4ZENA

Structure of gan1d, a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
474
structure length
474
Chain Sequence
b'HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
molecule tags Hydrolase
source organism Geobacillus stearothermophilus
publication title Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
rcsb
total genus 192
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zenA00
4GKLA 1EDQA 3QHMA 5DO8A 5I5RA 3MV11 1Q6FA 3VDHA 2W67A 4TX8A 2D2OA 1FOBA 4EK7A 3T0BA 1GOOA 3W0KA 4X0NA 1GUVA 4W7WA 1VFMA 4P8XA 5I79A 4XV0A 1EDGA 1VBRA 2J47A 4LYRA 1DWGM 1UQYA 1UWTA 1OGSA 2W62A 5A2AA 4JKMA 1UG6A 4H8UA 3IK2A 3KL5A 3MKKA 4AEFA 4MNKA 2YJQA 1E6RA 5DF0A 2DIJA 4JL2A 4JFSA 1LL7A 1Q6GA 1N82A 5CGMA 3CHDA 3F5LA 2WVSA 3N15A 2GJRA 1ISWA 4NRSA 1HXJA 3L4ZA 3N17A 6CGTA 3UESA 2HISA 2CIPA 1UQZA 5JIPA 2DGAA 4UZUA 2BXZA 3VGBA 4B3LA 2ZXAA 1VFFA 4CCDA 1ZBVA 3W25A 1PZ2A 1H11A 2Y8VA 4F66A 1JIBA 2OYMA 3MMUA 2J77A 3PTQA 4DM2A 1WDPA 5FCZA 2GUYA 3CO4A 4UNIA 1XD0A 2VZVA 4C7FA 3GM8A 3UR8A 1HNYA 3U57A 1UR8A 5FL0A 1E9LA 3A47A 1HT6A 4RE2A 4HU0A 2X8RA 1XD1A 1BLIA 2V3DA 4EE9A 3AHYA 5EBAA 4H2CA 4F9JA 1VJSA 1OIMA 8CGTA 1KB3A 4AZ7A 1E5NA 4MTVA 3WDJA 2A3CA 3MUIA 3DYPA 5D9NA 1VB9A 2YA0A 1ISXA 2GVYA 4W89A 3CUGA 1QNOA 1R8LA 3VD9A 3CUHA 4B16A 1W32A 2JF7A 1JXKA 1EQPA 1UWSA 1DWFM 4OOZA 3VINA 4CN4A 3BMWA 4JFWA 2WC7A 5C71A 1GQKA 4P8VA 3VX0A 3ZIZA 3AIEA 4DM1A 1ZL1A 4OBSA 4GXPA 2GJXA 4OBRA 2XTKA 5LYRA 1KGUA 3WFLA 3SCOA 3SUSA 2VQTA 4UOQA 3NDZA 4DWSB 1VFUA 1W9DM 2QMJA 4CD6A 4P7NA 4EKJA 1VIWA 3KL3A 1F4HA 2W61A 3O9NA 1DHKA 5ECUA 5A8QA 4M24A 1W3HA 1H3GA 1JG9A 1GPFA 5M03A 1W91A 3GXDA 3PBGA 2O9OA 5EB8A 4HA4A 1CNVA 1VEOA 1DEDA 1CZ1A 1O7AA 4OOUA 2CPUA 3EMQA 1E1EA 3CHFA 3KWXA 1E4LA 1QI2A 1TVNA 4AMCA 5CG0A 5DT7A 4CD8A 4PMRA 1ESWA 3SUUA 3EBVA 3G6LA 2J7FA 1EXPA 1QI5A 1JZ6A 1V3KA 2J8GA 3F4VA 4NF7A 5I3DA 5EFFA 2YKKA 5ABEA 1H1NA 3UG4A 1E5JA 1NM9A 2ZUUA 4HMDA 2PBOA 3JUGA 1CXHA 3VDAA 2XUCA 1F4AA 3ALGA 4XUYA 5BXPA 5A2BA 1TA3A 2VCCA 4DUVA 1QNPA 1G9HA 1UKOA 1V0MA 3OLEA 3VD5A 1UWRA 3PZMA 2V5DA 2DSVA 3HU7A 1W9UA 1PX4A 2UY5A 5CPSA 1EOMA 1XH0A 3G6MA 4UFJA 3AMGA 3EYPA 1RPKA 1C93A 3PZQA 1OGGA 1J12A 5IFPA 4GQQA 4DWSD 3TTYA 3CUFA 1WZLA 1ISVA 2DSZA 2ZUSA 1NOFA 3AZRA 3ARWA 4P7QA 3RO8A 3ALFA 2CBUA 1QHZA 2WSKA 1XGZA 3RPMA 1M53A 2XYLA 4KGJA 3CZJA 4PRWA 1H0IA 4BQ4A 2WZEA 2X1IA 4Z2HA 3BLPX 4AIOA 1E6NA 3RM8A 1AQHA 2YA2A 4JZ5A 4OIFA 3SUTA 2WZHA 1TE1A 2JFEX 3VTRA 5I23A 1GOMA 1NOWA 2FGLA 3CTTA 4LXFA 3ARUA 3I3EA 1FP9A 2ZX8A 4RE4A 1XSJA 4Q22A 2WCSA 1PPIA 5C8BB 1HJXA 2JE8A 4FMVA 1GOIA 1HP5A 2GFTA 3ARQA 1CBGA 2XVNA 2WPGA 3WD0A 3THDA 5A6AA 3AMDA 4IISA 3VD4A 1K9DA 1WCGA 1E1FA 4Z2KA 3OB8A 2EQDA 3QHNA 1Q6EA 5A6JA 3GNPA 2F8QA 4MNJA 2DPEA 3VILA 2GJXB 2JEQA 2ZXBA 1JXJA 1JYNA 1UWQA 2A3BA 2FDMA 1ECEA 2CXGA 2VRJA 1GOQA 2WKGA 1W9VA 3ZM8A 1QPKA 1EH9A 1OB0A 3UCQA 3WENA 3F5JA 1I1XA 2WLYA 3EMZA 1E70M 5A2CA 2VCAA 3KZSA 2BNJA 3WD4A 3VOCA 1RD6A 3SCUA 2XVPA 2WVVA 1NOUA 3ZT6A 1B3WA 3A3HA 3KE0A 4U31A 3W4RA 1UD5A 1CEOA 2J7EA 1JDCA 1G0CA 1GQJA 5D8WA 1WZAA 1B30A 4CN6A 1C8XA 4FLSA 3PZUA 1E56A 3RJXA 2YL6A 4CU7A 1EOKA 4HA3A 1E6QM 5BXRA 2XPKA 1HIZA 1E55A 1TFVA 4M82A 1XHGA 1JZ8A 2E8ZA 2WSPA 3BSGA 4MNMA 1W1TA 1G1YA 1X6NA 5CZKA 1HJQA 4OUEA 1E73M 1KGXA 4JL1A 3VM7A 2WZIA 2ZUVA 3HJEA 4AZGA 1V03A 5GNZA 1QI0A 1FA2A 2O92A 5D4YA 1XSKA 2C0HA 1AMYA 4QFUA 3PZNA 5E6YA 2VQUA 2CETA 2D22A 2CBIA 3VIFA 3MANA 4OKDA 3ZR6A 2YLAA 4PCTA 2ZX7A 5E70A 1QOXA 2DH2A 1QVBA 3T2QA 1UR9A 1CXFA 3PZOA 3CIVA 2X09A 4P7OA 3BGAA 2J75A 3POCA 6A3HA 3BCFA 2J74A 1ISYA 3VDCA 4PMQA 1NWTA 3BAYA 2DQXA 1XCXA 5BRPA 4R5EA 4JKKA 4S3JA 2FHBA 4UCFA 3QOKA 4AD3A 2YBUA 2G41A 3T0DA 3AXIA 4Z2LA 4WLCA 1JI2A 4KMQA 2DEPA 3WY1A 4WKFA 2V38A 4F79A 1W1VA 2WLZA 3AS0A 5CGTA 5CQ1A 3WNLA 3PHAA 2UY3A 1JDDA 1HKJA 1OD8A 2YIHA 1CIUA 4HMEA 1NP2A 4AC1X 1MFUA 1GJWA 2XFRA 3AMCA 4BQ5A 4IM4A 1J0ZA 1SFSA 7TAAA 1J18A 1VFOA 4PN2A 2DSWA 5DFAA 1XV8A 5A8PA 1ZBCA 1DWAM 1PX8A 1V0NA 1CYGA 4H8VA 3ARRA 4PTMA 2WCAA 1WO2A 3VGEA 1WDRA 1B3ZA 1J0YA 3VD3A 2C7FA 1MXDA 3GDBA 1WPCA 4GO8A 4U3CA 1AVAA 4AD4A 5GQBA 2E0PA 3IANA 3DC0A 3VU2A 1JZ2A 2D0HA 3RCNA 2BVTA 4ML4A 3WQ4A 3A4WA 3K8KA 4E2OA 1Q6CA 1QW9A 1C92A 4RL3A 5A6KA 4UFLA 3GZAA 2CBVA 1WAWA 1UWIA 4TXEA 1LWJA 3O2LA 5IXEA 3T0AA 4L4OA 2EBNA 4J7RA 2YLLA 2Q8XA 1B3XA 2PWFA 4ZXLA 1MFVA 5HDRA 3MS8A 1RH9A 3NYDA 5FD0A 2WC4A 1UHVA 3T2OA 2VL4A 1HL8A 1B3VA 2G3JA 3M7SA 1CDGA 3GNOA 1M01A 4J3WA 2FH8A 3APGA 2XM1A 2GSJA 4AYSA 4ATWA 3WELA 1EA9C 1BHGA 2VTFA 1XH1A 4PBGA 1W3JA 4AZCA 3WD3A 4UQAA 1GVYA 4LYQA 1WNOA 1MXGA 5KEZA 4TOQA 1V3LA 1W9XA 2XFYA 2V3FA 3SEPA 2W4XA 3SCRA 1JI1A 1HP4A 2Y5EA 1CXIA 1QW8A 1MWOA 1HX0A 2D0FA 2WHMA 1JL8A 3NJ3A 4UQDA 5D9MA 5ABGA 3VMOA 4GZJA 4A3HA 1IZJA 4MAZA 5GPRA 3GBEA 4M81A 3FXYA 3WEMA 1J0JA 4D6DA 1W1PA 3WUEA 5HOSA 4HTYA 3VVGA 1E6PA 3AJ7A 3EDKA 2ZX5A 3AOFA 2D20A 4K68A 5CPQA 3W29A 2DIEA 5FKYA 1NH6A 1CLVA 2VVNA 4HZ6A 1CXKA 3FNDA 1W1YA 1E72M 5D8ZA 2EPOA 1Z32X 1H0GA 5I24A 3CZGA 3B9EA 4IPNB 2XSAA 4AY1A 4AWEA 1HN1A 2G8ZA 3NSMA 1H49A 1B0IA 1AQMA 3DHUA 2ZX9A 3K4DA 4PMYA 4ATDA 1XC6A 