4ZENA

Structure of gan1d, a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
474
structure length
474
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 192
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zenA00
4JFSA 3AMLA 4LX4A 2HISA 4LGXA 4AZBA 1WO2A 1FP9A 1QI2A 1K6AA 1ZBKA 5D9NA 4PMRA 3PZTA 5HDRA 1MWOA 2WXDM 2J7GA 5ABGA 3K4DA 4L4PA 1ZS2A 4PEEA 2G8ZA 3VOCA 4OKDA 2ZX8A 3AIWA 3CUJA 4TVDA 4Z2JA 1B0IA 1TCMA 1OD0A 3AFBA 2ZICA 2YDQA 2Y8KA 3AHXA 3TTSA 1W3KA 1BYAA 2WWCA 5F7UA 2J7FA 4UQCA 2A3EA 3MSDA 5C71A 4PMXA 4LXFA 4W8LA 2WNWA 1B90A 5E6YA 1JXKA 3F4VA 1QHPA 2WKLA 5CJ5A 1ISXA 3SCVA 4ZENA 1HJSA 4H8UA 6A3HA 3SCSA 4JL1A 3MANA 4UFJA 1PJ9A 2IXUA 4HMCA 4JHOA 4MADA 4PMOA 3VMNA 1CGWA 3O6AA 3AICA 1NP0A 2O9TA 3RIKA 4HOXA 1L0PA 3ARZA 3CMJA 5C8BB 4P8VA 3AS1A 3IK2A 4DWSA 4JFVA 1W3JA 1PIFA 3W0KA 1UZ4A 4LYRA 1O6IA 3VD5A 2DT0A 1KXHA 4W7VA 5JBEA 3GM8A 3L2MA 1NOWA 1X6LA 3KL0A 4URIA 4JKKA 1H3GA 3VIGA 2WMGA 3I3DA 2OWWA 4AEEA 4B9ZA 1VB9A 1HXJA 2EXOA 1KXVA 2EPOA 2ZOXA 4OUEA 2WLZA 2DDXA 2NSXA 2ZXAA 5AYIA 4U31A 3U5UA 3W53A 3VDCA 1CWYA 4P8WA 2EO7A 2EPMX 3OA5A 3ARVA 1CXEA 4U2YA 2VX6A 4P7LA 3VM5A 1SFSA 3BXWA 5CG0A 4ACYA 1I1WA 3EMZA 5AY7A 2XM2A 3NYDA 2AAAA 3TP4A 1EA9C 1UWRA 3WMCA 2YBTA 5IDIA 3VPLA 4C7DA 2FGLA 2V3DA 1ZL1A 1C93A 2F8QA 1W9UA 2A3AA 2Z1KA 3CHFA 3THDA 1QVBA 2FDMA 3OZOA 1HKKA 1MXGA 2QLYA 2XIIA 2ZUTA 1MQRA 1E1FA 4U5KA 4E2OA 1XHGA 4PTWA 3WEMA 1V3KA 2BXYA 3ZQ9A 2GJXA 5I78A 1B31A 4AC1X 4PMQA 2PB1A 3KZSA 4M82A 2QV4A 3PTKA 1KGXA 2JF7A 2VZVA 3IJ7A 2VOTA 1W9XA 2BY2A 5CGTA 3VO0A 4EKJA 1VFFA 3CZEA 3WD1A 1GJUA 2J25A 1TFVA 4FLQA 1E70M 1H11A 1V0MA 3MSGA 1K9TA 4HU8A 3DC0A 4NRSA 3DYPA 4WK9A 3FAWA 3VIJA 3W27A 3CHEA 4IPNB 1UD5A 3WUGA 5ABHA 1JG9A 4XX6A 3BAIA 1V02A 3WEOA 4EANA 3SUVA 1OT2A 3OGRA 2CNCA 3WD0A 4M29A 5BXRA 1B3ZA 1CDGA 2WHMA 3N15A 3M46A 4CD8A 1UD6A 1XRVA 1UWIA 1PX3A 5DT5A 4X0VA 1Y7VA 4IUGA 3VIMA 1BYBA 4IISA 1VBRA 5FKYA 1E3XA 1BLIA 1KWKA 1WPCA 3BMVA 1GJWA 2X1IA 1RP9A 1EQCA 3WDRA 3D3AA 5A95A 3ZR6A 4E8DA 4ZE4A 1M03A 1JZ7A 1JF6A 2XM1A 2TAAA 3KL3A 1H4PA 3IAQA 1QNQA 1RD6A 3WKZA 3BMWA 4J3SA 3SIMA 1CENA 1CIUA 3UG5A 3VIOA 4GQRA 4CGTA 2D3LA 1GOOA 1HNYA 2GFTA 4ATWA 2XVNA 3VILA 1QBAA 2BY3A 1GNXA 3WF1A 2ESCA 3N12A 4PSRA 2DQXA 4Q7NA 1VJSA 5HOSA 1DWAM 1WZKA 4MAVA 1QI5A 2W63A 4DM2A 1XH0A 4J3VA 1ESWA 1HJXA 2W4XA 4JIEA 4F79A 5BXPA 1HVXA 4D6GA 4PRWA 1ISYA 3POCA 3A6OA 3AMKA 1C91A 1GOWA 3CHDA 5ABFA 2J77A 1VEOA 3VIPA 2G3IA 2CITA 1G94A 4D6IA 3WH8A 1MQQA 1C7SA 1ZU8A 2O9PA 2Y2WA 1VRXA 4E4PA 1SYTA 1VF8A 5DFAA 4U3AA 5A8QA 5A8OA 4AYSA 1GVYA 1VEPA 3OGVA 1SR0A 1KGUA 1UKOA 4PUEA 1UWSA 3AHVA 2UY3A 3GBDA 3K46A 1OIMA 1IT0A 1NOUA 1C3FA 3ZT7A 5A6BD 3ZT5A 2V3FA 2WCSA 2J75A 3WFZA 1NQ6A 1I1XA 2QMJA 5CPSA 5I6SA 2QHAA 3QHOA 4P7OA 3VD9A 1BG9A 1K9DA 1DP0A 1ITCA 1W3LA 1EDQA 4J3WA 1W9BM 4PCTA 1QI0A 3AS0A 1C92A 5CQ1A 4P7QA 4BS0A 2BVDA 2DGAA 4CU6A 4AIEA 4A3HA 1E72M 2XVGA 3SEPA 1MW1A 2GK1B 3GH4A 2VT0A 1UZ1A 3PTMA 2ZX6A 4MTVA 5EBAA 1Q6CA 3CMGA 2VZSA 3A4XA 3I3EA 1QW9A 3RJYA 1KXTA 2XSBA 2ZX9A 3W29A 1QI4A 1E6NA 1XSKA 1KQZA 1UUQA 4EK7A 4W5ZA 1GUVA 1J0KA 2VMFA 2NT0A 3IJ9A 3N04A 4AZ6A 2JEPA 1CGVA 2WSPA 5I79A 4AISA 3ARYA 4QLKA 1E1EA 4TXEA 3ARRA 3B9DA 1CXKA 2XGIA 4AD1A 4FK9A 5A8NA 2J8GA 5D8ZA 1E6XM 1Q6DA 1K9FA 3GDBA 2FH8A 3WQ4A 4H8HA 3VGEA 4GZJA 3VGGA 3K4AA 1KXQA 4AD5A 3KL5A 3VX1A 7CGTA 2VC9A 3WH6A 4LQ1A 1UWTA 3WDJA 2A3HA 1CEOA 1VEMA 1H1NA 4QP0A 1QBBA 3CUIA 2XFYA 4F9DA 4WKFA 3RMEA 3HN3A 2NW0A 4PMYA 3WUFA 1ITXA 3FN9A 1CXLA 5BCAA 2C7FA 5KZ6A 3VTRA 2XUCA 3D5HA 3RO8A 1JD9A 1H5VA 5GNZA 4NI3A 1G01A 5CSUA 3T09A 3AMCA 4K68A 4W88A 5CZKA 5BRPA 4HA1A 3L4VA 2WBGA 3EBVA 1JAEA 1E0VA 2X0HA 3KEHA 4UZSA 1M01A 3SUSA 1JZ6A 1TVNA 1E43A 4NRRA 1ECEA 2J7HA 1E6ZA 3DHPA 1HL9A 2VCCA 3AIRA 4HZ6A 2J47A 3WD3A 1MQPA 2WWDA 3APGA 1VBUA 3AIQA 1GVIA 3MMWA 3MUIA 4V28A 4UFHA 2FHBA 3OLIA 4BQ4A 5DEZA 1US2A 3VMPA 1XSJA 4W87A 1J11A 3WD4A 1KFWA 2WZHA 2QPSA 4DM1A 3MKKA 1JI1A 4MNLA 4PTXA 2XVPA 3ZJKA 4IPLA 2J7CA 3ZO9A 4P7RA 2DIEA 5LA0A 1JYXA 3PTQA 3HJEA 3ECQA 3VVGA 4DUWA 3AYSA 1UQZA 1UR8A 1V3HA 1XV8A 1V08A 3OLGA 2D1ZA 1W9DM 3CLWA 1BF2A 2EJ1A 1OWQA 1KBBA 3W81A 3G6MA 3BC9A 1EH9A 1A47A 3VD4A 1C7TA 3VDBA 3O2LA 3THCA 5FCZA 1TE1A 3L4XA 2EBNA 3HMCA 3N13A 2WMHA 4PN2A 1V6YA 3VGBA 4H04A 5JBDA 1WDQA 4UOQA 1JZ3A 1PZ2A 4CCEA 1OT1A 3BCDA 3KE0A 2WAGA 2VL4A 1FA2A 2CERA 1UWUA 5FL0A 2AOSA 1BG4A 3SCWA 5TD4A 4MB1A 1TUXA 1Q4NX 2YDSA 4QFUA 8A3HA 4GO9A 2XG9A 3DYMA 5D4YA 4DWSD 2VR4A 1UD8A 4A3YA 1V6WA 4HZ8A 1B3WA 2XPKA 4QDMA 3T0DA 1UD2A 1OGBA 4D6JA 4LYQA 5AYBA 4W86A 2VZUA 1B9ZA 3ARSA 2VQTA 1PPIA 1V03A 1V3JA 1Q6EA 1Z32X 2ZUMA 4UFKA 5D9MA 4Z2LA 4KWUA 2YIHA 1CPUA 4GI6A 1EDTA 2BHZA 3FY1A 4BQ2A 2XWEA 5I2UA 5A6LA 3N17A 3WDPP 2DEPA 1VENA 1S46A 3BAJA 3MMUA 3AIEA 4AZIA 3N1AA 1CGTA 1ZB5A 4NSBA 5FD0A 1GQJA 3AS2A 3FXYA 3O9NA 3ARPA 7A3HA 3QHNA 2JIWA 3GZAA 3VNZA 3WNKA 5HPCA 3AOFA 2IXVA 4R27A 4HTYA 4MPKA 3OGSA 1DWGM 1JD7A 2ZUUA 1J18A 1G0CA 3WEZA 1XGZA 3RJXA 2EQDA 3WN6A 2G41A 1C8QA 1V3IA 1JYNA 1WP6A 6CGTA 3CBWA 4HA3A 1JFHA 1EO7A 3WELA 1Q6GA 2VX7A 3ZT6A 