XFWA 3BW3A 2P8CA 4Z2JA 1D2KA 1XPYA 3UJ2A 1V0KA 1JNDA 1K7FA 2P88A 2QCDB 4LYQA 3L4TA 1ZFJA 4I8DA 3TJLA 2WNWA 1HJUA 1FCBA 1VIZA 3T0TA 1S5VA 4HMEA 3LI1A 4A05A 1ADOA 4AVOA 4IH3A 3UCQA 4K2SA 3IRSA 4AEOA 3MO7A 3W26A 2OCZA 3FGCA 1XIEA 2V8ZA 3E2VA 3GYEA 3CC1A 1WB0A 4DBEA 4MWAC 2WSRA 3WF1A 2WC4A 3W6LA 4PMNA 3WNPA 1ZJHA 3CV7A 3CV6A 4MHBA 1L2UA 1KBIA 4E4UA 2TAAA 3L7RA 1MNZA 4QNWA 2GGEA 1Z8AA 1YTEA 4ICMA 4D6FA 4C6MA 2OSYA 1HJSA 4BY3A 1GYLA 3VZZA 5FF2A 4HK6A 1NP2A 5LHFA 2RGMA 4BEUA 1Q8JA 1WOBA 3QKZA 4UWMA 2BOEX 3S6TA 2A2IA 1J6PA 2WZTA 5D2XA 2HBXA 2ZC8A 1IEXA 1FFRA 1EJVC 2DGAA 3HJZA 4XBSA 5F4WA 3QMRA 1TVPA 2V2DA 1FY6A 1ODZA 2ISWA 3CL8A 3EOLA 3UPBA 5T8GA 3PTQA 1JAKA 1H60A 1Q6RA 1S3TC 3KCOA 5K9CA 5XIMA 5GNZA 4IP4A 5FKYA 3GM8A 5BXSA 1GNXA 1K8YA 5E70A 1P6WA 1A80A 1JD9A 3EOUA 4Q4PA 2FVKA 1VB9A 3QLLA 3EPMA 4QG6A 2A6LA 5HA7A 3KP0A 5DRIA 1DHKA 1FP8A 4C1LA 4P7RA 3THQA 1EZ2A 2PDUA 2VGIA 2PDNA 4D6JA 4L65A 1CXIA 3E0FA 4AH7A 3EWYA 3F03K 4JTQA 2VNCA 5G2IA 4NYUA 4UTWA 2LLEA 2DORA 3M0XA 1MXDA 2GVLA 4UTKA 3CBWA 1Q4NX 1GVQA 1HT6A 5A8PA 1JIBA 1OQFA 2DZBA 3VZXA 4Z42C 1V6VA 2C19A 3BC9A 4UQAA 1AMKA 1IZCA 4WCJA 4CN6A 3GU1A 4DNHA 1ZUAX 2EG7A 4XIAA 3CHCA 4RNJA 3WNMA 3CEPA 1HL9A 4K68A 4AHQA 3ORWA 1TYGA 1LOSA 1DEDA 4TO8A 4XTIA 1GCYA 1P0EA 3IANA 3A64A 2AAAA 4ATWA 1IXOA 1RA5A 3M0HA 2GVYA 2VL4A 2QV5A 4IFKB 1AQ0A 5LNRA 3LCIA 3WUFA 2VCAA 1I8JA 1KR1A 4LAOA 3LPFA 1K7EA 3MZ2A 2XFFA 3RYSA 1UP2A 5ABTA 4O4WA 4TOQA 3EXRA