4ZENA

Structure of gan1d, a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
474
structure length
474
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 192
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zenA00
2J7FA 1KXHA 1H0IA 2ZXQA 2F61A 5JBEA 2GDUA 1UR8A 3GBEA 4PMQA 4FK9A 2VCAA 3K4AA 1UQZA 4U33A 2XJ7A 3SCPA 4ZEPA 2A3BA 2VOTA 2UWFA 2DQXA 2EBNA 2ZX7A 2F8QA 1D7FA 3ARPA 4W7WA 1BHGA 4AD0A 2VCBA 4H8VA 1ZL1A 1WZAA 1B1YA 4AMCA 3WDHA 3W37A 1XSIA 3BAWA 4UZUA 1R85A 3SCVA 3VIIA 2J62A 3VIFA 1E6PA 3EYPA 1B90A 4M56A 2J77A 4E8CA 4UQEA 1UR9A 3ZM8A 2QLYA 5BXTA 3L4WA 1M53A 2XVKA 3T0AA 4CU7A 1YHTA 1E72M 4UQBA 4ZFMA 1WZMA 1RP8A 2CITA 4XB3A 3K8LA 4JFSA 3PZUA 3TONA 1HT6A 1NWSA 1WNOA 3M6DA 2VO5A 1NOWA 2XGBA 1W9BM 1K9EA 2CYGA 1OSEA 5GNZA 3WL0A 2D0FA 3UESA 4D6DA 5CPQA 3CUJA 4W85A 4ZENA 1BLIA 2VX6A 1JZ7A 1B30A 2JIEA 3FAXA 2ZX9A 1EGZA 2XUCA 4PCSA 3AMGA 3THCA 3CTTA 4MNKA 4D6HA 4BCEA 4Z2HA 3MSGA 3DYOA 2WMGA 3MMUA 2XTKA 2VNCA 1W3JA 3WELA 4U3AA 4RE4A 4AYSA 1QW9A 1G01A 1QNSA 5M17A 1TVPA 5EFFA 4FLRA 1CGWA 4IPLA 1UR1A 5IFTA 1H09A 2J47A 1B3WA 1QI2A 2X0YA 1ZS2A 4QCEA 3AFBA 2BVTA 3PZQA 1PX3A 1H3GA 5HDRA 2DDXA 5A6JA 2DSZA 2JFEX 1NH6A 3VD9A 3RJYA 4PEEA 1OGBA 1V6XA 5DFAA 3U7VA 5CJ5A 3U5UA 4TXEA 4B16A 3ZT7A 3POCA 1KGUA 2ZXBA 1E4MM 3IAPA 3ALGA 4W86A 1UKQA 2XGIA 1VJZA 3QOKA 3FY1A 1CLXA 3MMDA 3ZJ8A 2QPSA 1C8QA 2J74A 3BAXA 3WH7A 1TFVA 3WQVA 1UHVA 2AMGA 3T2QA 4OZOA 2NW0A 2WLZA 2GSJA 1GOKA 1Q6CA 2WC4A 2GJRA 2BY1A 4HPHA 3PTKA 3PZIA 3LPGA 3VIGA 4C7FA 2D0GA 1CWYA 1XHGA 3W38A 5A8PA 1UA7A 1QHPA 3TTSA 1JNDA 3SUTA 2FDMA 1W1YA 2ZIDA 3OLDA 3I3DA 1J0HA 4MAZA 5DT7A 1VJSA 3CHDA 3GYCA 1TZ7A 2DSWA 1J0YA 2PI6A 2DH3A 3F5KA 1X1NA 1E6QM 2EXOA 1H5VA 3AHVA 3ECQA 1V6UA 2IXUA 1C8YA 4CCCA 1VEPA 1W9XA 1WZKA 2PWDA 1CGXA 3EBVA 4WJXA 4XZWA 2WCAA 2VTFA 1YQ2A 3ARTA 4J7RA 1XYFA 4DM2A 4PTWA 1JAEA 3BLPX 1E70M 3WDPP 1TA3A 2GDVA 2D0HA 2NT1A 1PJ9A 2BVYA 2WMIA 4PMVA 3ARQA 3OLGA 4R5EA 4R27A 4AIUA 4HOWA 4NRSA 2G3JA 3EDDA 8A3HA 3WF1A 3CIVA 3CHEA 2BV9A 1KGWA 1WDRA 1ISXA 1CXFA 3WEMA 1EDQA 1E0VA 3CZGA 4C7GA 3SURA 4F8XA 4M8UA 1CGVA 4MADA 1HN1A 4FLOA 2WK2A 3WUFA 1XD1A 3IJ7A 3BAKA 4Q22A 3QGVA 1AQMA 4AZ5A 3VILA 1BYCA 4RE2A 3WQ4A 3WNKA 3E1F1 3AHZA 1V02E 4F9DA 1UKSA 1V3JA 4YN5A 3WFZA 3VMPA 3WKZA 1ITXA 2WZEA 3AIUA 1B3ZA 2VRQA 3VD7A 3CUIA 2X1IA 1C91A 2DSVA 4EAMA 1JG9A 1BVZA 2EPNA 2NSXA 4H8UA 1QNPA 1SMAA 3PN8A 4MDOA 4CD6A 2V38A 2V5DA 1DWIM 3VTRA 3K1DA 2W91A 3WENA 3W27A 1JXKA 3WD1A 2XFRA 3AZRA 1AQ0A 2PB1A 4OOUA 1HJXA 5IXEA 4NZCA 1TVNA 3VUPA 1SR0A 4ATWA 3W0KA 4V28A 1OIFA 1UD3A 2WVUA 4IM4A 3VIMA 2W5FA 4HA1A 1UD2A 3QHNA 1UKTA 2V3GA 2PWGA 3G6MA 4UQ9A 1UR4A 4W8AA 2W61A 1NWUA 2E3ZA 4LPCA 3MS8A 1GOWA 4E4PA 1FH8A 1BYBA 4GKLA 1PZ3A 4DUWA 4E2OA 3T09A 3VX0A 3WNNA 4D6CA 4JFTA 1QBBA 1XRVA 2G3IA 3N18A 3VGDA 1OD0A 3T2OA 2D1ZA 2VZOA 3VIOA 5E0FA 1VFMA 4ACZB 1B2YA 1KR1A 2OWCA 5BXSA 4U2ZA 4P8WA 3MKKA 1LWHA 5C8BB 1NOUA 2DT0A 1GOMA 3WN6A 3BCFA 5E0CA 1I1XA 4AZ7A 1V0NA 1E3ZA 2BHUA 1OINA 5BXRA 2ZX8A 1E1EA 7A3HA 1JDCA 2J4GA 1QOXA 3GXIA 4WLCA 4HOXA 2PC8A 3VDBA 2PBGA 4HMEA 3WL1A 1KBKA 5LA0A 2BHYA 4J27A 1VEOA 2BY3A 1LWJA 2RGMA 1FH7A 1W1VA 4TVUA 3TA9A 3ZQ9A 2DT1A 4RL3A 3CUGA 4H04A 1V08A 2UY4A 3CO4A 3ZSTA 3ZO9A 3B9DA 1GNXA 1GORA 5D8WA 1GHSA 4UOJA 3RM9A 4TTUA 1FH9A 1TR1A 1KB3A 1WDQA 3GDBA 4JIEA 1BSIA 1HIZA 3ALFA 4QLJA 2J25A 3UCQA 3VDHA 3L4YA 3CZKA 1E3XA 4PTMA 2ZUMA 4CN4A 1B9ZA 1GOIA 1J0ZA 2OSWA 2DIEA 4P8UA 2DPEA 2YLAA 4CN1A 1F4AA 5CPTA 5IHSA 1JYVA 1HJUA 3VU2A 5ABFB 2G4FA 4D6FA 1UYQA 3OLIA 4HZ6A 1H4PA 5M5DA 3UR8A 5A6BA 4D72A 1JF5A 5IDIA 5I0DA 4DUVA 2BS9A 4TOQA 2PWFA 5FD0A 1W3KA 1Q4NX 2UY5A 1UH2A 4AZHA 2QMKA 1UKPA 1MQQA 2XSAA 4BF7A 3VDCA 2D24A 2VZVA 1W3LA 1PZ2A 5ABEA 1NWTA 2X2YA 5I79A 1NP0A 4QLKA 2YL5A 2A3HA 2J7HA 5D9NA 3OGRA 1HJSA 1PAMA 3GM8A 4Y7EA 4PN2A 5ABHA 1NWRA 1UD4A 1GUVA 2X0HA 3WNOA 2WM0A 1GOOA 1E6NA 5KEZA 3I3EA 3ZR6A 1XH2A 1EOKA 1SYTA 2V5CA 4CN6A 1QHZA 1UH3A 4JHOA 3CZEA 1TUXA 2EPKX 2GJXA 1JDDA 3CUFA 3KEHA 1K9FA 1UWUA 1LL6A 3ZJ6A 5C71A 2YA0A 1VAHA 1W1PA 2YDQA 1CXKA 4HU0A 5FCZA 3I3BA 3PBGA 5EBAA 3LPFA 4URIA 3N13A 5AYIA 4CUCA 4KGLA 1W2PA 3HMCA 2VL4A 4EKJA 7TAAA 1HVXA 1UA3A 1I1WA 4MPKA 1KXQA 5HPOA 3PHAA 3LPPA 3WDRA 4A3HA 4B15A 1OB0A 5A6KA 2X09A 4MB1A 1R8LA 1XGZA 3SCTA 4ZE4A 5A8OA 2E9LA 2WHJA 2YA2A 2YL8A 4DUXA 3VD3A 1R86A 2YJQA 3AXXA 1QNOA 4PBGA 2YLLA 1UZ1A 4QFUA 1BYDA 1H0GA 3RIKA 4UFJA 4WKHA 1WAWA 1BPLB 4X0NA 3SEPA 3WDJA 1EHAA 1CYGA 1EH9A 1O6IA 6TAAA 2W67A 4PRWA 4LXFA 2BVDA 1MWOA 1W9PA 4A4AA 5IFPA 3EDFA 2CXGA 4OKDA 4JKLA 4MAVA 1NP2A 4AD4A 2D3LA 1E56A 4UFIA 1MW2A 4NRRA 3WEZA 4TVCA 4PMOA 4J3VA 3BC9A 4OBSA 1VFUA 2CKSA 2J7BA 3WF4A 1R7AA 4FMVA 4L4PA 4B9ZA 1E15A 3WH9A 1GQLA 4FLQA 3G6LA 4M81A 3T0DA 1LF1A 4W88A 1V0KA 3UG5A 5M03A 4MNMA 5D9MA 2XG9A 1B3XA 1U33A 5EB8A 3A4AA 4AXNA 1SMDA 2WCSA 4EK7A 1RPKA 4CD8A 1GPFA 2GK1A 2X05A 3WD2A 1CENA 3AIQA 2C7FA 2E0PA 5M3WA 1DWHM 3U57A 1OGSA 5CXPA 3POHA 3LPOA 2GUYA 4NSBA 3W53A 3BGAA 3AIBA 2OLHA 3OBAA 4AD2A 3L4UA 1IV8A 3K4DA 1V3IA 3O9NA 1R7OA 3GXFA 2FHBA 4LYPA 3BMWA 4GI6A 3DHUA 