1U2YA 1BVZA 1VFMA 2BXZA 5E70A 4CD5A 3GXMA 1QNRA 2DSZA 4OJYA 3ZMRA 5A6KA 1CYGA 4N42A 4EAMA 5DO8A 4JHZA 1W2VA 1V6XA 1V3LA 3WH7A 2PWGA 2VZTA 5D9OA 1E3ZA 3BAKA 1PX8A 1GPFA 1I75A 1CTNA 1DWJM 2BHUA 3L4UA 2OYMA 3OB8A 2J62A 3EDDA 4CUCA 2WVUA 4HA4A 1JXJA 1WDSA 1XD1A 3VD3A 2D24A 3AZTA 4CKQA 2WPGA 1BGAA 3OLDA 4CD4A 4AD0A 4W93A 3WD2A 1EHNA 3PZ9A 1C90A 3UG4A 4DWSB 3ZR5A 1R86A 3CGTA 2D0FA 3MV11 1E4IA 3WY1A 2OSWA 3PHAA 4UFLA 1QPKA 1TA3A 1R7AA 3FNDA 1HKIA 2Q8XA 2C0HA 2CBIA 4Z2KA 4CCDA 3KWXA 1E5JA 2BY0A 4CVUA 3RDKA 3VUPA 1B2YA 2XFRA 3WDIA 4MNJA 4XUYA 1E15A 2PBGA 2ZUNA 1OSEA 2HVMA 3FW6A 3SCUA 3WF2A 2QF8A 2IUZA 4BCEA 1JZ5A 3EDEA 1IZJA 4F66A 2WC3A 1EDGA 4TVUA 3U7BA 3M07A 4Z2GA 4D6CA 1HN1A 5KEZA 2XIBA 1JYWA 5EFFA 2CCRA 4D6DA 5CPTA 1W9PA 3ARXA 1JDAA 3BAYA 3PZMA 2J7BA 2V5DA 1MW3A 1OINA 3UR8A 3OLEA 1UA7A 2GUYA 2YL9A 3WBEA 3CO4A 3AMGA 3S6TA 1UD4A 3ZSTA 4CD7A 3GNOA 5CPQA 1B30A 1UKPA 3MUAA 3UEQA 3VIKA 3S2CA 3K8MA 2YKKA 4F9JA 4D1JA 1J12A 3NDYA 4GQQA 3IANA 9CGTA 3VGHA 5JUVA 3WNLA 4L4OA 3WFLA 5I0DA 1LL7A 2VTFA 3EDFA 2WLYA 3AROA 5CLWA 2OWCA 1OD8A 2JE8A 2D22A 2WZEA 4D6HA 4W7WA 4WF7A 4QLJA 5M03A 1JNDA 2FGZA 3OG2A 1CGUA 4Q22A 3WF3A 1TR1A 3RM9A 3AIBA 1W1PA 3DYOA 2BY1A 3BAXA 3EMQA 3MUY1 3ZSSA 2YLAA 2YJQA 1OIFA 1GHRA 2Y5EA 4BA0A 3PBGA 3AS3A 4D6FA 5HXMA 5A6BA 1UYQA 1ZBVA 1FP8A 1KR0A 4FF5A 2G3MA 2CEQA 1F4HA 1GORA 1CBGA 4D1IA 1BSIA 1WDRA 1QNSA 4V2XA 3NJ3A 1L8NA 1JZ4A 2WK2A 4W89A 4PYSA 1V0NA 3LPGA 1NWRA 3UETA 3GH5A 1VFUA 4ZE5A 1OM0A 2WVTA 1UH2A 4MNMA 2ZXDA 1HVQA 3RPMA 1MFVA 2F2HA 2YDRA 1C8YA 1J0HA 1GOMA 2G3NA 2J7EA 4JZ5A 3F5JA 1ODUA 1W91A 4W8BA 3RM8A 5BRQA 3BSGA 1K9EA 2XVLA 2YL5A 3MUZ1 2X2YA 2DH2A 2F61A 3ZM8A 1QOXA 4NZCA 5M17A 1ZBCA 2C8NA 1NH6A 5D8WA 1LF1A 2ZXQA 1E55A 1KBKA 3B9AA 2WHLA 1QNPA 1TVPA 3GXDA 4H2CA 4M8UA 1WKYA 5GQBA 1ISWA 1KQYA 1NOFA 1YQ2A 4JFTA 5A2CA 2XTKA 2CBJA 2Y4SA 2CPUA 3BLPX 2DSWA 4D71A 2BVYA 7TAAA 4WSKA 1PEZA 1B1YA 3WH9A 2WCGA 1LG1A 1CZ1A 4J7RA 2QPUA 3B9EA 3UG3A 1W1TA 1KR1A 5HBFA 4GXPA 5IXEA 2EPKX 4J3XA 4HOWA 1GQKA 5CGMA 2UWFA 4FLSA 1CGXA 3SCOA 3WNOA 1CECA 4LPCA 1C8XA 4OBSA 2W92A 1UD3A 2WVVB 2OSXA 2GJXB 4NF7A 3L2LA 4MJ2A 2E3ZA 1XSIA 2CXGA 1ZJBA 2YA1A 1MVYA 5A1AA 4AD2A 1SMAA 2WZIA 1HIZA 2WC7A 3JUGA 3AISA 4PMZA 1CLVA 2ZUWA 1AQ0A 4GZIA 1TG7A 2D20A 2E9BA 4KGLA 3AXHA 1RP8A 4PCSA 2GJRA 5D9PA 1UKTA 4IM4A 2WVSA 4EE9A 5EMYA 2VNCA 2FHCA 3W28A 4ZFMA 2WB5A 3ARTA 1R85A 3VINA 3AJ7A 1DWFM 2XJ7A 2V3EA 1BYCA 3NSMA 3WUBA 5I23A 3II1A 4JKLA 1CXFA 4BF7A 3MO4A 2A3CA 1AQHA 1E6RA 3SURA 3W6MA 3UCQA 1FHDA 5LA1A 2X09A 4KRTA 1DWIM 1D2KA 1LG2A 3GNPA 1W1YA 1XCXA 4N0RA 3DHUA 2VRKA 1R87A 4M56A 5A8PA 1QW8A 4XZBA 2WMJA 3CHCA 2W5FA 4XB3A 3SCTA 4AD4A 1TA3B 5A6AA 3WQ6A 5CLTA 2D23A 3OIHA 5E9AA 3K8KA 1HKMA 4MB5A 3VM7A 4UFMA 2WBKA 1M7XA 4C7GA 2EPLX 5M3WA 4TX8A 3SUWA 2GDUA 1XCWA 3K8LA 4UCFA 1M53A 4AW7A 4H7VA 1PIGA 3LPPA 4BQ3A 1D3CA 3N11A 1EIBA 3I3BA 3TTQA 5HNNA 4QAWA 3AMDA 4U2ZA 2MANA 1WCGA 3LPOA 3AYRA 1J9YA 1NWSA 3VGFA 3ALFA 4D72A 1B3VA 1E6PA 2PBOA 1AVAA 1J0YA 1H41A 1BTCA 1XD0A 2VZOA 1GQIA 3ALGA 3WF4A 5E09A 4B15A 4JCMA 3GYCA 3PZQA 4TVCA 4GIAA 2RGMA 5AC4A 3W38A 3M7SA 1A3HA 2J4GA 2B31A 4PMUA 2VCBA 1IV8A 2DPEA 4M80A 2CHNA 2E8ZA 4U3CA 1DWHM 2VQUA 2D3NA 4A4AA 5IFTA 1HJUA 4BQ5A 1EOKA 4FMVA 3U7VA 2OSYA 3AIVA 3OZPA 3M6DA 1XH2A 3AHYA 2YBUA 2DSKA 1X6NA 1HJVA 4MB4A 4J28A 2J7DA 2VVNA 2PF0A 1G9HA 3L4WA 5CXPA 2D0GA 2W67A 3N9KA 1GW1A 4RL3A 4UQ9A 1XYZA 1OB0A 1EQPA 4FLOA 2WMIB 4E8CA 4RE3A 3AXIA 3WIJA 3ZOAA 2ZWZA 3PZOA 1LL6A 1E4NA 4UFIA 4CVWA 5FL1A 2WVVA 1R8LA 2VR5A 1HKJA 2BVTA 3CUFA 4QCEA 1V0LA 3FAXA 3W6LA 3ZJ6A 1GOIA 4MDOA 4WKHA 4PTVA 4AXNA 3SCQA 5JBFA 1OBAA 1JZ8A 1VIWA 4FLRA 2OWXA 1GZJA 1HJWA 4DUVA 4PMDA 4ACZA 4JCLA 1E6QM 4HZ7A 1DEDA 4BZYA 1B3YA 4ML4A 4W5UA 4W7UA 3A47A 2YOCA 2DT2A 2PWDA 2WCAA 1LL4A 3VU2A 1BHGA 3F5LA 1JI2A 1E73M 1WB0A 1JAKA 3WBAA 2CHOA 1RH9A 1AQMA 3WMBA 3W37A 1UR9A 1HF6A 4PMNA 3L4ZA 5A2BA 2BNJA 4TX6A 1V3MA 4HOZA 1F4AA 1EOMA 4AZ7A 5A94A 2V3GA 3VDHA 3CIVA 5A6MA 1WAWA 4R5EA 1H09A 4HPHA 3CZLA 1CLXA 1BPLB 3TONA 4AZHA 5C70A 1VFOA 3BCFA 2XYLA 2ZWYA 3PN8A 4HU0A 3T0BA 3EYPA 5I5RA 2YLLA 3SUUA 1J0ZA 4B16A 1JDDA 1U33A 1ZJAA 3QHMA 3VNYA 2G4FA 3NCOA 3L4YA 3CZJA 5DT7A 2UY4A 1X1NA 4UQDA 1HJQA 4W85A 4UZUA 1MFUA 1QHOA 2VJXA 3WQ5A 1UH4A 1KGWA 2VVSA 3VX0A 5A6JA 5HPOA 3A4WA 2D2OA 2E40A 3B8SA 4GI8A 1R7OA 2CYGA 1QNOA 2VUYA 4B3LA 5I24A 3A4AA 2VI0A 3VD7A 4AZ5A 2YA2A 1FFRA 1UR1A 3VMOA 3BSHA 2GSJA 1PX4A 3GH7A 1KB3A 4TUFA 1IZKA 4CN6A 1UH3A 3WENA 3AI0A 4WLCA 3F5KA 4RE2A 1XYFA 2GVYA 1QI3A 4P7NA 4GI9A 3CPUA 2DT3A 1PAMA 3ZIZA 4UR9A 1LQ0A 5A3HA 5LA2A 4V27A 5A8MA 1UHVA 4HMEA 4AIUA 3VIIA 1YHTA 3BLKA 3VIFA 1GCYA 2WSKA 4HP5A 4ZEPA 3IAPA 2AMGA 2WM0A 1E6SM 1FH7A 2PWEA 4W8AA 2E0PA 2FHFA 1HP4A 1G1YA 2Y8VA 1AMYA 4Z2HA 1H2JA 1GOQA 3EMCA 3U57A 3SCRA 5ECUA 4JAWA 4AIOA 3WUEA 3L4TA 3UR7A 2J79A 3CUGA 4MB3A 3TTOA 1RPKA 4LYPA 1O7AA 3NDZA 4GKLA 3QGVA 2ZX7A 5IFPA 3WF0A 1DTUA 1UKSA 1EGZA 1JNEA 1TZ7A 2PC8A 3CUHA 3W26A 3RM4A 2WANA 4QCFA 2CBVA 1E5NA 1FHLA 3T0AA 1H0GA 3T2OA 3WNNA 5I77A 1JYVA 1BVNP 4UNIA 2CKRA 3WNPA 