4ZENA

Structure of gan1d, a putative 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
474
structure length
474
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 192
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zenA00
1HL8A 1QNQA 1UKQA 3K1DA 2BVDA 1BSIA 1BFNA 2VVNA 9CGTA 2F8QA 3CZGA 3HU7A 3DYOA 1JYXA 1V3KA 2J78A 4P7OA 4WSJA 3MMUA 3MS8A 1JZ8A 1IV8A 4OJYA 3WMSA 3AMGA 1FP9A 4UQAA 2YDSA 2GK1B 4JZ5A 1H49A 1UKPA 2YIHA 3CBWA 4CUCA 4AD4A 4ACZA 4QAWA 4MNJA 2J74A 3W28A 2DT3A 1C92A 1O6IA 3ZJ6A 3N18A 2AAAA 1H5VA 1H41A 3WMBA 4XZBA 1YHTA 4UZSA 1JGIA 2BV9A 4RE2A 3MV01 3ALGA 4PBGA 3CTTA 2D23A 3OBAA 5FOOA 2QF8A 1JIBA 1AQHA 4MADA 3RM8A 5CXPA 4D6JA 3A4AA 1EQPA 4PUDA 2WCSA 3OA5A 1PZ3A 2EQDA 2C8NA 1GPFA 2G3MA 3MU7A 1HJVA 5E0CA 3AHYA 4H8HA 1E9LA 3WDIA 3AISA 3WF1A 5ABFB 1HJUA 3TONA 1XYZA 4UFLA 1VFFA 1K9FA 3N15A 5I79A 1MXDA 4GZJA 2E3ZA 2OSYA 2FGLA 3K4DA 1GQIA 1W9PA 3HJEA 3AOFA 1GONA 1V03A 4ML4A 1OSEA 4ZENA 1GHRA 2Z1KA 1QW8A 1NWSA 3AIQA 5IHRA 3VMNA 3WH9A 1UYQA 3VILA 4CGTA 3VGBA 5F7UA 1UD8A 3AFBA 3ARYA 1CLVA 3VKKA 4QCFA 5E09A 2WC3A 1FFQA 3S6TA 3WDQA 1VEOA 3QR3A 4PTWA 2J7DA 3WUFA 1JZ7A 1B3XA 3OLIA 4D6EA 3ZIZA 3MUAA 3UG5A 1V6YA 4MDPA 1UG6A 1CXHA 3SCUA 3PN8A 4AIOA 3VD9A 4OOUA 4BA0A 3AMKA 4W88A 1XHGA 5E6YA 3N1AA 3SCWA 4EKJA 5E9AA 1LL4A 1W3KA 2BNJA 4WSKA 5HDRA 3VDHA 4R5EA 2VX5A 3SUWA 3K8MA 3ZSSA 2W4XA 1J0JA 2Z1SA 1H2JA 4XV0A 5CLWA 2XUCA 4BQ4A 4LQ1A 5A8NA 2CNCA 4Z2IA 1E0WA 1QW9A 2DSWA 4MDOA 1ISXA 2DDXA 3I3BA 3MKKA 2D3NA 1W9XA 1BVNP 1A3HA 4EE9A 3SURA 1HIZA 2EPMX 2NW0A 2ZXQA 2V38A 4NZCA 4AZ7A 4D1JA 1W91A 5BXPA 1UH3A 3WSUA 1JNEA 1R85A 2YBTA 3GZAA 4UQBA 2EBNA 1VRXA 3F5LA 1UA3A 1V0LA 4W5ZA 3UEQA 3VIMA 3MMWA 1RP9A 1FH8A 4UQCA 3WENA 3SUSA 4AWEA 1TZ7A 1GOWA 1CGVA 3JUGA 1E4LA 3M7SA 3ZJKA 3EDKA 2EPOA 3L4TA 2X8RA 1ZBWA 1I1XA 1F4AA 3O6AA 4DUVA 2CEQA 2DIEA 3SCOA 1XH1A 4H7VA 3RCNA 1WPCA 3MSGA 1FP8A 1B30A 5BRQA 2VR4A 5FL0A 4D72A 1BF2A 1QNOA 5A2AA 1GUVA 5LA2A 1E56A 1JYNA 3FNDA 3GDBA 1DWAM 1ZB5A 2CIPA 3T2PA 5JBEA 1RD6A 3ZT7A 4J3XA 3TTSA 2OYLA 3WY1A 1CWYA 2QMKA 2J7FA 1Q4NX 3TTQA 2V3FA 1H3GA 5JBFA 1M53A 5E6ZA 3SCTA 3B9DA 2HVMA 4RE3A 5DFAA 5CSYA 1Y7VA 1E40A 5BXRA 3VDAA 3WF0A 3VX1A 3OB8A 1UWTA 1PEZA 2WMFA 4GQRA 1VF8A 2OLHA 4MB1A 3J7HA 1OT1A 4PMYA 2QPSA 3AIEA 4YHEA 2YL9A 4GI8A 4JL2A 3WNKA 2G4FA 2NT1A 3MO4A 1GOKA 2DSUA 2Y5EA 1ZJAA 2CXGA 2BXZA 3TTYA 5IFTA 4YPJA 1Q6GA 3GM8A 4AZCB 1RPKA 2GDUA 2VCCA 3N12A 3WL0A 1UHVA 4C7DA 1J10A 4AIUA 3TTOA 1IZKA 3KZSA 1GCYA 3BMVA 1R7OA 3VGDA 4AZGA 1E1FA 1M7XA 1V6VA 3VD5A 5BYWA 4R27A 2WZIA 5D9MA 2FH8A 4GI9A 3KEHA 2W92A 3VIFA 1MFUA 3A47A 1JG9A 1RH9A 1KXVA 4PCTA 1QNRA 2JE8A 1ISWA 4S3KA 4Z2JA 5A94A 5A8MA 2Q8XA 1QVBA 1UZ1A 1CYGA 4U3CA 3AMCA 2WLYA 2O9OA 1PIGA 3K8LA 4TOQA 2VJXA 3ZR5A 1QBBA 4W86A 5LA1A 2VZOA 2JF6A 1CGWA 3TA9A 3SCQA 3PZVA 3AXIA 3VMPA 1J18A 2XYLA 2XPKA 5ABFA 3D5HA 1KXQA 3L4ZA 5I2UA 1HP5A 3G6LA 1ECEA 1FA2A 3A3HA 1UD4A 1H11A 4LXFA 3NSNA 3DECA 4PCSA 3NDYA 1GQJA 1HL9A 3GH4A 4ZE4A 3T08A 3K46A 2E0PA 4V28A 3KL5A 4U3AA 2VRQA 3POHA 4PSPA 1E70M 1JXKA 3SCPA 4F8XA 3K8KA 2F2HA 3ARVA 2VO5A 5A8QA 1U2YA 2DH2A 2WVVB 1PX4A 5IXEA 4UFKA 1E6ZA 1UKOA 4F9JA 2QPUA 2XSBA 3WH6A 3ARSA 1LQ0A 2YL6A 2DH3A 1WZKA 2XJ7A 2YOCA 5CJ5A 5AYIA 1G94A 1TG7A 2X09A 2DSVA 1KBBA 2VT0A 3CMGA 5M03A 2RGMA 4HOZA 2ZXAA 4JFUA 3TP4A 1JZ5A 6TAAA 4S3JA 1M01A 4LYQA 1KFWA 1BAGA 4YHGA 5HBFA 3VO0A 3WFZA 1JI1A 4K68A 4PUEA 2DT2A 3WMCA 1NWUA 1CLXA 4CD5A 1C91A 4WK9A 4B15A 3OGSA 4GIAA 3NJ3A 4QFUA 2XFRA 1NOUA 1VJSA 1V3MA 2FH6A 4D6DA 2XGBA 2G41A 3GXFA 2EO7A 2PBGA 2EXOA 1K9DA 2ZX5A 1V0NA 2D24A 1CXFA 4JCMA 3WDPP 3ZR6A 5IDIA 3B9EA 1G01A 3T0DA 1EDTA 1KB3A 4P7QA 1R87A 4GXPA 1JZ2A 1GORA 3WEZA 2D1ZA 3AZSA 2DPEA 5KEZA 2VCBA 4NF7A 5KZ6A 4DWSB 1OD8A 3IJ7A 1OCQA 2WMIA 3BSHA 3BXWA 1EOMA 2XIBA 2JF7A 3EYPA 4HA4A 4OUEA 3T09A 4HA1A 2JEQA 2YA1A 1C8XA 3BAXA 3CGTA 4BZYA 4JKLA 4MB3A 4PMQA 1NH6A 2YL5A 5GPRA 1VJZA 4H04A 3VIOA 4J27A 3OGVA 2JIWA 3A6OA 5CG0A 