2XIBA 1JFXA 3SCWA 1WB0A 3A6OA 1UWIA 4S3KA 1WE5A 3OIHA 3VNZA 1W91A 1E4NA 4D6GA 4BQ2A 4CD5A 5EMYA 3F4VA 4PSRA 1CPUA 1UKOA 3VGEA 2VVNA 1UR0A 1PX4A 3QOMA 2EJ1A 3VPLA 3WD3A 3K8KA 1BYAA 2Y8KA 3VO0A 3NCOA 4BQ4A 1JXJA 1JGIA 4GPNA 1KCLA 3UG3A 1CDGA 2WVVA 5FKYA 3BMVA 3SCOA 2YBTA 3CGTA 3PTQA 1JD7A 3WUEA 1VRXA 5JBFA 4HU8A 1XH0A 2WWDA 3W82A 2XVPA 5EFDA 4QDMA 3VGBA 1PEZA 1XV8A 2C0HA 4P8XA 3AZSA 3DHPA 4M24A 3WH6A 4IISA 1JNEA 1G5AA 2E8YA 1W9VA 4AD3A 4D6IA 4AZGA 3AICA 2XIIA 4UFLA 1UD8A 1HP5A 1KQYA 1D2KA 1E0WA 3B9AA 3MUY1 4A3YA 3VD4A 3U5YA 1XCWA 5D9OA 1UWTA 4WSKA 3UERA 3SUUA 2X8RA 1CTNA 2Z1KA 5GPRA 4P7RA 2D3NA 1E9LA 2JALA 3NSXA 3M7SA 5CPSA 2WANA 2Y24A 1E6RA 3L4TA 3RMEA 4AZCB 3VKKA 3VGGA 2RGLA 3HJEA 3OZOA 2WHKA 3WF3A 2PWHA 3AS0A 4J3WA 4GI8A 4PYSA 3WH5A 4QAWA 3BAYA 1JZ5A 4GXPA 4PMUA 4GINA 5E6YA 1XSKA 1EA9C 3ARRA 4W8BA 1J10A 4UR9A 5CSUA 5TD4A 3ZIZA 2WMKA 4PMZA 2XWEA 2DT3A 5CG0A 3BSGA 3AQUA 3MO4A 1J11A 4PTVA 2CKRA 3DYPA 5AYBA 2XM1A 2BNJA 1JIBA 3A4XA 4J3XA 5LYRA 1M7XA 3EDEA 1UD5A 4AWEA 1A3HA 4CVUA 1FOBA 2ZUNA 2EQDA 1NQ6A 4K68A 2DEPA 4PMRA 4TVDA 2XHYA 2D2OA 2O9OA 1D3CA 4DWSD 5DT5A 2WW5A 4DWSB 5I77A 2WHLA 1DWGM 2WMHA 4AIOA 4E8DA 3WMCA 4KRTA 3OGVA 5HOSA 1CGYA 1I75A 4PCTA 3BAJA 4AISA 1QW8A 3AMKA 3FW6A 1JF6A 3WUGA 7CGTA 4PUDA 2CETA 2WVSA 3GH4A 3MU7A 4WKAA 2OSYA 1ECEA 3RM8A 4YPJA 3B8SA 4UFMA 2G8ZA 4HMDA 3WY1A 2JEQA 4OBRA 4PSPA 5HXMA 1MQRA 3AHTA 4U5KA 2B31A 1CIUA 3CMJA 4M1RA 5FOOA 3W25A 1UZ4A 2Z1SA 2VURA 1WZLA 2DSKA 2A3EA 4RE3A 4MB5A 3IANA 1O7AA 2D22A 2HISA 4JFUA 1CLVA 4GIAA 2OWWA 4AZBA 3NUKA 2A3CA 2QMJA 3RO8A 5E09A 5JIPA 3WIJA 2CBIA 4HTYA 2JEPA 2E9BA 3WNLA 4HA3A 2J8FA 2PWEA 5BROA 1E43A 3MANA 1EOMA 5D9PA 1EXPA 1UWRA 1HJVA 3JUGA 3ZMRA 1JD9A 2D20A 4B9YA 3A3HA 4D6EA 2V3FA 1WO2A 1KBBA 2BY0A 4H7VA 3F5LA 1E4IA 4GO8A 3VIHA 3W6MA 5A94A 2EPOA 2WBKA 4J3UA 4AD5A 1BTCA 3VNYA 3MMWA 3AYRA 1JI2A 1XH1A 3TP4A 1K9DA 3A4WA 2OYLA 5A69A 4S3JA 4P7OA 4ATDA 1H41A 5I23A 3OB8A 4V2XA 1EO7A 1W1TA 4F66A 4P7NA 4W84A 4M29A 2Y4SA 4CKQA 5GQBA 2WSPA 3RJXA 1CZ1A 4W5UA 2VZTA 1P6WA 4MB3A 3VM7A 1QI3A 3CHCA 4JKKA 4Z2LA 4PMDA 4GO9A 5D8ZA 2Y8VA 5A2CA 1CNVA 3RDKA 3VIKA 4GZEA 4MDPA 1EQCA 3AMLA 3NDZA 4N42A 2FGZA 2GVYA 4BZYA 5CQ1A 5A6MA 4UQDA 1E6SM 3A47A 3AXIA 3NJ3A 2WKGA 2JE8A 4V27A 1IZKA 1WP6A 1CXLA 5JIWA 5A2BA 4HZ7A 2O9TA 2XFYA 1GVIA 3GBDA 1CECA 4KWUA 4C7DA 1QNRA 1W3HA 4PTXA 3VX1A 4N0RA 1MVYA 2CIPA 2J8GA 4J28A 1GCYA 1Q6DA 3BAIA 1US2A 3SIMA 1W9DM 2WC7A 1C93A 4CCEA 3VVGA 2J7EA 3K8MA 3W29A 1C3FA 3RILA 1LJYA 4M82A 3WD4A 2CEQA 4Z2JA 2G3NA 4P8VA 2Y5EA 3QHOA 3UG4A 3M46A 2VR4A 1IT0A 3SUWA 4UQCA 3TTOA 1CXEA 1GJWA 3WMSA 2IXVA 1S46A 1ISYA 5AC4A 4H2CA 1H11A 4W7VA 3CLWA 4XZBA 1OM0A 1E5JA 4WIWA 2DIJA 1MYRA 1E73M 5IHRA 3ARXA 2WBGA 4D6JA 1PPIA 4ACZA 1HL9A 4UZSA 5CZKA 2OSXA 3PZNA 4XV0A 4UFHA 3SUSA 3DECA 1LG1A 4CD7A 2CBVA 1UWQA 2FGLA 2WNWA 3VINA 5CSYA 4AW7A 3BLKA 2E8ZA 3WEOA 3VIPA 1JYXA 1ZBVA 4NI3A 1OWQA 2ZOXA 3WQWA 2VX4A 2E9MA 1HL8A 4MTVA 3GZAA 1NOFA 4FLSA 1E6ZA 4HMCA 3AYSA 2V3DA 1OT1A 1W32A 3B9EA 3PZMA 3ZOAA 1CGTA 4P7QA 4OIFA 5CLTA 3ZJ7A 5A1AA 1W2VA 4X0VA 2TAAA 1QNQA 1B31A 4BS0A 3WBAA 5E9AA 4W7UA 2VT0A 3AOFA 1XC6A 4H8HA 5F7UA 3KL3A 1ZBCA 3ARZA 5BCAA 2D23A 1V6YA 3SCQA 1FA2A 4MNLA 4WK9A 2DT2A 2ZUVA 1ESWA 3CH9A 3UEQA 2VZSA 5DEZA 4W5ZA 2UY2A 1HX0A 3AIVA 1EDTA 4JFWA 3MV11 2ZE0A 1C92A 3M07A 1K6AA 2OYMA 4XX6A 2O92A 2ZWYA 3CZJA 4L4OA 4YHEA 3NSMA 4HPGA 1G9HA 1V3LA 4WSJA 3WF2A 5ABFA 1GW1A 2WZHA 2CHNA 1B0IA 3SCNA 1Q6GA 2YA1A 3L2MA 2C8NA 3D3AA 2WB5A 2FHFA 1HXJA 4TUFA 2VQUA 3APGA 1GHRA 4AIEA 1LG2A 4MJ4A 3FN9A 2XVLA 2BXZA 2GJPA 2WVVB 1ODZA 1GQJA 1HJWA 1ODUA 4W93A 3W24A 3N1AA 3BSHA 2XYLA 4D1JA 4YHGA 4LX4A 1KGXA 3OG2A 3KL5A 2DH2A 1GVYA 3PZ9A 5BRQA 2Y2WA 5LA2A 3RPMA 1F4HA 3HN3A 3PZTA 4WKFA 3KWXA 4HP5A 1CBGA 1V6VA 5I3DA 1QI5A 4MNJA 4CGTA 1Q6FA 5E70A 1DEDA 2MANA 1FFRA 3W6LA 1JYWA 1DWAM 1C7SA 1WDSA 4BA0A 1NM9A 1VB9A 3PZVA 3SCSA 1ZBWA 3WDQA 1JZ8A 4J3TA 5A6SA 2ZWZA 1J18A 2VC9A 8CGTA 3NYDA 2BHZA 1N82A 1BGGA 4PUEA 1VFOA 3NIYA 1CXHA 1C90A 3MUZ1 4IPNB 3WMBA 2E4TA 5JBDA 1TE1A 1FFQA 1M04A 1EHNA 4OUEA 4Q7NA 1MW0A 1V3KA 4MB4A 5I24A 3QR3A 2O9PA 2W92A 3FAWA 4LGXA 2JF6A 2ZICA 1J12A 2WPGA 3UETA 1TA3B 1JDAA 1MFUA 3PTMA 1BGAA 3GH7A 2WMIB 3VOCA 3K46A 5DO8A 1J01A 1UH4A 3GNPA 3WQ5A 1G0CA 2V3EA 1JI1A 2OWXA 5GNYA 1HKKA 4U2YA 3OA5A 1IZJA 2YL6A 4OOZA 1VEMA 2YDSA 4HA4A 4TX6A 2ZXDA 1C7TA 3ARYA 1J0IA 3VGHA 1HP4A 3IJ8A 2UY3A 1ITCA 2HVMA 4F9JA 1QBAA 5D4YA 3WH8A 1GQIA 2VX5A 2VCCA 3KZSA 1PBGA 3RM4A 3WDIA 1WKYA 1FHLA 1GOQA 4AEFA 2J7GA 3AISA 2VMFA 3MSDA 2WLYA 2VRKA 4OJYA 1JFHA 5I78A 5FIPA 3VDAA 4U5IA 1Q6EA 1OCQA 1L8NA 4CD4A 1FHDA 1OT2A 2F2HA 2XWDA 5A8QA 3ARWA 1GONA 2W4XA 3GXDA 2CCRA 3AXHA 2J79A 4FF5A 3AMCA 2ESCA 3EMZA 1JL8A 1XYZA 4Z2GA 4U3CA 1ISWA 4HZ8A 3WD0A 3AMDA 4KMQA 5A2AA 2JIWA 1QI0A 4D71A 2XFFA 1MW1A 3D5HA 3W26A 1EDGA 4AY1A 3KL0A 4B3KA 4H41A 1WDPA 2YDRA 2YL9A 5LA1A 1EO5A 3VGFA 5AC5A 3AI0A 4DWSC 3CZ8A 1V03A 3AIWA 3MUAA 4UOQA 1PX8A 4UOZA 1QHOA 1OBAA 2J7CA 1A47A 1DTUA 2VI0A 4JCMA 4LYRA 4WF7A 4CCDA 1X6NA 2ZXAA 3NDYA 3S6TA 1H1NA 1BG9A 