3SCNA 8CGTA 1M04A 3SUTA 4C7FA 4MAZA 1JL8A 1XC6A 4J3TA 1US3A 3PZUA 2ZXBA 1KWGA 2XVKA 1UR4A 2FH6A 4AZGA 3E1F1 4WIWA 4JKMA 2VRJA 3G6LA 4H8VA 1CXIA 3GTNA 4F8XA 3BH4A 2WHJA 2CKSA 2DSUA 4TTGA 4AMCA 5E0CA 1BGGA 3MMDA 1E4LA 1NP2A 5ABFB 3LMYA 1N82A 1NWTA 6TAAA 1PZ3A 1W9VA 3CZGA 1J01A 2E9MA 1V0KA 3GXIA 3TA9A 1V6VA 5CSYA 3IJ8A 4UQBA 1ISVA 2BS9A 3U5YA 3CH9A 3J7HA 1FOBA 1NM9A 1H0IA 2Z1SA 1WZLA 2G3JA 3FHQA 2CESA 2PWHA 4UOZA 5AC5A 4OIFA 3ZJ7A 3PZNA 1UQYA 1FH9A 2ZE0A 3UESA 3AHZA 4PSPA 2ZX5A 4DUXA 3GXFA 3VKKA 4JFWA 3MV01 3POHA 2OYKA 3VGDA 3NSXA 5BXTA 1XH1A 4CU7A 4GPNA 3GBEA 2DIJA 2E4TA 4J3UA 2VX5A 2OYLA 4CD6A 2E8YA 4ATDA 1EO5A 1JF5A 1B3XA 5I3DA 4P8UA 1W32A 3GNRA 4M1RA 4X9YA 4UOJA 2X0YA 2WMIA 4UTFA 1P6WA 1UR0A 1LLOA 1J10A 3OBAA 1E9LA 2BV9A 2WKGA 1VAHA 4H41A 2XSAA 2O9RA 2W62A 4P8XA 4WKAA 1UG6A 4KH2A 3RILA 1BAGA 5GPRA 4TOQA 4B9YA 3ARUA 1QHZA 3QOMA 1U30A 4AEFA 3ARWA 2O92A 4ATLA 1D7FA 3VDAA 2V38A 1MW2A 4GINA 1J0IA 4J27A 1WZMA 2WW5A 3HU7A 2WC4A 4CU8A 1WZAA 5M5DA 1WNOA 5BYWA 2GK1A 4AY1A 1ISZA 4JFUA 2Y24A 3DECA 4CN4A 5GNXA 1HT6A 1FH8A 1HL8A 4AZCA 1NARA 4W84A 3LPFA 3W24A 3W82A 2PWFA 3WSUA 1Q6FA 2ZUVA 1LWJA 3CTTA 5FIPA 5EB8A 4ACZB 1LJYA 4TTUA 1E40A 2VCAA 4U33A 2W91A 3A3HA 3AZSA 1E0WA 1MW0A 2QMKA 1WE5A 2A3BA 3MS8A 4Z2IA 4KRUA 1DHKA 1HP5A 3VIHA 2YA0A 1MYRA 2UY5A 1KCKA 2YL8A 1GQLA 2VURA 4XV0A 2YL6A 1GONA 3TOPA 4AD3A 1PBGA 3NSNA 4Y7EA 1UOKA 2CBUA 4WSJA 2UY2A 2XHYA 4OOZA 5ABEA 1JFXA 5EFDA 3QOKA 3AHTA 1CXHA 2D0HA 4M81A 1CGYA 1E71M 2CETA 2EPNA 2WMFA 1ODZA 3CZ8A 1NWUA 3AIUA 3ZJ8A 1W1VA 4RE4A 1ZBWA 4PUDA 2XFFA 4UQAA 1W2PA 5A69A 3EDKA 3TTYA 4YHGA 2WHKA 2VO5A 3WQWA 1JZ2A 3EDJA 3AXXA 2CIPA 1EXPA 4CCCA 4S3JA 1TMQA 1OCQA 1OGSA 2WMKA 4HMDA 3PZIA 2XWDA 2X05A 3WNMA 2JALA 5E0FA 2W66A 3WDHA 3ARQA 5JIWA 4B3KA 1UR2A 2EEXA 4AZCB 4DWSC 4YN5A 2DH3A 1JDCA 2GJPA 5A2AA 2V5CA 1UA3A 4PMVA 3WQ8A 2X8RA 1V6UA 4MNKA 5GNYA 1KCLA 4XZWA 3PZGA 1CNVA 2VRQA 2JF6A 4MJ4A 1LWHA 4YHEA 3K1DA 2J74A 5E6ZA 1OGGA 4D6EA 3T2PA 1BFNA 3WL1A 2JFEX 3AQUA 4WJXA 2VX4A 2ZIDA 2BHYA 4AWEA 3SCPA 3WDQA 4GO8A 4ZXLA 2GDVA 1H49A 1E56A 4OBRA 2PI6A 1JGIA 3MU7A 1FFQA 2DSVA 1JIBA 3WL0A 5BROA 1BYDA 1EHAA 4ZXOA 5JIPA 4OOUA 2BFGA 1WDPA 3WH5A 3W4RA 1W3HA 5DMYA 2XGBA 3NUKA 3CZKA 3UERA 3NIYA 4S3KA 5FOOA 4OZOA 1MXDA 4M24A 4X0NA 1VJZA 4YPJA 1V02E 3RCNA 3WMSA 3W25A 5LYRA 3T2QA 2DT1A 3T08A 2OLHA 4HPGA 4MDPA 3BGAA 2O9OA 5A6SA 4QLLA 1HX0A 3QR3A 5BXSA 4GZEA 1UWQA 1SMDA 2WYSA 1G5AA 1BQCA 4JL2A 2J78A 4PTMA 1GHSA 2RGLA 1J0JA 5DF0A 3PZVA 1E4MM 1GOKA 2W61A 3BAWA 4CN1A 2ZUSA 4U5IA 3N18A 5BWFA 4KMQA 4KGJA 4UQEA 2NT1A 1UKQA 5IHRA 4PBGA 3WQVA 2J8FA 5IHSA 2E9LA 3AZRA 3FHAA 2JEQA 1E0XA 2JIEA
chains in the Genus database with same CATH superfamily
2YFOA 4LX4A 1FP9A 1LRNA 4A35A 3LENA 3PZTA 5MKGB 2OR2A 1L6YA 2WXDM 3A21A 4IXXA 1X39A 3MY9A 3K4DA 2POTA 1XQKA 3KWSA 2ZX8A 3AIWA 4TVDA 4Z2JA 4YTSA 2ZICA 4JNZA 1RCOB 4LJ3A 3MJMA 2CZDA 4OHQA 2Z2UA 1BYAA 5DY3A 1ELSA 1S2UA 4UQCA 2VEFA 1K8YA 5E6YA 2WKLA 5KITA 4FXRA 2PLKA 3QQ0A 3TJIA 3K13A 1IE7C 1QFEA 1NIUA 1EX1A 3T07A 3WO8A 4UFJA 1A4LA 2GJLA 2PD5A 2IXUA 1FWNA 5FSEC 4HMCA 4JHOA 4MADA 4QJ3B 1Q3NA 3TJXA 1I60A 2O9TA 1L0PA 3ARZA 4CCZA 2CFFA 2HXUA 3PSWA 4C6OA 4DLFA 1LORA 1FUYA 4UTUA 1UZ4A 1O6IA 4W7VA 3L2MA 1NOWA 5IOBA 4JKKA 4PGLA 4YYFA 3STPA 3VIGA 3JRKA 1IEIA 3CV1A 1HXJA 3W7QA 1KXVA 2EPOA 2G97A 2REQB 2Z29A 2DDXA 4HJWA 4NHVA 5AYIA 4U31A 3U5UA 3O3RA 3W53A 2IPFA 3DHDA 2YYUA 4MZYA 1T8XA 1NFBA 3DEQA 2WM1A 4XBKA 1ZP3A 4ZQRA 2NQLA 2QCGA 2PEVA 1P7TB 1QXLA 1WXZA 2NX3A 4S3AA 4ACYA 3EMZA 3NYDA 1EA9C 5IDIA 3ITLA 2VELA 4C7DA 3C2EA 4NNCA 1W9UA 3THDA 2HVNA 3ZFHA 1FVPA 3SADA 3LD5A 1MXGA 4IG2A 1DL3A 2ZUTA 3O6DA 4UMCA 1XHGA 3PF3A 1WV2A 4L1XA 1VHNA 4KESA 5I78A 4IH3A 2PB1A 3FKKA 4GUHA 3KZSA 1KGXA 1RALA 2JF7A 4F2UA 1W9XA 3P74A 1XS2A 4JQ2A 1QRQA 5CGTA 4EAYA 1F2JA 2H6RA 1G7UA 3WD1A 1PTDA 4Q4OA 3GHSA 1GJUA 2J25A 2VC7A 2XH4A 1RVKA 2Z28A 1K9TA 1ZFJA 3NZGA 3GW3A 4WK9A 3CHEA 2ON3A 3P0WA 3KBJA 4IF2A 5ABHA 1ITQA 3WEOA 1KLYA 2CNCA 3C0LA 5LNWA 2WHMA 4X0VA 2C19A 1BYBA 1TVLA 5FKYA 3G2GA 2HK0A 4KCTA 1BLIA 2Y61A 1JPMA 1WPCA 3UR2A 4Z17A 4JEJA 4WRHA 4E8DA 1M03A 1UCWA 1JF6A 3S1GA 3SGUA 2XM1A 2E25A 1W5PA 3U4FA 1OZQA 4QE1A 3IAQA 3I65A 1QNQA 1RD6A 5HR7A 3SIMA 1N55A 3MCMA 3SI9A 4GQRA 1OVDA 1HNYA 3CB8A 1SGJA 2GFTA 1YADA 4ATWA 3VILA 1H51A 1GNXA 3IPWA 3WF1A 3N12A 1Q6LA 2DQXA 3GNDA 4Q7NA 1DWAM 5E5CA 4DM2A 2RDXA 2ZRVA 3F4WA 1RLDA 1KFLA 3NM3A 1HVXA 2NWSA 3AMKA 1C91A 2CLMA 2YXOA 1AQFA 1EC9A 3L21A 2J77A 2AAMA 3QC3A 4GFSA 4DO4A 2A6NA 5TIMA 4E0CA 1TWZA 1ADSA 3VIPA 2G3IA 2PDFA 1G94A 1H60A 3EWWA 3DDMA 4G6CA 3RCMA 5HULA 3R8HA 1VF8A 1HGWA 1EP2A 4U3AA 3LYEA 1RY8A 5A8QA 3O1NA 1UZHA 1XLMA 1XIEA 5LNSA 4ZGYA 1VEPA 4I9AA 1JGMA 1GYMA 2X0SA 4LBRA 5CPLA 4M3PA 1KM5A 1KGUA 4PUEA 2R82A 3CNYA 1HW6A 3AHVA 1DE6A 3GBDA 4LYKA 1PDZA 4J35A 3PWIA 3UWQA 5D2XA 4WJ8A 2IS7A 1W1A1 1ITCA 1UBPC 1W3LA 2V5BA 4ORIA 3S5ZA 5CQ1A 4P7QA 3LHWA 3ES7A 4AIEA 2XVGA 3SEPA 2PWUA 1O12A 2H3DA 2W6RA 1A5KC 1VPXA 3HMJG 2YCKX 2PSNA 2GQ8A 4ZBCA 3LQLA 2VFFA 2QF7A 3FSTA 4ASTA 2VZSA 4O16A 3FV9A 