4YHEA 3FHAA 2EXOA 1E15A 1BVZA 1TVPA 1FH8A 2DH3A 1JGIA 2VZOA 1UZ1A 3AISA 2A3AA 3RMEA 4DUWA 2CERA 2ZUMA 3II1A 4TTUA 2TAAA 1Q6DA 2PWGA 2WB5A 4U2YA 1R85A 3PZ9A 3SCTA 3WUFA 2XWDA 3RJYA 1UD2A 4PMXA 1ZU8A 2YOCA 1CGYA 2WWDA 2ZWZA 5LA2A 2QHAA 9CGTA 2XHYA 5A8MA 4U5IA 1C7TA 4V28A 1OBAA 3VMNA 4A4AA 4GZEA 3CZ8A 4FLOA 4MB1A 3VIHA 1KXTA 1DWHM 5TD4A 3K8MA 3NDYA 3W24A 4W5UA 4CCEA 2WK2A 4JCMA 5AC5A 2WKLA 4TVDA 1V6XA 3FAXA 3ZJ6A 1UKPA 1C7SA 4XX6A 3BAWA 2BXYA 3W26A 3CZEA 3RILA 3GYCA 1DTUA 3WQWA 4D72A 2J7DA 4H41A 4AIUA 3CBWA 4TTGA 2WMHA 4X9YA 4EAMA 1TCMA 3EDFA 3NSXA 3IJ9A 4LGXA 4JFUA 3M46A 3BLKA 3VIJA 1LL4A 5A6BD 4D6IA 1BQCA 1IV8A 1UD8A 3OA5A 3E1F1 2GK1B 2OYLA 1A47A 1BF2A 1MQPA 2VC9A 5AYBA 1UUQA 3HMCA 1GOKA 3KL0A 3VMPA 1J0HA 3WNMA 2J25A 1CWYA 2V5CA 4E8CA 5HNNA 3WDIA 1W3KA 4PMNA 1IT0A 5IDIA 2VUYA 1NARA 3MMWA 1QNQA 2WHLA 5FIPA 3MO4A 2VO5A 4PSRA 4CUCA 2GK1A 5AYIA 2E8YA 1PIGA 1R87A 2VNCA 2ZXQA 4XZBA 3VNZA 1H41A 1ODUA 1W9BM 3N1AA 1P6WA 3WH5A 1XRVA 4FF5A 1UH2A 1U33A 1VJZA 1UYQA 5A8NA 2BY1A 2VI0A 1GNXA 1E0XA 4CD7A 3CPUA 3PTKA 4QLLA 3LPFA 1V02A 1QBAA 1GHSA 2QPSA 2NW0A 1GCYA 3MUY1 1XSIA 4HZ7A 4W88A 3ZT7A 1B90A 2WMKA 1MVYA 4JHOA 3WF0A 1B1YA 1FH7A 2VR4A 4ZXOA 3VDBA 3WKZA 1KBBA 5IHSA 3T2PA 2PC8A 4GI8A 3SCWA 3MV01 4QCEA 3WQ6A 1JFXA 1QBBA 1BYCA 2D3NA 4ACZA 2BY0A 3WMSA 2BY3A 1HL9A 2CNCA 2F61A 4HPHA 1HJSA 3N12A 2BHYA 1JZ7A 4JCLA 4PUEA 2BY2A 2FGZA 5HXMA 1U30A 3N18A 4LYPA 4AD0A 3BAXA 2EPLX 5C70A 3PZGA 1PEZA 4HMCA 2BHUA 3AQUA 4GQRA 3OLDA 2ZIDA 4TUFA 1JYXA 4YPJA 1NWUA 2EEXA 3QOMA 3BXWA 1UA3A 2WHKA 5A6BA 4BA0A 1V0KA 2ZXDA 3DECA 5BROA 4LPCA 5E6ZA 3VKKA 3VGFA 2CKSA 3W53A 5I6SA 4HP5A 1HJVA 1NP0A 2PWEA 3FW6A 4KH2A 1BPLB 3WD2A 3BAKA 1I75A 3WNOA 5M5DA 3ZMRA 2W63A 5A3HA 1ZS2A 4P8WA 5HBFA 3WFZA 1KXVA 1CENA 1UZ4A 3AZTA 2JIEA 3WQ5A 3N11A 4CN1A 1DWIM 1V3HA 1KCKA 3ZQ9A 4J28A 1B3YA 1SMDA 5EFDA 1HVXA 3WUGA 4E8DA 1EHAA 2JF6A 3CH9A 4YHGA 4LX4A 5E0CA 3AIVA 4F8XA 1L8NA 1NWSA 5JBDA 2DT3A 3AHZA 3ZJ7A 4W84A 1KFWA 4AZBA 4MDPA 4GIAA 1LJYA 1JDAA 3VNYA 1QHPA 4CVUA 3RM9A 1TG7A 3WL1A 3VIIA 2OSWA 3WQVA 3GXFA 3WDRA 2WBGA 2CBJA 2PI6A 2BHZA 2F2HA 3AHTA 2QV4A 2WMJA 1EIBA 4UQEA 2XVGA 3VO0A 4CCCA 1J0KA 3WMBA 2WYSA 4XB3A 5A6MA 3MU7A 4CU6A 1FFQA 3FHQA 3AHVA 2WVUA 3GXMA 4MADA 2WBKA 3AMLA 4YN5A 1BAGA 1HJUA 1MW0A 1FP8A 3GBDA 4D71A 1D3CA 3NUKA 3D5HA 1OD0A 4B9YA 2VX5A 1BG4A 3ECQA 3HN3A 4UFKA 2YBTA 5A95A 1OWQA 1EQCA 4DUXA 4UQBA 3VGDA 1V3IA 4HOXA 3EDEA 3VX1A 2E9LA 4LQ1A 4D6EA 1TZ7A 2IXUA 1J0IA 4D1IA 4CD5A 2J79A 5JBEA 2GDVA 3UERA 2A3HA 3GH7A 3WF3A 3RIKA 4UR9A 2Y4SA 5ABFB 3B9AA 3CGTA 1ZBWA 2Z1KA 1WKYA 3D3AA 1I1WA 4ZE5A 5I77A 2DDXA 2DT1A 4H04A 3OLGA 1PIFA 3CHCA 5GNYA 4MB4A 2X2YA 4PMZA 1UR2A 1S46A 3VM5A 2QMKA 1OIFA 4D6GA 1JZ4A 3U5UA 2HVMA 1JAKA 2GDUA 1IZKA 1KXQA 1CTNA 1E71M 1W2VA 1UD4A 2W91A 1PJ9A 4WIWA 5ABFA 5CLTA 3F5KA 3K1DA 3AFBA 1CPUA 4Z2IA 2XWEA 2NT0A 3AXHA 3TP4A 1OM0A 5CSYA 3ZSSA 4OJYA 1EGZA 3CMJA 1ITXA 1E4MM 1ODZA 3WUBA 1LLOA 3FN9A 3WNKA 2CESA 2BFGA 5M17A 3A4XA 2E40A 1TR1A 2E9MA 3W81A 3AS2A 4CU8A 2A3EA 1E0WA 3AIRA 1JF5A 4WSKA 3WSUA 3SIMA 4CGTA 1E6SM 1WB0A 4KGLA 2Y24A 3N9KA 3VIKA 2VX4A 3UG3A 1ZJBA 4PTXA 1JZ3A 3VPLA 3UETA 1VENA 4JKLA 2VCBA 3PTMA 4UFHA 2DT0A 1E3XA 2E9BA 1HVQA 4MAVA 2YL9A 1FHLA 3CMGA 4S3KA 2UY2A 4J3VA 4U5KA 1XYZA 1XCWA 2J78A 3ARZA 3OGSA 1GORA 4M56A 2E4TA 4HOZA 2J8FA 2XGBA 3VGGA 2WW5A 4KRTA 4L4PA 1R7AA 1OT1A 2WMFA 1JD9A 1V02E 3WF4A 4UFMA 5LA1A 3WMCA 4UQ9A 2X0HA 1EHNA 2WC3A 2XG9A 2RGLA 3OZPA 3CHEA 3UR7A 1KWGA 4C7DA 3W6LA 3BCDA 4AXNA 2OLHA 1V3JA 4QCFA 3U7VA 4M1RA 2CITA 2C8NA 1KR0A 3I3DA 2PWHA 1JFHA 1Y7VA 3U5YA 3L4TA 4N42A 1MW3A 3AIBA 3WDQA 4QLJA 1XYFA 3VIMA 1BYDA 3OGVA 4WF7A 4AZHA 1UD3A 1XH2A 4BCEA 2GJPA 3AI0A 2WVTA 4PSPA 4J3TA 1CLXA 4DWSA 3CUJA 4HA1A 2WMGA 5CXPA 3QR3A 2OWCA 2O9RA 3DHPA 5E9AA 3OLIA 3CUIA 3NSNA 1FFRA 4M8UA 3WH6A 4Z2JA 3EMCA 2AAAA 1KWKA 4IUGA 1JYVA 1E4NA 2J7BA 4Q7NA 2XVLA 3QHOA 4BQ3A 3AYSA 1C8QA 1RP9A 4D6CA 3L4UA 1VBUA 1D7FA 3MUZ1 2FHFA 3CZLA 3DYMA 4GO9A 3WNNA 2NT1A 3BAIA 1CGXA 1KBKA 2V3GA 2Z1SA 3IJ8A 1V6UA 2EJ1A 1C3FA 1HJWA 4GINA 1GHRA 1V08A 4AD5A 5KZ6A 4ZFMA 3IJ7A 5CJ5A 1SR0A 3GTNA 3B8SA 2WAGA 2MANA 4PTWA 3TA9A 3UEQA 4HOWA 1PAMA 1QHOA 2O9PA 1BGAA 3ARYA 2ZWYA 2VMFA 3L4XA 1DWJM 2ZOXA 3VD7A 2WANA 2RGMA 3ARPA 4GPNA 3BAJA 2ZUWA 3BMVA 4PCSA 3PZVA 4W5ZA 1KR1A 5I0DA 2D3LA 3K4AA 3GNRA 1L0PA 2UWFA 3T08A 4AIEA 1FHDA 4W7VA 3TTQA 1PBGA 4MB3A 4PMOA 2J4GA 2V3EA 2OSXA 3GXIA 3M07A 2WCGA 1CXEA 1B31A 4J27A 1V0LA 2XIIA 4CKQA 1WDQA 2PWDA 1AQ0A 5F7UA 1G94A 1K9TA 2VOTA 1KGWA 4PMVA 2W92A 4N0RA 3AHXA 2OSYA 4AZ5A 3TONA 4UTFA 3EDJA 1V6VA 4PMDA 2EO7A 3MSDA 5A94A 3OGRA 4MJ2A 2OWWA 4BZYA 4X0VA 5EMYA 1B9ZA 2G4FA 2YA1A 3RM4A 4ZENA 4P8UA 3BH4A 2WNWA 3ZOAA 1EO7A 1OT2A 2VURA 1MQRA 2VR5A 3QGVA 2YDQA 8A3HA 2QF8A 2YL8A 3ZO9A 1O6IA 3ARXA 1BSIA 1PX3A 4EANA 4GI6A 1OGBA 3ZJKA 3NIYA 4RE3A 4WSJA 1GVIA 4NSBA 1KXHA 4W8LA 1QNRA 3WH9A 4NI3A 5IFTA 3MSGA 4B3KA 4B15A 1X1NA 3BC9A 1SYTA 3WIJA 2E3ZA 2FH6A 3ARSA 3WDHA 1R7OA 3W6MA 1BVNP 3W82A 1E6XM 3WL0A 2J7HA 4ACZB 3OZOA 4HPGA 4QP0A 5A6SA 3OBAA 2VJXA 2VX7A 1CXLA 2CKRA 1UR0A 