2BFGA 1KXVA 2WXDM 3VM5A 2PF0A 4AZIA 2CNCA 4CU8A 4JZ5A 2WHMA 2WAGA 1V3MA 5I5RA 4JL2A 3RCNA 3BCDA 3ZR5A 4KGJA 1E0XA 1UD6A 1PIGA 5CGTA 3ZJKA 4QCFA 3F5JA 1J0JA 1HNYA 1MXDA 1QVBA 1M03A 2WVTA 3O6AA 1JZ4A 1SFSA 2Q8XA 3OZPA 3GTNA 4UTFA 3L2LA 2AAAA 3N15A 3NSNA 3VIJA 5BWFA 1AMYA 3TTQA 4ACYA 4TTGA 1BAGA 3HU7A 2G3MA 3PZGA 1U30A 5HBFA 3WSUA 4CVWA 1U2YA 1GQKA 1ISVA 2EEXA 2WCGA 3AJ7A 1XSJA 3GNRA 1G94A 1FP9A 3SUVA 1QPKA 2XSBA 3N17A 1TCMA 1NARA 1C8XA 2ZUSA 4TX8A 2BXYA 5I6SA 4IUGA 2QHAA 4U31A 2VUYA 1GZJA 4NF7A 1Y7VA 1TMQA 1EIBA 4UCFA 1ISZA 5ABGA 4JHZA 4ZE5A 2XPKA 2CHOA 4AZCA 3WQ8A 1V6WA 3AZTA 3QHMA 3VMOA 1X6LA 3MV01 2J7DA 3AHYA 1CXIA 1H49A 3CUHA 3OGSA 4P7LA 4W89A 1AVAA 1PIFA 1K9TA 4AD1A 4GZJA 3OLEA 1L0PA 4GZIA 2VRJA 1MW3A 1VIWA 5BXPA 3T2PA 5JUVA 5DMYA 3J7HA 5A6LA 1UG6A 5A6BD 4EE9A 2FH8A 4D1IA 3GNOA 2CESA 1KWGA 2NT0A 3AS3A 4B3LA 1KWKA 3BXWA 3AROA 2FH6A 1JYNA 2G41A 5I2UA 4J3SA 3VD5A 3FNDA 3EMCA 3SCUA 1J9YA 2VR5A 1KXTA 1ZJBA 1BVNP 1JZ2A 1MFVA 2J78A 3N04A 3FHAA 4ATLA 1KCKA 1CGUA 3WNMA 4PMNA 2WZIA 3AIEA 1US3A 2WSKA 1J0KA 1V0LA 1V0MA 1VFFA 4ZXOA 3ZSSA 1JZ6A 2W63A 4GQQA 5FL0A 2OYKA 1G1YA 1UQYA 1E6XM 3EMQA 4DWSA 2J75A 5BYWA 5HNNA 5E6ZA 4LYQA 2QV4A 1BFNA 5GNXA 2CERA 2CPUA 1DWJM 2YOCA 3LMYA 3W4RA 3WNPA 2GJXB 1KQZA 4Z2IA 3IAQA 1BQCA 1XCXA 5DF0A 3FXYA 5BRPA 5A3HA 3EDJA 1E1FA 2BY2A 1HJQA 2EPMX 2WC3A 1UUQA 1Z32X 4BQ5A 3ARUA 2YIHA 5A8NA 1HKJA 1DP0A 1KFWA 1HF6A 5FL1A 3L4XA 1HVQA 2WKLA 2ZUUA 2W66A 3CBWA 1TG7A 2QF8A 3CZLA 3N9KA 1DHKA 2FHCA 3L4VA 5KZ6A 3W28A 3CMGA 2GFTA 4PMXA 1OIMA 3S2CA 3DYMA 1VBRA 4UNIA 1LL7A 1RP9A 5AY7A 5A8MA 4PMYA 1E71M 1V3HA 3AHXA 1UWSA 4GQRA 5A95A 1BG4A 3WFLA 3L4ZA 1JZ3A 3T08A 1RD6A 4M80A 3ZT6A 1M01A 4F79A 1ZB5A 3AIRA 2XM2A 1HKMA 3BH4A 2DSUA 5HPCA 1LL4A 2XVNA 2EPLX 1W9UA 5CGMA 5C70A 2YKKA 3VMNA 3GXMA 1LQ0A 2WYSA 1XD0A 5CLWA 1BF2A 1VENA 1GJUA 3SCRA 4JFVA 3IJ9A 4BQ3A 1H2JA 3WF0A 3N12A 2ZX5A 2IUZA 3MUIA 4AEEA 4LQ1A 1OGGA 1DWFM 2VJXA 1AQHA 3U7BA 2VVSA 1R87A 3FHQA 3W81A 1OD8A 2YBUA 2VZUA 4KRUA 2JF7A 3O2LA 2AOSA 4MJ2A 4EANA 1UOKA 2ZUWA 1LLOA 3PZOA 3IK2A 4QP0A 4UFKA 4GI9A 1E40A 3WQ6A 3N11A 2DGAA 4ML4A 2GK1B 1ZBKA 3II1A 2ZUTA 1JAKA 6CGTA 1V02A 1B3VA 2WMFA 3AS2A 3CHFA 4AZ6A 1E4LA 1CEOA 1FP8A 2WWCA 3WUBA 2VX7A 2A3AA 1B3YA 3AS1A 1MQPA 3EDKA 1KR0A 4ZXLA 3KE0A 2CBUA 4JCLA 4DM1A 2QPUA 3CPUA 4HOZA 1WPCA 1E55A 1HKIA 2W62A 4JKMA 4UQAA 4X9YA 1ZU8A 1QI4A 3DC0A 1EQPA 3TOPA 3THDA 1MXGA 5ECUA 1WCGA 1ZJAA 3ARVA 3GH5A 2ZX6A 6A3HA 2O9RA 4Z2KA 1VF8A 1VBUA 1UR2A 2XVGA 2CBJA 4XUYA 4CU6A 1E5NA 9CGTA 4QLLA 2PBOA 4AC1X 3UR7A 4KH2A 2EO7A 1RH9A 3ARSA 3TTYA 4W8LA 2E40A 4JL1A 5A6AA 2WMJA 3ZT5A 4JAWA 2VQTA 3WBEA 4W87A 3T0BA
chains in the Genus database with same CATH superfamily
1JVNA 2NLIA 4PEKA 3T0TA 1JCJA 3LHUA 1P1MA 3QLLA 1FCVA 3K4AA 3G0SA 4U33A 2F2KA 3UR2A 4ZEPA 4LH8A 3KCJA 2WQDA 3GDTA 2UWFA 1VIZA 1D7FA 3H4WA 4YL2A 4H8VA 1ZL1A 3BWWA 4AMCA 2QGHA 4C60A 3VZYA 1H7NA 3Q45A 4NU7A 2C19A 3VIIA 1XPYA 5XINA 1FWEC 1TJ1A 1XGDA 3ELFA 2A85A 3FA5A 5GJNA 4JTCA 3L4WA 1M53A 2XVKA 3GR7A 4Y9PA 4UQBA 1VLWA 3BTNA 2CITA 3K8LA 4JTRA 4JFSA 3PZUA 3TONA 3MT1A 1NWSA 3WLMA 1K9EA 3DIPA 2YXGA 3FDGA 4CNUA 4C6CA 3QLDA 1BLIA 1JZ7A 2PDJA 5LIYX 5GJMA 2WSQA 1OYBA 3UXKA 1YPXA 2B4GA 3EPMA 3AMGA 4IH3A 3KWSA 4BCEA 4Z2HA 4LU0A 4AVFA 3H24A 2J9ZA 2VNCA 1W3JA 3NVTA 2X30A 3WQPA 3BW4A 4EF9A 4NT0A 1NAL1 1NY1A 5H2ZA 1H09A 4QIUA 2J47A 1B3WA 2X0YA 1S3HA 2BVTA 2A7PA 3LTPA 1PX3A 3SSZA 5A6JA 1O95A 2JFEX 4PEEA 3USZA 3SY1A 1L6FA 4TXEA 4DN1A 1KGUA 2DW6A 3KVLA 4W86A 3N3MA 1ZZMA 4YTUA 2I17A 2XGIA 2PAJA 3NOYA 1E9IA 1W3TA 4QJ5B 3FGCB 3FY1A 3MMDA 1FWHC 4PUMA 4S2BA 2QPSA 3OP2A 1SZFA 1FWNA 3BOLA 1UHVA 1XKYA 2AMGA 1FWDC 1QUMA 1M9HA 1KM6A 1Q6CA 2WC4A 2GJRA 2OX1A 5I3IA 3M0IA 3VI2A 2FZMA 3LPGA 4O0QA 3VIGA 2D0GA 5HNUA 1CWYA 3SO7A 1PKLA 3W38A 5A8PA 4BKNA 1QHPA 1JNDA 2C14A 3SUTA 4NVTA 4AQLA 1X98A 2EHHA 2OKOA 4WOZA 4RZ6A 2R14A 3PBVA 5DT7A 1Q45A 3WBYA 2PI6A 2DH3A 3LS9A 1FHUA 5C7HA 3GG1A 3DENA 2GGHA 1C8YA 1M68A 1VFSA 1VEPA 2Z6JA 3QY6A 3ARTA 2F6KA 1R3VA 3TN3A 1YE4A 3ZWSA 1POJA 3GKAA 4ZOBA 3T1GA 4LUTA 2F38A 2PDBA 3GD6A 1TJPA 2PTWA 2WMIA 2MUCA 2ZZ7A 2G3JA 3EDDA 4B3ZA 5BMXA 2VEGA 3PBYA 5C0QA 1RQBA 3T7VA 2BODX 3H21A 1P7TA 1YLVA 1GPWA 2XN2A 5HANA 2GPTA 1EC7A 1A5MC 2ACQA 4C7GA 4HCLA 3RUBL 3OU8A 4MADA 1HN1A 1OFRA 4O0ZA 3BAKA 5EKYA 1AQMA 4AZ5A 4P61A 1IWBA 1SJBA 3E1F1 3M0JA 3WFZA 3WKZA 4UMCA 2GVGA 4O8AA 3UXIA 3P81A 3H55A 4NNBA 2O7QA 1EYWA 1SW0A 2DSVA 4JYFA 1TV4A 4EAMA 1A4MA 4JPGA 1QNPA 1GVOA 4DPQA 4RXGA 1LTDA 4LF1A 4F0RA 1R2RA 2V2CA 1UBPC 4NY2A 1DWIM 2X40A 4O1AA 1L8PA 1AQ0A 4OOUA 3KDNA 1E9YB 1U83A 5IXEA 1IIGA 3AYVA 3MDUA 4NZCA 4AXKA 1QW7A 3W0KA 1T8QA 1UZHA 3QYQA 2AMXA 1UKTA 5CAHA 3G6MA 2DW7A 3EPNA 4W8AA 2A21A 1NWUA 3LBOA 1CT5A 1IEXA 2PDFA 3O8AA 4E4PA 3QEZA 3PUEA 4OWGA 3H8AA 1BYBA 4IMAA 1TUFA 4XZMX 3Q37A 4PUKA 3K1GA 3N34A 1DIEA 5M1TA 1MO0A 3FXGA 4H00A 4OV9A 4K8HA 4I5UA 3S9ZA 1UUMA 5BXSA 3O05A 1YPIA 1LWHA 2IQDA 3WN6A 3BCFA 5E0CA 1ZUAX 5DMMA 2BHUA 3L66A 4PZVA 1OINA 5E93A 2ZX8A 4Z1AA 1QOXA 3V5FA 4HOXA 2PC8A 3UQNA 1S3TC 3CWOX 4KRZA 