1D9EA 3A4XA 1QW9A 3I3EA 1KXTA 4FNSA 1A5MC 1QI4A 1EUAA 5E1QA 4P61A 3N04A 5H6HA 2WSPA 5I79A 3O0FA 3M0LA 2XGIA 2Y7FA 3H4WA 4F40A 4ICCX 3N6QA 1KKRA 4EACA 1AW5A 3SR7A 2TRSA 5D8ZA 4QG6A 1Q6DA 3RX2A 2X1TA 3MSYA 5K3VA 4I6KA 1EJTC 1CEOA 4DI8A 4UTLA 3H4XA 1OFQA 4B90A 4WKFA 4AHOA 2R1MA 3RMEA 1TE6A 3SFKA 3QQ1A 3U2OA 4PMYA 1CXLA 1KKOA 3DBPA 5BCAA 1N2VA 3VTRA 1F74A 3D5HA 1I0BA 2FZ8A 4NI3A 5FAGA 5CSUA 3T09A 3AMCA 4K68A 3A9BA 5CC6A 3RLHA 3OG3A 2WBGA 1KTBA 2OQHA 2X0HA 4X3ZA 1DHPA 5BWAA 2OVLA 1JZ6A 1TVNA 2OPJA 2OZ8A 4NRRA 1ECEA 2J7HA 2A3LA 2VCCA 2J47A 3WD3A 3TCEA 1NF0A 3APTA 3S8HA 3KUMA 1AA1B 2BX7A 3MUIA 4O13A 1P48A 3LLXA 1I9CB 1DORA 1QO2A 2WJZA 2R1KA 1US2A 1LCOA 3TQPA 4AF0A 3G1DA 1JRCA 3ISIX 4XKYB 1GZ1A 5HMSA 2QDEA 3P3BA 4LCQA 3M4HA 4A8IA 1EC8A 3FXGA 4P7RA 2DIEA 5LA0A 3CO8A 2EPHA 1F9CA 1V08A 3TTEA 2OTDA 4DO7A 4XO6A 1XRSA 1HKVA 2EJ1A 1OWQA 2ZA1A 3ABQA 1F6YA 2OCZA 4HNCA 3W1NA 2PLCA 2INEA 3NZPA 4S3EA 3FS2A 3THCA 3R58A 3NNTA 4R53A 2EBNA 4O1DA 4S38A 2PDHA 2WQDA 4AAJA 1V6YA 4F0RA 4ILSA 5JBDA 4UOQA 3HPAA 4M51A 3KE0A 3ZS4A 1SO5A 1GEQA 2VL4A 2CHRA 4ES4A 1BG4A 3QY8A 3KBSA 1TUXA 3QGKC 2XIMA 3EOLA 1L8PA 2PF8A 4HT3A 4LWWA 1UD8A 2C18A 4QR6A 1I45A 4ADTA 3JS3A 3KOZA 3W74A 4YWIA 2CU0A 3AUJA 5J5RA 3T0DA 4NAEB 4WHBA 4LYQA 3VC6A 1Z9AA 5AYBA 2PP3A 1VJIA 4FA3A 4E3VA 5M2FX 1B9ZA 4LUSA 3ARSA 3LX9A 1I8JA 3LUTA 3H2EA 4HA0A 4LVFA 1TJ0A 5LHFA 4PC8A 4WDXA 4UFKA 1CPUA 4H9ZA 4FXSA 2X1SA 1AW1A 3BARA 3QMSA 3FY1A 1OFDA 1KCZA 3MVIA 3VA8A 3W1TA 3S42A 4JYFA 3AIEA 4FR6A 3DFHA 3N1AA 1CGTA 3GDMA 4GVGA 3O9NA 3N2TA 3T42A 3UJEA 5HPCA 4HTYA 1KRAC 3B40A 1BEUA 1DWGM 1TYGA 1JD7A 1ONEA 1J18A 1G0CA 5A8GA 3NZQA 3RJXA 2G41A 1R2SA 3FGCA 4JTGA 2FFIA 2QJHA 1RQEA 2QZRA 2QPXA 1DQXA 4WY0B 1U2YA 4WSHA 1QNRA 4OJYA 3WX7A 1CYGA 5B7YA 4B92A 2V82A 4RV3A 4JHZA 3TDFA 2PWGA 1GPFA 4POCA 3IIVA 4AB4A 3LLFA 4XSMA 3EX4A 1WDDA 1F8IA 4KEVA 3TYBA 4KFOA 2WVUA 5C2CA 3IUDA 3R7MA 3NQ7A 3SBFA 4CNSA 4L80A 3WD2A 1C90A 4EXQA 5CCZA 4QROA 3GIPA 4GRSA 5K7JA 3H7VA 4EXBA 1AL7A 3TUUA 3UXLA 4MM1A 3NQGA 1E4IA 4ZQNA 3BG3A 2X30A 3DBNA 3R0UA 1XJBA 3QV9A 2BY0A 3QSTA 3RDKA 4CEXC 2A6LA 3QMTA 1B2YA 4MNJA 2PBGA 2FTPA 4ZOCA 3GQYA 1KTNA 2HVMA 3NPXA 3SCUA 5CG7A 2VGGA 2W79A 1R47A 1JZ5A 5C6MA 1LTDA 4F66A 2DZXA 3HBLA 3L5MA 4TVUA 1O60A 3BQ6A 4NAFB 3CQKA 1JYWA 3R25A 2XIQA 4R9OA 3M0KA 3R89A 4LBSA 1JCTA 3BAYA 1MW3A 1OINA 3DERA 3OLEA 1W5QA 3BQ5A 3QXBA 1LYXA 1F76A 4CD7A 5CPQA 1UKPA 3UEQA 3S2CA 3ZVIA 4F9JA 1FHUA 4D1JA 1OYCA 3NDYA 3BGJA 3OYXA 4GJ1A 9CGTA 3VGHA 1FWCC 2NUYA 3O8AA 3WNLA 4MY1A 4BFAA 5I0DA 3SY8A 2VTFA 3IIOA 1VCGA 4YS1A 1VRDA 2B7OA 1AJ0A 3EWUA 2JE8A 3HQNA 4W7WA 1TWSA 3PS7A 4QLJA 1JNDA 1CGUA 4Y2WA 3FLUA 2QIWA 4Q22A 4LRTA 3WF3A 4CNOA 4NL1A 2ZRWA 3LRLA 2OXNA 2YLAA 4X9SA 4PTNA 1OIFA 2ANUA 1GHRA 4FO4A 4S3GA 2Y5EA 1ZLPA 3AS3A 5HXMA 5A6BA 3URNA 1YDVA 4LY8A 1FP8A 1KR0A 4FF5A 3USBA 3OPSA 1GKRA 4ZSUA 3K4WA 3W01A 5AHFA 3RR1A 1F3TA 4QE5A 3NJ3A 3MWAA 3EPMA 1V0NA 3LPGA 2OFJA 1MEWA 2WVTA 4DJDD 1NAL1 1UH2A 5HWJA 3CWNA 3VXGA 2J7EA 2OZ0A 1ODUA 1W91A 2Y88A 3BSGA 2XVLA 1R2RA 1XICA 3O0KA 5EMLA 3UBPC 2X2YA 3E0FA 2DH2A 1X7IA 3JZUA 1NELA 4JIQA 3RPTA 2OQYA 2XISA 2GSEA 5JXQA 3SRKA 2VUNA 3QLLA 3NPUA 2OG9A 2ODOA 1C29A 5AHLA 1NOFA 1KBJA 1YQ2A 3TSMA 4JFTA 1VPQA 5A2CA 3CAVA 4O1EA 4QSFA 3APYA 4LUJA 1PSCA 1B1YA 4KIEA 2XH2A 4A22A 4LUTB 3VC5A 5CBJA 2FFCA 4QXIA 3Q37A 2B7NA 4JTJA 3N3MA 5KINA 5AHNA 1JCNA 1W5OA 3CYVA 2WJDA 2Q01A 3UJ2A 4GXPA 3IRDA 4AC7C 1Z89A 1DXFA 3E02A 1KRCC 3M0ZA 5HWNA 3HFTA 2F38A 4HOWA 5ABTA 3SCOA 2NSOA 1MDLA 3G8RA 1CECA 1C8XA 2KZHA 4OBSA 3QKZA 3VCRA 3TW9A 5BMXA 3L2LA 4MJ2A 4W9TA 1FY6A 2OOFA 1DKWA 3EKZA 4H9TA 3W07A 3BPWA 1W0MA 3NQDA 4DJEA 3WLHA 2WZIA 2WC7A 3BO9A 2GWNA 3IJQA 4PMZA 1CLVA 4I9TA 4WXYA 1F05A 3RLVA 1RP8A 4PCSA 2IQDA 4DJFC 2GJRA 3EOOA 4QEHA 5EMYA 2VNCA 4ZFMA 1P0DA 3ARTA 1R85A 4PUJA 5LSMA 3SJNA 2V3EA 3II1A 3O63A 4L56A 4JKLA 3C0QA 2WPBA 3KHDA 5LXXA 2UBPC 1AQHA 5LNRA 3PSVA 4HQVA 3W6MA 3LTPA 4JY9A 1FHDA 3UY7A 1V4YA 3MT1A 4KRTA 1EJUC 3GIQA 3G18A 3GNPA 4BY3A 2Y5JA 4RZBA 1XCXA 4N0RA 2VRKA 5A8PA 4JTSA 3CHCA 2W5FA 4WOQA 3AWNA 4GG9A 3OIHA 3K8KA 4MB5A 3VFLA 2R9RA 4Q8VA 3GR7A 4Z0JA 2GDUA 3K8LA 4UCFA 1M53A 2R8WA 2R24A 4E2VA 2XH0A 1PIGA 4LUTA 1AK5A 2PRLA 3N19B 4HN8A 1D3CA 3I3BA 4US6A 3TTQA 2F6KA 3H4GA 1XLAA 4JTFA 3AMDA 5HQMA 1XYBA 1DIKA 4AU0A 4OVXA 3NQBA 3MUCA 1UC4A 3FDGA 3GNNA 4IP7A 1UPMB 3ALFA 3WLSA 1JCYA 3KDOA 1J0YA 1H41A 3PBVA 1XD0A 4PFHA 2PODA 1GQIA 5E09A 1TO3A 3HG4A 1GW9A 4Q33A 5CBIA 4HJFA 1MNSA 3M7SA 2B31A 4PMUA 4C6FA 4GY7A 2E8ZA 3I7RA 1NFGA 2D3NA 4GVHA 3DOPA 4ZOAA 1GVEA 4AWUA 1EF2A 8RUCA 1OJXA 2A21A 1XH2A 3AHYA 3BDKA 3LSBA 2PF0A 3L68A 5AECA 2QUNA 2W67A 4Q4RA 1SPQA 3GVVA 1OB0A 2WMIB 4E8CA 4S3DA 3N25A 1MUWA 3AXIA 1GT8A 3PJUA 1TKKA 1OX4B 3DGRA 4DXXA 1BRLB 4C6CA 4XAZA 5JBFA 2QCDB 1O4UA 1OBAA 3MQTA 3BWWA 1OX6A 1D7KA 4PMDA 4DIAA 2NVCA 4JCLA 2TMDA 4HZ7A 1HG3A 4G56A 4GWEA 3V36A 1RVGA 1B3YA 4GIRA 3VCNA 4W5UA 4W7UA 1DIEA 3A47A 1IT8A 1UP0A 4PZVA 5CEWA 4XVDA 2WCAA 4LY4A 4O12A 4YVPA 3F5LA 1JI2A 1JAKA 2AGKA 1H63A 3TKFA 2QCMA 4JIRA 2CHOA 