2NSXA 3SCPA 5D9OA 3T09A 1CECA 2J7CA 1G5AA 2WHJA 4W7UA 4U33A 2XFFA 4M29A 4D6HA 2B31A 4UQCA 1GOWA 3AS1A 3SCQA 3VGHA 4WK9A 4BS0A 1BGGA 4U3AA 1GZJA 4JIEA 1H2JA 1W9PA 4GZIA 5AC4A 1US2A 4NRRA 1ZBKA 2PBGA 2BV9A 4TVCA 4PMUA 1K9FA 2CYGA 1V6YA 2WWCA 1E40A 3AIQA 3S6TA 2CCRA 4JFVA 3VIPA 4AD1A 2IXVA 4PEEA 3WQ8A 4CD4A 1WP6A 2X05A 2JALA 1G01A 1BFNA 1B2YA 4UOJA 2PF0A 4R27A 1LWHA 3A6OA 4W87A 4E4PA 7A3HA 4TX6A 1TA3B 1V6WA 1BTCA 2YDSA 3SCNA 1D2KA 2W5FA 7CGTA 2FHCA 1VEPA 2OYKA 3BSHA 1H09A 1UH4A 2QLYA 1LL6A 3L4WA 4TVUA 4XZWA 2W66A 4U2ZA 2AOSA 1VRXA 2VT0A 2EPNA 3L2LA 4DWSC 1NQ6A 1UR4A 5A8OA 5D9PA 2IUZA 3U7BA 3SUVA 1M03A 3TOPA 3AYRA 5A1AA 3WH7A 1KQYA 2BVDA 1WZMA 2VVSA 5AY7A 1HKMA 1WDSA 2WM0A 4OZOA 1J01A 2ZICA 1HKKA 1OCQA 4H7VA 4WKAA 2XM2A 4BQ2A 2VRKA 5DEZA 1WZKA 3GH5A 1UH3A 1J9YA 2WMIA 5E09A 2VZTA 3AXXA 5BXSA 5I2UA 2VRQA 4W86A 1C90A 5JUVA 4V27A 2BVYA 4P7LA 1LG1A 5GNXA 3W27A 2VZSA 1EDTA 4P7RA 1UKQA 2YDRA 3PZTA 5LA0A 4M80A 4V2XA 5JBFA 1UA7A 1ZB5A 3ZJ8A 5IHRA 1BYBA 4JFTA 1ISZA 3KEHA 3W28A 2G3IA 1E0VA 1RP8A 1C91A 3SCSA 1QNSA 2WMIB 3WD1A 3VIOA 2D24A 5BWFA 3L4VA 1CGWA 2VZUA 3CZKA 1A3HA 4BF7A 1OINA 3WEOA 2JIWA 2DSUA 1VEMA 1GQLA 2ZX6A 1H4PA 1M04A 2J62A 1BG9A 1KQZA 3M6DA 4D6FA 1QI3A 3AROA 3WN6A 4URIA 3LPOA 3LPGA 4MJ4A 2Y2WA 2CHOA 3NCOA 4J3SA 1J11A 5M3WA 3WF1A 1U2YA 1UD6A 4W8AA 2WVVB 1CGVA 3N04A 4J3XA 2UY4A 3SURA 3K8LA 1V3MA 1UKTA 2ZUNA 2D23A 3LMYA 2G3MA 5ABHA 1MW1A 1PZ3A 1Q4NX 4C7GA 3IAQA 2DT2A 4QDMA 4UOZA 3OIHA 2Y8KA 3AS3A 2XJ7A 1MQQA 4PUDA 1HF6A 3AICA 4QAWA 4UFIA 3WNPA 4Z2GA 4W85A 3J7HA 1KCLA 1SMAA 2XGIA 3WBAA 5DT5A 1E6ZA 2AMGA 2WXDM 3POHA 1QI4A 5CPTA 4ZEPA 1C8YA 1TUXA 2PB1A 3WH8A 4B9ZA 1WE5A 3TTOA 1UR1A 3DYOA 3AZSA 3EDDA 1K6AA 1JZ5A 3WF2A 4AZIA 1J10A 2CEQA 4QLKA 2O9TA 1MYRA 1H5VA 1YHTA 5BXTA 3ARVA 1JAEA 5HPOA 4IPLA 1DP0A 1GW1A 1FH9A 1M7XA 2DSKA 3AIUA 4AZCB 2BS9A 5HPCA 3MUAA 3GH4A 4W93A 5DMYA 1CGTA 2VX6A 1W2PA 3PZIA 1ITCA 3RDKA 4HZ8A 2X0YA 2D1ZA 1BYAA 1E4IA 3SCVA 3WEZA 3TTSA 2ZUTA 2ESCA 2XSBA 4WKHA 5BYWA 4GI9A 5A6LA 4MPKA 4FK9A 3AIWA 3PN8A 2QPUA 1US3A 1JNEA 4AD2A 3CLWA 3FAWA 6TAAA 2JEPA 5BRQA 3ZT5A 5BCAA 1UWUA 5I78A 2CHNA 1JNDA 1VAHA 1X6LA 3UG5A 1LQ0A 1EO5A 4AEEA 4AZ6A 3A4AA 1JD7A 3S2CA 4JHZA 5FL1A 3LPPA 2OWXA 4W8BA 1OSEA 1UOKA 1HKIA 4PTVA 5FOOA 5CLWA 1LG2A 5CSUA 1LF1A 1JYWA 1MW2A 3W38A 4HU8A 4KRUA 3MMDA 3L2MA 1UKSA 2XIBA 4WJXA 4D1JA 3I3BA 3K46A 2XVKA 3N13A 3O6AA 4FLQA 2D0GA 4Y7EA 5JIWA 1TMQA 2G3NA 3ARTA 5A69A 3ZSTA 4AISA 3THCA 4AW7A 4MB5A 4MDOA 4ZE4A 1CGUA 3W37A 3WBEA 4NZCA 1K9EA 1GJUA 1W3LA 4PYSA 4UZSA 4D6JA 2ZE0A 3OG2A 4H8HA 4F9DA 4A3YA 1VF8A 4CVWA 3ZR5A 3VUPA 3L4YA 1JF6A 1NWRA 4ATLA 4FLRA 1ZJAA 3WDPP 4ACYA 1E43A 4KWUA 1YQ2A 2YL5A 3FY1A 3IAPA 4J3UA 4JAWA 1E3ZA 3AMKA 3B9DA 2EPMX 3SUWA 3VIGA 4MNLA 1GQIA 1R86A 2EPKX 5E0FA 1GONA 2J7GA
chains in the Genus database with same CATH superfamily
1I6NA 2Q01A 4K8HA 3QHMA 1DORA 4AX6A 5I5RA 1F9CA 3LG3A 2YBVA 4TX8A 1UBSA 2PGRA 2ZZ3A 1ZP3A 2HVOA 4W7WA 4GNKB 4MUZA 2QYGA 5I79A 3UJ2A 1VBRA 2J47A 3ZVIA 3BZJA 1DWGM 3ITCA 5HK4A 2W62A 4JKMA 4EAYA 1Y5VA 4O12A 1XUZA 3IK2A 3MKKA 4HSNA 1J4EA 4AEFA 3GK0A 2DIJA 1SO3A 1KM2A 4A35A 4H9MA 1UPMB 1KFKA 4FXRA 3F5LA 2WVSA 3M6YA 1HXJA 4RPQA 3N17A 3UESA 4G8TA 3L23A 2DJXA 3W7JA 3EOOA 5JIPA 3VOFA 3KTXA 1WBJA 4DYKA 4H4IA 4JTLA 1Z41A 3W25A 1PXGA 1PZ2A 3RRXA 4FAMA 1H11A 1FWBC 4F66A 4Q8VA 4FO4A 2J77A 1WDPA 1GJPA 4ZZ9A 4PZVA 3UT0A 4AHPA 3AXMA 3GM8A 3R4IA 2OQYA 4TMBA 1YXCA 2O4QA 2ZDSA 4IIGA 1OFAA 4RE2A 1M5WA 3P0WA 4HU0A 2X8RA 2ZRUA 1ZLPA 1BLIA 3OZMA 4IP7A 4RW5A 4H2CA 4F9JA 3NTYA 3W73A 3UXKA 2FTWA 3SO7A 3COTA 3EPOA 1FCVA 1KB3A 1SO5A 4ZFCA 4KCUA 4MTVA 4QBXA 3ABQA 2P5NA 1L6YA 3DYPA 2R82A 2CW6A 4JYFA 2QCFA 1R8LA 4LALA 1W32A 1WQ5A 2B4GA 1ML1A 1UWSA 2TODA 4OOZA 2XGZA 2P0OA 2WC7A 1IIHA 3PWIA 3AIEA 1ZL1A 2OJPA 4GXPA 5CBJA 3FVDA 3V5OA 3VCRA 3SCOA 2PP0A 1SFLA 4MY8A 3UJSA 4DWSB 1VFUA 1J6PA 2QMJA 1AH3A 4CD6A 3T78A 4EKJA 3H2AA 1VIWA 1EBHA 3KL3A 1TZ9A 4RJEA 3W7EA 4Q6JA 1W3HA 1LCOA 4NZ3A 3NXLA 2IKJA 3C8NA 4HD5A 2XH0A 1XRFA 3HPFA 4NHVA 1VEOA 3EXRA 4Y9MA 1O7AA 3FDKA 1ZALA 1QI2A 5M2FX 5FF2A 3ITOA 4AMCA 2A5HA 2ZZ2A 2P88A 1JPIA 4Z42C 4LS1A 2QVNA 5CG7A 1RQBA 2J7FA 2C79A 1H1ZA 3URNA 1JZ6A 1V3KA 2QR6A 4LFYA 3GDLA 1FBAA 4FNTA 1G7UA 2YKKA 1FX6A 4RDWA 1TRIA 3G8EA 4KFNA 2ZUUA 3KTCA 4HMDA 4IT1A 2XUCA 1F4AA 3B97A 1GKPA 3ALGA 4N9BA 5I00A 4N6FA 4B92A 3APYA 1UKOA 1UWRA 2V5DA 3LB0A 3HU7A 4ZA0A 3ABRA 4ZQPA 2J6XA 5FI8A 1EOMA 5DBTA 4DAIA 4G6CA 4GQQA 3FJLA 2O4MA 4IL2A 3CK5A 2YCEA 1EJWC 1WZLA 4NY2A 2DSZA 1WOBA 3IVUA 4S23A 2ZUSA 2A7NA 1VHNA 4C6LA 2NWSA 3AZRA 5HQMA 1OK6A 3KFTA 3S47A 2WSKA 1XGZA 3BQ6A 1A4LA 1M53A 4KGJA 4Q4MA 5JH1A 3CZJA 4HT3A 4PRWA 5EY5A 4BQ4A 3FFSA 3LV6A 4H9VA 2GOUA 3A5VA 5DLCA 1SUXA 3SUTA 3CMFA 3A23A 3WCZA 2CLMA 1N2VA 3CTTA 3KBSA 3DFSA 1FP9A 2ZA3A 4BWLC 1XSJA 1UZDA 1PPIA 5C8BB 2JE8A 4LW7A 1GOIA 2GFTA 1PO9A 1CBGA 5G4EA 2VM8A 4FNPA 3WD0A 2ZKMX 3I68A 4RK8A 4UMBA 3TSDA 3JRKA 1KO0A 1X8FA 3QHNA 1Q6EA 3ZVHA 2OODA 3GNPA 2F8QA 1W5OA 2NXHA 2CHRA 2Y7EA 3A64A 4M6VA 3Q67A 4I6VA 3G0UA 1JXJA 4M6PA 1UIPA 4GYKA 1JYNA 2A3BA 4DBWA 