1VEOA 2BY3A 5H8MA 1TWZA 3WMLA 3SAZA 1SZRA 3GAKA 2DT1A 3N6JA 4H04A 3HQNA 3VE9A 3CO4A 3U48A 2E6AA 1F2JA 4UOJA 3EB3A 4TTUA 5D38A 1FH9A 4YS1A 3WFAA 1KB3A 1WDQA 2OQHA 4JIEA 3SR7A 3UW6A 1KW1A 5LNRA 3CH0A 3ALFA 4L9YA 4QLJA 3CZKA 1E3XA 3W1PA 4CN4A 3NG3A 3EPOA 3BURA 3L0NA 4ROPA 2I57A 2OSWA 3STCA 2DIEA 1PZ0A 3PANA 4F2TA 1Q65A 2I9UA 1QK2A 3BJTA 3RPDA 3DBNA 4LNCA 4F0KA 3TWAA 4AH7A 5K4ZA 1A5BA 1JYVA 4C6DA 4E2DA 3MI3A 5G4WA 4ZFCA 1TIWA 4H19A 1SO3A 5M5DA 3KS5A 1CCWB 4IXXA 5T26A 5DELA 3MSYA 1GG1A 2DIKA 5LZLA 2VWTA 2R1MA 1Q4NX 2UY5A 4AYGA 2QMKA 3VNKA 1UKPA 4INFA 3GTIA 1X6UA 2VZVA 1PZ2A 1DJGA 1G67A 2X1TA 4G7EA 1NP0A 1T40A 3LCHA 4S3FA 4U4MA 4Y9MA 5D9NA 1IEWA 3OGRA 4GNJA 4JTKA 5DY3A 3GW0A 1UD4A 3ES8A 3TYBA 2JGYA 3WNOA 2WM0A 4HN4A 3I3EA 1WOAA 2BZNA 1L6SA 1UH3A 1DQXA 3W02A 4Q4PA 1TUXA 2EPKX 3C0JA 1JDDA 1K9FA 3WJSA 3KTCA 4XTDA 5I09A 1W1PA 2V5LA 2YDQA 3TYZA 1I0BA 3V5CA 3W1AA 5EBAA 3LPFA 4BF9A 4F40A 4QTGA 1A49A 3CAQA 3QKZA 3QV7A 3AC0A 4LAUA 4EKJA 1UA3A 1O60A 3PHAA 4A3HA 3BJFA 4PCNA 1OB0A 4S3CA 5CSRA 4ICMA 4KWWA 2O0TA 5EYWA 3P61A 1V5XA 3HMJG 3W2LA 2YJQA 1QNOA 3UXDA 1QTWA 4QFUA 1BYDA 2NVCA 3OEXA 3SEPA 1WYIA 2WOQA 2A79A 3RLGA 3B0VC 1EH9A 1PKMA 4PULA 1SGJA 3TYCA 2W67A 1YBQA 5C5YA 3MP3A 4IXHA 4NJIA 4C6OA 4IL0A 5KMYA 4HHHA 1PB0A 2BVDA 4NZ3A 5IFPA 3EDFA 4FAMA 1NF7A 4AD4A 2VXNA 3SADA 4UFIA 3IVTA 3HM7A 4PMOA 3QV6A 3THQA 1Q2SA 3S2JA 1XLMA 3C8FA 1KFCA 4XG1A 4AY7A 4B9ZA 2C0AA 3G6LA 5T8GA 3H2FA 1LF1A 4IIBA 3VNDA 3TJXA 4GY1A 2TODA 6ALDA 2HROA 4F0MA 3TU9A 4FXSA 5D9MA 3D47A 2D73A 5EB8A 4B5WA 1SMDA 2WCSA 3P82A 5IOBA 3C0LA 3PB0A 3IV3A 3S5ZA 2GK1A 9RUBA 2X05A 3MUCA 4BF5A 2C7FA 3G8EA 1TPB1 2GZXA 5CXPA 3A22A 3BGAA 3LB0A 3FKKA 3K4DA 3UU0A 1NVMA 4A8NA 3GXFA 4REQA 3U9IA 3BMWA 1KFBA 2CLPA 4N02A 5AZ1A 5TNVA 3E6EA 2J6XA 3MQTA 3VOJA 4F2UA 4GD0A 4QSHA 1ICPA 4AHOA 4D6GA 4IMFA 4Q7IA 3WCZA 3BUVA 1VYRA 4CD5A 2YYTA 1CPUA 2GDQA 4RNIA 1XCFA 3SW6A 4RK8A 2F9RA 3K8KA 3N19B 4G8TA 1JGIA 1Q2RA 2IS7A 4JTAA 5HINA 4IPPA 2VEKA 1TRDA 2YBTA 1DL3A 3PTQA 1JD7A 1PTGA 3QV9A 1UPPA 3CIWA 3WUEA 2GGJA 4Z08A 5JBFA 4MUZA 3FSTA 1IEVA 3PJXA 4FSAA 3A9BA 4XBKA 3VGBA 3GTHA 4P8XA 1MEHA 3VC6A 1Q6LA 3UNTA 1JNEA 4RLIA 5G1TA 4ORMA 1G5AA 3VOHA 4DB7A 2XIOA 1JDEA 2XIIA 4QJ1A 2BGQA 1REQB 1UJQA 3P8JA 3B9AA 3RXZA 3U5YA 1FVPA 5D9OA 4WSKA 3GLCA 1WXJA 3SUUA 1CTNA 3C61A 4GVHA 4P7RA 3W7JA 4IJRA 1SJDA 1E6RA 3NL2A 1XIEA 3DZ1A 3VNIA 4YCPA 3VGGA 2PP3A 2G0WA 1SO4A 3HJEA 2WHKA 3WF3A 1XUUA 4A2RA 3EX2A 1W1ZA 3U2ZA 1XGEA 1US0A 3N73A 4WY0B 1R5YA 4PYSA 3O7UA 2XFWA 4PMUA 4Z42C 1XSKA 2HV5A 4W8BA 1YTDA 3C2VA 5TD4A 3QPYA 4JICA 1KTNA 3ZIZA 3GFZA 2WMKA 5CJNA 2G50A 1RPXA 4PTVA 3DYPA 1YKWA 3A4XA 4D8ZA 1TIMA 3OQ8A 3W75A 1NFGA 1K7XA 2QUMA 4HYWA 4JY9A 2DEPA 4S3GA 1POKA 2O9OA 1D3CA 3KBMA 4DWSD 5DT5A 1QPNA 3S8HA 4DWSB 3M6YA 1DWGM 2CLKA 3W2NA 1A5LC 1F6YA 3P62A 1I75A 4ZMGA 3WUGA 1S2VA 1UIOA 3U8GA 5LGXA 1RLCL 2G96A 4DY1A 4MWAE 4GVGA 4CNSA 1I8JA 3GH4A 4LVBA 3MU7A 2OSYA 1ECEA 3RM8A 4CQ8A 4JN7A 3B8SA 3LZ3A 2G8ZA 2JEQA 2B31A 4G7FA 3S5SA 4M1RA 3NZQA 3W25A 4IIGA 1FHVA 3W1LA 5E0KA 2VURA 1WZLA 2Y7EA 3N29A 2G37A 3IVSA 2OEJA 5CZJA 1VC4A 3C2YA 2FKPA 5AC6A 4AZBA 2A3CA 2BWGA 2QMJA 2DJLA 5EY5A 2VD8A 1EPVA 3THAA 5CC7A 3LHZA 4HTYA 1DV7A 1F3TA 2E9BA 3GAYA 4JIPA 1GT8A 3N4FA 3A3XA 3MANA 1EOMA 1HJVA 3FX4A 3EZ4A 3JUGA 2ISVA 3TLQA 2EJAA 2BOEX 2D20A 4D6EA 4E8GA 1LRTA 3F5LA 1E4IA 3VIHA 1KFJA 2VGBA 1TCDA 1BXNA 3EOSA 4BJHA 1BTCA 4JDBA 2HPMA 4I5RA 3RX4A 1F05A 4B2DD 2OYLA 3TQVA 5A69A 1EGVA 3NGFA 1H5YA 3OB8A 1W1TA 1GEQA 1B4KA 1K8CA 2QAPA 4P7NA 1M7PA 2Y4SA 4JNYA 1XBXA 3IIXA 5F4XA 4KT2A 4JYDA 3DUGA 3RJXA 3F4NA 2H3DA 3GG8A 2VZTA 1P6WA 1KRCC 3Q65A 2A1YA 5CPNA 2QDEA 4JKKA 4Z2LA 3PC0A 1TJRA 2ALRA 4FNUA 4F48A 2XN0A 5HMSA 4ZQOA 1A0CA 1A0EA 3AMLA 3W70A 4N42A 4RPPA 4DXVA 2HZGA 5A6MA 3B4YA 4JTDA 1OABA 1OK4A 2IW0A 3VNJA 2NX3A 3OZMA 2JE8A 3RYSA 3E0IA 1LOQA 4QQUA 3SQLA 2G5WA 4AHQA 1XQLA 4LUSA 4KQNA 4N0RA 1MVYA 2NUYA 4J28A 1US2A 3S0CA 3DHFA 4S23A 4IJBA 3LCXA 4DYKA 1S2CA 1C3FA 3RILA 2VP8A 4M82A 3WD4A 2CEQA 2YCLA 3O15A 5FJPA 5FJIA 2Y5EA 3IUHA 4M6QA 3ITVA 2X42A 4UQCA 2G3FA 2GLKA 1OFOA 1GJWA 1VH7A 4PUUA 3Q94A 5LHEA 4RDWA 3Q67A 1H11A 2OXNA 4XZBA 1OM0A 3CB8A 3KTSA 3TAOA 1E5JA 4CNOA 4WIWA 1JCTA 1E73M 2P8CA 5IHRA 3PUOA 4DAFA 1F6KA 5CZKA 3PZNA 4XV0A 4UFHA 4CQBA 3PM6A 1A80A 1O68A 4ZVJA 2CBVA 2FGLA 2GYIA 3IPWA 4PCFA 1LCOA 2E6YA 3HGOA 5CSYA 3FYPA 3B9OA 1EWDA 3H22A 4O8RA 5HJLA 1OWQA 1EJXC 3WQWA 2NQLA 3PJWA 1HL8A 1N55A 3GZAA 4DO5A 1EJUC 4FLSA 3C2FA 1E6ZA 4JIIX 4HMCA 1OT1A 1W32A 4MZ8A 3PZMA 1TQXA 5C2CA 3TX9A 1K7EA 1B31A 1XC6A 4H8HA 1N8FA 3KTXA 1MNSA 3ITOA 5F7UA 2TPSA 3GXTA 3RPTA 2D23A 1V6YA 1C29A 3DFSA 5KTLA 1VGAA 4GZ7A 4MLJA 3RU6A 2POTA 4MNLA 2DZVA 4WK9A 4W5ZA 2OT1A 2Y7GA 3CAVA 3GTFA 1MUWA 5KZDA 2WZMA 1U1JA 3NL3A 3N9RA 5A6TC 2ZWYA 4YHEA 1BF6A 1EWEA 2VGGA 2R24A 3SY8A 3NSMA 5E5CA 5AYYA 1G9HA 1GW1A 1IXPA 4JQ4A 3L2MA 3KXQA 2PA6A 3D3AA 4NKCA 2NX1A 3PWAA 1GHRA 4AIEA 4MJ4A 3FN9A 5H8UA 3W7IA 2BXZA 1RQEA 4IOTA 1V7AA 1ODUA 2GVEA 3H53A 4W93A 3N1AA 3W24A 1Q4WA 1ZTVA 3HO8A 3OG2A 3KL5A 5BRQA 4GYPC 