1SO6A 3L12A 4MFDA 1UR9A 3B0YA 3AYTA 1FWEC 1XLKA 5FAJA 1PWMA 4HOZA 4AUBA 2I5IA 3HJZA 1YTDA 3R11A 2AKMA 2V3GA 4ZR8A 1AUSL 2BLEA 3GC4A 4R5EA 3V7PA 1ECQA 5C9UA 1EFZA 2ICSA 1EA0A 4AZHA 2ALRA 4JTKA 1QJWA 4IJCA 4AX6A 3G1XA 4KFPA 1LROA 3KOYA 3EYPA 4E4FA 4G7EA 2O0TA 1S5WA 1J0ZA 1PIIA 4RKAA 1ZJAA 3IJIA 2AQVA 3VDGA 1U1HA 2G4FA 3B03A 2UY4A 3ONCA 1SR9A 3RFAA 4GABA 4UQDA 1DJGA 4GQ0A 1NDZA 3UWEA 4FOKA 1KGWA 3VX0A 1IHIA 3A4WA 3H2OA 3WK1A 2E40A 3B8SA 4GI8A 3M0IA 5FJIA 4PUNA 2BB0A 3ITXA 3A4AA 4EPEC 1ZHAA 5FJRA 4MWAA 4AZ5A 1FFRA 3GS6A 3VMOA 1OK4A 1EJVC 4FP1A 1WKFA 1A53A 4JN6A 4NY2A 1UH3A 3F5KA 4ZO6A 1PZ1A 4P7NA 2Z26A 4ENLA 2W0UA 3TVAA 1PAMA 2VFGA 5AHEA 1LQ0A 5LA2A 3ANUA 1UHVA 3VIIA 4E2BA 3BLKA 3EOEA 4IMAA 4HP5A 4ZEPA 3DUGA 2AMGA 1UIOA 1E6SM 2FHFA 1HP4A 3T6CA 3GX9A 5AYZA 1B4KA 3FX4A 3SCRA 3NEVA 1NDWA 3K30A 3E0LA 3BSMA 3WUEA 5AC6A 1T7LA 2J79A 1OADA 1FDZA 4LYPA 1U1JA 3UYIA 1O7AA 2JK2A 3NDZA 2ZX7A 5IFPA 3WF0A 4GJJA 4XBJA 1TPEA 1XCFA 1EGZA 3CUHA 1PVNA 5H8UA 4B2DA 3PY2A 5D03A 4BK9A 3T2OA 3WNNA 2Q3RA 1JCLA 2CKRA 3EPNA 2VDIA 4AMAA 3KVMA 1LT8A 1XC6A 3EWXA 1US3A 1NDVA 3PZUA 1KWGA 1XIIA 3R5EA 2VEPA 4Q8QA 1CXIA 1S2WA 3BH4A 5HK4A 4R88A 2CKSA 2DSUA 4TTGA 1DQWA 4U28A 1NP2A 3EWCA 5DMLA 1NWTA 4GBUA 2QUMA 2Y1HA 4JD4A 3SB0A 4A29A 1Q63A 3KS5A 4BR1A 1AW2A 1WBHA 1XBZA 1ISVA 2BS9A 3J7HA 4IFKB 3GFXA 3KXQA 1QOQA 2G3JA 4CEUC 1EXBA 2JBMA 1VCVA 3LB0A 3LBCA 5DXYA 4M7TA 5XIMA 2ZE0A 2YB1A 3H55A 4NQ1A 3W88A 3H7UA 1L6GA 4PSPA 2ZX5A 1P0EA 5D38A 2OELA 2FYMA 1AL8A 4ZVJA 3N2CA 1XLGA 2VX5A 2PP1A 3MTWA 1LLZA 2R94A 2E28A 4Q7IA 1AODA 4P8UA 4HYVA 4K8GA 2X0YA 4UTFA 1P6WA 1S39A 2H90A 4UIOA 1LQAA 1JDEA 1OFRA 3QGAC 1YBQB 1E9LA 4ONVA 1UWAA 4XSLA 1TCDA 2WKGA 3L9CA 3RITA 1UB3A 4HSOA 4XZHA 1XX1A 2XSAA 5C54A 3N73A 2W62A 4J9JA 3LHUA 4P8XA 3WZ0E 4KH2A 1BAGA 1BKSA 3SO7A 2O92A 4XKMA 2Z7GA 5L6UA 1MW2A 8XIMA 1DV7A 3GD6A 2WW5A 1T99A 2QVNA 4I5UA 5CJMA 1FHVA 5BYWA 3CPGA 1OFPA 3SZ8A 3QKEA 5HATA 3DECA 3W7LA 6REQB 3BOFA 1HL8A 3L7RA 1Q8AA 3W24A 3H26A 5FJOA 2ZUVA 2QCLA 1Y65A 3G1AA 3L0KA 4ACZB 4TTUA 3W7PA 3UWZA 1E40A 3NQCA 4O8RA 2W91A 2XN1A 3KTSA 4TMBA 3AJXA 1UMYA 3A3HA 5LIXX 1RA0A 3AZSA 2QMKA 4QRNA 2BGNE 3FSUA 4ZQOA 4IFKA 4LAUA 1A5NC 2GL5A 3VIHA 1TELA 3MBDA 3O7UA 3WQPA 1TTQA 4MIMA 3VUSA 3WG6A 1GQLA 3CU2A 5AHIA 4AD3A 4TV6A 2P3EA 4WSJA 2UY2A 4M6PA 1KW1A 2WZMA 3AHTA 3QOKA 4WZHA 1CGYA 1E71M 4M81A 3O05A 1XLJA 2WMFA 1WBJA 1J2BA 3ZJ8A 2ZDSA 1HTIA 3TN5A 4UWMA 1ZBWA 4AHQA 4UQAA 4R9XA 3HO8A 2Z7KA 1V77A 1V79A 5SWUA 2CIPA 1EXPA 1HFBA 5DN1A 2VP8A 2WMKA 2F6XA 2E6YA 2GWGA 3TYZA 4RNIA 1KFJA 1RSCA 3KDNA 2GGJA 1TPDA 3WNMA 1OF6A 2JALA 5E0FA 2TPSA 3ARQA 1UROA 1VR6A 3TQ0A 4AZCB 3TMLA 2NWRA 4AQLA 2V5CA 4PMVA 3WQ8A 2X8RA 4JTAA 5HMEA 4XZWA 2Z27A 5HINA 4MJ4A 3V75A 1NFPA 4UUIA 4D6EA 2EF9A 1QAPA 3W83A 2OZ3A 2VX4A 3SCPA 4GO8A 1H49A 2PI6A 3GUGA 2DSVA 5H8PA 3WL0A 1EHAA 1UZDA 3W2UA 2IW0A 4K1GA 3WH5A 3W1PA 2XGBA 4IGHA 2IMRA 5CGQA 4O54A 1Z41A 2NV2A 1NU5A 3QYQA 4M24A 1XRFA 3RUBL 4YWSA 2GUBA 1V02E 1O1ZA 3RCNA 1XGDA 4N7QA 1P0NA 1LZOA 4K8EA 2DT1A 2IKHA 1OQFA 3B8VA 4LF1A 2GYIA 1RJRA 3NQ6A 2DJLA 1JRBA 5A6SA 3ANYA 1A3XA 4QTGA 4GZEA 1ICPA 3LA4A 2BWGA 1G5AA 4KWSA 4M6VA 2FZNA 5JMUA 1J0JA 1P6CA 1E4MM 1P5BA 3ZWTA 1YNYA 4HHMA 3DKJA 4BEQA 3P14A 1GWJA 1PHWA 2NT1A 5MHBA 2ZCGA 4DJFD 5IHRA 1XL9A 1XFCA 3TOYA 2GGGA 3NR0A 4ROQA 3VKAA 2JEQA 2V9DA 3T7VA 1IXOA 2HCVA 3VKJA 4C65A 3PBUA 4LUIA 4ZA0A 3NL3A 4QJ5B 4UTWC 3LTYA 5LNVA 3QW3A 1IT7A 2ISDA 1XR2A 2FVMA 4L4PA 4PEEA 4JYDA 5BRBA 3CUJA 3SSZA 2CC0A 4NZ3A 1OD0A 3LCIA 2YDQA 2Y8KA 4YCPA 1T6MA 1XF0A 3F2BA 2WWCA 4OQVA 2J7FA 3A24A 1M68A 3WLKX 5C71A 3G0XA 4W8LA 1UR3M 3SFWA 1JXKA 4PRRA 1TQXA 4AWTA 1ISXA 5FACA 3IV8A 4BJHA 4V1YA 4MY9A 6A3HA 5I06A 1BD0A 3TMQA 3EZ4A 1VBGA 2CLEA 3V1PA 3OJGA 4JIHA 1WOBA 3GFYA 4JICA 3C2OA 4UC5A 3OBEA 1CGWA 1TWDA 3AICA 4WX2A 2ZC1A 3LXCA 1KTCA 3BG5A 4XG1A 2Y70A 1JULA 1AJZA 4XUGA 3CMJA 4DZ5A 4P8VA 3IK2A 4DWSA 3RG6A 1HUVA 2DW7A 1PIFA 2H3BA 4AF0B 3VD5A 2PTZA 4EP8C 3PK7A 2DT0A 1ZY9A 1KXHA 4U10A 3AXKA 3H54A 3KL0A 1LBLA 2DJXA 3IJ6A 4D8LA 3W7OA 4O57A 4NX0A 3OODA 3DC8A 2OWWA 4DRSA 3W7HA 3ZZ1A 2ZOXA 4OUEA 5RUBA 2WLZA 1IWBA 3B4UA 2Y7EA 1KO0A 5EU9A 1IIHA 1UC5A 1Q7MA 3ARVA 1CXEA 1UJPA 4XISA 1IXNA 2VX6A 3BLOA 3IJDA 4B91A 2AL1A 3HG3A 5CG0A 3ATYA 3MP5A 5AY7A 2XM2A 2AAAA 3CH0A 1SU5A 1UWRA 1FWBC 3R2GA 2F8QA 2Z1KA 2J9YA 3PPFA 3W1LA 1VPYA 3EKLA 3WLPA 3NQ2A 3T81A 1HKKA 3C8FA 3B04A 1MQRA 1TRIA 1E1FA 2EG8A 1EJ7L 1RBLA 4G9PA 2BXYA 5I00A 4LV4A 3CHVA 4AC1X 3BLIA 3ZYZA 3K5XA 4M82A 3PTKA 3W23A 2BVWA 2VOTA 1XIBA 2XINA 1DJNA 1K8XA 4EKJA 4F2BA 3CZEA 2A7NA 2IPWA 4M6QA 4H1ZA 1TFVA 4FLQA 1V0MA 2P8BA 3NPVA 3DC0A 4MWAE 1RAKA 2C1GA 3FAWA 4QHRA 3XIMA 1UD5A 3WLNA 4XX6A 1JUBA 3SUVA 3OGRA 2P0OA 1J8VA 2HWGA 3N15A 3OZYA 3H8AA 1UD6A 1XRVA 1PX3A 5DT5A 2FIQA 2HE5A 5G5IA 1Y7VA 1P0KA 4IUGA 3LSCA 4IISA 2DZWA 1E3XA 2X7VA 1RP9A 2R1LA 2NQ9A 1EQCA 4R85A 2H8XA 1GEHA 1A0EA 2B81A 2DFAA 1NY1A 2TODA 3GO2A 3ZR6A 1JZ7A 2PMQA 3NZRA 4K37A 1POJA 3WK3A 4ZSTA 1H4PA 4MMWA 1EP3A 2DV0A 2H9AB 3WKZA 2W3ZA 4N9BA 2G95A 1CENA 3BANA 3VIOA 3WLJA 