2CXGA 1QPKA 4HJFA 4LY4A 3ZLHA 3WENA 3F5JA 1I1XA 3URBA 2BNJA 1VFTA 1E51A 1RD6A 2XVPA 3TYAA 4RCXA 3LCLA 3TIMA 1OC7A 2Q3RA 1G0CA 1RD5A 1DJXA 1DBTA 3VNLA 1C8XA 4C6BA 4FLSA 5E0KA 1F73A 1EOKA 5AHLA 4EP8C 3B8DA 1W17A 2Y61A 5DCDA 4INFA 1IYXA 4XO6A 5D32A 1HJQA 5G5IA 1KGXA 5D38A 3UZ5A 2ZUVA 3PAOA 5GNZA 3VNMA 1FA2A 3LCGA 3G0XA 4J2MA 4JYDA 3TJ4A 2C0HA 2Y70A 4ZL1A 1F3TA 4QJ1A 3PZNA 5E6YA 2G37A 3AUOA 3MI2A 2D22A 3C0SA 4XKMA 2DP3A 4OKDA 3HFTA 8XIAA 5E70A 2BB0A 1RSCA 4O1AA 3OQ8A 4DPPA 4L1GA 3VZXA 3OZYA 1XFCA 1CXFA 3PZOA 3UVAA 3VOIA 2QUNA 3BCFA 3TR2A 4XVDA 1A5CA 1R3YA 3VDCA 4PMQA 4FA3A 3ZLGA 3SY8A 3T8LA 5HUPA 4R5EA 1S1RA 2FZ9A 4UCFA 1ZAHA 2CFFA 2YBUA 3QV9A 3KS5A 4WLCA 1RUSA 2DEPA 1ZGDA 1G7VA 4WKFA 1HG3A 1I8JA 1W1VA 2WLZA 5HR7A 1IXOA 1XINA 2YIHA 4HMEA 1NP2A 3G8RA 2XFRA 3BG5A 2A3LA 2B7OA 4IIFA 3MCNA 4K8GA 4BQ5A 1UCWA 2ANUA 4IM4A 1C9DA 3KOXA 4PN2A 2DSWA 1XV8A 3H8AA 4XZNX 2PDBA 3LXAA 1PX8A 3QLDA 1V0NA 5AC6A 4NZ1A 2VENA 4PTMA 2WCAA 4GJJA 3LTPA 3VGEA 1WDRA 2NV2A 3VD3A 3EWYA 1WPCA 3H2MA 4QSHA 4AD4A 2BTMA 1WXZA 5KINA 4O4VA 3QZAA 3M0XA 3A4WA 4E2OA 1REQB 2QW5A 3R25A 3IUHA 4UFLA 3GZAA 1JPHA 1UWIA 1LWJA 1DQXA 5HR6A 4KWSA 1R38A 5G2WA 1W1A1 4IFKB 1U22A 2QNEA 1R47A 2PWFA 3LHZA 4ZXLA 1RH9A 3HGJA 3BANA 3D46A 2WC4A 3GC5A 1UPPA 1VD6A 3LK6A 4NP7A 1HL8A 4DF0A 3M7SA 1LROA 4KERA 1M01A 2KX9A 4J3WA 2GGEA 3APGA 2XM1A 3QJAA 2YCIX 2FKPA 2Y1HA 2ASHA 4CLMA 3WELA 1BHGA 3GTXA 4C6MA 1EZWA 1VP5A 2G5WA 2DZPA 3NGFA 3MT1A 4TOQA 4IX2A 1DQWA 4YL2A 3GR4A 3TMQA 3UXDA 1CXIA 2PP3A 4QE1A 5SWUA 3NJ3A 4UQDA 2GVJA 4GZJA 1QMLA 4MAZA 3GBEA 1MUCA 1W31A 3S6OA 1J0JA 4HKPA 2NQZA 1YDOA 1MNZA 4FPSA 3VVGA 1E6PA 2ZX5A 2V5JA 4J2PA 1U1HA 4R88A 3R12A 5CPQA 1CLVA 2BODX 3N2XA 5F4SA 3GFZA 1B57A 1CXKA 5IRPA 3FNDA 3Q2DA 3DFYA 4ZSTA 3HZ3A 1R3RA 1H0GA 4J5NA 3V75A 3URQA 3WJWA 2J9YA 4AY1A 3NSMA 4BY3A 1G4PA 1G4TA 3BLEA 3DHUA 3K4DA 1J96A 4ATDA 4YHEA 1NJJA 5BMWA 1TVPA 2DZAA 4Y90A 2FFIA 2PDPA 3AU2A 3B40A 2XIQA 3ISIX 4UNKA 4EF8A 4DUWA 2CERA 4KT2A 4TMCA 5BU9A 4Z17A 2ZUMA 4BK9A 3II1A 1KNWA 2WB5A 4LOCA 4JN8A 1UD2A 3STGA 1FHVA 3WK3A 5L9FA 2YOCA 3GLCA 1L6GA 2WWDA 1KM0A 2QGHA 1AMKA 1EX1A 3NOEA 1ICPA 9CGTA 2CC0A 2Z2UA 1PTGA 1OBAA 2C1GA 1DWHM 3NDYA 1NU5A 3PJXA 1Q66A 4JCMA 5AC5A 1V6XA 3FAXA 3ZJ6A 1POKA 4PODA 3H7UA 2P76A 3W26A 5C7VA 3CZEA 3RILA 3PBYA 1JQXA 3M0VA 4AHQA 4H41A 5G1YA 4AIUA 3CBWA 4TTGA 2WMHA 4CNNA 4EAMA 1TCMA 3EDFA 3BLKA 1LL4A 5A6BD 2TPSA 1BQCA 2XIOA 4MZYA 4GNVA 5D2WA 2PDGA 2O7QA 1PCWA 3E6EA 1XLIA 4S3GA 1LOQA 5H6HA 4JOMA 1KTNA 5AYBA 1UUQA 3N6JA 9RUBA 3EWDA 3TFCA 3BLLA 3BGGA 2REQA 3NPWA 1U83A 2J25A 4E8CA 2AKMA 1HL2A 4M6QA 3OHIA 3PWGA 1NARA 3PTDA 5CPMA 3MMWA 3L65A 2YYUA 1AODA 5AYIA 4PEKA 3PJTA 3FV9A 3V0SA 2ZXQA 5AHEA 5HUOA 2ALDA 2YDAA 1QK0A 3RRAA 1XLGA 2FB2A 3WQOA 4NVTA 1FWNA 2BGNE 1ENUA 2YCLB 3S9YA 2VFEA 4ZVJA 1FY6A 3GDKA 3CPUA 3PTKA 2QT3A 2HTMA 1GHSA 4GNJA 1L6SA 3MUY1 1XSIA 3MSRA 1B90A 1VBHA 2L5HA 4Z1CA 2WMKA 5LHEA 5F1VA 2PGWA 4IF2A 4JHOA 3WF0A 1B1YA 3R0KA 2BBFA 3QYQA 1LUCB 2UBPC 3L0KA 3FJ4A 4AF0A 3WQ6A 1QBBA 3FYOA 2D3NA 2BY0A 1YADA 3LBCA 3RYSA 2IQTA 3TZFA 3N12A 1UWAA 3TYBA 2OR2A 3TC6A 5TIMA 5HXMA 1TREA 3F2BA 3PZGA 4TX9A 2ZIDA 1VCGA 3C0QA 2EEXA 3IRDA 3BXWA 4IX0A 1UA3A 2R91A 4BA0A 1WAUA 1V0KA 3DECA 5BROA 4JEQA 5E6ZA 3VKKA 5AHFA 2CKSA 1NDZA 1HJVA 4DO4A 3I10A 4PUJA 3M41A 1I75A 3WNOA 2YCJA 3OP2A 3UZYA 3N34A 6PTDA 1XKYA 1UZ4A 4LNYA 1J8VA 3CV1A 3N2OA 3WLHA 3N11A 4FS9A 1ICSA 1KCKA 3ZQ9A 2FFCA 1B3YA 4RUBA 1SMDA 4O1DA 3BPWA 3KHJA 3G1SA 1MSSA 1TMHA 4WGXA 5H8PA 2Y85A 3QFWA 4XO7A 3SGGA 1JCMP 2ZFAA 1L8NA 3M43A 2DT3A 2PGFA 3AHZA 5EYWA 1KFWA 4NX0A 4MDPA 3TYDA 4Y96A 5HQLA 1UZHA 4NT0A 3LCHA 2Y89A 2PTWA 3RM9A 3WL1A 2W79A 1XLKA 2Z0IA 5I3JA 3IVSA 4RZ5A 2F2HA 3NVTA 1XIGA 1PV8A 2WMJA 5A6MA 3MU7A 1FFQA 3FHQA 2WVUA 3LHUA 2WBKA 4I7VA 4DLFA 5PTDA 3GR8A 4DWDA 1FP8A 1D3CA 3M44A 4HHLA 3D5HA 3EWXA 2I17A 4N9EA 2NX3A 1ONXA 3HN3A 4H9TA 2O0TA 4Y6GA 3T8QA 2PDCA 4Z1DA 3UZXA 5F2LA 4DUXA 4UQBA 4Q6XA 2XH7A 1QFEA 2NZLA 3LNPA 4GJ1A 1F8MA 3EDEA 2QCNA 3TH6A 4LQ1A 3GU2A 4D6EA 4I5UA 3P80A 3MWAA 4GYPC 3MWCA 4D1IA 2FTPA 2E77A 2J79A 2A3HA 1T99A 2QQ6A 3GH7A 3MTWA 3BW3A 3GHUA 4WY0F 2Y4SA 3R43A 4NQ1A 1WKYA 3E49A 4DZIA 2G97A 1XX1A 3TC3A 3OLGA 1QR7A 1M9HA 3CHCA 4MB4A 3T9PA 2VC7A 4PMZA 2FGBA 3VM5A 2DUZA 1JZ4A 3BJTA 1K8ZA 3REQA 3CLMA 1S1PA 3N29A 3MYPA 2HROA 4Q4RA 1RVKA 3QW4B 1KTBA 2GSHA 5FJTA 3SI9A 4DI8A 3K1DA 1PUDA 4O1FA 2R1MA 2ZQ0A 1RJRA 5BZAA 4MKNA 4US5D 1KFJA 2QCHA 1OM0A 3ZSSA 4XD4A 1X1ZA 3EWZA 4Y2WA 1GVSA 3CMJA 4JDYA 2GPTA 1E4MM 1XG4A 2Y8UA 2GDQA 1LLOA 2CESA 4K6AA 1XRTA 5M17A 3BLDA 3EOSA 1IEVA 2W27A 3W81A 4CU8A 4LV9A 2A4AA 3CV2A 4TR9A 3WZ0E 3LHTA 3W00A 3WSUA 5F2GA 3QR1A 4KGLA 2DQWA 2Y24A 5D30A 5KITA 2IPJA 4OV9A 4OUIA 3EKGA 3STPA 4B4HA 3W88A 3E0FA 4IGMA 1HVQA 3CMGA 2F6KA 1Q2RA 3BLFA 2J78A 3ARZA 1I2PA 3OVGA 1FWGC 1GORA 4KF1A 4IMCA 2V30A 3VGGA 2WW5A 5CJNA 1XIJA 1R7AA 1OT1A 1TPVA 1HO1A 2WMFA 3GTIA 1I2NA 2VC6A 3L5MA 4XUGA 2FLIA 3W01A 1EBGA 3W6LA 2OLHA 4QDWA 3RUBL 1R2RA 3Q94A 1KD0A 4X63A 3LCFA 3FCPA 3L4TA 3OIXA 4UC5A 3WDQA 3E12A 4WF7A 3NDOA 4GE8A 3EB4A 2GJPA 3AI0A 