4B3KA 2Y2WA 1GJWA 4C7FA 1CENA 2CKRA 1K9TA 2J7EA 5JUVA 5C71A 1HJQA 1JDDA 1V08A 3PZNA 5D8ZA 2OSWA 1QI5A 1XH0A 2ZUTA 2XWDA 2DGAA 2BY1A 4AW7A 1B2YA 2GVYA 5M5DA 2MANA 2XG9A 4LPCA 2PBOA 4GI6A 4FMVA 4URIA 5CPTA 3VGHA 5ABHA 2A3AA 3UETA 2O9RA 1W9DM 2PWEA 2CBVA 4HZ7A 4PTMA 1I1WA 1JF6A 1GOIA 1EIBA 3IJ9A 5I6SA 1R7AA 1MVYA 1MQQA 4W5UA 1WZMA 4AXNA 3W37A 3GXIA 1EDGA 5M3WA 2J79A 4KH2A 1P6WA 2A3CA 2DSZA 3QOMA 1WAWA 2E8ZA 4FLQA 1E4IA 4AEFA 3SCNA 2PC8A 2WHKA 1DWHM 3FY1A 1CPUA 1QI4A 4MAVA 2J8GA 5BXSA 1H0IA 1Q6CA 1B1YA 1JAEA 1GZJA 3N9KA 1DWFM 3MUZ1 2BS9A 1CEOA 3BCFA 4GO8A 4D6IA 3FAWA 1OD0A 1I75A 1LWHA 4U5IA 1HT6A 4CN4A 2D20A 4Z2HA 3THDA 4ZXLA 2WB5A 4IISA 1E0VA 4LYPA 5AC4A 3W81A 2ZUWA 5EFFA 1CNVA 4AYSA 1W3HA 4CCEA 1QHOA 4OKDA 1LWJA 4J28A 3RM4A 2ZUUA 4TXEA 3AIRA 1B9ZA 3L2MA 3WUEA 3WD4A 4LYRA 1UD6A 1TE1A 3T0AA 4HZ8A 3SIMA 4CVWA 3PBGA 4MNLA 2J25A 1RP8A 2W63A 1TR1A 4P7RA 1BTCA 4OIFA 3VD3A 3U7BA 5CSUA 1U30A 8A3HA 2PWGA 4DM1A 3ARRA 5DF0A 5GNZA 5E70A 3GXDA 2XGIA 4CU7A 1HJXA 3CH9A 1QHPA 3ARXA 3RILA 3LMYA 1GOQA 1QI0A 3KE0A 1H0GA 1HNYA 3CO4A 1E73M 2CBIA 5EBAA 2VC9A 4GPNA 5D8WA 4AD2A 2WHMA 4PMUA 3NYDA 4D6FA 1AQ0A 2XVKA 2XM1A 2ZXBA 4HOXA 1XCWA 5EFDA 1XYFA 4E2OA 4P8WA 2WKGA 1H4PA 2YDQA 4AZBA 3GNOA 1V6XA 1FHLA 7A3HA 1US2A 5A6SA 4J3SA 4D71A 4LGXA 1SMDA 3WNPA 3VGFA 3UCQA 3BCDA 1XCXA 2E8YA 4MNMA 3AIWA 2DQXA 1BG9A 3B9AA 3PZGA 1E5NA 1G5AA 2D0FA 3IAQA 4A3HA 3AQUA 3PZTA 4JAWA 1UWSA 2QLYA 2ZX6A 5DT5A 5M17A 4QCEA 1W9VA 5HOSA 3CMJA 1KXHA 1OGGA 1E5JA 2UY3A 1UWRA 4UFJA 1OINA 3S2CA 1LL7A 1E6SM 3ARZA 3PTQA 3CZKA 1M04A 1VFOA 1JFHA 2HISA 2WBKA 3VVGA 5I23A 2BY0A 1D7FA 1WDSA 3BMWA 2GSJA 1QHZA 1MYRA 1Q6DA 4GZEA 1X6NA 1CTNA 2WWDA 3MMDA 3POCA 3FW6A 1NQ6A 2WK2A 2YA0A 3GH5A 2ZXDA 1NP0A 3WD0A 1E1EA 1CGYA 3OLDA 5I24A 2ZX8A 3L4WA 4PMXA 1CXKA 3EDJA 1B0IA 1SFSA 1PPIA 3WD1A 1MXGA 4UCFA 2E9LA 1GNXA 4EK7A 1E6PA 4HMEA 1EA9C 2BY2A 2DT0A 4WJXA 1TA3A 3WQ6A 1HKJA 2B31A 2VI0A 2J75A 1XH2A 3I3EA 3TOPA 2D0GA 2WZEA 1FH9A 1V0MA 3W0KA 1HVQA 4M82A 4XUYA 2W91A 2YDRA 1IT0A 3NUKA 3SCSA 1TVPA 2GJXB 4BQ2A 6CGTA 4OBSA 1MW0A 3GTNA 4J3VA 2YA2A 4QP0A 1CXEA 1DTUA 2J47A 1JYWA 1PIFA 4IM4A 3ZMRA 1EXPA 3VD4A 2YLLA 5CQ1A 3CZJA 4MJ2A 4JKKA 4W7WA 1EDQA 4HPHA 3BAKA 3F5JA 3MSDA 4W7VA 1B3WA 4H41A 3FXYA 1ISYA 2IUZA 1J0YA 5C8BB 1W1YA 3AIUA 3N17A 5ABGA 3WELA 2OSXA 2NSXA 5A2BA 1EH9A 4ATWA 3ECQA 5HPCA 1JDCA 1UR9A 3BAJA 1UD5A 4AY1A 1BYAA 3U5YA 3OGRA 5FCZA 4Z2GA 2WMGA 4N42A 2DT1A 5A1AA 1JZ4A 4AC1X 4PMRA 3CHEA 1JZ6A 4PTVA 2CKSA 2UY4A 3CUFA 4TVUA 2J62A 2J8FA 1B31A 2W5FA 2X05A 1CXLA 2CETA 3CHFA 2WSKA 1W1TA 4MB4A 3AICA 2G3IA 2J77A 3SUUA 2EPNA 1BYCA 4JL1A 1TCMA 3NSXA 1GW1A 3WQ4A 4DWSD 1HP4A 2VTFA 1BYDA 2QMJA 2ZWYA 5HNNA 1E55A 4ACZB 5I77A 1KWGA 1E4MM 1TMQA 2PWDA 4AISA 3DHPA 1X6LA 1KQYA 1WDPA 3SEPA 1Q6FA 1E6NA 2GDVA 4NRSA 1H09A 2RGLA 4AZIA 4H8UA 3VINA 1V3JA 4CD6A 3CIVA 2A3EA 1C7SA 1FFRA 1QOXA 1ITXA 1GQLA 2X1IA 3AJ7A 3ZT6A 1MW3A 2FHBA 1LG2A 3RIKA 4WLCA 1SR0A 4PTXA 4JFTA 3QHMA 3B8SA 2WXDM 3WD3A 1X1NA 1UQZA 5TD4A 3WH7A 2WMHA 1L8NA 4HP5A 4UFIA 5FD0A 4E8DA 1E43A 2WVSA 1UWUA 3KL3A 4IUGA 1XC6A 2XFFA 2WZHA 4UR9A 4AD5A 3RDKA 5A6MA 4JFVA 3L2LA 4OZOA 2GJXA 1SMAA 1HJSA 1HJWA 4W85A 4UQEA 1TUXA 1HN1A 4FF5A 3EMZA 2D2OA 2G8ZA 2WBGA 3NIYA 3SCRA 5A95A 5A8PA 2YLAA 2IXVA 2FGZA 1WCGA 2WMKA 1NWTA 1Z32X 5BCAA 1DWIM 4P7NA 3WUGA 4JHZA 3GNPA 2E4TA 4HMCA 3UR8A 5GNYA 4GZIA 3L4YA 1TA3B 2ZUMA 1KCKA 4Q22A 4WF7A 1LF1A 3AS1A 2BY3A 5JIWA 1B3YA 1KGWA 1W2VA 4EAMA 1M03A 4NI3A 1EGZA 1VIWA 3WIJA 4XZWA 5I0DA 1WNOA 1W32A 5FKYA 3RJXA 1OBAA 4OOZA 1ODZA 3AXXA 2UY2A 5FIPA 3AHXA 4BF7A 3IJ8A 5EMYA 3W29A 3AMDA 3WDRA 3GH7A 5A3HA 1UH4A 1G1YA 2A3HA 1IZJA 4WIWA 3N11A 2WC4A 1KGUA 1OIFA 3NDZA 3U7VA 4TVCA 4BQ5A 3LPOA 3F5KA 1V3IA 5I3DA 3KWXA 3SCVA 4GO9A 1R8LA 3QHNA 3AHVA 5D9NA 2V3GA 3KL0A 2ZUVA 5D9OA 1W3LA 4W84A 3BLPX 4XB3A 2VQTA 4IPNB 2EEXA 1UWIA 1XD0A 1KWKA 3AXHA 1J0HA 2WVTA 4HPGA 1QPKA 3PZOA 4PMDA 3ZSTA 5HPOA 5A2CA 2WKLA 2JALA 4PEEA 