2D3LA 1GOOA 4WDTA 1N8IA 4PODA 1QBAA 2BY3A 3LHVA 2ESCA 4JTDA 1VJSA 3D6NA 1WZKA 4EVZA 3NFUA 5LIKX 1QI5A 4DYKA 4J2MA 5LXEA 4J3VA 4GE8A 1ESWA 2PE4A 1EUNA 1HJXA 2W4XA 1ZNNA 2GZXA 1KFBA 4NVTA 2OX1A 4RDZA 2PDQA 1GOWA 1AZ1A 3CHDA 3SY5A 1HQTA 4JNYA 2NUWA 2P76A 3QM3A 4D6IA 3WH8A 1ZU8A 1PZ0A 4PL1A 4D8ZA 1VRXA 2A1YA 4E4PA 1J6PA 1YKWA 5REQA 4O1BA 3B9OA 5DFAA 2Y63A 3H12A 4I8YA 3WBYA 4YXGA 1LOSA 4WVXA 2V30A 1R9ZA 1H50A 4AH7A 2VFIA 2YSWA 1DBTA 1SR0A 3OEXA 1AH3A 3BW2A 1XIJA 5REQB 1IT0A 2PDYA 2QJJA 3ZT5A 3W7DA 1GVSA 2J75A 1NQ6A 2DUAA 3E2QA 2PDXA 3TXVA 1I1XA 3XINA 5CPSA 5I6SA 4P7OA 5D04C 3W1AA 2ZZ6A 3A9IA 4WY0F 4L1GA 3WJYA 1EDQA 4J3WA 1W9BM 4PCTA 1XLDA 3KOFA 2BVDA 1E72M 4KFNA 1MW1A 2V2DA 1UZ1A 1XISA 3PTMA 5EBAA 1KRMA 1QATA 4DNMA 4UTKA 3RJYA 3DENA 1HO4A 3W29A 1XSKA 2YCLA 4RE0A 1KQZA 1UUQA 1J0KA 4US5A 3ARYA 1E1EA 4TXEA 2QDGA 2PRMA 3B9DA 1CXKA 3HQPA 3LBMA 2V69A 2NLYA 4FK9A 4IPJA 5AC7A 1PKYA 4H9YA 4YIWA 5A8NA 4O10A 2WOQA 1E6XM 3GDBA 3P67A 2C71A 1BTMA 3VX1A 2VC9A 3WH6A 1Y8BA 1Z8AA 1H1NA 3CEPA 4F9DA 4PUUA 4L9XA 2V68A 1KA9F 4EPDC 3HGRA 3RF9A 4DUOA 1ITXA 3FN9A 2ISFA 5KZ6A 4JOMA 4KT2A 3W02A 4ZMGA 3DG7A 1H5VA 1G01A 3GVQA 4IICA 5CZKA 4LAMA 2CLHA 1GVRA 2Y62A 1KFKA 3SUSA 3CTLA 1KM4A 1VC4A 3VE9A 1E6ZA 4PTDA 1TV2A 4HZ6A 2WWDA 3NAVA 4YCOA 4X60A 4K8HA 3AIQA 1GVIA 2XSXA 3TWBA 4MPQA 3HG5A 3MMWA 4UFHA 1ONRA 2FHBA 4J4KA 4HNVA 2HE8A 1C8VA 4BQ4A 5DEZA 3IK4A 1XDJA 3VMPA 3S1XA 1XSJA 4B5XA 1J11A 2G0WA 1R3RA 1KFWA 2QPSA 5J04A 3GC2A 3MKKA 3BLEA 2OEMA 5HJXA 4IPLA 3G1SA 3PTQA 3HJEA 5ENLA 3ECQA 4DUWA 1OFOA 1V3HA 1U5JA 1N8WA 2VC5A 3DFSA 4LVBA 1YNQA 4RDYA 2NXIA 3E2RA 2O4MA 1TPVA 3LHZA 3LXBA 3P82A 3BV7A 1VFLA 2FPYA 5AVNA 4YTQA 1C7TA 3S5OA 3VDBA 3AAMA 4MLRA 2YZ5A 3L0GA 3L4XA 5CZJA 2HQAA 3HMCA 3E0WA 2E68A 2HK1A 4H04A 5HMFA 4RNJA 1JZ3A 1OT1A 2DORA 3G22A 2WAGA 3C0JA 1UWUA 5EPDA 5FL0A 3I68A 2AOSA 3SCWA 4X2PA 3KRSA 4GMEA 2WKJA 1Q4NX 2W9MA 8A3HA 4NILA 3DYMA 5D4YA 1FWWA 4JDYA 2AGTA 3N34A 5D2VA 3P84A 1VHCA 1JQVA 1HL2A 1V6WA 1PUDA 4HZ8A 1B3WA 4LC6A 4QDMA 4C6IA 3TYUA 1OGBA 3O6YX 4W86A 5FEXA 3CAKA 1NSJA 3CQJA 5HWMA 1S2CA 3L0NA 1RUSA 1SFJA 1PPIA 1V03A 3PG9A 1Q5MA 3BUVA 5D9MA 4TR9A 2INFA 4KBXA 2YIHA 4KWUA 5EMJA 1Z48A 2FDSA 2E7FA 3PBMA 2XWEA 4HCLA 4CQ9A 9XIMA 1D3GA 2CZEA 4FAMA 1VENA 3DIPA 4PH6A 5BOOA 1S46A 4PE8A 1IEWA 3BAJA 1XPGA 4RW5A 1OFBA 4NSBA 3LLDA 4AY7A 1KM6A 4IL2A 1GQJA 4AY8A 4L7ZA 3HQ1A 3FXYA 3NQVA 3K2GA 3MBFA 2R1PA 1NQKA 3VCCA 5JH1A 3DFTA 4N4QA 2OO0A 4L65A 3DG3A 1FWGC 3EB3A 4K36A 1C8QA 2Z6JA 3MC5A 4ZODA 2G3FA 3CBWA 1A5UA 1TJPA 2JKEA 1EO7A 1K77A 2VC6A 3ZT6A 2BBFA 5E70A 4CD5A 4GIEA 5A6KA 5BU9A 4GQGA 2WV8A 5HQEA 4N42A 3ABRA 4XD4A 4EAMA 5DO8A 4JTRA 4E2DA 1ZP4A 1V6XA 2GGHA 3WH7A 5D9OA 5FJPA 1E3ZA 2FTYA 3BAKA 3NO5A 1Q2RA 1W54A 2ZZ2A 1I75A 2XIOA 4LC8A 3PPCA 1CTNA 1DJYA 3L4UA 1S5VA 2J62A 4FNRA 3EDDA 3LZ5A 3VD3A 3UZXA 2QJMA 4M7SA 2PDLA 3AZTA 5H91A 2WPGA 4JEQA 1FWJC 4W93A 5FJUA 1EHNA 1XBVA 3LEPA 5CSSA 4C6DA 2D0FA 1I4NA 4XIMA 3WY1A 1NDYA 2OSWA 1KBIA 1ZENA 3CV2A 1QPKA 4LAZA 5CAHA 4Z2KA 4CCDA 2E09A 4HVXA 1TJRA 4HN4A 2BTMA 1LT7A 3VUPA 3WDIA 3BJSA 1PDYA 4XUYA 4GLEA 1YPFA 4L6OA 3LM3A 4ICNA 3DFYA 3FW6A 4J1OA 2P0IA 2IUZA 4Y9PA 4BCEA 1IZJA 3IGSA 4GHRA 4JN7A 5JVLA 3WJZA 2QJGA 5F2GA 3M07A 4L9ZA 2OT1A 5K4ZA 1HN1A 3PJXA 3LCWA 3E74A 1G7VA 5CPTA 4D6DA 4QG8A 1JDAA 1XGEA 4IX2A 1S1RA 5DMNA 1UOZA 3TFCA 1K1DA 3S6TA 2C91A 1UD4A 4XD5A 4JS3A 2VD9A 3MUAA 3VIKA 3LTSA 4KWWA 3ZR4A 2BMBA 4U4MA 3TZNA 4JX6A 1EZ2A 5U7SA 1S2TA 4C6NA 1E9IA 3NOEA 1W1IE 4CQBA 1U5VA 1LL7A 3EDFA 1WOAA 4R7OA 5CLWA 2PDWA 1K70A 1W3TA 1OD8A 3OVGA 3URBA 5M03A 3P0XA 4B5WA 1B54A 3DZ1A 4REQB 3G8EA 4K1WA 3RM9A 3AIBA 3TA6A 4M19A 3DYOA 2BY1A 3ZSSA 1PKMA 3P7YA 3TH6A 5FF2A 2YJQA 1Q4WA 3PBGA 1ML1A 3CQIA 2C14A 3KM8A 2CEQA 3NGJA 5HAOA 1CBGA 3TR2A 4D1IA 2I17A 1WDRA 1H7PA 4GIYA 3GSMA 3RAOA 3FK4A 1RQBA 4W89A 3UETA 4ZQCA 3GH5A 4ZE5A 1XRTA 4MNMA 2YDRA 4QBXA 3MHGA 2G3NA 4GYJA 2V5KA 2QXWA 2VOMA 1M7OA 1M9HA 4QIUA 2YL5A 1QOPA 1GKPA 4IIBA 1QOXA 2QIIA 5M17A 2FLIA 4F0HA 4KWVA 1PKNA 2W27A 1DXIA 3UZYA 1A49A 1Q65A 5BNKA 5T8GA 1KBKA 3DFPA 1JR1A 3S6OA 2WHLA 3GXDA 4N4PA 5GQBA 1KQYA 4DJFA 4IQEA 1W1ZA 2YCLB 1J5SA 2Y4SA 3ZWSA 1OF8A 2Z2AA 4LS0A 2WZTA 3B0UX 1WX0A 3OHMB 2WCGA 3SN4A 3TQKA 1EPXA 3IIXA 3FJ6A 3VZXA 3B9EA 3TW7A 3S5YA 4EF8A 3UG3A 1DXEA 3UZZA 1W1TA 4DAFA 2NXGA 1KR1A 5IXEA 2EPKX 4J3XA 5G2IA 2J9XA 4S39A 4PB5A 5CGMA 1GVOA 5FEPA 1FDJA 4YTUA 3WNOA 4LPCA 1UD3A 3ZVHA 2QUTA 4NF7A 1I0DA 1TIWA 1AD4A 4KCWA 1XSIA 1MUMA 1ZJBA 2DUXA 2RJGA 5DXXA 4AD2A 1M7JA 4L4LA 3AISA 3WJWA 2D20A 1L2UA 1TUFA 4IXHA 4Q4PA 5D9PA 2WVSA 5CPNA 3WBWA 2FHCA 1MEIA 3AJ7A 1H7XA 1S3HA 1FXQA 6ENLA 4FNUA 2O7SA 4IL0A 3XISA 3WUBA 1XQLA 8XIAA 5G4HC 3MO4A 2YXXA 4XQ6A 3UCQA 4YLWA 3PP7A 1I2OA 1D2KA 1LG2A 1WXYA 2HRWA 1R87A 4Q4MA 3KVLA 1YMYA 3CT7A 5A6AA 4LEFA 3WQ6A 1IZCA 2D23A 3MSRA 3GAYA 5E9AA 5IBXA 1CB2A 3VM7A 4UFMA 1V6TA 3BZJA 4C7GA 2BSLA 2EPLX 4TX8A 3SGZA 3SUWA 3LBOA 3TXZA 3UZ5A 1XCWA 7PTDA 4H7VA 3LPPA 1RCXB 4MLJA 3FEQA 3LNPA 4MYXA 1J5TA 4JHMA 1OCNA 2YCJA 1I2NA 4QAWA 1ENUA 1AH0A 4U2ZA 2MANA 1PL9A 