3CWOX 4C60A 4Z1YA 4J3TA 1JQVA 2V5KA 3EGJA 4WEVX 3IJLA 3RN6A 3CUIA 1EYEA 4Z2JA 1XDMA 5TQLA 3OBEA 4IUGA 3QY6A 4GUHA 2XVLA 2QUMA 3CWHA 2XH2A 4D6CA 3G18A 2ZRXA 1B5TA 2FHFA 3CZLA 3U4AA 4GO9A 4LUSB 2NT1A 2GQ3A 2Z1SA 4XAPA 4PRTA 2BLEA 3H55A 1OFRA 2ZZ5A 3N3TA 4NG3A 1QOQA 1TIWA 2EJ1A 2PCQA 3WLRA 3ABOA 1RPXA 3KLKA 5KZ6A 4ZFMA 2VWSA 1H60A 1H7RA 2MANA 3U2OA 3EB3A 4E2DA 1IEQA 3GYEA 1QHOA 4ML9A 3TQKA 3THUA 4BI7A 1Y5WA 4CQ8A 1EXBA 1OG6A 5GJPA 3VD7A 2WANA 4GUJA 3BCJA 2ZUWA 3BMVA 4PCSA 2CZEA 1TVLA 2OU4A 4PRRA 3DU0A 1KR1A 2IQDA 8TIMA 1L0PA 2UWFA 4L56A 4LCRA 5AYYA 2V3EA 1CXEA 3W2JA 1V0LA 1VHCA 2RUSA 2Z29A 3B03A 3OOQA 4HCDA 1G94A 2VOTA 1KGWA 2HJPA 4MWAA 2O56A 4XG1A 1M7JA 4DLMA 1SPQA 3ID7A 4N0RA 3TWAA 4MKSA 3HOJA 3W6YA 3EDJA 1JRBA 3STFA 4IGNA 4O54A 4PMDA 1IWAA 3P2VA 1PIIA 3SECA 1NQKA 5A94A 1EYWA 1UP2A 2G4FA 2ONEA 4ZENA 2PDJA 2PDIA 5DCBA 4P8UA 2X1SA 3MVTA 3ZOAA 1OT2A 2G95A 8A3HA 1O5RA 3EX4A 1O6IA 4IIHA 3SZ8A 3EX2A 2AGTA 4NYYA 3QLLA 1M68A 2FPYA 3ZJKA 3GIYA 4NSBA 4YTTA 3T6CA 3UYIA 3IEBA 4R34A 1VBJA 4B3KA 1OFQA 1EIXA 2A7RA 4J40A 3ARSA 3WDHA 5CKSA 1R7OA 3W6MA 3CQIA 1XISA 3W82A 2J7HA 1JCYA 2DIKA 3IV8A 3OBAA 5FJRA 2VX7A 1IEIA 2CKRA 1FWEC 4C91A 4GQGA 1UROA 1WV2A 3T09A 3NR0A 4ERGA 4K1WA 5LIXX 1D8CA 4OWGA 2B31A 2OB3A 3MZNA 4LWWA 1NTHA 1FXQA 1GKRA 1KFLA 1XWYA 1P7TB 1XLJA 2A2IA 4JIEA 4GZIA 1XG3A 1US2A 1WDDA 4L9ZA 4TVCA 1ZNNA 1K9FA 2AL2A 3UR2A 1E40A 3P8IA 3TMLA 5D2VA 3P60A 3RFAA 5FJOA 1WP6A 4C6IA 3E96A 2X05A 4AG0A 3FLUA 1J79A 1TO3A 1U1JA 7A3HA 1EEPA 3EEZA 3MHUA 1TA3B 1V6WA 1FCUA 3SGUA 4F40A 2FHCA 3ZZ1A 2OYKA 3BSHA 1Q6QA 5HNUA 3NEHA 4I9AA 5HULA 4DJFD 5A8OA 1ZCOA 2BGQA 1A0EA 3TOPA 1S5NA 4GOAA 4JNMA 2INEA 3N9RA 3QZEA 1J01A 2VEKA 4GVFA 4CQAA 2XZ7A 3CO8A 5DEZA 1WZKA 1UH3A 1YTKA 3TLQA 4IPPA 1QATA 3M0MA 2CZ5A 2VZSA 4IMDA 1EDTA 1P0NA 4P7RA 3S2MA 2Q71A 2YDRA 4GFIA 2BGSA 4V2XA 4RXGA 5LSMA 1ZB5A 4NKCA 1KKOA 5IHRA 1BYBA 3KEHA 3TVAA 3ITLA 5REQB 4HZMA 5C9UA 3GDMA 4Q4QA 3VKCA 1LQ2A 1RLCL 1LLWA 4J3ZA 4UTLA 4ZODA 2D24A 5BWFA 3L4VA 4H6RA 3QPZA 1P0DA 4B5NA 2DZWA 5I3GA 4BF7A 4Q4SA 1YRRA 3V36A 1BSLA 3WEOA 4RNHA 3F03K 4LBSA 2ZC8A 2D2GA 2QCLA 4HVXA 1Y65A 1QWGA 3GO2A 1KM3A 4LU0A 4RDYA 2I5IA 1BG9A 1YIXA 3PFMA 5E1QA 5HJXA 1UP0A 1QJWA 3WN6A 4URIA 1V51A 3DFHA 4GWEA 1J11A 4M6UA 3UWQA 3H7VA 1KTCA 2WVVB 1W37A 2A7PA 3ITYA 1UKTA 4HB7A 1YPIA 1XLLA 3BW2A 4N9DA 4C7GA 4G1KA 2R1LA 4RDVA 2DT2A 3A4JA 3PP7A 3OIHA 3AS3A 2XJ7A 1MQQA 1X1OA 4O1EA 3AICA 3EZ4A 2MUCA 3G1XA 4WY0B 4DYJA 3SRDA 3E2SA 4RLIA 1QI4A 4R9OA 1MZHA 4B5XA 4ZEPA 3GXNA 1ME8A 4CNSA 1VFLA 1UR1A 3AZSA 1P6BA 1AG1O 1WKFA 2QJIA 3WF2A 1GEQA 4AZIA 5BOFA 2QJGA 4K2SA 1MYRA 3GR7A 4PL2A 5HPOA 4IPLA 1DP0A 3E9AA 1GW1A 1O66A 2DSKA 1QWKA 4AZCB 2BS9A 3APTA 3NO1A 3RITA 4GG9A 2CLEA 3PZIA 1ITCA 1XR2A 5DY3A 1TIMA 2D1ZA 1BYAA 3DH7A 3TTSA 7XIMA 5A6TC 5I07A 1VCFA 2PUZA 4ZCWA 2VGGA 3IRSA 3RR4A 1XP3A 2WZMA 1EF3A 4P5UA 4GI9A 1N8WA 1YDYA 1F61A 3AIWA 2QPUA 2V69A 5CGQA 4HNUA 1ZJHA 4LUIA 5BCAA 1UWUA 5I78A 4GUGA 1P0BA 3CQJA 1SM9A 4ZO6A 3LGEA 3EKZA 4C65A 1VAHA 3LX9A 4JIRA 1X6LA 1EO5A 1GYMA 1I2RA 4AFYA 2OWXA 1RLDA 1UOKA 2ZRWA 3GC2A 4PTVA 5FOOA 3M64A 3W38A 1VC4A 4CQCA 5BMXA 5I3KA 2V5LA 1M6JA 2X1TA 3I3BA 2XVKA 5E93A 4A8LA 4Y7EA 5JIWA 2G3NA 3ARTA 1DIOA 3SRKA 1PYMA 4GIYA 4ZE4A 1QO5A 3C86A 4NZCA 5F2IA 1XBVA 1LWIA 4NJJA 3T40A 4H8HA 3L9CA 1JF6A 2NSOA 1MMFA 4ILSA 3NPUA 4F0HA 1E43A 3LSCA 3CAVA 3NZQA 1E0UA 5CC5A 2DZVA 4J3UA 4JAWA 1E3ZA 3VIGA 3B9DA 2EPMX 4H6QA 3SUWA 4BI6A 3MYOA 2EPKX 5E0FA 2YX0A 2C6QA 4MKVA 2RDXA 4I6KA 1OFDA 4DZAA 3RHGA 1UJPA 2PLJA 2HVNA 1NDVA 3RLGA 3S2NA 4DUOA 2W67A 3MJMA 3GHRA 3I6EA 3DGBA 3SJ3A 1K8XA 3K30A 1A49A 4LYRA 5XIAA 2YXGA 1OGSA 3QY7A 2PLMA 3VNJA 1BWVA 3KL5A 4XD5A 4MNKA 4DBSA 3BICA 3N25A 3ICJA 1A5BA 3WQPA 4DJEA 1E1CB 3A5FA 1Q6GA 1N82A 5I06A 2OT0A 1V7YA 1K8CA 2C13A 2DVTA 4NRSA 3L4ZA 6CGTA 1SVDA 2HISA 4GYJA 2DGAA 4UZUA 4IMAA 4B3LA 4D9PA 4GX8A 1Q2SA 4A2RA 3UGRA 2Y8VA 3W1TA 4EX4A 3MMUA 3ONCA 3QR0A 5FCZA 1AUSL 2F2KA 3V4BA 3UA3A 2JKAA 1PKYA 2EG7A 1NDWA 3PSVA 2FZ8A 1ZCCA 1XD0A 3YPIA 3T4WA 3WLPA 1NELA 3DX5A 4PR4A 1T96A 5FL0A 1E9LA 1OFPA 2CWXA 3U2CA 3U9IA 1FWDC 1XD1A 2V3DA 2YB1A 5KZMA 2WNQA 4LNCA 1FDJA 3GVGA 4BEQA 1JPDX 3CV7A 3LCXA 5G2HA 2I9UA 3EEGA 4TIMA 3GG7A 3S6DA 3OTRA 4F0LA 3MUIA 3QM3A 1ISXA 5DANA 3CUGA 4ZB0A 2X2GA 3CUHA 3P82A 4B16A 3LBMA 4A22A 3QFEA 3KOZA 4FX6M 5C71A 3NQ6A 3VX0A 3ZIZA 1N7KA 4OBRA 1K1DA 1KGUA 2KZHA 2VQTA 3KP1A 4OVXA 2PDFA 3ORWA 1EPXA 3M0JA 4M19A 2B0MA 5CEWA 1VYSX 2DW6A 4OT7A 4E0CA 2LLEA 4P7NA 4L6OA 1TPB1 4Z0JA 1ZZMA 3UZWA 4NILA 1F4HA 2OZTA 1BXBA 3O9NA 4IFOA 3UP8A 2PU0A 2PE4A 3AWOA 4C6DA 4WJ8A 1JG9A 4E6MA 4HCHA 5M03A 1YXYA 4MUPA 3PBGA 3QC0A 4HA4A 1CNVA 1RXOB 2JGYA 2CPUA 3EMQA 2ZYFA 1C29A 1TVNA 4S3DA 5LNUA 3LI1A 4DAFA 4DJED 4P2VA 5DT7A 3W7GA 1YNPA 3CQKA 3W7MA 5F2MA 2ZTKA 1SW3A 3SUUA 2WM1A 3XIMA 1QI5A 1BRLA 4LF2A 4EACA 3U8GA 4R53A 4W4QA 4GQBA 4E38A 4FOJA 4NAFA 1K70A 3B0YA 3OHMB 2V5BA 5ABEA 3RAOA 3UG4A 3USBA 3WG6A 2QJNA 3SGZA 3C6CA 5LNRA 3BQ5A 1Z44A 1DIDA 5CPNA 4N7QA 3G5EA 3UA4A 3P5ZA 2FZMA 3NQBA 5BXPA 2GWGA 4H6KA 3KRSA 2DZTA 1V0MA 4V1XA 