3L4XA 1BGAA 3CUIA 4MNKA 1WZLA 2JFEX 8CGTA 3T2OA 2BHUA 1HF6A 5LA0A 2WYSA 1G9HA 4TTUA 2WPGA 3L4UA 3EDEA 1Q6EA 2OYMA 4M81A 5A6BA 3U57A 4CD8A 4AZHA 4J3UA 4JKMA 2GFTA 1E6XM 2BHZA 2EPKX 7CGTA 1J0KA 5DT7A 2V3EA 4PRWA 4M56A 3AHZA 4A3YA 3AYRA 2J7GA 3BSGA 4GINA 4A4AA 1KBKA 4FLRA 2W61A 4ACYA 2WNWA 4CD4A 1TVNA 3WNMA 3AIBA 1JL8A 1C90A 4W7UA 4L4PA 2G3JA 1W1PA 2WMJA 4HU8A 3VGEA 1VFUA 4KRTA 2VOTA 1NOFA 2CESA 3VMOA 2WCGA 4BS0A 3VDCA 4PMZA 2VR5A 4DM2A 1MW2A 1BPLB 5ABEA 5DMYA 3CZ8A 3EBVA 4UQ9A 3SUTA 2V5DA 4U33A 1MQRA 3ZJ8A 2VZSA 1C3FA 1JZ3A 3AS3A 2V5CA 3VNYA 2XVPA 2ZE0A 3IK2A 4L4OA 1EHAA 1HKKA 4AD0A 4TUFA 2YKKA 1HXJA 3WDHA 2CHNA 3G6MA 4UZUA 3W6LA 5JBDA 4GKLA 1VFMA 2VX7A 1GJUA 4DUXA 3VX0A 4CU8A 1NOWA 1TFVA 2PB1A 4ZE5A 2G3NA 3T2QA 4FK9A 4DUWA 4HZ6A 3LPPA 3VIGA 5BROA 1JF5A 2W66A 3AMLA 3WQ8A 1S46A 3WF3A 2O9PA 4Z2LA 1R86A 3WEMA 3WKZA 4E4PA 1J0IA 1JXJA 1B90A 2VX4A 3PZ9A 1CBGA 3PZQA 1ZU8A 1MFVA 1UA7A 1XV8A 3W24A 2UY5A 1GQKA 3VD7A 1UR4A 2VZUA 1WE5A 3WN6A 3CLWA 4AD1A 1FHDA 1WDRA 3QOKA 4MJ4A 2O9TA 3WQWA 3MV11 4M8UA 4HOWA 1CDGA 3WH5A 5GNXA 1D3CA 1JFXA 3W82A 3AS2A 3VM7A 1LLOA 2WWCA 2ZIDA 4CD7A 1DWGM 1JNDA 1D2KA 4AZCA 3CHDA 1CGUA 3W27A 4PN2A 2VMFA 5LYRA 2A3BA 2D3LA 1V0KA 1CECA 1US3A 1PAMA 1V3HA 3PTMA 2UWFA 2Y4SA 1E0XA 3GBEA 1JD9A 2X0YA 1E6RA 2WCAA 4IPLA 3CZEA 1VEPA 2D0HA 1J11A 2YL8A 1HKIA 2DEPA 2ZWZA 5A6LA 2E40A 3FAXA 3AI0A 2W67A 4CVUA 5I5RA 4HA3A 4ZEPA 2AMGA 1KR1A 1UQYA 1WDQA 1E4NA 2V3DA 4LX4A 2VRJA 2XVLA 3WH8A 4MAZA 1J0ZA 5BWFA 3AHTA 1MWOA 4ZXOA 3WF2A 2E9BA 4J7RA 3BAYA 1FH7A 4AIEA 3MUIA 4NSBA 2CPUA 4X0VA 4BQ3A 4PMOA 3DYMA 4N0RA 3CHCA 4CKQA 4TX6A 1ZBVA 3CUJA 4MPKA 2WLZA 3WNNA 2CHOA 5FL1A 1OWQA 1XGZA 2Y8VA 3W26A 1L0PA 3L4VA 3N13A 2VCAA 1W2PA 2QHAA 1HVXA 4UTFA 5C70A 1OB0A 1BG4A 2EPLX 4H8VA 1BVZA 2OWXA 4PMVA 1OM0A 1NP2A 1WO2A 2EJ1A 1VENA 3LPGA 3N04A 4QDMA 2GUYA 5E0FA 1F4HA 1B3VA 2BHYA 3WD2A 1XSKA 4WKFA 5A8OA 1V6UA 1J12A 2CITA 1E3ZA 4X9YA 4RE4A 3WUBA 1VB9A 2WM0A 1WB0A 4M1RA 2ZOXA 3RO8A 1ZBCA 3VPLA 2NT0A 2FHFA 1BGGA 4PMNA 2GJPA 3WNOA 2J4GA 1EO7A 1EQCA 1ITCA 3O9NA 4QLLA 4DWSC 3HMCA 3VUPA 1GOOA 3PHAA 4OBRA 5JIPA 1UUQA 3CPUA 4J3WA 1LL6A 2ZICA 1HX0A 1UD2A 4CU6A 1ZBKA 3WQVA 1CXIA 2WMIB 4HTYA 4Q7NA 5A69A 5DO8A 3OG2A 2DIJA 2PWHA 1XRVA 3UERA 4KMQA 1PBGA 2VX6A 2XVGA 4JFSA 1CGTA 1E6QM 3EDDA 1SYTA 1VBUA 3CUHA 4GQQA 4PYSA 3BAWA 4B3LA 5BXTA 3FN9A 4FLSA 2XSAA 4UFMA 1CGXA 5CZKA 1UWQA 3F4VA 4P7LA 2ZUSA 2PF0A 2PI6A 4M29A 4NRRA 2BFGA 3EDFA 1PX3A 3OLEA 1PJ9A 3UG3A 4JCLA 1CZ1A 1QBAA 3IAPA 1WP6A 4KGJA 1UH2A 1FOBA 2Y8KA 4RL3A 4UQDA 1ISZA 4XX6A 2XWEA 1E71M 2VVSA 1BHGA 4QLKA 2XIIA 3NCOA 3D3AA 3WQ5A 1DWJM 2J7BA 3RJYA 4UOQA 2J7CA 1LJYA 3AIVA 1NARA 2BVYA 4UOJA 5BRPA 3GBDA 2WW5A 1BYBA 1V6WA 1J9YA 1W1VA 1GHSA 1N82A 3HN3A 3W4RA 1UKSA 1UR8A 3WFLA 2YBUA 5CGMA 3APGA 3AROA 3WL1A 1VAHA 3BGAA 3WDJA 4MTVA 1VBRA 2IXUA 3ZQ9A 1V02A 3OZPA 5CGTA 3BH4A 2VZVA 1OT2A 7TAAA 1E72M 2XTKA 2E9MA 4CN6A 1W9BM 4JIEA 5D4YA 4UFHA 5AC5A 1UZ4A 1ISVA 2AOSA 1GOMA 2X2YA 3VM5A 3WBAA 1BLIA 4YN5A 2WAGA 3WBEA 1EO5A 4U5KA 3ARQA 2W62A 1VEMA 3I3DA 1ODUA 3M46A 2JEPA 4X0NA 4F66A 2WVUA 3UG4A 4KWUA 4D6CA 3EMQA 2ESCA 4M24A 3OLGA 2DSKA 2D22A 4V2XA 1U33A 1OIMA 3BC9A 3MUY1 1O7AA 2WSPA 3VIKA 1W3JA 4WKHA 2OWCA 1KGXA 3W25A 3VIJA 3GXMA 2XM2A 1WZAA 4Y7EA 1MQPA 3VGGA 4JFWA 1AQMA 2OYKA 3FHQA 3DYPA 4U2YA 4V27A 1XSJA 1QNPA 1PX8A 4JHOA 3W53A 1JI2A 1EHNA 1V3LA 4ATLA 1KCLA 1CIUA 4UNIA 2X0HA 1KXTA 2CBJA 3E1F1 4TTGA 1KR0A 3ZO9A 3ARPA 3BAIA 1NWRA 2WC7A 4J3TA 6A3HA 3PTKA 2O92A 4W87A 3VNZA 4U2ZA 3ZT5A 3MANA 5EB8A 3WEOA 3AZTA 1V02E 4TX8A 2GJRA 1QI3A 2C7FA 3UESA 1AMYA 1XD1A 4AZ5A 1DEDA 1E15A 4Z2KA 3VTRA 5CLTA 5A6JA 4P8UA 3VIIA 4B9YA 4KRUA 1J01A 1OGBA 1MW1A 2PWFA 1OGSA 3ZJ7A 2WANA 4F9DA 1ZJBA 3AZRA 5CPQA 2CYGA 1LG1A 2FHCA 4CCDA 4F79A 3ARWA 2ZX7A 1GVYA 1JDAA 4CN1A 1QNSA 4PSRA 4B16A 4D6HA 2YJQA 2WVVA 3OZOA 4AZ6A 2VNCA 4AMCA 2Y24A 1AVAA 4KGLA 1QI2A 1C93A 4W93A 3LPFA 3WNLA 2VL4A 4ZFMA 1UR1A 2GK1A 4QLJA 