3BOXA 4LF2A 4PFHA 2Y2WA 5LA2A 2X41A 3HN3A 4WKFA 1OCJA 4HP5A 3DDMA 5I3DA 2BXVA 4WVXA 4MF4A 1DEDA 3W6LA 2PU0A 4BA0A 1K02A 1NM9A 4IZGA 1VB9A 3PZVA 1NFBA 3WDQA 1JZ8A 5A6SA 2ZWZA 2PCQA 1J18A 1U5HA 1N82A 4ZCWA 4PUEA 1WKEA 4RE0A 1CXHA 2GJLA 2R91A 3OZYA 1J4EA 1J2WA 3T9PA 3MUZ1 5AB3A 2XIQA 3P3BA 4G9PA 1TE1A 1M04A 1Z69A 4OUEA 1MW0A 1V3KA 1ADSA 3W73A 4QBXA 4XIAA 3QR3A 2O9PA 2PDKA 1HL2A 3C0QA 4AB4A 2HPIA 5I7GA 4LUTB 4DWDA 1MFUA 4HIBA 1BGAA 2WMIB 1YDNA 3ZVHA 5DO8A 1J01A 1UH4A 3GNPA 2R82A 2I1OA 2NUXA 3CK5A 2NVDA 1Z42A 1W37A 3NQ6A 2QCDA 1T8XA 1D8WA 1RY0A 4Q8OA 4J3ZA 5LNWA 2YL6A 2PU1A 4HYRA 1P7TB 1P43A 4TX6A 4LV4A 1C7TA 3STPA 1J0IA 1XF0A 1AH0A 4FIRA 2YFNA 4HQVA 4JEQA 1FWTA 3CTLA 4XSMA 3GS6A 2UY3A 1ITCA 2HVMA 4KCUA 3HFTA 1IXOA 1GQIA 5XIMA 5EBUA 1WKYA 2J24A 1FHLA 2HK1A 2J7GA 4QDWA 5HWMA 3W00A 1JFHA 3KBJA 1FXQA 2GVLA 2OMAA 1H7WA 1OCQA 5IBXA 1L8NA 2I5IA 4IG2A 2J9YA 1GVEA 5A8QA 4IGMA 1MXSA 2CCRA 3AXHA 3BLFA 1ADDA 2QGYA 1XG4A 2FVKA 3W7LA 4CQDA 2F6XA 4JNZA 5C7VA 3EMZA 4JEJA 4U10A 3ANUA 4HK5A 3LBCA 2I14A 4HZ8A 1TV3A 4LAMA 3AMDA 4Z1YA 1QI0A 4D71A 2FMNA 1EDGA 2X1RA 1R3TA 3ZS4A 2QF7A 3KL0A 3QW3A 1JUKA 1QPOA 1AZ2A 1WBHA 3VGFA 5AC5A 4DWSC 3NPUA 1KM4A 4JTGA 2XSXA 1UC5A 2YSWA 4GA8A 1SR9A 4I9JA 3W86A 2J7CA 2VI0A 1RA0A 4JCMA 4CCDA 5GJPA 4EACA 4UTJA 2FFIA 1KM5A 1JRCA 3E49A 4HNOA 3DHDA 4GC4A 4XTIA 3VM5A 4R53A 3GVWA 5JQ9A 3C8NA 2YZ5A 3C4UA 5I5RA 3RCNA 2TRSA 4KGJA 4BEUA 4QSFA 1PIGA 3ZJKA 4HK7A 1MXDA 1TPEA 2B7PA 2WVTA 3O6AA 1CW2A 1SFSA 2AQVA 2ZDRA 4EWJA 2BG5A 2AAAA 3N15A 3PVFA 3VIJA 5BWFA 1UW9A 4XAPA 4ACYA 2FJKA 4LVGA 3P6LA 4RW3A 3EOLA 3PZGA 1V79A 1FRBA 4DNHA 5CCZA 3TUUA 3IACA 4A05A 2C3ZA 3WSUA 2ZQ0A 4AWSA 1ISVA 4RDZA 2QDHA 3AJ7A 3SUVA 2PRLA 1NARA 2BXYA 4DRSA 4BEQA 1TZ9A 5I6SA 4IUGA 4C6MA 3E5BA 4ZR8A 2JKEA 2QHAA 3N6QA 2PTXA 2EF9A 1Y7VA 1TMQA 1EIBA 4XQ6A 4HTBA 1ADOA 2PURA 3NOEA 5FJUA 1I4NA 1TX2A 3HA1A 2ATSA 5AHIA 2CHOA 4FR6A 4AZCA 3AZTA 2QCLA 3MV01 3NXLA 3W71A 2NWRA 4PCPA 4W89A 1MRQA 1PIFA 3W1MA 1AQFA 4AD1A 4AF0A 3OLEA 3DU0A 4GZIA 1MW3A 3T2PA 4I7WA 4UWMA 5JUVA 3A12A 5DMYA 1MZHA 5A6LA 1UG6A 4B5XA 3FV9A 2INZA 4B3LA 5F2IA 1KRBC 4O1BA 2HBXA 3EMCA 2AL1A 5IRPA 3GHSA 2FDSA 1BSLA 3MVTA 3LI1A 4K6AA 5LXXA 4FR1A 1MFVA 1C8VA 1P0DA 1EP3A 3WNMA 4G7EB 4HSOA 4ZTYA 4AEOA 4GX8A 3TC7A 2C1GA 3DAQA 4ZXOA 3ZSSA 1JZ6A 4GQQA 4XD6A 2JGQA 4P5UA 2J75A 1K03A 3KP0A 4XZLX 2E5BA 5HJXA 4KIEA 1TPWA 3WNPA 3LMYA 4Z2IA 4IFOA 4AIBA 3IAQA 4C1KA 3BGJA 2HS6A 4IP5A 3FXYA 3W85A 3EDJA 5JU6A 1OF6A 3SM0A 1E1FA 4FI4A 2PTZA 1OYAA 3LCGA 4HNLA 2W66A 3CBWA 3FYYA 3TFXA 3U0HA 1TG7A 3PSWA 3QY8A 4IP4A 3CZLA 1DHKA 3K13A 3L4VA 4IIFA 3LCIA 3CMGA 3STGA 2GFTA 3S2CA 3DYMA 2PDIA 4JBRA 1H7RA 4UNIA 7XIMA 3MMTA 4IIHA 2CZDA 4IIEA 5A8MA 1U1HA 1E71M 3G2GA 2IKHA 3CB3A 4GQRA 1A0DA 4S2CA 4XISA 3W7MA 4GFSA 3QZ6A 1M01A 4O10A 2XM2A 4QR6A 2FYMA 1YBQB 1J6OA 1LL4A 4DBSA 5HWJA 1W9UA 3E38A 3GXMA 2INEA 3R12A 3V35A 3E5PA 5EPDA 3KAOA 1GJUA 4UMAA 2VFFA 4HBKA 5HULA 2E6DA 4RJEA 5BRBA 3TYEA 1YDVA 3ID7A 2P3ZA 2IUZA 4PL2A 1LUCA 1DWFM 3FVDA 4I9TA 3FHQA 3S2LA 1OD8A 1RA5A 1T6MA 1DE6A 2V81A 3QN3A 4IQDA 3NEHA 2A7RA 5KINA 1E40A 3RCYA 4QG8A 2ZRVA 3LN3A 2DGAA 2GK1B 3KBSA 5BNKA 6CGTA 2PWUA 3CHFA 2WWCA 3WUBA 1PO9A 3AS1A 3PP7A 4ZXLA 3IJQA 4JCLA 4DM1A 4L80A 3MI6A 3EB2A 1WPCA 2FVLA 5HUPA 4M5PA 2FPVA 4REQB 3D46A 3VOFA 3DC0A 4Q8NA 3THDA 5ECUA 1WCGA 4A3QA 6A3HA 4ML9A 1VF8A 1UR2A 1WBJA 3NQFA 3UY8A 4XUYA 4KWOA 3TW7A 1R47A 1RH9A 1ZJHA 4PB3A 2HEJA 1ZCOA 1KC7A 4JAWA 3CXOA 4V15A 1T7LA 3E3HA 1KXHA 5JBEA 3N2OA 2GDUA 4L4LA 1UR8A 3GBEA 4Z1DA 1VBHA 3FJNA 2OZ0A 3F03K 2D2HA 2VOTA 2EBNA 1BHGA 3BVJA 3IARA 1WZAA 4PGLA 3W1XA 4IMCA 3BAWA 1RK6A 1ZALA 3L9CA 3SCVA 5FF2A 5CC6A 2J62A 1OZMA 3WLHA 3EYPA 1B90A 4UQEA 1RLDA 4N4PA 3HURA 4GWEA 3GSMA 2QLYA 3ZM8A 1RUSA 2V82A 4OGZA 2QJNA 5I3HA 2DU2A 1YHTA 1E72M 2YW3A 3CLMA 2RDWA 4QM1A 2OO0A 1HT6A 1WNOA 3I6TA 3M6DA 3UYCA 1NOWA 5B7YA 2CYGA 5TF0A 3U4FA 1OFQA 2EPHA 1D9EA 1OSEA 2OB3A 3UESA 4D6DA 2FZ8A 1XYLA 5HAOA 1UCWA 4ZENA 4B92A 3IWPA 1B30A 3A13A 3V0TA 4YU1A 3EKLA 1EGZA 3FFSA 2AQOA 5DBUA 2IKJA 3BZJA 3TXVA 3UA4A 3DYOA 3A5VA 2Y5JA 1LOLA 6XIAA 3S46A 1NTHA 1HFBA 3D0CA 3TC6A 4NASA 4ZSTA 3UZXA 4RE4A 2X7WA 4FLRA 2PDUA 1UPMB 5IFTA 1QI2A 1H50A 4QCEA 3IJDA 3NQEA 4MOZA 1GGOA 4DLFA 3RJYA 3RITA 4JOMA 3B0YA 4NQ1A 1V6XA 4YWIA 3W83A 4S3EA 3MJMA 3IAPA 1UKQA 2V67A 3R8RA 1H60A 3OVQA 3BV7A 1JPMA 3W7DA 3T44A 3AO0A 4MM1A 3U3HA 3LNPA 4LC8A 3B40A 3BLDA 4OZOA 2NW0A 3RMJA 4UR7A 2O7SA 1UZDA 2OKTA 3TZNA 1X39A 2BGSA 4GFIA 4OT7A 4XVDA 3PTKA 3TQ0A 2OQYA 4XBSA 4AC7C 4K2SA 3TN5A 1UA7A 3TTSA 4LB3A 3PB2A 3VOIA 1M65A 2YXOA 2HNEA 3GYCA 1MSSA 3P84A 3FCPA 3GRIA 3AU2A 5GVJA 1J0YA 3QR1A 3M47A 3M44A 4HPNA 1ICQA 4ZQMA 4AWUA 3UWEA 6ENLA 2PWDA 5I07A 1P0BA 4GJJA 2VTFA 4UIOA 1H61A 1SO6A 3QH2A 4PTWA 3AWNA 3BLLA 1E70M 3C6CA 4DBEA 3DI1A 3W2UA 2QUNA 5JH1A 2GDVA 1PJ9A 3MWCA 3ZZ1A 4AIUA 3OLGA 4R27A 5G1YA 4C65A 3UPMA 3N6HA 4O13A 1M5WA 3GDLA 3S9IA 3CIVA 1JEZA 1KGWA 5L6UA 1WDRA 1Z44A 3GIPA 2C6QA 4PUWA 1LRNA 3GFXA 3CZGA 4F8XA 4LFYA 4M8UA 4FLOA 3JVAA 2VEIA 2D69A 4HD5A 1BYCA 4RE2A 