2DSVA 3TYCA 1W9UA 1PX4A 5LIWX 2UY5A 3UZZA 5G4HC 3PJWA 2VDGA 4UFJA 3AMGA 1RPKA 4US5A 1C93A 3W85A 3C0LA 4J9JA 4DI9A 2PURA 2V6AA 1GOXA 1TX2A 1ISVA 5G1MA 3RO8A 3ALFA 3W2LA 2IW0A 3NZ1A 8RUCA 4DJDC 1H0IA 3LRLA 3UXAA 3E02A 2ZZ6A 3MDWA 4JD4A 4AIOA 1E6NA 4MGGA 3RM8A 1AQHA 4LC6A 4XZIA 1I0DA 5C5YA 2WZHA 1IGSA 1TE1A 4QSFA 5I23A 1W1IE 1NOWA 1S39A 4GY1A 3S5SA 3I3EA 2ZC1A 3S2JA 1V77A 4RE4A 1W5MA 3DHFA 4PC8A 1XDJA 4N6EA 3IIOA 3ARQA 3L0NA 3LERA 4ZO9A 3QKEA 4QJ5B 2WPGA 1TWDA 2PPGA 1XQLA 5A6AA 4XK2A 3WLJA 1Q5MA 1XICA 3CASA 1DTNA 1D3HA 4HNVA 2HPIA 1VYRA 5A6JA 4MHBA 4WR3A 4WUIA 4M5PA 3VUSA 3B05A 5FSDC 2DPEA 4K7YA 2OGYA 2HXUA 2C15A 3HPZA 3GVRA 1NAL1 1UMYA 2OOFA 5L6UA 1ECEA 2VRJA 2WKGA 1W9VA 4IP5A 4UTJA 4FNSA 2DORA 5HANA 4GHRA 3V0TA 3DUGA 1Z8AA 3EX3A 2A0NA 5A2CA 2VCAA 5AHNA 1MNSA 4DJDA 1C8VA 1RCOB 3R1ZA 3E0WA 3ZT6A 3BG3A 3A3HA 3EPMA 3WLIA 1UD5A 1CEOA 2J7EA 1XM3A 3L0GA 4JTUA 4YVPA 3KCOA 3IJ6A 4GGBA 2F6XA 3O16A 1WZAA 4CN6A 1WBHA 3N4FA 1E56A 1R9ZA 2RKXA 2NVDA 1TJRA 1XYMA 1JCJA 5BXRA 4C90A 2G50A 2PDLA 2XPKA 1F76A 1OF8A 2YXXA 3L7RA 2E8ZA 2WSPA 1W1TA 4ZOBA 1CI1A 2EPHA 4PUMA 4JL1A 3VM7A 3GKAA 1QI0A 2O92A 1QAPA 3PUDA 4KEUA 3R58A 3TQVA 2E6AA 4AU0A 2VQUA 3TLLA 2F38A 3WQGA 2CETA 4AEOA 2CBIA 3MANA 1EF2A 1KFBA 3P8JA 5C6MA 4WGHA 2YLAA 4PCTA 3FA3A 2DH2A 1RK5A 2HNHA 1H1YA 5D04C 2X09A 2E6DA 3POCA 6A3HA 5ENLA 3UGVA 2X7VA 3BAYA 1BD0A 2DQXA 1XCXA 3HQNA 4S3JA 2FHBA 3QOKA 2E68A 5C0QA 1DE6A 4KMQA 2X41A 3WY1A 2FPVA 4O11A 3QZ6A 1AD1A 3QW3A 4F79A 2G0WA 3AS0A 3WNLA 3PHAA 1JDDA 1HKJA 1OD8A 4A8RA 1TKKA 3W2UA 1DIEA 4QX4A 2A21A 3R5EA 2IPFA 3WBXA 3JVAA 1JEZA 3M0LA 2A1YA 4JX6A 3PNZA 5MHBA 4XAYA 2PMQA 1VFOA 2Q3OA 1ZBCA 4MWAD 1O5KA 5HMDA 1BEUA 4XKYB 1H7WA 4AXKA 3R89A 3PG9A 4H8VA 2HK0A 4O0ZA 2QDHA 1B3ZA 4O57A 2V82A 1MXDA 3GDBA 4U3CA 3SSZA 3B0PA 4L9YA 1TCDA 1ZY9A 2AAMA 3IANA 2OEKA 2CLHA 3DC0A 2PZNA 2D0HA 1W3TA 3I7RA 4ML4A 3BVJA 1QW9A 4GVGA 4RL3A 4IPJA 3ZVHB 5A6KA 4Q4OA 2CBVA 4HHPA 4TXEA 3LU2A 3S2LA 3T0AA 4L4OA 1J5TA 1T7LA 4I9TA 3P6LA 3VKJA 4PE8A 1KV5A 1WXJA 5LGZA 3MS8A 5KTLA 1LRNA 1KA9F 2FMNA 1UHVA 3T2OA 1D7KA 2X16A 1B3VA 4GH1A 3PG8A 5CAKA 1FVPA 4ICCX 2GSJA 1ONEA 3OBKA 5LGXA 2PTDA 4PBGA 4HK6A 1PTDA 3WD3A 4UQAA 4LYQA 5KEZA 1UB3A 4EIVA 4DX3A 5HNRA 2V3FA 3SEPA 1QW8A 5EA9A 3BDKA 2D0FA 4RX0A 5ABGA 3FJ6A 4A3HA 1FDZA 5K9CA 4RKAA 4OFCA 5GPRA 5EMUA 3P0XA 5DCEA 3WEMA 2QJJA 5HOSA 4HHMA 4ZO7A 3VNKA 3AOFA 4LB3A 2TYSA 4K68A 5K4ZA 3W29A 3SRHA 2VVNA 1LP6A 2Z26A 3IK4A 1DIKA 4WVXA 3BMXA 3WMLA 4G7EB 4F0KA 4DJFA 1Z32X 4ZQOA 2R1NA 4IPNB 1DVJA 1EP1A 3T4CA 2Z4GA 4QE4A 1HN1A 4AWEA 4HNCA 2TRSA 1IZCA 1O95A 4AX7A 1B0IA 2ZX9A 3MW7A 2WNNA 1A5OC 1XPGA 3FHAA 3LD5A 1E15A 1P0KA 1BVZA 2I5GA 2QJHA 3LCWA 1KW1A 3NPVA 2CU0A 5BW6A 1ZRQA 1Q6DA 1OCNA 3SCTA 1R85A 3PZ9A 1HTIA 1ZU8A 5BWAA 4GY0A 3CQ0A 2GOKA 4MPQA 3G1RA 3BL3A 2WQPA 2V67A 5AYZA 1GG1A 4ONVA 5A8MA 3CWNA 1MEHA 1C7TA 2GLKA 1QPOA 3IGSA 3TQPA 3VMNA 1SR9A 3CZ8A 1ZSXA 3FJNA 5TD4A 1EC7A 4W5UA 1PYFA 4EXQA 2WK2A 4H3DA 1C7SA 4XX6A 4YNGA 4MLJA 2Z25A 4J1OA 2Z7KA 3WQWA 3B4UA 4D72A 4GVHA 3A9BA 3FEQA 4X9YA 3KBJA 3W7CA 1R2TA 4JFUA 3M46A 3A13A 1GK8A 4GC3A 4D6IA 3V3WA 1UD8A 4CNUA 2BOEX 3OA5A 1DJGA 2GL5A 2EHHA 1BF2A 2Z1BA 3VI2A 2VC9A 4LVBA 2BX7A 4NASA 4GMEA 1GOKA 4WDWA 5D03A 3MA8A 4IFKA 3DOPA 1J0HA 1U5VA 5HWJA 1CWYA 5D05A 3LYEA 2X42A 5HNNA 4HK7A 1W3KA 5IDIA 3TXZA 2VUYA 4I90A 1QOPA 2VO5A 4PSRA 1P48A 2QGYA 4CUCA 2RAGA 3NQAA 1F5ZA 2GK1A 4EPBC 4UMCA 1PIGA 2HBVA 2E7FA 4Q8PA 1FUYA 4AH7A 2NX1A 3N1AA 1SJCA 5LKYA 1Y8BA 5A8NA 3B3DA 2H6RA 2HZGA 4A3QA 4KEVA 5FEWA 2OO0A 4DJFC 3FEMA 3LPFA 3F2DA 2NW0A 3KS6A 3NQCA 4HZ7A 4JTTA 3QSTA 3ZT7A 1YMYA 2FZBA 1MVYA 3LSBA 3M0KA 2Z7GA 1AZ1A 4CEXC 2TSYA 1FH7A 3KX6A 1HGWA 2IS7A 1TELA 3T2PA 4GI8A 3M0HA 3MV01 1K7FA 4QCEA 1Q65A 3PVFA 1JFXA 3RK8A 5TF0A 3TTEA 5T9CE 2NV1A 3M0IA 5AN7A 4ACZA 3WMSA 5HA7A 3A21A 1HL9A 2CNCA 4XD6A 4HPHA 3SQSA 4YTSA 4JTQA 5BOEA 1JZ7A 4A6GA 2BY2A 3QV7A 4LYPA 3PPHA 5FJUA 3KXQA 1ZQ5A 4HMCA 1XYBA 3RCMA 2BHUA 3VABA 3OLDA 3WLQA 1A0CA 1JYXA 4YPJA 1Y0EA 1QO2A 3TQ0A 3NL2A 3IIVA 3VGFA 3OYXA 3W53A 4KH2A 1JJKA 2QDGA 4EXAA 4LEFA 3W70A 5A3HA 5HBFA 4OBTA 5EMLA 3PB0A 1B4KA 1KXVA 5EU9A 5G4WA 4MZ8A 3U6WA 1AL8A 1DWIM 1V3HA 4J28A 2YFOA 3S5ZA 3R10A 1EHAA 3P81A 2JF6A 3S5YA 2P0IA 3GZ3A 4YHGA 2P8CA 2QEZA 3AIVA 4F8XA 1G4EA 3ABXA 3WQFA 1UIOA 5JBDA 2Z1XA 3NFUA 3ZJ7A 1AFSA 2VGIA 4AZBA 2VOMA 4L4LA 3A3WA 4GIAA 1PTAA 3UNDA 4YWSA 3QBUA 1JDAA 3VNYA 1QHPA 1TPH1 1TE6A 3VIIA 2OMAA 2OSWA 3WQVA 3N6QA 2C18A 3N73A 3WDRA 2CBJA 1EIBA 4UQEA 4OHQA 1J0KA 2WYSA 1NY1A 4CEUC 4POCA 3UPMA 4PMJA 3AHVA 3GXMA 2NVAA 4HNTA 1SJAA 1ZFJA 5C54A 4YN5A 1RBAA 1BAGA 3BLIA 1MW0A 1EJXC 3GBDA 2V68A 3QSRA 3W1LA 3WQEA 4HSHA 4L4MA 3H23A 4OGZA 5DXYA 4UFKA 1TV5A 1SZRA 2GQ9A 5FESA 2AGKA 3WJSA 4IQJA 3R8GA 5GVJA 1V3IA 3NURA 1YBQA 2CLFA 3T07A 2OEJA 3LGDA 2IXUA 1J0IA 1O5QA 2JK2A 5JBEA 2GDVA 5FF3A 2RDUA 4AMAA 3CAWA 3FYYA 2W9MA 1FWIC 3KM8A 4HJWA 3RIKA 3SIZA 4UR9A 4IG2B 5ABFB 1A4MA 1I1WA 2VC5A 1WUFA 1WXYA 2R1PA 1GVFA 1ZUAX 5HAOA 3HV8A 4ZE5A 5I77A 4H04A 3GAKA 3ITXA 1PIFA 1A5NC 1XIBA 3SY1A 1XLDA 2J24A 4F48A 4LS2A 4I9MA 