3ARTA 4CCCA 4BCEA 1UKTA 4E8CA 5IHSA 3BLKA 2BVTA 1NM9A 1K9EA 3RM9A 4P8VA 1C7TA 3A4WA 2TAAA 3IANA 4HMDA 1JAKA 5I78A 5ECUA 1DHKA 1BQCA 2WHJA 3THCA 2CERA 3PZMA 3ZOAA 1GVIA 1ESWA 3WF4A 2VQUA 1UR2A 1XSIA 2ZX9A 5AYBA 3VIPA 2VZTA 5AY7A 3U5UA 3DC0A 1KQZA 1K6AA 3ARUA 3RPMA 3CZLA 3II1A 4W8BA 1PZ2A 2WHLA 5A6BD 3SUVA 4TVDA 3VOCA 3K4AA 3M07A 2VRKA 1E3XA 3RMEA 3AS0A 4ATDA 5GQBA 2ZUNA 4HU0A 5D9PA 5A6KA 3OIHA 1A47A 1ZL1A 1JYVA 3W38A 1ZS2A 2F61A 1W9UA 5HXMA 3EMCA 4DWSA 2JIEA 3W6MA 4FLOA 3NSMA 2VURA 4AD3A 3T0BA 3AYSA 3FHAA 3GYCA 4AEEA 3A4XA 1UOKA 4D6GA 2BXYA 1C8QA 1H1NA 2J7HA 2XFYA 5DEZA 3GNRA 3DHUA 3VU2A 1G0CA 3QHOA 1C8YA 1UD3A 3QGVA 2XHYA 2VUYA 5A6AA 4C7GA 1B3ZA 3VDBA 4B9ZA 4EANA 4W8AA 1EOKA 3O2LA 4U31A 3M6DA 5IFPA 4W8LA 3UR7A 3VIHA 1WKYA 2FDMA 4D1IA 4UOZA 3ZM8A 1UR0A 1JD7A 2CCRA 4H2CA 4W89A 2OWWA 2C0HA 2XVNA 4P8XA 4M80A 1YQ2A 4WKAA 2CBUA 3PZUA 4MB5A 5CPSA 3PZIA 3ALFA 1HKMA 2QV4A 3CUGA 1DP0A
chains in the Genus database with same CATH superfamily
3UW6A 1Z89A 3BLEA 1V8EA 3MVTA 4EPKA 3K1DA 2BVDA 4XQ6A 2VVNA 2PAJA 3CZGA 3STFA 3HU7A 3DYOA 1VR6A 2FZDA 3PPHA 3MP3A 3MMUA 3MS8A 1IV8A 4CNOA 3AMGA 2C15A 1FP9A 4UQAA 2GK1B 4JZ5A 5BMWA 5B7ZA 1UKPA 3N6JA 2O7QA 1RK5A 4PFHA 4MNJA 2A0NA 3W28A 1C92A 2OZTA 1YHTA 3NGFA 1JGIA 2BTMA 4RE2A 3WQOA 3WQGA 3CTTA 2D23A 4ZQNA 3OBAA 5FOOA 4DJED 2XFWA 1AQHA 3G3DA 5CXPA 2PP1A 2Z2AA 3GX9A 4PUDA 1ZZMA 3OA5A 2G3MA 3MU7A 3T0TA 3AHYA 1E9LA 3WDIA 4GGBA 1XYZA 4NG3A 1VFFA 4PGLA 4AHOA 4S3DA 5EU9A 1PS9A 2E7FA 3K4DA 3HJEA 2YCEA 1NJJA 5HNUA 3H70A 4Y8FA 4ZENA 1HUVA 3EX1A 1GHRA 3AIQA 2EKCA 2O4QA 3W73A 1XYBA 4UNKA 5EY5A 3LQLA 2DIKA 1XLIA 2DZPA 2NQLA 1EF2A 2HNEA 1EBGA 1RJPA 3NL3A 1B3XA 3BSMA 4L64A 4HHMA 4NP7A 4LANA 3ZIZA 3RAOA 4XO6A 1JDEA 1V6YA 1UOZA 4MDPA 4DEFA 1XUUA 4FNUA 3KCJA 3PN8A 4E5TA 4OOUA 3AU2A 4M51A 3SCWA 2BNJA 2J9XA 4DZAA 3ZSSA 1R6WA 1J0JA 1UJPA 2XSXA 2XUCA 4BQ4A 4LQ1A 3S1WA 4AYGA 2V63A 4MDOA 4FXJA 3LHZA 4QSFA 1YPIA 3TZFA 2GSHA 1Q7ZA 2NW0A 2ZXQA 2V38A 3DC8A 3GAYA 4RDVA 1M6JA 5CZJA 3NTYA 5K9CA 1GVQA 1JNEA 1XYAA 3WJZA 5CSSA 4MZ1A 3NPUA 5CKSA 3THAA 3VIMA 1RP9A 3SUSA 3UWUA 1CGVA 3JUGA 3V0SA 3QY7A 1LBLA 1E4LA 3PF3A 3M7SA 1VRDA 2EPOA 3L4TA 1S3TC 2X8RA 4R34A 3NQCA 4FIQA 3S3GA 3KRBA 2V5LA 3TVAA 2QGHA 5CAHA 2PS2A 2DIEA 3EEZA 4I7UA 3W7NA 4E3TA 1QPNA 3CEUA 1B30A 1FY6A 1K1DA 4QRNA 3RO6A 5FL0A 3CAVA 3EA2A 3OVQA 3VFCA 1T6MA 4DJDD 5A2AA 3DHDA 3AC0A 1KM6A 1DWAM 2ZDRA 4RZBA 5DN1A 4KCUA 1R3QA 3W7MA 3ZXWA 1AH3A 1CWYA 1YNQA 2Q02A 4O13A 3S46A 3WQDA 2V3FA 5A5WA 1H3GA 1U1HA 1A0CA 5E6ZA 2VGFA 5CSYA 1A50A 1FWCC 4S38A 4HZMA 3WF0A 3QKZA 3TLLA 1B5TA 2HPMA 1FWFC 5FF4A 5KINA 3LBCA 4JIIX 1MSSA 1OCJA 4MB1A 2CWNA 4PMYA 4YJ5A 1XFCA 4TR9A 3S1UA 4F0RA 1ZJAA 2BXZA 3TTYA 5IFTA 1H1ZA 3T05A 4WZHA 4K1GA 3WL0A 2VXNA 1XLBA 1DJNA 3C6CA 2PU1A 3VGDA 1V6VA 1BXBA 3M0KA 1XFBA 4HSHA 5D9MA 1PKLA 4YVVA 2PA6A 3VIFA 4JD4A 1DJHA 2ZRYA 2X16A 3PUOA 1RH9A 4IH3A 5IM51 1KXVA 3OODA 1QNRA 4UC5A 4S3KA 5DY2A 3WK3A 5CPNA 3VOGA 3TYEA 1DXFA 1CYGA 2F6UA 3KCOA 4XAFA 3BOLA 4TOQA 1EUAA 1KLZA 4QIUA 2JF6A 1C8VA 1CGWA 3TA9A 6XIMA 3SCQA 4C6KA 2ZZ5A 1J18A 4NZ1A 2IQ0A 2W6RA 4O50A 3QC3A 5LIWX 1XDMA 1X8CA 2NXGA 1YKWA 1FA2A 2PP0A 1D3GA 4FA3A 3N2OA 4DAFA 3UD6A 3TR2A 3DECA 3H23A 4FI4A 3T08A 2E0PA 4PBFA 5DCDA 2QUUA 2OGJA 3POHA 4PSPA 3TC6A 4UTTA 3SCPA 3T8QA 4JQAA 3ARVA 3LSCA 5A8QA 5AB3A 3T6CA 3GW0A 4UTWA 3QV6A 1S2AA 3MP5A 1FTXA 1PX4A 4UFKA 3R7MA 4C5ZA 5E93A 1BEUA 1MXSA 3WH6A 3ARSA 3U2ZA 2DH3A 1WZKA 3XINA 1XCFA 1S2VA 2FZ8A 2RDUA 2PDQA 1Z9AA 1F9CA 2PDKA 1KBBA 1QR7A 4HKPA 1FWIC 3RX4A 2OPJA 1PKMA 5AZ0A 6TAAA 3B8IA 2ZDSA 1M01A 4LYQA 4D9PA 1KFWA 3BV7A 4YHGA 3WFZA 2WV8A 1JI1A 2DT2A 1JPMA 1DE6A 3B0PA 4ONVA 1W1ZA 4CD5A 4WK9A 2PPGA 4IZGA 4FX6M 4YS1A 4OFCA 2XFRA 4HNUA 2G41A 3CMFA 3VKBA 3DFOA 3M6YA 1CXFA 3B4YA 4JCMA 2P10A 1OX6A 3GE7A 3HGJA 4LRTA 1AH0A 1JUEA 3T0DA 4S3AA 1R87A 3W7RA 4IF2A 4KFOA 3WEZA 3MMTA 1THFD 3W1XA 2FMOA 2VCBA 3GC2A 2INFA 5KZ6A 1R3RA 1XIFA 3RN6A 4O4WA 