3KFTA 1IR2A 3M5VA 3AHZA 3NPXA 1V02E 4E2VA 2V2DA 1UKSA 5J5RA 5CGQA 1ITXA 2VRQA 1QNVA 5HMDA 3H6OA 2X1IA 3K5XA 4FZIA 1EPXA 1WKDA 3BW3A 4LJ3A 4CQAA 4F2BA 4O17A 2EPNA 4NG3A 3B8UA 1K8XA 4LUSB 3EA3A 1JCNA 4YVVA 3GIQA 4CD6A 3VTRA 1WX0A 2W91A 2DUAA 3W27A 3LHYA 4LCSA 2XFRA 3AZRA 3CUXA 2R6OA 2PB1A 4FPSA 1EB3A 3NQCA 3AYTA 1TVNA 1XLCA 4DBWA 4GRSA 2DZAA 3M16A 5BWAA 1K4GA 3H12A 3MTWA 4O14A 4MKSA 3VIMA 1EP2A 4GH1A 3LRKA 2YCLB 5DANA 4EPKA 2PWGA 4UQ9A 4A2SA 1UR4A 2W61A 4WUIA 1UROA 2E3ZA 3MS8A 1GOWA 4TR9A 3H70A 4GKLA 3T09A 3VX0A 3WNNA 1XYMA 4JFTA 3FLUA 2G3IA 1W56A 1OD0A 4I3GA 3T2OA 2D1ZA 4PL1A 2QJHA 4LW7A 2VZOA 5E0FA 2REQA 1K6WA 1AJ0A 3IUDA 4GOAA 5C8BB 1NOUA 2PDCA 4MVAA 2EAWA 4AZ7A 3EGJA 1V0NA 1E3ZA 3A9IA 4ZL1A 4QJ4B 3WL1A 2BHYA 4J27A 2HWGA 1O5KA 4Y9NA 3NQ2A 1VP5A 4XIMA 4S38A 1FH7A 3MWAA 1Q3NA 1A50A 5LNVA 3UF9A 3WLQA 5MKGA 3WK2A 5T91A 3W88A 2WM1A 5C9UA 4GI4A 3PBUA 4PH6A 3KOWA 3NWRA 3UGRA 1HIZA 1ZHAA 1TR9A 3VDHA 3R0UA 1BD0A 4FALA 1S5NA 2ZUMA 3RN6A 1B9ZA 3PWIA 1AK5A 4S3AA 2OTDA 4GNVA 4I7UA 5ABTA 1Z8AA 1Q5MA 4CN1A 2OODA 5IHSA 3G1AA 2QQ6A 1F5ZA 1OFDA 4JTJA 1UYQA 1JR1A 1H4PA 1FQ0A 5A6BA 4D72A 5IDIA 5I0DA 4DUVA 4YTSA 4TOQA 3DCPA 2V30A 3MB9A 4O53A 3GHRA 4KFPA 1VFHA 4IMGA 1U1UA 2Z1VA 3HIJA 4YVXA 5ABEA 1NWTA 4ONVA 2X2YA 1H1ZA 5I79A 1Y0EA 2J7HA 1HJSA 4LCRA 4Y7EA 1HTIA 3AALA 1TPVA 1GOOA 1P48A 5KEZA 3ZR6A 3E0VA 2V5KA 1SYTA 4JTLA 3KBWA 2V5CA 1GYLA 3URAA 1QHZA 1L6WA 1QASA 3CZEA 3KEHA 1UWUA 2V5BA 1LL6A 3ZJ6A 5C71A 3KRZA 1VAHA 1EZWA 2Z29A 3HPAA 3O0KA 3W3OA 1FWSA 5FCZA 3I3BA 4XAYA 1KBLA 4URIA 4BR1A 5AYIA 4CUCA 4KGLA 1W2PA 4U28A 1I9CB 3C2EA 2VL4A 3I7QA 3DG7A 1I1WA 3C2OA 1R9YA 3NQBA 4B15A 3ATYA 3F7JA 4K8EA 4B5TA 1R8LA 1XGZA 3SCTA 2QUTA 1XLFA 3GHTA 3NQ7A 3UWQA 4JN8A 5A8OA 2YA2A 2YL8A 2X1SA 4DJFA 4DUXA 1P0EA 4YTRA 1L2UA 3SI9A 3URBA 3AXXA 1GKRA 3ZVHB 4HKPA 4PBGA 2YLLA 1UZ1A 3ZLGA 3LGEA 4N9BA 1PDYA 3EEZA 1H0GA 2QIWA 1BPLB 2QCDB 3WDJA 1CYGA 3PF3A 4ENLA 6TAAA 4QDPA 3W1QA 3ONBA 3DGRA 1A53A 3R94A 1EJSC 1KRAC 4MAVA 1MUCA 1NP2A 2HRWA 3HPXA 1E56A 1B3OA 2PGRA 4NXSA 3WEZA 2CLMA 4Y96A 4J3VA 1ME8A 5AKQA 4OBSA 1ZLPA 2Z0IA 5M2FX 4YNGA 1VFUA 1Z3NA 4LBSA 2Z1XA 1E15A 4IG2B 2VGIA 5AZ0A 3T0DA 2QVHA 1G7UA 3HF3A 3NL6A 2YZRA 4W88A 1NJJA 4MNMA 2CZFA 2WSYA 2XG9A 3QMSA 5FSDC 1PKYA 1EJTC 2Q09A 3A4AA 4AUBA 5DMNA 3BGGA 5BU9A 3TA6A 4CD8A 3WJYA 3I68A 3VFLA 1GPFA 3I6RA 3WD2A 1AW2A 4HNTA 1CENA 4NXKA 3HJZA 3POHA 3LPOA 5F1UA 2WJFA 1NFPA 3AIBA 3W53A 4AD2A 3L4UA 4LVFA 1W5MA 4IFKA 3VC5A 4LYPA 4LEQA 2GWNA 4POCA 1SW7A 1UR3M 1RSCA 1JFXA 1F3EA 2HK0A 1UWIA 1WE5A 2YCJA 3MHFA 3T40A 3OIHA 4L7ZA 1W91A 1E4NA 4BQ2A 1R6WA 4IWWA 4J1OA 3QZEA 3DI0A 3N9SA 3WJZA 1KCZA 4HU4A 1KM1A 2VVNA 1UR0A 3LZ5A 4WGHA 1Z41A 3B4UA 5K7JA 2ZCGA 3M0YA 3VKAA 3E2QA 3NCOA 1G4TA 3VNLA 4FOUA 2PLCA 4GPNA 3UG3A 2WVVA 3CGTA 3R43A 3WK3A 3ZFHA 4OFCA 4HU8A 4BY3A 3MP4A 4GQ0A 4A22A 1PEZA 1FWGC 4M24A 3DHPA 4QQ3A 3JW7A 2YCIX 3IUIA 4Z0SA 3E2RA 1PYFA 1GVSA 1ENUA 3B9NA 2R1LA 2E8YA 1W9VA 4AD3A 1D3HA 3QFWA 4D8AA 1PSCA 5FEZA 1E0WA 1SVDA 5I3GA 2X8RA 4O50A 2Y70A 4RW5A 2D3NA 2ZRYA 3M7SA 2PGWA 3G22A 3L4TA 3R8GA 4AZCB 1FCBA 2RGLA 1ZAIA 3E12A 2FFCA 1EIXA 1QCWA 1LWIA 2H9AA 1MDLA 1RQHA 2PWHA 3AS0A 2YXXA 4HHMA 2ZZ6A 4GI8A 4AF0B 1V77A 4GXPA 5KSWA 5E6YA 2Z24A 1EA9C 2Y63A 1J10A 2CLEA 3B06A 5CSUA 3M0LA 1DJQA 4PMZA 1YEYA 4WR3A 3TWBA 3BSGA 3LSCA 3AQUA 3V3WA 4MY9A 5AYBA 1JIBA 1M7XA 4BFAA 1FOBA 2ZUNA 4RNHA 4K68A 4DF1A 2ZVRA 4LANA 1KD0A 5D2WA 4PMRA 4WY0F 3S47A 1IEIA 1PHWA 3MDWA 2B7NA 4OVXA 5I77A 2WHLA 1OADA 3UJSA 1D8CA 2WMHA 3FEMA 4IUOA 4AIOA 2TMDA 2E7FA 4KRTA 1CGYA 1OCNA 5EMUA 1JF6A 1IGWA 1TZZA 7CGTA 5D2XA 4PUDA 2CETA 1BKSA 4QG9A 4WKAA 3HG2A 1DJHA 4S3BA 3SSJA 2VDGA 4FF7A 3PAJA 2Z2AA 4PSPA 2EG7A 1MQRA 3CYVA 3H2EA 3CMJA 3GWQA 5FOOA 1UZ4A 1MEWA 2O4MA 4R85A 2Z1SA 4LRSA 2DSKA 2A3EA 4RE3A 3HG4A 1D3GA 1CLKA 2X16A 4MB5A 1O7AA 4UTUA 4MUPA 1OFEA 2OWWA 3NUKA 3TE9A 3L21A 5JIPA 3WIJA 1TWIA 1GKPA 2CBIA 3WNLA 3IGUA 2J8FA 2V5JA 2ZRZA 1R3QA 3H7UA 4MFEA 5BROA 1I60A 5D9PA 4DJEA 1UWRA 2P8BA 3VXGA 1KV5A 4ERGA 2PDGA 3A3HA 5F4SA 3W74A 2TSYA 3SIZA 1GW9A 4GO8A 3GYEA 2WBKA 1YIXA 4J3UA 4AD5A 1GYMA 3VNYA 3MMWA 3G18A 1XH1A 3TP4A 2QCEA 4H7ZA 1MDRA 5I23A 3C3NA 1KFEA 4M7SA 1JQVA 3SRKA 1EO7A 3A21A 3LX9A 1TRIA 1P6BA 1UP2A 4M29A 2NUWA 4CKQA 3W87A 3OVGA 1LUCB 1OX5A 3K30A 5C9WA 3VM7A 3GFYA 2GVJA 4X3ZA 1FWWA 4ZO7A 4UTHA 2VFEA 3OHIA 4ZO6A 3LDVA 3W76A 3NDZA 1F73A 3C52A 4K39A 3CT2A 4BZYA 1E0UA 5KZEA 3S2MA 3UVIA 4JR5A 2QT3A 2P0IA 3PPFA 4PBEA 4V27A 1IZKA 1CXLA 2BSLA 5A2BA 2XINA 2O9TA 4HZ7A 5EL1A 3GBDA 2GOUA 1AW1A 2PPGA 3BMXA 4AAJA 3DX5A 4PTXA 2D2GA 1Q63A 3S5OA 1IQ8A 2J8GA 4UTKA 1KA9F 1T41A 3BAIA 3HQ1A 3N2XA 5DCBA 3NQDA 2WC7A 1RK5A 3UJRA 7ENLA 3W2MA 4CCEA 2J7EA 4TX9A 1FKXA 4PODA 3AUJA 4WRHA 5CKSA 3W29A 1LJYA 2G4JA 2PLMA 3ERPA 3TNBA 3P0WA 4P8VA 3QHOA 3UG4A 1Y65A 1IT0A 1F3XA 1ZQ5A 3GC4A 4XO7A 2IXVA 1S46A 1ISYA 5AC4A 5LNSA 2HQAA 5F4WA 1LBMA 2WKJA 1PUDA 1F61A 1XLIA 2P1FA 8XIAA 4K36A 1UIPA 4MLRA 1YTEA 5AECA 1ZJIA 1O4UA 2INFA 3ITYA 2WBGA 1TV5A 1X8CA 1PPIA 4ACZA 4AVNA 2Z27A 1HL9A 2B7OA 2P0OA 4M6PA 