1WCGA 2I9UA 3AYRA 3W75A 1J9YA 1OK6A 3VGFA 1Q6RA 4B5TA 1E6PA 4ZB2A 3DGBA 3OQ8A 4A05A 3ALGA 4GXWA 3WF4A 4B15A 4FNQA 3GWQA 2QT3A 3ITCA 1JUEA 4JCMA 3T0CA 3GYCA 3PZQA 4TVCA 1I6NA 2RGMA 1A3HA 4GGHA 3H53A 2VCBA 1IV8A 4HIBA 3GNXA 4QNWA 4U3CA 2VQUA 5F1VA 2FB2A 4UB9A 4FMVA 3U7VA 2OSYA 1SZRA 4FZIA 3TLQA 1DJIA 2YBUA 1HJVA 4OUIA 1E9ZB 1X8CA 2J7DA 2VVNA 4UR7A 2ZZ3A 1E1CA 2D0GA 4UQ9A 1XYZA 3QC0A 3GDTA 1EYWA 2Z4GA 3KBMA 3WIJA 3WCZA 5K2ZA 4YJ5A 5FL1A 2WVVA 4JY8A 1KM0A 2VR5A 3FCPA 3IIZA 1LUCA 4E3TA 1CB7B 3FAXA 4XAYA 5FA5A 1I2RA 4PTVA 4AXNA 1AZ2A 4RR4A 2QULA 3TIMA 4CNPA 5HNTA 1VIWA 4JTQA 2OWXA 1GZJA 1HJWA 4ACZA 4IMCA 1E6QM 4A8LA 3GU9A 4IIEA 3GYEA 2C1IA 3GHTA 4ML4A 1YPXA 4PR4A 2YOCA 2PWDA 2CWNA 1LL4A 4LUYA 1SM9A 1BHGA 3NVTA 3T05A 3JU2A 1WB0A 3MZNA 1FWHC 2ZZ1A 1PV8A 1RH9A 2V6AA 3QEZA 1XC4A 3T4CA 3W37A 3GFZA 4ORMA 1TPB1 1ZZMA 3L4ZA 5A2BA 2BNJA 4TX6A 3U9IA 1XM3A 1NTHA 3EA2A 4PULA 3NL2A 3E96A 2GPTA 3S9ZA 1DOSA 2PWVA 3UGVA 1WAWA 1H09A 2PGWA 3CZLA 4HB7A 3VNDA 3QY6A 1AG1O 1BPLB 1CLXA 4RZ5A 1VFOA 2G96A 2XYLA 5AZ1A 2ZWYA 3PN8A 4HU0A 4XD3A 3T0BA 1W8GA 3QRHA 2GVLA 2YLLA 3W70A 2AQWA 2REQA 2HZGA 2KAUC 3IVSA 1JDDA 3TCSA 3TU9A 3QHMA 1IQ8A 3L4YA 3CZJA 5DT7A 4FXJA 4I5XA 1V7AA 1HJQA 4UZUA 1MFUA 1QHOA 4S1FA 3CYJA 1KFCA 4GY0A 3K1GA 1F8MA 3EEZA 2CYGA 3ITVA 3N29A 2VUYA 3HV8A 3GDLA 3R43A 1YXYA 1U83A 5AB3A 3BSHA 4FNTA 1KB3A 3W7KA 2X7WA 3LCFA 2V5LA 3T1GA 2QW5A 3LN3A 4RE2A 2GVYA 5JH2A 2E67A 5TNVA 2A7PA 4IPIA 3KVKA 4UR9A 5A3HA 4AIUA 2RDWA 4NZ1A 4RV8A 1YHTA 5D2YA 3VIFA 1GCYA 2WSKA 1IGWA 3UWUA 3IAPA 4YTRA 1SO4A 1FH7A 1G1YA 2Y8VA 3EMCA 5I7GA 4GUGA 3ZLGA 1B4EA 4CNUA 3LV6A 2I1OA 3UR7A 2OLAA 1U1UA 5I09A 4A8NA 4S3CA 3P62A 2YW4A 2YX0A 1XYAA 4GKLA 1S3TC 1PHQA 4J2PA 1DTUA 2PDCA 3W26A 2I7GA 3UGRA 3Q45A 3H6OA 4QCFA 1E5NA 1FHLA 4O19A 4JTEA 3T0AA 1H0GA 5I77A 2D69A 3WNPA 3SCNA 4H9MA 4C7FA 2HPMA 1H7RA 4JX4A 2PGEA 2XVKA 1L6FA 3ITOA 1VFSA 2EHHA 4JKMA 2VRJA 1K02A 3LHYA 2WHJA 3UJRA 3CS2A 4H6RA 5E0CA 5GJNA 1UJQA 1X38A 2C1HA 1GZGA 3VOFA 4YYCA 3R1ZA 1PZ3A 1R3VA 3GC5A 4N6EA 2PDGA 4MFEA 3R12A 2E9MA 5C55A 5CC5A 1V0KA 1XUZA 2AL2A 3TA9A 1V6VA 5CSYA 3IJ8A 4Q8WA 1ONWA 4PEKA 3CH9A 1NM9A 1XIFA 2Z1SA 2BOGX 3FHQA 3GVWA 1XG4A 2PWHA 4OIFA 5F2IA 3IRSA 3ZJ7A 1SZEA 2YCEA 2YB4A 3E2SA 3AHZA 4GYPA 4AHPA 3GXFA 3QZAA 2QJIA 3MV01 1U5HA 2ZVIA 5BXTA 5LIUX 4CU7A 4K39A 2JGQA 5CPMA 3UQNA 2OYLA 3QR1A 2OZTA 4ATDA 1B3XA 3W7IA 5I3DA 3NURA 2NQ5A 1V93A 1TZ9A 3RPDA 4UOJA 2IQ0A 1WXJA 3IVTA 1J10A 3HV9A 4QJ4B 1EZWA 1RK6A 4INFA 2F9RA 5F2MA 1VAHA 3LU2A 2NXHA 2ISWA 4R34A 1R46A 4LEQA 4J5NA 2VHLA 4N9CA 2B7PA 1YYAA 3RLGA 4WGHA 4BWLC 4B9YA 3V0SA 1U30A 4AYGA 2C15A 1BKHA 2OU4A 3UF9A 4LVAA 1LLWA 3Q58A 4GINA 4J27A 1WZMA 1WAUA 3HU7A 2TSYA 1WNOA 2A85A 4DF2A 2HMCA 1K7EA 4AY1A 2P8CA 4JFUA 2Y24A 1RD5A 4CN4A 1HT6A 1UMLA 1FH8A 4CQ8A 3LPFA 2FZDA 1QCWA 3VKDA 2PWFA 3G3MA 2FPVA 4IIGA 1WDWA 1QMLA 3GR4A 3VNMA 2VCAA 1BWVA 4W4QA 3NVDA 1W56A 4JTTA 1R0MA 1R9XA 3W84A 2EKGA 4Z2IA 4KRUA 2V2CA 3IUHA 3IVUA 3EX1A 5HNUA 4MG4A 4FX6M 1EEPA 2YL8A 2D73A 4XV0A 2YL6A 4K38A 2JQXA 3TOPA 3D46A 3NSNA 1UOKA 2CBUA 4OOZA 1JFXA 3PFRA 2EPNA 3CL7A 3FIGA 4M0XA 3QN3A 3TYCA 3GK0A 4PUDA 5A69A 3EDKA 1W5MA 1E0UA 3VYLA 1HGYA 1JPDX 1JZ2A 3AXXA 1B9BA 4S3BA 3RXZA 1OGSA 4HMDA 3WLQA 4XWUA 3WFAA 5CAKA 3SW6A 3I7QA 3WDHA 2W66A 3AC0A 3LI1A 3S2NA 3GRIA 2GVEA 3G0UA 1H1ZA 4YN5A 2GJPA 3W7JA 4Q8MA 5FEZA 1UA3A 2J9ZA 1KCLA 1CNVA 3L65A 3P61A 3K1DA 1XINA 4WJXA 4UTIA 2GDVA 3MI2A 3TN3A 1JGIA 3TN6A 2GJNA 2VDGA 5BROA 1BYDA 4ZXOA 2EAWA 1XXXA 3VOHA 2BFGA 3V1HA 3CL8A 5G1MA 5KZDA 1W3HA 5DMYA 2PURA 3NUKA 3CZKA 5FI8A 4OZOA 4A3UA 4X0NA 3N2BA 3B0VC 1VJZA 5AN7A 4YPJA 3C61A 4QITA 1TRDA 3H2NA 1RBAA 5D33A 1P4CA 4FOUA 3TSBA 4AFYA 1GG1A 1EGVA 3W25A 2ZTKA 1DJHA 4JQAA 2HEJA 4HPGA 1XIHA 4QLLA 4PCNA 3RR4A 3QR3A 1QUMA 1X98A 1BQCA 4FNPA 5CBBA 4PTMA 2RGLA 5DF0A 2QCDA 3LRKA 3LS9A 4U5IA 1EJRC 4REQA 5BWFA 1CT5A 2YXGA 4UQEA 1UKQA 2CLKA 3WQVA 3O15A 3M44A 2J8FA 2E9LA 1TV5A 3KCOA 1TREA 1YLVA 3OP2A 3DH7A 5I03A 3UXAA 5I02A 4C6KA 2HISA 4LGXA 2I16A 1WO2A 4Q8TA 1QI2A 4ZO7A 3DXIA 4F0KA 2C0AA 1ZBKA 2O7QA 4PMRA 5D9NA 1PE1A 1EX5A 3UJSA 1FWSA 2ATSA 1MWOA 1Z69A 5ABGA 2FMNA 1ZS2A 1EBGA 3AUOA 2DY3A 5AFDA 1TCMA 3AFBA 4HNUA 4B4HA 3I6RA 3WLTA 3TN4A 1S38A 2FGBA 3P80A 4RNFA 3I4EA 1ZAJA 4NZFA 1OEPA 1TZZA 3MSDA 4LXFA 3CPRA 2WNWA 3KLLA 5D30A 1B90A 5C9XA 4OV4A 3F4VA 5AYXA 4DZIA 3KHJA 4H19A 3AWOA 3SCVA 3QFEA 4H8UA 2BOFX 3PUOA 3WQFA 3WK0A 2PDUA 3MANA 2OOGA 3MKVA 1GJPA 3VMNA 3DI0A 1LWIA 3F7JA 2E5BA 2PDMA 4PL2A 3O6AA 3ITYA 1RA5A 2J13A 2VFDA 4IT1A 4PUWA 3TAKA 3RIKA 4UNKA 4HOXA 4LAOA 1KV8A 4F48A 5C8BB 4HYWA 3AS1A 4JFVA 1W3JA 3P5YA 2I5QA 5JBEA 3LK6A 2FVKA 2Y7DA 1X6LA 4FIRA 4URIA 1A5BA 2ACSA 3V5OA 1H3GA 1QK2A 4NJJA 1F61A 2PDJA 3TJ4A 3BLLA 4DAIA 3N9RA 1K6WA 2GSHA 4AEEA 1XBYA 1IWPA 2NV1A 1Q6OA 5KSWA 1DJQA 3HOJA 2ZXAA 3QH2A 1XBXA 2PFHA 4QEEA 3VDCA 1YDNA 2CWXA 2WSQA 2EO7A 2EPMX 3OA5A 2P50A 3V0TA 4DJEC 4HSNA 2PS2A 4Q4SA 1A5SA 3NL6A 4DYEA 3KRBA 1EJXC 4P7LA 4Y6GA 2G4JA 4G7FA 3VM5A 1SFSA 3UFYA 1EC7A 3BXWA 1I1WA 5FF4A 3TP4A 5TQLA 4ERGA 4EXAA 2YBTA 