3EGJA 3IJ7A 1OCQA 4LAMA 1S1PA 3BXWA 2XIBA 5HQMA 4KF1A 3UYIA 4M0XA 2Y61A 2I57A 2YA1A 4ZQPA 3EXSA 2NUWA 3CL6A 4A6GA 4JKLA 2YL5A 3NPWA 3OIXA 4G7EB 4H04A 4F48A 3OGVA 4B3KA 4N9CA 4DJFD 4WXZA 3DOPA 5CBBA 5JUVA 5C71A 4DBEA 1I4NA 4XZMX 4IPIA 1PVNA 5E1QA 3PZNA 1AUSL 2OSWA 4POCA 2DGAA 2BY1A 3RLVA 5M5DA 4ZFCA 1W3IA 4XVEA 4GI6A 3VGHA 3FFSA 4OWGA 2A3AA 3QTGA 3UETA 5I3HA 4K7YA 2PWEA 3CL8A 1GK8A 2CBVA 4JOMA 1I6NA 4Y96A 3IPWA 1JF6A 1EIBA 4RR4A 3BOXA 1R3VA 5I6SA 4W5UA 5JU6A 3STPA 2DZWA 3W37A 2P8BA 3N2TA 3TSMA 2J79A 2GZXA 2POTA 5HMSA 1SPQA 5HWNA 2E8ZA 2PRLA 3MHFA 3HBLA 4OTKA 4E2BA 2ATMA 1XGEA 1DWHM 4EF9A 1Q8JA 5AVHA 4P5UA 1V51A 3LX9A 2QJMA 3LCWA 4MFDA 2R82A 4Q8TA 3N9KA 3MUZ1 4GO8A 1T7LA 2OOFA 3FAWA 3SIZA 1DJGA 3GSMA 1XLKA 5DCEA 3TSDA 3WLNA 4Z2HA 3R94A 2WB5A 1E0VA 1D8WA 1S5VA 3IGSA 3SY8A 2H9AA 1SO6A 1QHOA 4H1ZA 4RKAA 4J28A 2QVNA 3AIRA 3SJNA 3U4FA 3VOFA 3SIMA 3BV4A 4L4MA 3P61A 5HMFA 2ACQA 4ZVJA 2PGWA 1TV5A 4OIFA 3U7BA 4JQ3A 2DZXA 3ARRA 3HQNA 3A24A 5GNZA 4LVAA 2XGIA 1HJXA 3CH9A 3RILA 1ZTVA 2A6LA 3LMYA 3IIVA 4DQWA 5EBAA 3KBNA 4GPNA 2Y70A 4ZOEA 4UTJA 4PMUA 4MLRA 2BZNA 3HO8A 1XCWA 3B40A 2O7SA 3K13A 4O0ZA 2CLFA 1A5AA 2I5QA 1Q6RA 5A6SA 4J3SA 4D71A 3WNPA 1NF7A 3G1SA 4D8ZA 3BCDA 4MNMA 3HQ1A 4C6QA 3L5LA 4ERAA 1E5NA 2YSWA 4GQ0A 3H2EA 1A5BA 3N73A 3GR7A 2PDCA 3M0LA 4B5WA 1NEYA 2QLYA 5DT5A 5M17A 1OY0A 3R1ZA 1PWLA 4H3DA 1W9VA 3KOXA 1OGGA 1E5JA 2UY3A 4EVZA 3URAA 2FTYA 3UJRA 2X0SA 4C6PA 4UFJA 2I9EA 3S2CA 1E6SM 1LM1A 3CZKA 2OQLA 1GT8A 5D2TA 3W88A 1VFOA 1JFHA 1XQLA 2NVAA 2HISA 1XYMA 1WDSA 3NGJA 1TX2A 1O4UA 1MYRA 1QHZA 1AA1B 3I4KA 4LV9A 1CTNA 3O05A 2ZZ2A 3MHUA 4GCAA 2AMXA 3GH5A 4PUMA 1S38A 2ZXDA 2F7FA 4B5TA 4GNJA 1E1EA 3L4WA 4GJ1A 2B7QA 2BP1A 5HQEA 1XG4A 3SQLA 3SDOA 7XIMA 4DXKA 1HL2A 1IEIA 3GIQA 2ABAA 7PTDA 2E9LA 3TH6A 2BY2A 1LT8A 4OBTA 2B31A 1Z3NA 3WBXA 2J75A 3TOPA 2WZEA 1V0MA 3ZFHA 4M82A 2J6VA 3VCCA 1SZNA 3NUKA 3KP1A 4H83A 4JR5A 3GG7A 4O0KA 1HFBA 2I9UA 3GTNA 4LNYA 3L5AA 1CXEA 3LS9A 4S1FA 2RDWA 1QMLA 1LRNA 3ZMRA 4IMEA 1U1UA 3TQPA 1QK2A 3UWWA 4O17A 3CQJA 3NZ1A 2YLLA 5CQ1A 3CZJA 2YZ5A 3OO2A 2H3DA 4A2SA 2A79A 2H9AB 1OCNA 4QISA 1NY1A 3BAKA 3C3NA 1B3WA 1CB7B 4OE7A 2FVLA 2IUZA 4O19A 5C8BB 1W1YA 5ABGA 4A3QA 1XUZA 3RX2A 3WELA 4YL2A 1XM3A 4I8YA 1EH9A 5AN7A 3OP2A 5G2HA 3BGGA 1JDCA 3HB9A 3BAJA 4QBXA 1GKRA 4N42A 2DT1A 5A1AA 4PMRA 4UTTC 3CL7A 3CUFA 4GE8A 2JKEA 2J62A 3V18A 1B31A 3TNBA 1W6TA 2WSKA 3B06A 4MB4A 1Y5XA 3AICA 2G3IA 2X2GA 3SUUA 5FSDC 2AL1A 1R47A 2FVKA 4DWSD 1HP4A 3UPWA 2VTFA 1BYDA 1R3TA 2QMJA 2GQ3A 5HNNA 1E55A 3EWUA 4ACZB 1KWGA 1PZ1A 2PWDA 2HK0A 1KQYA 4DXXA 1EC9A 1XR2A 3A3XA 1E6NA 4IGHA 4AZIA 1JCYA 1V3JA 4IX2A 1K77A 4KFPA 3W1RA 1ECQA 3T7VA 3W70A 3TWAA 3TR9A 1GQLA 1MW3A 1BRLB 2ON3A 1UQZA 2WMHA 1L8NA 5D2XA 4HP5A 5K9XA 3GUGA 3TCEA 3TXZA 3PM6A 3NWRA 3WLRA 3RX3A 3KP0A 1NQKA 2YW4A 3KL3A 3CH0A 1XC6A 2XFFA 3MSYA 2CWXA 4DHGA 3MCNA 1E9YB 3USBA 2DZAA 3BICA 1SMAA 1HJSA 3ZS4A 4UQEA 3RLGA 1LT7A 3EMZA 5A95A 2WMKA 1LDCA 1W54A 1WCGA 2CLMA 2FGZA 3BO9A 5BCAA 1EJRC 4HYRA 1Z8AA 2FZ9A 2E4TA 4KT2A 2WSQA 3L4YA 4LYKA 3F2CA 1YE6A 3B8UA 1SQ7A 4RDYA 5JIWA 4RUBA 1KO0A 2WQPA 1GG1A 4NI3A 1UP0A 3EZ4A 3T44A 4G1NA 5I0DA 5LXXA 2QCLA 2XH2A 1EC7A 3GB6A 3IJ8A 3W29A 1LBFA 1TTPA 1UH4A 3A5VA 1XP3A 2WC4A 1G4TA 2XN0A 2DW7A 4GO9A 3QFEA 1R2RA 1RD5A 4UTHA 2V3GA 3WJYA 3KL0A 4QROA 4GYFA 5CPLA 7ENLA 3V1PA 3APTA 3VNMA 3IRDA 4IPNB 4GVIA 1K3UA 4HPGA 3NA8A 2XIJA 3HV8A 3TE9A 5HPOA 4GBDA 2WKLA 2JALA 1WOAA 2I7GA 1VJIA 4JDBA 4MKVA 4L1XA 1XRSA 4MNKA 1X6UA 1VZWA 4GC3A 1G9HA 3EDEA 4M81A 1EIXA 4CD8A 4AZHA 4J3UA 5BW6A 1E6XM 2EPKX 4XSMA 1JQXA 4AHPA 5DT7A 1GW9A 2HS8A 2QEZA 3LENA 1ZGDA 4PB4A 4M56A 3W7EA 3BSGA 1KBIA 3FEQA 3NM3A 4Z1CA 2ZTJA 1KBKA 2QCFA 3T1GA 4CD4A 2WNWA 1JL8A 3CYJA 1XX1A 3TN4A 5D2VA 1VFUA 4LH8A 1TVLA 2CLPA 5DY3A 4C90A 1XLLA 4IUOA 2WCGA 1QPRA 4AF0B 2I17A 3QMTA 4DM2A 1MW2A 1BPLB 1YTKA 1QO2A 3R5EA 1W1IE 3CZ8A 1XRTA 4U33A 3LN3A 1JR1A 3Q65A 3IK2A 2PTWA 4L4OA 4FALA 