5F2LA 3B8IA 3CJPA 1BRLA 2QUUA 3O3RA 1ICSA 4H8NA 3LQGA 3DECA 1XLDA 2OU4A 3GU9A 1LG1A 2Q3RA 3G24A 4CD7A 3FA3A 3BSMA 5CZTA 2OLSA 3M0VA 4L6HA 4NIRA 4GVIA 1S1PA 3WEOA 3IGHX 4LS0A 2OT0A 3CAWA 3GUWA 5D05A 1DQUA 3RCMA 3THUA 1IYXA 2Y8UA 2BOGX 3AYSA 3B9EA 1UC4A 3QSTA 4Q8UA 1GQNA 1CGTA 2NVAA 2Z4GA 5A1AA 3RR1A 1K8YA 2OX4A 4PB4A 2VT0A 1R0MA 3KL3A 3UZZA 4JX5A 1ZBCA 5G4HC 3HG5A 3U6WA 2Y5SA 4D9PA 3DFHA 2DT2A 4WXYA 1NQKA 3UEQA 3LY0A 1K70A 1HX0A 3ANYA 3AIVA 1RCXB 5I00A 4JFWA 2FPTA 2ZE0A 3R11A 3M07A 4FX6M 1X38A 5SWUA 2O92A 5HQMA 5AOUA 3NO5A 1R30A 1OZQA 3OBEA 1B0IA 3W7GA 3SCNA 1U5JA 2PODA 4WJEA 4DBDA 1Q6GA 2YA1A 5DX7A 2W6RA 2C8NA 3WQFA 4GH3A 1YXDA 4HT3A 1HXJA 2QEZA 4PMJA 4TUFA 3ABRA 5U4NA 1GK8A 3FOKA 4GJ1A 2GJPA 1QFEA 1ODZA 4HB7A 3MO7A 3R5EA 4A6GA 4YHGA 4LX4A 3Q2DA 5TAOA 3UCDA 2G97A 3KOYA 3GDMA 5EMJA 2W9MA 1WUFA 2XZ9A 3PZTA 4XAGA 3KWXA 2X2GA 3F4CA 1ONRA 4OE7A 4CGTA 1RVGA 2DUZA 3BDKA 1DWAM 2O56A 3KUMA 3LXAA 8CGTA 4KERA 3IS4A 2E25A 3KBNA 1VFOA 3NIYA 1C90A 3WMBA 4YWSA 4JTHA 4Q7NA 4PTDA 2OJPA 2ZRUA 3FAWA 2HVOA 4JGDA 4Q33A 2WPGA 3GH7A 2ODOA 3K46A 3UWVA 4TV6A 1OFAA 6REQA 2JK2A 3WLSA 1G0CA 4DJDD 2V3EA 1JI1A 3S2NA 4H01A 3L12A 1HKKA 2I56A 3W7NA 3GXNA 4U2YA 5FAGA 3NZRA 3H7VA 1XUZA 3VGHA 5AHMA 1SU5A 1Y5XA 5D4YA 5BU6A 3WH8A 3KZSA 2ALDA 1XLLA 2CLHA 4NAEA 2PZNA 1OEPA 2WLYA 2VRKA 1TVLA 3CYJA 4OJYA 1K77A 2VR2A 4KESA 4DX3A 4CD4A 1XQKA 4OQVA 1OT2A 5D32A 2R1NA 3ARWA 1QPQA 1BWLA 1VD6A 1SSDA 4FF5A 4O1EA 3AMCA 2ESCA 2V8ZA 2E5DA 5K2ZA 1TX0A 4WZHA 4Z2GA 3N4EA 5BMWA 4RZBA 3NVDA 1ONEA 4K3ZA 3H23A 2NXIA 2XFFA 3LI0A 3ABOA 3ME3A 4MJMA 1GZGA 4AY1A 2C13A 1IZCA 4B3KA 1R3RA 1WDPA 1TWWA 2YL9A 3LLDA 4DVOA 4TMCA 3TIMA 1O5RA 1Q7ZA 3CZ8A 4H1ZA 5HMFA 3V0UA 3TVAA 4UTWA 4HPJA 6TIMA 1QHOA 4DBUA 1A47A 3HPZA 1DTUA 3LD5A 5HUOA 3OODA 2Z00A 1BG9A 2QJGA 2PF0A 4CU8A 1TTPA 1UWAA 1OC7A 2REQB 1KTCA 3MCOA 1QT1A 4G1KA 1E0XA 3PY2A 3DFOA 1UD6A 3UWWA 2L5HA 3SRDA 4LS2A 5CGTA 2MNRA 1SJAA 3MKCA 3V7PA 4RNJA 3S42A 1J0JA 1HNYA 4JTUA 2HXUA 1QVBA 1M03A 4EPEC 4N7QA 1OHLA 2NXHA 4XAZA 2C71A 1JDFA 3NSNA 1OQFA 3JZEA 4LV9A 1NELA 1AMYA 3GVGA 3TTQA 1JCMP 3NZPA 2OELA 1BWKA 1BAGA 2JBMA 3HU7A 3G3MA 3T0CA 1TPDA 3NXFA 1F8IA 1B5TA 4FNTA 3MCMA 1U30A 3GVRA 4GMEA 4CVWA 5MKGB 4JQ1A 2WCGA 3PPGA 3GNRA 2Z25A 2OO6A 2BDQA 4IPJA 3BICA 3QSRA 1C8XA 2ZUSA 2A6NA 2BB0A 5B80A 1RZMA 3IRDA 3P8IA 3MA8A 3MZ2A 3C56A 4JHZA 2BASA 3NQGA 3B05A 3QHMA 3LXCA 1H49A 3CUHA 4P7LA 3OGSA 1AVAA 1S2AA 4FHAA 3A64A 4GZJA 5HA7A 4L1WA 5K3VA 1RBAA 2VRJA 3RF9A 1KKRA 4G6CA 4GE8A 2QS8A 7TIMA 1TQJA 5A6BD 1I2PA 4EE9A 2FH8A 3JZUA 3LCLA 3GNOA 3AS3A 1XLHA 3AROA 2FH6A 1JYNA 4N4QA 5FJTA 3CWHA 1ZJBA 2GOKA 3L5MA 4A3UA 3VCNA 3GDKA 1JZ2A 1SZNA 3GU2A 4C6EA 2Z2UA 1GVFA 1FWAC 4ADUA 1KCKA 2WZIA 3HPSA 3AXKA 3AIEA 1US3A 3SBFA 3W7OA 4E3TA 2ZYFA 3NAVA 4NYYA 3M5ZA 1V0MA 1VFFA 1X1ZA 1G1YA 3TNOA 1E6XM 5BYWA 2HDJA 1XX1A 2PF8A 4QROA 4GHRA 5DRCA 4L65A 5DRIA 2CERA 4XD5A 1DWJM 2WO5A 1RY8A 3T81A 3VE7A 4H9TA 1BQCA 3E0WA 5DF0A 2OEKA 3CO8A 1TB3A 4PA8A 5BRPA 3S1XA 5A3HA 2QXWA 1PYMA 4I9AA 4DZIA 2BY2A 3EEGA 1YTKA 1QPRA 4DZAA 5FJOA 2WC3A 4BQ5A 3ARUA 1ZY9A 1R2TA 2P10A 3V1HA 1KFWA 5FL1A 2CHRA 1HVQA 3L4XA 4M3PA 2ZUUA 3M5XA 1GG0A 2XIMA 2QF8A 2Y1HA 3N9KA 3SRHA 1N2VA 4NZ5A 2PE4A 1EC8A 2ACSA 4FXRA 4EP8C 1I2RA 1OIMA 3TC3A 4DJFD 1LL7A 2ASHA 5HJYA 1JCXA 4JIHA 1HKWA 4PMYA 1KLZA 1H1YA 1UMYA 1V3HA 4JNMA 3HGRA 3AHXA 2CLFA 3L4ZA 3W07A 1JZ3A 3T08A 1XBZA 4Q8TA 4O57A 4F79A 1F7BA 1XIHA 1HKMA 2BTMA 2DSUA 1KLYA 5HPCA 2EPLX 3UG8A 3IRSA 5C70A 1VHNA 2YKKA 3LERA 4Q8PA 1XD0A 5DCEA 1C9WA 2C91A 1VZWA 4JX6A 1VENA 1CX9A 4KF1A 1FY6A 1S5TA 1XP3A 3IJ9A 3TSDA 3UWZA 2WSRA 1EGMA 4XK2A 3FSUA 5AFDA 3WF0A 5CPLA 1WAUA 2VVSA 3ANVA 3LENA 1HG3A 1FTXA 1XBYA 4G56A 5RUBA 2VZUA 2JF7A 3OHMB 1UOKA 2ZUWA 1XDMA 1EP1A 4KWVA 4QP0A 4FNRA 4UFKA 4DZHA 4GI9A 2VDHA 3EXTA 4Z1BA 4X63A 4ML4A 1ZBKA 3II1A 2ZUTA 3DBPA 1LORA 2FTWA 3QRHA 2VELA 3L7RA 4R9XA 3PPCA 2VX7A 4DI9A 1LT7A 3EDKA 2CBUA 3WLNA 4NJGA 3KCLA 3FK4A 5J8LA 4JKMA 1RJRA 4IFKB 1L9WA 2ABBA 3WO8A 1A5CA 1G6CA 2BMBA 3ARVA 3GH5A 2ZX6A 3EOUA 4MHBA 2CBJA 3HQPA 1P5BA 2EO7A 3REQA 4Y8FA 4UBPC 3LTSA 2E40A 3LXBA 1OC6A 3OYXA 3WQGA 3ZT5A 3K4WA 4W87A 1H0IA 1IR1A 3MBFA 4PMQA 2QVNA 4FK9A 2VCAA 2FZNA 2FGBA 2A3BA 2E67A 2CZEA 2DQXA 1TPH1 4W7WA 4AD0A 5HATA 1GTEA 3WDHA 3W37A 4LB4A 1R85A 1FWIC 2CWXA 3VIFA 3W7PA 1E6PA 4F3HA 4E8CA 5DQPA 1OVDA 3LHTA 3AU6A 4CU7A 4MJZA 4UNKA 4ZFMA 4JY8A 1XM3A 1WZMA 4TIMA 3HV8A 3R0DA 1Y5WA 1W9BM 2Q8LA 3DN5A 3BQ6A 3G1VA 4HJFA 1MI3A 2CU0A 3CUJA 3T05A 4C1NA 5C9XA 5KITA 2H9AB 2DZWA 1WDWA 5IDZA 2XUCA 4HZMA 4EWND 4JQ2A 3CTTA 4MNKA 3LGGA 4S3DA 1IT7A 4ADSA 3BCJA 3KDOA 2WMGA 3MMUA 2XTKA 5PTDA 1DJXA 4BWLA 4L4MA 1YNQA 1DKWA 4U3AA 3DKJA 3HZ3A 1Q8AA 4QEEA 3VKJA 4AYSA 1QW9A 1SM9A 1G01A 1TPFA 1CGWA 4IPLA 3DOPA 1EBGA 1ZS2A 3UY7A 3AFBA 1LBFA 1H3GA 3WJXA 2DSZA 1NH6A 1OGBA 4G5DA 3U7VA 5CJ5A 5LIKX 4B16A 5CJMA 3POCA 2ZXBA 1E4MM 3L5AA 3ALGA 2VD9A 4I5XA 3M0XA 2QCHA 3MPGA 4XSLA 3TQPA 3HB9A 3PG8A 3QOKA 3STEA 1CLXA 4KCTA 3LG3A 1RAKA 2P76A 3I6EA 3EAUA 2J74A 1V8EA 3WH7A 4DXXA 3WQVA 4LVAA 2ZFAA 