4D6GA 3U5UA 3DBNA 6REQA 1N55A 2UZ9A 1CTNA 1I2QA 4WIWA 1W2VA 2W91A 3DDMA 3L12A 4U10A 2BOGX 5T8GA 3CEUA 2NT0A 4QISA 4Q8NA 2PC4A 2ZZ7A 4XBKA 4EOUA 3UQNA 3TP4A 2QZRA 1TRDA 3TX9A 1KKRA 3QQ0A 5HJYA 1ITXA 1ODZA 2PLKA 3B9NA 3KDOA 1KV8A 4MIMA 2Q09A 3G1YA 2OQLA 2BFGA 3R7MA 4DRSA 1XIIA 3DKJA 3H54A 3AS2A 3KBMA 4DY1A 1E0WA 4GFSA 1JF5A 2VYOA 1E6SM 1KM1A 5LHFA 3T81A 3N9KA 2VX4A 1WKEA 3CYJA 3TC7A 3VPLA 2ABBA 1PL9A 1SW7A 3AO0A 2VCBA 1KBLA 3QQ1A 2NUWA 1E3XA 4HPJA 2E9BA 2FJUB 4IIEA 4S3AA 3WFAA 3SFKA 4J3VA 3SJNA 3LRKA 4M56A 2E4TA 3B8VA 1AL7A 1GVEA 1IIGA 3C61A 5JH2A 1RAKA 3HURA 3DFQA 1JD9A 1V02E 1RALA 3WF4A 1CLKA 3WMCA 2Y7GA 2X0HA 3SN4A 3ABSA 3OZPA 4YCPA 1OX4A 3HG3A 4NAEA 1GKQA 2PODA 4LV4A 4QCFA 3NM1A 2CITA 2PWHA 1VPQA 4LBRA 3LRMA 3U5YA 3LZ5A 3VOGA 2ISFA 1RHCA 4B5SA 3H12A 1MW3A 1XBZA 1XYFA 3OGVA 4JX5A 3N2MA 4AZHA 3UG8A 4JIQA 4BCEA 3F4DA 2DJLA 2F6UA 4XD3A 2OEMA 4O8AA 4LTSA 1W8GA 2WMGA 3DHPA 4JTDA 5E9AA 3C8FA 4J4KA 3OLIA 4B2DD 3G2GA 5AC7A 1KBJA 2VEIA 4RXFA 4PCFA 1TV3A 4Q7NA 3S1GA 2BG5A 4BQ3A 1C8QA 2VEGA 3R2GA 1D7FA 4UTTC 2X1UA 1K3UA 2HE8A 3WNNA 3LHWA 1PKMA 1FWFC 1W6TA 1V6UA 1OJXA 4QQUA 1HJWA 3EKLA 1REQA 4YLWA 4UNLA 5CJ5A 3WLKX 2WAGA 3GW0A 5I3HA 2EF9A 3GNDA 4AC7C 3NL3A 1BGAA 3ARYA 3IWPA 6XIAA 2ZWYA 1FWTA 2VMFA 1RQHA 1A3XA 2ZOXA 4I7WA 3W71A 2OLSA 3PZVA 3W76A 4W5ZA 2D2JA 5I0DA 2QVHA 2GUBA 1L6FA 1FHDA 2CWNA 4Q8MA 1TPUA 3TTQA 5KETA 3O7UA 2OSXA 3M07A 1E9IA 1LRTA 4HMNA 4HGXA 4R33A 1YNQA 4DJDD 3NVDA 4CKQA 2PWDA 3BOXA 1H5YA 3QKZA 4QE5A 1K9TA 2QS8A 4XAZA 4FF7A 2PF8A 2W92A 3E38A 3G1DA 5EPDA 3TFXA 4ALDA 4AZ5A 3TONA 3C3UA 3GG8A 1X39A 1V6VA 1AQFA 4YS1A 2EO7A 2POZA 4ECLA 2OWWA 5EMYA 4LRTA 1B9ZA 2Z2AA 3RM4A 1Y5XA 4GKTA 3PANA 1ITQA 4B2DA 1KBIA 2PWVA 1XBYA 2BP1A 2VURA 1MQRA 3IUDA 2YL8A 3S42A 3NG3A 3ARXA 1BSIA 5AKQA 4E3TA 1JCNA 5G2IA 5C9WA 4RE3A 1GVIA 2ZVIA 4PCPA 2ATSA 5IFTA 4QQ3A 3MSGA 2QJMA 3N4EA 5CC6A 1BWKA 2FTYA 3BC9A 4HU3A 4O1BA 3PWAA 1XLHA 1OFOA 4ZSUA 3WL0A 4NIRA 1XLBA 4FIQA 4IJBA 4GIEA 4HPGA 3DGRA 4JBRA 1ALDA 2VJXA 1CXLA 4DJEC 1UR0A 3ES7A 3SCPA 1XPYA 5JMUA 2FB3A 1EPVA 3UY7A 1G5AA 4U33A 2XFFA 5HJLA 5KZDA 5CC3A 4JYEA 2G3FA 3NL5A 4D6HA 5AVHA 2G4JA 4IIBA 4NUWA 1GOWA 1POJA 3SCQA 3VGHA 1I0BA 5LIUX 1GZJA 3SN0A 1B3OA 5AC4A 2CZVA 1ZBKA 1O1HA 3H7RA 4PMUA 4M51A 2CYGA 4ZQRA 2DUXA 2XH4A 1EKOA 4JFVA 4GRSA 4CD4A 2VP8A 2FZNA 2JALA 1BFNA 1B2YA 1VR6A 1H7XA 3A6OA 1TB3A 4E4PA 1BTCA 3SCNA 3FSUA 1UUMA 7CGTA 4N4QA 1ADDA 4O18A 2HCVA 1XIEA 1B9BA 1H09A 2BOFX 1KCZA 3L4WA 1IEXA 2REQB 2AOSA 3GG1A 3WK0A 3L2LA 2ZTJA 3C52A 1IWBA 1AJZA 4JTIA 2IUZA 4XIMA 3U7BA 1B54A 4WHBA 1K4GA 1M03A 3AYRA 2C3ZA 4C1NB 5A1AA 1AA1B 5D37A 1YTDA 2BVDA 1FRBA 3PUOA 5AB3A 3B4YA 4OZOA 3SFWA 2ZICA 4PL1A 5MKGB 3WLLA 3V7PA 3W1MA 2PRLA 3GH5A 1GVQA 4C6EA 1AJ0A 1HO4A 2VZTA 3GKFA 4GYFA 5I2UA 1C90A 4YMZA 2KAUC 3WX7A 3CIXA 1UKQA 3E5PA 1R5YA 4N02A 4QM1A 3S1WA 2HNEA 3BO9A 5JBFA 3UBPC 1MDRA 1ISZA 2OG9A 3SBFA 3ME3A 3W28A 1JCXA 1OG0A 1RP8A 3GVVA 2PZ0A 1C91A 3BGJA 1S5WA 4AAJA 2WMIB 4UXDA 3L67A 3WD1A 2I7GA 4CCZA 1CGWA 2VZUA 3WO8A 1A3HA 5C7HA 4G9PA 4H6EA 3O0KA 3UWUA 4Q7IA 1TTPA 3LLFA 3C2YA 2YW3A 1GQLA 2ZX6A 3ATZA 3PBMA 4LVFA 5I3IA 1CW2A 3UVIA 4A3UA 4R7WA 2B7PA 3M6DA 1QI3A 1WX0A 3AROA 2QCEA 4XSLA 3SM0A 4MJ4A 2CHOA 3NCOA 6TIMA 3TNBA 4W8AA 3N04A 2UY4A 3SURA 1NFBA 2ZUNA 1XKJA 2D23A 3DG3A 5ABHA 4LUTA 1Q4NX 3BW4A 1OYCA 2Y8KA 5XIMA 7REQA 4KESA 5AYXA 2DUAA 3EA2A 3GFYA 4Z2GA 3N6HA 1SMAA 3POHA 1UC5A 4HN8A 1C8YA 3TTOA 3DYOA 3Q58A 1XGDA 3MKVA 1JZ5A 1E9ZB 2VFDA 2E6YA 1J10A 3DKLA 4QLKA 3DFNA 3CIWA 4XAGA 2Y6ZA 1JAEA 3KP0A 1W1ZA 4K7VA 3WLNA 1DJQA 1M7XA 3HPXA 1Q7QA 3GH4A 3MUAA 4O1CA 4W93A 2IKHA 1W2PA 3UXLA 4HZ8A 2X0YA 3SCVA 3T44A 3KZPA 2ZUTA 1TPWA 2HS6A 3GU1A 4MPKA 2XN1A 4FK9A 1US3A 3CLWA 4BFAA 1VZWA 4A3RA 6TAAA 3SADA 1OABA 2QF7A 3ZT5A 4WSHA 3W2NA 3FGCA 4WXYA 1GTHA 2CHNA 2Q6ZA 5AVNA 1Z7AA 3OODA 5E5CA 1Z3NA 1JNDA 2RH9A 3A4AA 1TSIA 4IMEA 4F4RA 4W8BA 3LGGA 1T0OA 1XQKA 2OKOA 5CLWA 1MEIA 3MKCA 4JS3A 1DJIA 3OO2A 2E1DA 1K4HA 4HU8A 4KRUA 3MMDA 5AECA 4WJXA 1DL3A 3K46A 3CAKA 4FLQA 5B7ZA 2GJLA 1I2OA 2OX1A 5F4WA 1XLMA 1TYGA 4ZQMA 1SZEA 3UZJA 4MDOA 2PU1A 1P5BA 2ZDRA 2H9AA 3CT7A 4OECA 3W37A 3H2FA 1GJUA 2RJHA 3LTSA 1W3LA 4UZSA 1OZQA 2A6LA 3OG2A 3G24A 4KRZA 4CVWA 1DJYA 3ZR5A 3VUPA 1BQGA 1BWLA 4FLRA 1H51A 4UIOA 4E8GA 1K02A 1Q85A 3U48A 3IUIA 4RR4A 4GD0A 3V35A 1GQIA 1UR3M 2J7GA 3QPEA 3G3MA 1L6WA 3LUTA 3QPYA 1LORA 4GKLA 5DO8A 1P4CA 1KM6A 3MV11 4XTDA 1FKXA 1Q6FA 3PUEA 3LA4A 5ABTA 1FOBA 4EK7A 3A9IA 3T0BA 2I57A 4R3UA 3V5FA 4X0NA 4GGHA 3DN5A 1VFMA 3N4AA 4ASTA 4LAMA 4P8XA 3UR5A 5ECVA 3NPXA 4M0XA 1UWTA 3FS2A 1UG6A 1UP3A 2Q8LA 4HYRA 3W7RA 2YJQA 1E6RA 4B90A 2W0UA 5DF0A 1PVNA 4JL2A 5JU6A 1J93A 1LL7A 3PNUA 4S3BA 2PSNA 3N15A 1ISWA 3MUXA 3VA8A 2YYTA 1HW6A 3RX2A 3KRZA 2PDXA 3O15A 1GZGA 2BXZA 3BZGA 3VGBA 4AY8A 1R3SA 1SZNA 1VFFA 4DEFA 4CCDA 1R9XA 4HN4A 2OT1A 5JXQA 3B0VC 2OYMA 4ZO8A 3PTQA 1PSCA 1JDEA 3DI1A 4Q33A 1S2WA 2NQHA 4C7FA 1ONWA 3UR8A 3U57A 1SU5A 5CC7A 3A47A 3HV9A 4DB7A 3RG6A 4EE9A 3TN6A 3AHYA 5EBAA 2QULA 3I6RA 2Q02A 1JUKA 1OIMA 4QJ3B 5AHMA 3UU0A 4GXMA 4UCGA 3C5QA 3QTGA 