4F0SA 5B7YA 4TUFA 2YKKA 3W74A 3GR4A 3BARA 3FDKA 2XH4A 4IMFA 3W6LA 5JBDA 2VX7A 1GJUA 3ABQA 3DZ1A 2NVDA 5DBTA 4DUWA 4HZ6A 5BROA 2W66A 3AMLA 3C56A 3P7YA 3PWGA 1R86A 3WEMA 3Q2DA 2PC4A 2VX4A 3CAQA 3PZ9A 1CBGA 3P81A 1T0OA 1FKXA 1UA7A 3W1TA 3HG2A 4AUBA 3VD7A 4LBSA 1D9EA 3ITLA 4DZHA 4BI6A 2VZUA 1WE5A 4JEJA 4MWAD 4PODA 4CQBA 3N9RA 2O9TA 4KWWA 2VWSA 4LEQA 3QPEA 4IPJA 3LD5A 1UC5A 1KFJA 4LVBA 5GNXA 2QCDB 3SQMA 1J93A 3SI9A 1JVNA 3L12A 4JIPA 2ZIDA 3S2MA 4CD7A 4LB4A 4DF0A 2E25A 3TA6A 1FXPA 1JNDA 1F5ZA 3INPA 1E0XA 3KTSA 4BY3A 2PZNA 3S4TA 2WCAA 5LGXA 1K4HA 5FAJA 4ENLA 1XLEA 4MY1A 2ISFA 2OELA 1KTBA 1R2TA 3SQSA 3TK7A 2P50A 2W67A 4GYJA 4CVUA 5I5RA 4ZEPA 4XK2A 1YYAA 1UQYA 3LDVA 1WDQA 3HOJA 3G22A 1QASA 3N2CA 4D8LA 4ZXOA 2X1UA 3WF2A 3GZ3A 2GLKA 3BAYA 2I5IA 1UIOA 2AKZA 3KBSA 2PRMA 3IIPA 4PUNA 4BQ3A 3DYMA 2OZ8A 4CKQA 4HQVA 3CUJA 2ISDA 1QXLA 3CK5A 1B9BA 3AUJA 1A80A 1EZ2A 4AVFA 4RPQA 3Q4DA 1OWQA 1XGZA 3HTWA 1K8ZA 5FEZA 2XGZA 4A35A 2AGKA 5G2IA 1MUWA 4ZB0A 5C70A 1OB0A 2C14A 3KZPA 1CLKA 1H63A 3SBFA 1F4HA 3DGRA 2BHYA 1XSKA 5I7GA 5A8OA 3IGHX 1J5SA 2QNEA 2CITA 3SSZA 3WUBA 1VB9A 2WM0A 2X30A 5AC7A 3Q94A 3M47A 3NL5A 3VPLA 2FHFA 3MJMA 4QE5A 2GJPA 2VD8A 3ERPA 1OF8A 1ITCA 3I7RA 4DWSC 1FWEC 2RHGA 2ODOA 3PUEA 3PG9A 3S2LA 2OZ0A 3RMJA 1HX0A 1UD2A 2RDXA 3DFNA 2Y5SA 3PULA 3HFYA 4HTYA 3DDMA 1R38A 1TPVA 2PWHA 1XRVA 4KMQA 3S5NA 3IVSA 1CGTA 3EDDA 3MKVA 3W2JA 2NV9A 3WLSA 3LCFA 2QCMA 5EPDA 3CQHA 2HBVA 4FLSA 1UWQA 2ZUSA 4NRRA 4DY1A 1PX3A 3OLEA 1PJ9A 3UG3A 1CZ1A 3B04A 3UWEA 1UH2A 2Y8KA 4O16A 2QCNA 2XWEA 3MTWA 4ERGA 1VS1A 1X96A 3IUDA 4X9SA 1PTAA 3NCOA 4PTNA 3TQVA 1QUMA 1HKVA 3OHIA 1LJYA 3AIVA 1RCQA 1NARA 2W0UA 4JQ1A 2ZYFA 5BRPA 1ENUA 5IBXC 2KZHA 4E4UA 1PZ0A 1F8MA 2PCQA 3T9PA 1GHSA 3M0ZA 4I5UA 3EPMA 3W4RA 3G1VA 3NZPA 1UKSA 4RLIA 4F0KA 1P7TB 2GVEA 3AROA 3WL1A 2PDMA 5AECA 3S1GA 3UT0A 4IICA 4R9OA 1H1YA 3TMLA 3ZQ9A 2IS7A 5CGTA 2E5BA 1Y5WA 2VEFA 3W7KA 1GVSA 3LERA 1GJPA 1MNSA 3AWOA 2XTKA 2E9MA 1W9BM 4IQEA 1TIWA 5GVJA 4GYKA 1ISVA 2GGEA 3R8RA 1RUSA 1GOMA 1Q13A 3MWCA 3WBAA 3WBEA 1EO5A 4C6CA 3A22A 1ODUA 4U10A 4F66A 2JEPA 4KWUA 2NV1A 2VELA 3EMQA 4M19A 3C2OA 4LF1A 4M24A 2DSKA 2D22A 1U33A 1OIMA 4JTQA 5K4ZA 2A7PA 1KM5A 3S1XA 4YYFA 3W25A 1UMYA 3GXMA 3OYXA 3M0JA 2GWNA 2A4AA 4JFWA 1AH4A 2C0AA 4Y6GA 4RE0A 3MUXA 3SO7A 1N8FA 3FKRA 2FZBA 1JI2A 4F0LA 5FA5A 3QJAA 4CNNA 1XLFA 1CIUA 3GYEA 4UNIA 3BANA 5LXEA 1F74A 2B7PA 4XBKA 4LBRA 2O4MA 3E1F1 4TTGA 5H8PA 1NWRA 1TV2A 4U2ZA 3ZT5A 3A3WA 2Z24A 5EB8A 3I68A 4DBSA 3WEOA 5CC3A 5IOBA 4B5VA 1R2SA 1AMYA 3B3DA 1YLVA 1DEDA 2ZA2A 3OOQA 4P8UA 4WD0A 4ICMA 1QATA 1KM3A 3PVFA 3EX3A 1EXBA 3NXLA 3S2JA 1Z7AA 1QNSA 2R6OA 4B16A 4MZ8A 1IZCA 5HATA 2YJQA 5RUBA 3M0HA 3OZOA 4AMCA 2Y24A 1I8JA 1XINA 4ZFMA 4O14A 2GK1A 1TTIA 3ARTA 4A8LA 1UKTA 4E8CA 5IHSA 3BLKA 2BVTA 4UNLA 1K9EA 3TJIA 4IMDA 1C7TA 1ZENA 1JAKA 4WSHA 5I78A 2Z2UA 5ECUA 2YCLA 3FV9A 3THCA 3O07A 9RUBA 3WF4A 3LLXA 4WEVX 1OZMA 5D02A 4Y9OA 3VIPA 5AY7A 1RJQA 3CZLA 2WHLA 3LV6A 4DJDC 1QK0A 3RMEA 1SFLA 3AS0A 4RK8A 4GY1A 5A6KA 2WKJA 3OIHA 5FACA 4HD5A 4NX0A 4DJFC 2AQVA 3EMCA 5M2FX 3DH7A 4XD3A 1VCGA 3DUGA 5DLCA 1TPFA 2VURA 1KM4A 3T0BA 3FHAA 3B8TA 1XRFA 3GYCA 4AEEA 1W37A 2PTZA 1UOKA 1TWWA 3VZYA 3DHUA 2V2CA 3QHOA 2P76A 5KMYA 4A3RA 1L6FA 4PTDA 5A6AA 4HGXA 3VDBA 4KPLA 1A5LC 2AQWA 4JQ2A 2V2HA 3G5EA 2Q3OA 4I3GA 2OWWA 5TQLA 2XVNA 3GC4A 5C9UA 2PLCA 2WJDA 1QTWA 2CBUA 4LBUA 3VA8A 5F2GA 3OBKA 2OFJA 1PCKA 1TPC1 3CUGA 1HL8A 2QJHA 3QY6A 1QNQA 1POJA 3NFUA 5H8MA 1BFNA 4NNAA 1YDOA 1NU5A 4FR1A 4EPBC 4XBJA 3WMSA 2Z7GA 2YDSA 1EEPA 2GGJA 3W7JA 2QCCA 1H49A 3SRHA 4AH7A 3W2KA 2EGZA 4IJCA 4JDYA 1X7FA 3UFYA 4IJRA 1O6IA 3N18A 4KERA 2AAAA 3DI0A 2FJKA 3W1AA 4AAJA 2BV9A 4J5NA 4L1GA 5G4WA 2VR2A 2QF8A 4Z08A 3P62A 1EQPA 3H6OA 5EL1A 3GU9A 2WCSA 1DBTA 1PZ3A 1XLCA 2EQDA 4GCXA 4RZ5A 2C8NA 1HJVA 1D3HA 5ABFB 3AISA 3WF1A 1JPDX 1KFKA 4GH3A 2REQB 3GDMA 1K9FA 1MXDA 4H6RA 2HXTA 5CZTA 1RA5A 1GQIA 1FCQA 3AOFA 3DN5A 1RY0A 1O5QA 4UR7A 