4LWWA 1RR2A 1VCGA 3WK0A 4E2BA 2ZDSA 2WLZA 1ME9A 2GSJA 3CIXA 1EJ7L 3W7HA 3COTA 2BY1A 4RZ5A 3PZIA 5EMKA 3MJYA 1YNPA 4EPBC 4H6KA 2FDMA 2PFHA 1J96A 1W1YA 2ZIDA 1F07A 4MAZA 2RHGA 3CHDA 4C6FA 4ZQRA 4HMNA 4NILA 3MY9A 2ZRWA 1G4SA 2DSWA 1EYEA 2ISDA 2WZTA 4DJED 3O1NA 4S39A 1H5VA 3H2CA 3FKRA 3KRBA 4Y9AA 1E1CA 1NDYA 2WCAA 3QV8A 3CM4A 1YQ2A 1XYFA 1LBLA 2E1DA 1JAEA 1A5SA 1GVRA 3FYOA 3WDPP 4IMDA 2NT1A 2BVYA 3O0FA 4CNTA 4PMVA 5JMUA 5F2MA 4KEUA 4NRSA 3WF1A 5KZMA 3CHEA 2BV9A 3G1RA 4DPPA 4Q4OA 1AUSL 1ISXA 2QIIA 1DPMA 3P7YA 1NEYA 1CXFA 1KNWA 2LLEA 1E0VA 5ENLA 3DXIA 4IIDA 2WK2A 2QW5A 3WUFA 1OYCA 4ZTXA 3IJ7A 7REQA 3LM7A 4GQBA 4Q22A 1ITQA 4J5NA 4KS0A 2E77A 2WQPA 3B03A 3WQ4A 2G95A 5CH9A 4F9DA 1V3JA 3H2NA 4YN5A 3VMPA 1LQ2A 3L5LA 2VFHA 4NYUA 3GTXA 4RDYA 3AIUA 1B3ZA 3ZLHA 3CUIA 1C91A 5I3FA 2I16A 4JTSA 2PD5A 4N9CA 4GC3A 3R1ZA 3A23A 4H8UA 3TKFA 1XIMA 3Q58A 3PN8A 2V38A 2V5DA 2VGFA 2QJMA 3WD1A 3TR9A 3GY1A 2ACRA 5CSSA 2FPYA 1B57A 1YDOA 2XH2A 1SR0A 4ATWA 5MF5A 5BW6A 1OIFA 1P6CA 1UD3A 3CEUA 2WVUA 1UD2A 3KLLA 3D3FA 3W2JA 2V3GA 1QAPA 1RBOB 4H6RA 4LPCA 4OV4A 1FH8A 1A3XA 1OY0A 3OPSA 4RCXA 1U5VA 5D2VA 3NPVA 4DYEA 4KWSA 3VKDA 4E2OA 5EMMA 4D6CA 1QBBA 4NZ1A 2PLKA 3R2GA 3VGDA 1TREA 4WDXA 4A21A 1VPXA 3GX9A 3RO6A 4IGNA 4ACZB 1B2YA 1KR1A 2QCMA 2OWCA 2OGYA 2ATMA 1FDZA 1BRLB 1V51A 1W8SA 2F6UA 2POZA 3MKKA 3QTPA 1BEUA 2DT0A 2PDNA 3ITCA 4GJIA 2QDDA 4WSHA 2PGFA 1I1XA 2XN1A 1ZAHA 2H3BA 4EXAA 4O54A 4FO4A 4UTTA 1E1EA 4GUIA 3PBWA 4KBXA 5AN7A 4WLCA 3VNMA 2DUXA 3NM3A 4DJFC 3VDBA 4HNNA 4IX0A 4NP7A 1B9BA 5LA0A 1W1VA 4TVUA 3ZQ9A 1B54A 1DQWA 4RL3A 3MYPA 4A35A 3CUGA 2J6VA 1V08A 1QXLA 4JXCA 4WXZA 3ZO9A 1GORA 1S1RA 5D8WA 3RM9A 4R7OA 3WJWA 1FXPA 1TR1A 4A3RA 3GDBA 3BLEA 2PTYA 2H90A 1BSIA 2Y62A 2J25A 3M9YA 3L4YA 1TMHA 3G77A 2NQ5A 4CQ9A 3W6YA 4ZOCA 1XI3A 4C6JA 1GOIA 2OZTA 1XPGA 4ZB0A 1EJVC 2R94A 4H6QA 1WQ5A 5JH2A 3PNZA 3L67A 2YLAA 4Y90A 1F4AA 5CPTA 2ZZ1A 1HJUA 3M1ZA 1LQAA 3UZWA 4O19A 4AU0A 5D04C 3OLIA 1S2WA 2ZVIA 2ZBTA 1KRMA 3MHGA 4DHGA 2BBFA 2PWFA 1XW8A 5FD0A 3CV1A 1W3KA 1R9ZA 3HQOA 4AZHA 5CBJA 2GQ3A 1X7IA 2VFDA 3QMTA 1XC4A 4OTKA 4TMBA 1QOQA 2PRMA 3BARA 4JDYA 4QLKA 2A3HA 2XU2A 1Z9AA 5D03A 3GM8A 4PN2A 5ABHA 1WV2A 1AMKA 1NWRA 1DORA 5LGZA 3PUGA 1EL3A 1XH2A 3Q4DA 4YVPA 5BOEA 4JHOA 1MZRA 2PDXA 2KAUC 1L6YA 3CUFA 8XIMA 3LRMA 3TR2A 4HCDA 1XJBA 2ONEA 4MWAA 1CXKA 4HU0A 3TLLA 3OBKA 5CBBA 4C5ZA 1WKFA 4K1GA 3ZWTA 4D2JA 5FJJA 3N13A 1VYPX 4NJJA 4ROQA 4H7CA 2J8TA 4RX0A 3UZ5A 4MPKA 5FF0A 5HPOA 3QQWA 3LPPA 2EGZA 4N6EA 2ZZ4A 5A6KA 2X09A 4GACA 1JPKA 3JR2A 1PZ1A 2BX7A 4ZE4A 1JULA 3APYA 3F2CA 2E9LA 2WHJA 3H54A 5AC8A 6REQB 3KLKA 2TYSA 4QAIA 3B0PA 3BQ5A 3QBUA 4UFJA 1WAWA 4QE5A 3TK7A 1XS2A 1CI1A 4RKAA 4HNUA 3IVUA 3M0MA 1O6IA 4B5SA 4AMAA 4NL1A 4LXFA 4A4AA 1MWOA 1W9PA 3EKZA 2CXGA 4JKLA 1NU5A 4JS3A 4PRTA 2D3LA 1MW2A 2PDPA 4QITA 3O06A 4J4KA 4NAEB 5AC7A 3EWXA 4DXKA 1VJIA 2FTYA 3NO1A 1LT8A 3CQJA 2YB4A 2J7BA 4FMVA 2QNEA 3WH9A 1GQLA 4FLQA 3BG5A 4UTLA 5L9FA 2HE8A 4R33A 4GG9A 1V0KA 1HGWA 4OECA 3G0XA 5M03A 1XYCA 2A0NA 3T78A 1F76A 1B3XA 3VYLA 4BHYA 5HWNA 1OX6A 3K2GA 3TROA 4AXNA 4CLMA 3IIZA 4EK7A 2CLIA 1O5XA 4MFDA 4KPLA 1YMYA 2YX0A 4XZ9A 4UB9A 2XIJA 2E0PA 4L6DA 1A5KC 1DWHM 4IL2A 3OW1A 4NSBA 4ZGYA 4GIRA 3OBAA 4IICA 3O9NA 1R7OA 5G4EA 4C6KA 2FHBA 2QCGA 5TQLA 4OBTA 2XIBA 3SCWA 1J8VA 3NA8A 3W1UA 3A6OA 1AA1B 4S3KA 3VCRA 3CV6A 1PCWA 1N8IA 4HHPA 3ITTA 3URNA 5EMYA 3VCCA 1GEHA 3VGEA 4H9ZA 1PX4A 1QRQA 5EMLA 3QOMA 1H62A 5F1VA 2VC6A 3EKGA 4KCVA 3PJTA 1Q8JA 3VO0A 3OVRA 2BOFX 3G3DA 4NZFA 4BQ4A 2FLIA 4XWUA 2V6AA 3BMVA 3SCOA 1X7FA 2PWVA 1YX1A 4YIWA 2Q71A 1K7FA 2WWDA 3W82A 4YTTA 5EFDA 1FUYA 4QDMA 3VFCA 1J2BA 5AVHA 1KO0A 4DJEC 2JKAA 3AZSA 1IGSA 4GYFA 2P53A 1AL8A 2HJPA 4ICNA 4AZGA 3AICA 4E0CA 2DVUA 1XLKA 3GNNA 1MRAA 2AAMA 4LY4A 3MUY1 3VD4A 1XCWA 1UWTA 3UERA 3GNXA 4I7VA 4CEXC 1WOBA 1YNYA 1E9LA 3NSXA 3U2OA 3P74A 1AJZA 3M4HA 4E6MA 5FF7A 5J04A 1UB3A 3RMEA 4Q8WA 4GUFA 3VKKA 2QCFA 4L5ZA 2NZLA 1VYSX 4HSNA 2NWSA 3SB0A 3EWDA 2CC0A 3WH5A 4QAWA 4M51A 1M6JA 3LMZA 1JZ5A 1EJWC 4GINA 2J66A 4B4HA 3KHJA 3ARRA 1DHPA 4UR9A 4FS9A 3OQEA 2HE5A 3CNYA 2DT3A 5CG0A 1J11A 2CKRA 4I90A 1L6GA 1HGYA 1TO3A 4C6NA 3KX6A 4EF8A 3O16A 4J3XA 3VDGA 5LYRA 2BGNE 2EQDA 4I6KA 8TIMA 4NZJA 3NPWA 4TVDA 2XHYA 2ICSA 2WW5A 4RUBA 3XIMA 4S1FA 3ICJA 2DZUA 3WQCA 3B8TA 1XRTA 4E8DA 5AHLA 4Q6JA 4PCTA 3BAJA 1X1OA 1QW8A 2E6FA 1FWRA 2DJXA 1TTQA 1YE6A 3WYZA 4YPJA 2VC7A 4UFMA 4HMDA 4US6A 2HS8A 4EOUA 3AHTA 4U5KA 5C54A 1CIUA 3T07A 3GQYA 4YYFA 2VFGA 2PP0A 3R10A 4WDWA 4NJKA 4B4FA 1UP3A 2D22A 3W7CA 1BXCA 2HISA 1EXBA 1LOSA 1KM3A 1JCLA 1RBLA 4BI6A 4FOKA 3N2MA 3JU2A 5E09A 2OQLA 4EXQA 3B04A 4K38A 4UC5A 3W9ZA 1SQ7A 5BOFA 2ANUA 3LLFA 4NAFA 4L1XA 4B9YA 4KEZA 4GXWA 2GSEA 1WO2A 2BY0A 4LEFA 3RG6A 3W6MA 5G2WA 2VKZG 1O1ZA 2EPOA 1OJXA 3AYRA 1K9DA 4J2PA 3A4WA 1MNZA 4S3JA 4ATDA 1VS1A 5LNUA 1RALA 4V2XA 1PXGA 1W17A 4X60A 3RAOA 3RHGA 3EX4A 4XAFA 1TTIA 2WSPA 4W5UA 4MB3A 3WX7A 4WOQA 3M41A 1QI3A 3CHCA 3GUGA 4YTQA 2FZBA 3CL7A 4PMDA 5D8ZA 3GVVA 2Y8VA 5A2CA 1SSGA 1CNVA 3VIKA 2I5QA 4GZEA 1EQCA 1WXYA 1DXEA 1T99A </