3WDJA 2A3CA 1PDYA 2YA0A 2GVYA 4W89A 1QNOA 1JPKA 4YTQA 1WOAA 4XZ9A 1UC4A 3W72A 1JXKA 3G3DA 1DWFM 3RLVA 3VINA 4AY7A 3BMWA 4JFWA 3O1NA 1GQKA 2GJXA 5LYRA 1B4EA 3HBLA 1SGJA 5A8GA 4GYPA 3NDZA 1W9DM 3C2EA 4DPQA 2QPXA 3H21A 2ON3A 4AVFA 3ONBA 3T7VA 4FNRA 4ROQA 5ECUA 3ANVA 5A8QA 4M24A 3L2IA 3GWQA 1GPFA 2A79A 5EB8A 3WK2A 4IPIA 1DEDA 3PB2A 4RZ4A 3QMSA 1LZOA 3CHFA 3KWXA 1E4LA 3K1GA 2P3EA 2R6OA 3B06A 1XLFA 1VBGA 2WOQA 3FYPA 1AK5A 1ESWA 3EBVA 3G6LA 4YVXA 4BF5A 1EXPA 1FWRA 1TWSA 1R3WA 2J8GA 3F4VA 4NF7A 4ZMGA 2PDUA 1WDWA 4L7ZA 1L2UA 3ES8A 2ZE3A 4JN7A 1YNYA 1H1NA 1E5JA 1WYIA 4ORIA 1NM9A 2PBOA 2PA6A 3GB6A 3VDAA 3W23A 4C5ZA 1EA0A 5A2BA 2GZXA 4YVVA 3MI6A 3VKBA 4DUVA 1QNPA 1G9HA 4ENLA 3PZMA 3R6IA 1RZMA 1TMLA 4NNBA 5CPSA 3G6MA 1E1CA 3PZQA 4LUYA 2FJKA 5IFPA 1OYAA 4DWSD 4NX5A 2VFIA 1YDNA 1XLCA 3IIZA 3Q4DA 5DX7A 1NOFA 4JR5A 2BWGA 1IQ8A 4YCOA 1X98A 3RPMA 2J9XA 2V2DA 2XYLA 2F9RA 3WLMA 3GAYA 3WBWA 2XINA 4JQ2A 3EA1A 2WZEA 2X1IA 3BLPX 1SJDA 4QEHA 3MPGA 2YA2A 4JZ5A 4AF0B 1EZ2A 3BG9A 3WQDA 1F3WA 3VTRA 1GOMA 1RK6A 3ARUA 1XXXA 4UWMA 1FWAC 2DVUA 3INPA 2Z28A 1F3EA 1I45A 3EX6A 3C2RA 3DC8A 3Q37A 2HXTA 1TPEA 1IT7A 4ADSA 2XVNA 2J9ZA 3AMDA 2HQAA 1E1FA 1X6UA 4YIWA 4GUIA 3OB8A 2QUVA 3ABZA 3DERA 1YE4A 2YSWA 3OEXA 1H50A 3VILA 3UF9A 1LQAA 2ZXBA 1EJUC 4KCTA 4CQBA 1UWQA 2FDMA 2HPMA 4UB9A 3ZM8A 4JICA 4O16A 1EH9A 4FR1A 3EMZA 3I7SA 4BKNA 1E70M 1ECQA 3SCUA 5IBXC 1R0MA 4WZHA 1NOUA 3KE0A 5D2TA 4I5XA 4H9UA 3W4RA 4JTFA 3A12A 4F2BA 1JDCA 2ICSA 1LDCA 3CUZA 1GQJA 5G1TA 1B30A 4HK5A 3DXIA 3RJXA 2YL6A 4CU7A 1CX9A 1XCFA 1PWMA 4QS5A 1JULA 1R2SA 1E6QM 4MMWA 1HIZA 1TFVA 5HMSA 1XHGA 1JZ8A 2NUXA 4MNMA 1F3XA 1X6NA 5AHIA 4QITA 3NQ2A 1OYBA 2WZIA 4AZGA 4IZGA 1W5NA 5MF5A 1XSKA 4NAFB 1AMYA 4QFUA 4DF2A 3W7DA 1I4NA 3UJEA 3ZR6A 2P53A 4PB3A 1PKLA 2D73A 4QG6A 2ZX7A 1QOXA 2NVCA 1PB0A 2QCDB 1F8IA 1UR9A 5BU6A 1SFTA 2J75A 4UTUA 2SFPA 3TA6A 2PDYA 4AVNA 1NWTA 3A3XA 5BRPA 2PDKA 5DN1A 2XN2A 1KLZA 3CYVA 2GYIA 2G41A 3AXIA 3FK4A 3S5NA 4QRNA 5CQ1A 1OY0A 2OFJA 3W86A 3LHVA 2OCZA 4RW3A 3W1QA 4S1FA 4C6PA 3W1RA 3AMCA 4W9TA 1SFSA 4G1NA 7TAAA 4LF1A 1J18A 3E0LA 1PDZA 3BTNA 3XINA 5A8PA 4PBEA 1E9YB 1DWAM 2Y7FA 1D8WA 1CYGA 1F74A 5CZTA 1EJRC 3K2GA 1J0YA 2C7FA 1A5AA 3W7KA 4GO8A 3HG2A 2FQIA 3MCOA 2PP1A 4H19A 2E0PA 2XFWA 3E74A 1F05A 3VU2A 1JZ2A 4ZOAA 3RX3A 3NL6A 3K8KA 4F3HA 1Q6CA 3W74A 1C92A 4L65A 5EBUA 5B80A 2QAPA 1DQUA 1WAWA 3O2LA 5IXEA 1DHPA 1FWWA 4J7RA 2INFA 1EFZA 2Q8XA 5E9XA 1B3XA 2AKZA 3AYTA 1KM4A 4WY0A 2QUTA 1KCXA 3I4EA 3RO6A 3CEPA 3A22A 1QK2A 4WJEA 4A05A 2BXVA 3BV4A 1IEWA 2ZRVA 3RLHA 3KOWA 1FCQA 2QKFA 3L5LA 3LNMA 1U1UA 4AYSA 4PUUA 4DBDA 2VTFA 4AZCA 3M5ZA 1I60A 1WNOA 3DZ1A 1V3LA 1W9XA 2XFYA 3O07A 2VD9A 3SCRA 1HX0A 3RR1A 1XI3A 1JL8A 5D9MA 1IZJA 2VDIA 1PS9A 4XZLX 4HIBA 4D6DA 3WUEA 3LEPA 1MRQA 3LXCA 4HTYA 4JTHA 1JRCA 7TIMA 2D20A 3CHVA 3MHFA 4FOUA 5FKYA 3IGHX 3P5YA 2XN0A 1W1YA 3I65A 1Q13A 5D8ZA 1AD4A 3F4CA 2AQVA 4JQAA 3MC5A 1YKWA 1XRSA 3TW6A 3GC4A 4I5RA 3B9EA 1WA3A 4PFHA 1OX6A 2XSAA 1Q45A 5AOUA 2G8ZA 2PRMA 2J88A 1IXQA 4HTBA 4PMYA 4YYFA 1XC6A 3H4WA 5D2YA 2RDWA 2EXOA 1EGMA 3W87A 1YEYA 1FH8A 4MYAA 3WJYA 1JGIA 3AISA 3RMEA 4J35A 1IF2A 1PZ0A 2PWGA 5DMNA 3O06A 3H2NA 3RJYA 1XYCA 4PMXA 2OPJA 4KBXA 2YXOA 1CGYA 3TDFA 3BOFA 2QIWA 1J6OA 3BLOA 5LA2A 4DXVA 1OC6A 4KCVA 3W07A 4A4AA 4GZEA 3NAVA 4FLOA 4M7SA 3VIHA 1KXTA 3GY1A 4IQDA 3B8TA 2Y5SA 4CCEA 1TPFA 2WKLA 4I8DA 1V8EA 4DO7A 1TJPA 2VGBA 3BV7A 3ZS4A 5LNSA 1BKHA 4KKXA 3NZRA 1KRAC 2J7DA 1DPMA 3NEVA 2JKPA 3DFPA 4L9XA 5FF7A 3IJ9A 1TV2A 3LOTA 4XVEA 2VEPA 1IV8A 3MP4A 3VZYA 5HWMA 2OYLA 1A47A 1YE6A 4JIIX 1K7XA 2GGHA 3LM7A 3VMPA 3WNMA 3RLUA 4GCXA 3H6OA 3ZXWA 1KRCC 2GQ8A 3KBWA 3OW1A 1IT0A 3DHDA 3HFYA 3MDUA 4RNJA 3TJLA 2FDSA 1QNQA 2WHLA 1IE7C 5FIPA 5EMJA 4S2BA 3LN3A 4YU1A 4ICNA 2VNCA 1WKDA 1DXFA 3ITVA 2DZXA 3VNZA 1XIHA 1DJHA 4O28A 1H41A 1W9BM 1S2AA 1P6WA 3WH5A 4LAUA 3G0SA 1HGYA 2FVMA 3F4WA 3UCCA 5CPLA 1UYQA 2VFFA 2VI0A 1GNXA 2YB4A 2I9EA 1E0XA 4CD7A 2DY3A 1DYSA 3IJIA 3GHSA 1EWEA 3NWRA 4QLLA 4MY1A 1QBAA 5KMYA 2QPSA 5FA5A 1GCYA 3HM7A 4R9XA 3W7PA 4K1GA 1X96A 3H24A 4W88A 4H7CA 2C19A 4QNWA 4GZ7A 2G96A 2X0SA 2VR4A 4ZXOA 1GTEA 3W7QA 1KBBA 2J8TA 5J5RA 1ZAJA 5IHSA 2E67A 4IH3A 1H62A 4ZB5A 1SO4A 1UASA 1DJZA 4ES4A 2AQWA 4MZ1A 4G7EA 1BYCA 1AW2A 2BY3A 1EX5A 5D02A 1J2BA 3I4KA 2BHYA 1R6WA 1YLVA 4PUEA 2FGZA 3C4UA 2GJNA 3N18A 4AD0A 3BAXA 2EPLX 3FXGA 3AQUA 1RBOB 3N2BA 4EXBA 1NWUA 4LSBA 2WHKA 5A6BA 4HBKA 2ZXDA 1TPDA 4CQ9A 4LPCA 3LHYA 3W84A 1NP0A 2PWEA 3FW6A 2Z27A 1BPLB 2NXGA 4X61A 3WD2A 3BAKA 1FCBA 3S3GA 5M5DA 3ZMRA 5CPOA 3CAQA 1SFJA 3ZR4A 4DBUA 3RU8X 2PDQA 3E2VA 4GISA 3TE9A 1HQTA 3WLSA 1S5MA 3WFZA 3AZTA 2JIEA 1IHIA 3VOHA 3PPGA 1BRLB 2R24A 3CT2A 3ENLA 3W1NA 2BASA 1HVXA 3CS2A 3W7OA 1Q6OA 4DIAA 3QMTA 3HJZA 5E0CA 4AB4A 1VFSA 1RVGA 4I3GA 1F6PA 4ZOEA 3PR2A 3AALA 1R3QA 4WDUA 3S1VA 2NLYA 4XISA 3FKKA 1LJYA 1TZZA 3W83A 3IV3A 1TG7A 3G22A 2I1OA 4IXXA 2I14A 3MMTA 3AHTA 2QV4A 5HNTA 4CCCA 1AJ2A 3MCMA 4JPGA 4CU6A 1CCWB 4REQB 3LLXA 3PK7A 4MADA 3WLOA 4MWAE 3NUKA 2Y63A 3U4FA 1G69A 1W3IA 1OD0A 1BG4A 3ECQA 4JDBA 5A95A 1A5UA 3HG4A 3I6TA 1VJIA