3U48A 4S2BA 3RRXA 1F73A 2Z1KA 4HMNA 1QW8A 3V5CA 3VMNA 3VILA 1QW7A 1KRMA 4LALA 4NASA 3VGBA 3MCMA 4EX4A 3ARYA 1ZY9A 1M41A 3LCHA 5JQ9A 3VKKA 3GO2A 4QCFA 5E09A 1SU5A 1FFQA 3WDQA 2W9MA 2XDFA 1L6SA 3QR3A 2J7DA 3WUFA 1JZ7A 3EWWA 4TO8A 4QS6A 4QITA 3E38A 4D6EA 3ITTA 3KVKA 3QM3A 3G1HA 3MUAA 3UG5A 4A21A 3TTEA 3NQ7A 5FF7A 1EEXA 1MEHA 2GOKA 2EHHA 1CXHA 3O63A 1K8CA 3KOZA 3N2BA 4AIOA 1HGYA 4Z0SA 4W88A 1H50A 1XHGA 5E6YA 2YB1A 4GA8A 3N1AA 5U7SA 4GABA 4EKJA 4GRSA 4V33A 3BPWA 5HDRA 4MYXA 1SJDA 2I16A 3TSBA 1H2JA 5JXQA 3GU2A 2ZZ4A 1RY8A 3MP4A 2B7NA 1E0WA 3DESA 2DDXA 3C2RA 3MKKA 4NYYA 2BWGA 1ITUA 1A3HA 2XZ7A 1GZ1A 3DKLA 3DCPA 1AL7A 2EPMX 4NZCA 1UWAA 3GWQA 4D1JA 1W91A 3WSUA 2YBTA 3LGEA 2BODX 2PGRA 5CEWA 1VRXA 3F5LA 1AW2A 4UQCA 2CLLA 1GOWA 4FO4A 1FWSA 3ZJKA 2C1GA 2DU2A 2OGYA 2PWVA 1TZ9A 4K3ZA 4G1KA 5IBXA 5D03A 3GR8A 5HJXA 4H7VA 3IACA 3RCNA 1ICQA 2PCEA 5I03A 5BRQA 3LRMA 4PULA 3LK6A 4D72A 1BF2A 2Y88A 2QJNA 3L7RA 2PDLA 3FNDA 3GDBA 4ZO8A 4LCSA 3GIPA 1RD6A 3C61A 2PD5A 3TN5A 3TTSA 3KOYA 3IV8A 2FZMA 3CNYA 4GIEA 2QMKA 3TC3A 3MZNA 3PSWA 1Q4NX 2NX9A 3TTQA 3B9DA 4UMBA 4M7TA 4A3UA 2OO6A 2BXVA 4RE3A 3WYZA 4WJEA 1P5BA 2YZRA 1UWTA 3RR4A 1PEZA 4OHQA 4ZQCA 2WMFA 4MVAA 5LNRA 4YHEA 3SRDA 4G5DA 2YL9A 2VDHA 4GI8A 4JL2A 3WNKA 4NKCA 4NYUA 5DMLA 2TYSA 3CJPA 1PIIA 1I2OA 4YTUA 4YXGA 4QSHA 1PE1A 4YPJA 5D33A 4IMCA 4AZCB 1RPKA 3N12A 2NXIA 1J10A 3TWBA 3W7PA 3TTOA 1IZKA 4HHHA 4L6DA 2QUTA 3BMVA 4AZGA 3EEGA 2FH8A 2J13A 2W92A 4LF2A 3NQ2A 3A47A 2HCVA 4LFYA 2BB0A 3HG5A 1JG9A 4S3BA 4UWMA 2WJEA 5LGZA 4Z2JA 5A94A 3EOEA 1GVOA 1RPXA 4JPGA 5H1WA 3KLLA 1GVRA 5K9DA 4EAYA 2O9OA 1PIGA 3ZR5A 3C0SA 4IOTA 5LA1A 3QKEA 2WNNA 1ZP4A 1BRLA 4HB7A 5T91A 3PZVA 3W7CA 3LCIA 3ZWTA 1KXQA 3L4ZA 3UY7A 4GIRA 2CZ5A 3G6LA 3V0TA 4GC4A 1XWYA 2PRHA 2A21A 4DJEC 4JHMA 2PDWA 2P8CA 3A3HA 1UD4A 1H11A 1VYRA 1PCWA 1XLAA 4Q7IA 1HL9A 3SM0A 3K46A 3DU0A 3KL5A 3IUHA 4Q8NA 1BXNA 2C91A 3W1NA 2WM1A 4EXBA 1I45A 4F8XA 4LVFA 3WK1A 2VO5A 2RAGA 3B0YA 4RXFA 4QE1A 1LQ0A 1RV8A 4DVOA 2YOCA 4XWUA 4C6IA 1RCOB 1G94A 1TG7A 1EJUC 1TO3A 2X09A 2DSVA 1K03A 3N19B 2VT0A 5ECVA 2OXNA 4NT0A 2FVMA 5M03A 2RGMA 1U5HA 2EKGA 5FSEC 2PDJA 3OZYA 1A5SA 4JFUA 1JZ5A 2CLKA 4S3JA 1AW1A 2EPHA 1WDWA 3CUZA 3MDWA 1BAGA 5HBFA 3VO0A 1ONEA 1FWHC 1SVDA 2FJUB 2R14A 2V2DA 4K68A 3PR2A 2BDQA 1NWUA 4M6QA 3QXBA 4YCPA 3LHUA 4XVDA 3NJ3A 4IGSA 1EZWA 3O1NA 3T4CA 5F2IA 2NWSA 1KFCA 4RV3A 4XZHA 4O52A 2EO7A 1NFBA 2E09A 3KBWA 4HPJA 2D24A 4HCLA 3G24A 5CZ0A 5FF3A 4IMAA 3EOUA 3ZR6A 4LRSA 1G01A 3E96A 4GXPA 2ZADA 3FJ4A 4JTHA 4JTAA 4XD6A 1K7FA 1M9HA 3TNOA 5KEZA 3WLPA 4NF7A 4U4MA 4CNTA 4DWSB 4OQVA 1XS2A 4AWUA 1V7YA 2OKTA 3N14A 1IEXA 4OUEA 3R2GA 2JEQA 1W5OA 5C55A 1C8XA 3CGTA 4BZYA 2WZTA 4PMQA 1NH6A 5I00A 2FLIA 4GI4A 1VD6A 3RRAA 2Z29A 1OYAA 1UCWA 3UCCA 4H00A 3H26A 3FJLA 1CENA 1MEIA 1UPPA 2UZ9A 3DG6A 2J7EA 2A1YA 3DFSA 2QULA 3W23A 1JDDA 1V08A 2NUXA 4DNMA 3KVMA 1QOPA 3E2VA 2NLYA 5HQLA 4AW7A 1B2YA 2GVYA 4KEVA 4EIVA 4BR1A 1RZMA 2TMDA 4URIA 4C1LA 4C6NA 5ABHA 3FX4A 3RF9A 4HZ7A 2GQAA 1EJ7L 1GOIA 5J04A 3P60A 4YCOA 2DVUA 3EOLA 4QX4A 3GXIA 3EX6A 5LIKX 5M3WA 4KH2A 1OC6A 1AW5A 3V5OA 1WAWA 3HFTA 4PR4A 2PC8A 3THUA 2BOEX 1OX4A 1OFDA 4MAVA 5BXSA 1EPXA 1RSCA 2YYUA 1Q6CA 2QYGA 3V5FA 1JAEA 1V77A 1ALDA 3BCFA 2Q6ZA 2DVTA 3JW7A 5AHMA 2Y85A 4TV6A 1P4CA 2QQ6A 3CAWA 2VFGA 1HT6A 4XZ9A 3SADA 4AY8A 4O10A 4GUFA 3THDA 1UP3A 4B90A 1KW1A 1M68A 1A3WA 4IISA 4IPPA 1EP3A 3W81A 3CAKA 4AYSA 1XLMA 2ONEA 4BWLC 4E2VA 2E6DA 2BSLA 4BWLA 2OZ3A 1EJVC 2ZUUA 1EGVA 3WD4A 4LYRA 1TE1A 3L23A 4HZ8A 1UB3A 3QFWA 4N2YA 2J25A 4B5XA 1TR1A 1IWBA 3W76A 2OOGA 5CSUA 2Y6ZA 2PWGA 3MBFA 2P5NA 1D7KA 5DF0A 2YXGA 4O28A 2Z1VA 1HTIA 4ZOCA 4UB9A 1GOQA 3H4WA 3GTFA 3KE0A 1H0GA 3SY1A 7TIMA 2RDTA 1LRQA 2CBIA 5XINA 2VC9A 4O1FA 1TCDA 1TKKA 2WHMA 3DFQA 3BGJA 3O6CA 2Q8LA 3NXFA 4RPPA 3UZZA 3QZEA 2XM1A 2ZXBA 4HOXA 4ADTA 1P1XA 5EFDA 4E6MA 4E2OA 1YDNA 4AZBA 1I2PA 3GNOA 4G7EA 5F4WA 7A3HA 3L9CA 3LZ3A 2RJHA 5BOEA 1US2A 4L56A 