4N9EA 4RW3A 1ZL1A 1C93A 2Y6ZA 2A3AA 3CHFA 3GB6A 4ZFCA 3G1VA 1QVBA 4HNTA 2C79A 3UNDA 4JIPA 1PTGA 2XIIA 1K4HA 4LALA 4FR1A 4MWAD 4U5KA 4DF0A 1KM3A 4E2OA 1MXSA 4PTWA 1V3KA 1IF2A 3C52A 5T91A 4OFCA 1XUUA 2Y8UA 2GJXA 1IR1A 1SO3A 1B31A 1XLBA 4Z08A 3S5SA 3N14A 2QV4A 2R1NA 5T26A 3SQLA 4UMAA 1TV7A 4E5TA 3UVAA 3VE7A 1S1PA 3RMJA 1LUCB 3HM7A 4S2BA 3MSGA 4ZTYA 3ITTA 1VP5A 3DYPA 2GUUA 1GVQA 3VIJA 3KOWA 1ZCOA 2E77A 4IPNB 3HPXA 2NQHA 1EEXA 3H2CA 1V02A 3PWGA 4EANA 3KLKA 3MYOA 4JYEA 4M29A 5BXRA 1CDGA 2ZE3A 1Q7QA 1QPQA 4HU3A 4FALA 1UWIA 3S3GA 4WEVX 3C2VA 1G4PA 1S2VA 3DCPA 1P1XA 1W1B1 1ZUAX 1KWKA 3CEUA 2X1IA 4CQDA 3M41A 1JQXA 1VYSX 1L2QA 1M65A 5IDZA 4ZE4A 4MKVA 1K4GA 2PCEA 2C6QA 4JQ4A 9RUBA 3S1VA 3UZWA 1LP6A 4I7VA 5MF5A 3BMWA 3E3HA 4J3SA 1IYXA 3LCHA 4XIAA 4GJIA 3UG5A 1EYEA 5DBUA 3ATZA 4CGTA 3NTYA 3MHUA 5HNRA 2XVNA 1E0TA 4E6MA 3TNBA 1LOQA 2DZUA 3BE7A 3HGOA 4PRTA 3B0PA 3V5FA 2PTDA 4MAVA 4QQUA 2DVXA 3FA3A 1XH0A 2G37A 1US0A 2PLJA 4GD0A 3C0SA 1OCBA 3LGDA 3M7WA 1VYPX 4PRWA 5G1TA 4G1NA 1ISYA 4S2CA 1ME9A 3POCA 3M6YA 1VCFA 4IUOA 1B5TA 2CITA 1UIPA 3FOKA 1MQQA 1C7SA 2OODA 4ECLA 3NL5A 5CC7A 1SYTA 3MW7A 4O8AA 4DJDA 3MYPA 4XZ9A 1ZAHA 4IJBA 2O4QA 4L6HA 5A8OA 4AYSA 3FDKA 3LGEA 3H21A 3FJ4A 2GVJA 1EP1A 1L6WA 2UY3A 1OIMA 1NOUA 4J3ZA 4LT9A 3ZT7A 3F2DA 3G1RA 2QMJA 3YPIA 1MZRA 3QHOA 4GUJA 1DP0A 3W2LA 3AS0A 2WJEA 1O95A 4CU6A 4PBFA 3ONBA 1EJWC 1TPWA 3FJNA 3GAKA 1UUMA 4DXVA 1VLIA 3ZVHB 1Q6CA 3CMGA 1KBLA 2ZX9A 2J27A 3UNTA 3E0IA 1E6NA 1EWEA 1YNPA 4EK7A 3A13A 4W5ZA 1GUVA 2NT0A 4AZ6A 3ABSA 4QLKA 4L9YA 1E51A 3QPEA 4AD1A 2XZ9A 4WXZA 1C9WA 4K7YA 3I10A 4ERAA 1PCKA 4YMZA 3UY8A 2Q02A 1K9FA 2G50A 3REQB 2FH8A 3WQ4A 4H8HA 4GZJA 4JQ3A 3VGGA 1KXQA 3K4AA 1KM2A 4AD5A 4JBRA 4Z1BA 1FXPA 7CGTA 3GTXA 3SSJA 2O55A 1UWTA 2HDJA 2A3HA 4HCDA 3WDJA 4KS0A 2HROA 5HUPA 4QP0A 1QBBA 2X2GA 1ITUA 5EYWA 3CUIA 4GX9A 4LNCA 3OO2A 3BJTA 4HKPA 4MJMA 2NW0A 3WUFA 2C7FA 3RRXA 3TSDA 4Q8NA 2CZFA 1JD9A 4DI9A 1VZWA 1S5NA 5GNZA 3MDWA 1VKFA 1GK8A 5I3FA 2GVGA 4W88A 1KC7A 3TLLA 4K7VA 3EX6A 1QNVA 1G4EA 3PNUA 3F4NA 1PXGA 6XIMA 2I57A 4NUWA 5AHMA 2QAPA 3BZGA 3DHPA 1RY0A 1HL9A 1MQPA 3OA3A 2GQAA 3WQDA 1VBUA 2VKZG 3M16A 5BOEA 3E6EA 4V28A 3OLIA 3GG7A 3N6HA 2ZRUA 3FJLA 4YNGA 1LM1A 2WZHA 1BSLA 4MYAA 2XVPA 3ZJKA 3PM6A 3WMLA 1JYXA 3VVGA 3RN6A 5EMUA 1UQZA 1UR8A 1XV8A 3M5XA 4DZAA 1REQA 1TQJA 1DYSA 4NX5A 5DMMA 3CLWA 1BF2A 2VFHA 2J88A 3B97A 1QT1A 1KBBA 4QGCA 2QAFA 2INZA 3G6MA 3VD4A 1IWAA 3QR0A 5FCZA 1TE1A 3EA1A 4HU4A 3TYEA 1BVWA 5K4XA 2WMHA 3F4CA 2VGFA 1JPKA 3CJPA 4LF2A 4MOZA 3ZLHA 1WDQA 2YBVA 1PZ2A 4CCEA 3BCDA 3UD6A 3UP8A 2CERA 4QS6A 5TD4A 2YDSA 5KTLA 3PPGA 4LUSB 2PP0A 3B8TA 1W37A 4QFUA 1SJDA 2PDPA 1MNZA 2VR4A 3R8RA 4GC4A 4X61A 3KOXA 2ZBTA 4IJRA 4Y90A 3VZYA 2OQLA 1UD2A 3D0CA 4LSBA 2FJKA 4MZ1A 3Q65A 3R79A 1KFEA 4I9JA 4LFYA 2BDQA 3SRFA 2VQTA 1KV5A 3W00A 3MZ2A 1V3JA 1Q6EA 2FZBA 1SW7A 1J93A 5L9FA 4Z2LA 4GI6A 3N2XA 2H9AA 2BHZA 4BQ2A 1LDCA 3TQVA 1P0BA 4JNMA 2DEPA 1EGMA 2IPJA 2FZ9A 4NJKA 4JTLA 4WDWA 2A5HA 4IIFA 3EKGA 3L23A 2QEZA 3ARPA 1O1HA 2QR6A 5G4EA 7A3HA 1YIXA 2JIWA 3Q94A 3QHNA 3GZAA 2GLKA 4WUIA 3KX6A 2IXVA 4NP7A 4MPKA 3OGSA 3W1MA 2ZUUA 3KS6A 3WEZA 4LAKA 3MP4A 3WN6A 1V3IA 3R0KA 2OT0A 1JYNA 4NAEA 3ITGA 4V1XA 1TPUA 4NI8A 1QW7A 4O0ZA 8TIMA 4HA3A 1QPOA 3WELA 4GK8A 2VX7A 3W1XA 4MUPA 3M0JA 3UG8A 1BVZA 1VFMA 3A5FA 4NNAA 3GXMA 4NG3A 4C1KA 3MI3A 2WQPA 3AALA 4NZJA 1V3LA 3EWDA 2ISVA 1DVJA 1PX8A 2NVDA 3MI6A 2X16A 1TSIA 1K03A 1DWJM 2Y89A 2OYMA 3OB8A 3G3DA 1JXJA 1XD1A 4GQBA 2ABBA 3NOYA 4CKQA 5EGRA 3CIXA 4RJEA 1BGAA 3OLDA 1Z3NA 4AD0A 3NQFA 2Z1VA 4DWSB 1AH4A 1R86A 5CZSA 3MV11 2DZVA 1XWYA 2B7QA 1A5CA 4PA8A 1J96A 3PHAA 4UFLA 2P53A 2XIJA 4D2JA 3GXPA 4C1NA 5J5DA 3WQOA 1R7AA 2VEGA 2Q8XA 2CBIA 3B9NA 3B05A 1YXDA 1HKWA 3KWXA 4CVUA 1PO9A 2XFRA 4PCPA 1E15A 3SM0A 2ZUNA 1OSEA 1J2WA 2QF8A 4PFMA 1EF3A 3EDEA 4ZB0A 2WC3A 2AL2B 3KRUA 3VNLA 1POKA 3VK5A 4R33A 4FF7A 1R30A 3REQA 2PDNA 2RH9A 4D6CA 5KEZA 1WKDA 4O0KA 6XIAA 3WK2A 1W9PA 5D02A 2V5DA 3NZ1A 3T40A 2GUYA 4UNLA 3AMGA 2P1FA 5HR6A 3S1WA 1F6PA 3ZSTA 3GNOA 1B30A 4AG0A 2YKKA 1VFTA 4DBWA 3N4FA 4GQQA 2NQZA 1EJSC 3S9IA 1GTHA 5D32A 5D2TA 5JUVA 5E0KA 3M9YA 4C60A 4O50A 2WLYA 2OWCA 5HANA 2Y5SA 4RPPA 4D6HA 5C2GA 2FGZA 1TR1A 3OVRA 3VKCA 3BAXA 3MUY1 3EMQA 2ACQA 3G77A 4TO8A 3F1QA 3EOSA 4LTSA 4BA0A 5M1TA 3SQSA 4BF9A 4EPBC 5BZAA 4GY1A 5A6TC 1OYBA 2G3MA 3HGJA 4OBTA 1GORA 3L2IA 3LMZA 1BSIA 1L8NA 1JZ4A 2WK2A 1MRAA 2Z6IA 3E9AA 1VFUA 1X1OA 1OM0A 4Y9MA 4C6QA 5FJJA 3URQA 4LANA 2ZXDA 1HVQA 3RPMA 4M1BA 1MFVA 2F2HA 4JZ5A 3RM8A 1VQTA 3MVTA 3B8DA 3MUZ1 2F61A 2HJPA 3ZM8A 4NZCA 2OKTA 4QJ1A 4DBSA 4B3ZA 3PWAA 2C8NA 4XZLX 5D8WA 5HJYA 3GKFA 1LF1A 3RX3A 2YDAA 3TROA 3QLDA 4ALDA 4R7JA 3N6JA 3B9AA 4QDWA 1TVPA 4H2CA 4OGZA 4B4FA 4IOTA 4M8UA 3KTXA 2YGYA 3A3XA 4Q4QA 1ISWA 5LGXA 4GVIA 3THAA 1K7FA 4IQDA 2QGYA 2HNHA 3RGTA 2CBJA 2CPUA 4IG2B 2DSWA 3C4UA 4D71A 2BVYA 1JUKA 4H3DA 1CW2A 4DELA 4A2SA 3CIWA 3HPFA 4QSHA 3CWOX 2ZYFA 1CZ1A 5TBOA 3S46A 4TMCA 3R8GA 2QPUA 4JTUA 3KCJA 2V67A 1OX5A 4A8RA 1P7TA 2Z2BA 1GOXA 4J40A 1W17A 4GOAA 3IGXA 3GXTA 1G67A