4YLWA 1XCXA 3LI0A 3AIWA 1PYFA 1TV8A 2DQXA 1BG9A 3BWWA 1Q8AA 3PZGA 1G5AA 1GPWA 3FCPA 1UWSA 2F84A 2PDUA 3CMJA 3COTA 3GVQA 1WV2A 3ORWA 3UU0A 3EB2A 1LL7A 5G2WA 3DAQA 1IIHA 1VP5A 3KX6A 2W3ZA 3WK2A 4LCRA 2WBKA 3DFHA 3VVGA 3B9NA 3BMWA 1Q6DA 4WY0A 1C9WA 4KEMA 4IQJA 1SGJA 3TCSA 1YXYA 3M41A 3IV3A 2GOUA 3W2UA 4ICCX 5C2CA 1JUBA 2Z1BA 1CXKA 1OFAA 2DW6A 1FDYA 1Q65A 1MXGA 3DFPA 4UCFA 2J27A 1XF0A 1PWMA 4GXWA 3C0QA 1NIUA 4DX3A 1FWWA 4HMEA 1EA9C 3U9IA 4IG2A 4WJXA 1TA3A 4L7ZA 1XH2A 3UR5A 4BFAA 4PB5A 2D0GA 3HPZA 4PH6A 3W0KA 4XUYA 2W91A 1IT0A 1HQTA 2NUYA 3SCSA 1RQBA 2GJXB 4BQ2A 1P0KA 4OBSA 1US0A 1B4EA 3L67A 4J3VA 2YA2A 1JYWA 1B3OA 3BLDA 5CC5A 2Z6IA 4HNLA 3VD4A 4AWTA 2R94A 4LEFA 1EDQA 3NQ6A 3GC5A 3MSDA 1T96A 4A29A 1TRDA 3BG9A 4IGNA 1P0DA 4K6AA 3AIUA 1Q63A 1S2CA 3N17A 3V4BA 2PDGA 1KFLA 1MI3A 1WYIA 3ECQA 4H01A 5HPCA 3W2LA 1RBOB 3SECA 2ANUA 4Z1BA 3OGRA 5FCZA 3VE7A 4DBWA 3TZNA 4RNJA 6ALDA 4J2PA 4E2DA 3STCA 1V5XA 1FCVA 4IX0A 2CKSA 5HJLA 2UY4A 5L6UA 4QJ1A 2FQIA 3PWIA 3W1UA 3LM7A 2W5FA 1VQTA 2X05A 3ZZ1A 1I60A 3FJ6A 2EPNA 4JL1A 1TCMA 1GW1A 4WY0B 1LP6A 3NNTA 4DF1A 2OX4A 1WUFA 1TMQA 2FB3A 3ZLFA 2Z00A 1X6LA 4JQ4A 3SEPA 1H7XA 2FKPA 5DXYA 4NRSA 3HIJA 1H09A 2RGLA 3DFTA 4H8UA 3K2GA 4CD6A 1V7AA 4KRZA 3RK8A 4ECLA 1QPOA 1QOXA 3P2VA 1J2BA 2A7RA 3C0JA 3PB0A 4C6BA 3R58A 3UQNA 3ZT6A 3OZMA 4A2RA 4JTCA 4UXDA 5JH1A 3GHSA 5HUPA 4JTLA 3MVIA 5HWJA 1X1NA 1M1BA 1W17A 5F1UA 3CT2A 4YTTA 3ITXA 4JTJA 1YDYA 4GOAA 4K8GA 3W71A 1E43A 1A5NC 1UWUA 4JYEA 3ABOA 4IUGA 4QEHA 2HNHA 3BCJA 2ZA3A 2WZHA 3CO8A 4UR9A 5EKYA 5FI8A 3OU8A 4JFVA 2QR6A 3L2LA 4FAMA 4DIAA 3BUVA 1HJWA 4W85A 2PD9A 4H7ZA 1TUXA 4LUIA 5D30A 3OBEA 2G8ZA 4RDWA 3HG3A 3SCRA 3H8AA 3HV9A 3D6NA 1RVGA 4N6EA 4P7NA 1GZGA 4JHZA 4NVTA 2L5HA 4HMCA 5GNYA 2ISWA 2ZUMA 1KCKA 4CNUA 5CSRA 4ZQMA 4GQBA 1LF1A 1B3YA 1QJWA 1A5KC 4EAMA 3UJFA 1VIWA 4Q3MA 3WIJA 1Q7QA 5LNSA 4KESA 4DI9A 1REQB 2XISA 5E5CA 4BEUA 1SFTA 1ODZA 3AXXA 3HGSA 3LSBA 1ME8A 3HQOA 4BF7A 2QT3A 5GJNA 2A3HA 5AHFA 4WIWA 1H60A 1KGUA 1OIFA 4TVCA 3W7IA 4FB7A 2JGYA 5CC6A 2GSEA 5I3DA 4Q6XA 3AUOA 3KWXA 1IXPA 1R8LA 3QR0A 3AHVA 2O56A 5D9OA 1W3LA 1JCXA 1A5UA 2CXEA 1Q5MA 4FNQA 2VQTA 1UZDA 3UXDA 4B91A 1UWIA 1KWKA 1J0HA 2WVTA 1H7WA 4PMDA 3VAVA 3ZSTA 3BLFA 1FCBA 1IQ8A 2FPVA 3CUIA 1PSCA 4YIWA 4QR6A 4ALDA 3M43A 1VC4A 4HT3A 1HF6A 3R79A 3PJXA 5LA0A 2XN1A 3L4UA 3NQ8A 4QS5A 3VXGA 1K6WA 3OQ8A 4GX9A 2OYMA 1V79A 1XIDA 5A6BA 1XXXA 4JKMA 2GFTA 1UZHA 3UWQA 1L2QA 2EG8A 4PRWA 3EPOA 3M0MA 4JN6A 4NXSA 2NQ9A 4A3YA 3H7UA 4IFKB 2X41A 4E38A 3H53A 5FJPA 2C1HA 4QQUA 1DOSA 1OQFA 2PLKA 1C90A 5FJIA 3LEPA 1F07A 1AZ1A 1ZLPA 4L4PA 2G3JA 3TW7A 1W1PA 5G1MA 3C2EA 4IQDA 3CIXA 4J35A 4UUIA 2GL5A 4XISA 3VMOA 4QM1A 3PBUA 3T78A 2VR5A 4I5XA 5FJJA 5ABEA 1SZFA 2VEPA 3EBVA 4UQ9A 3SUTA 1MQRA 4Q4RA 4Q4QA 4V1YA 2PMQA 3NO1A 1DIKA 3AS3A 1F76A 4AD0A 3W1QA 1XIBA 1XPYA 2J66A 1DQXA 2GDQA 1HXJA 2VFEA 1DJQA 3G6MA 2ACSA 2VC7A 3UP8A 4UCGA 1VFMA 3VX0A 4CU8A 3QYQA 5JVLA 3QLLA 3VIGA 5CPOA 4N02A 3WQ8A 4L6OA 4Z2LA 3WKZA 2ZZ6A 4I9JA 1J0IA 1B90A 4MWAA 2WQDA 3KBVA 1ZU8A 1R3WA 1KD0A 1XV8A 1SZEA 3I10A 4Q8QA 4REQB 1UR4A 3SB0A 3VNDA 1RAKA 3WN6A 1J96A 1SO5A 3E6EA 4WHBA 4MJ4A 3TUUA 3WQWA 1I0DA 3USZA 1BVWA 1F3XA 4IXXA 2Y62A 5DRIA 1VKFA 1DQWA 3NAVA 2J6XA 3W84A 1WDDA 4XKYA 4I9MA 3IJIA 1JFXA 4YVXA 3SN0A 1EKOA 1EJSC 3GXPA 1D2KA 4JTKA 3NQFA 4ZO7A 3EAUA 4QJ3B 4UTWC 1PAMA 1V3HA 3EKGA 2ZTKA 2Y4SA 2W79A 3TYZA 3GBEA 1JD9A 1BD0A 4MWAE 4IPLA 1E6RA 1Q45A 1VEPA 4Y90A 3OW1A 1HKIA 2JK2A 5F4XA 4JY8A 2E40A 4FNRA 4M6PA 3FAXA 1WBJA 3RR1A 4M6VA 3DIPA 2AMGA 4YVPA 4GHRA 4OUIA 3KXQA 1ME7A 2VRJA 3WH8A 4DZ5A 4O54A 3S5OA 4YWSA 4ZMGA 4OECA 1RR2A 5BWFA 3AHTA 4EOUA 2JGQA 5LNVA 2QXWA 4IWWA 1RBLA 3MUIA 3N6HA 2CPUA 2DFAA 1G4EA 1XIMA 3E2RA 5F2MA 1PTDA 2DUXA 1QFEA 3CHCA 3WK0A 5LIXX 4H9UA 1ZBVA 4MPKA 2PGEA 3WNNA 2V69A 2QUVA 5C7VA 4QAIA 2AQOA 3QQ0A 2QIIA 1MNZA 2G50A 1Y8BA 3L4VA 1B57A 3NDOA 2YYTA 3LCXA 2VCAA 2QHAA 1HVXA 2Z1WA 4B5UA 3MZ2A 2OWXA 1NP2A 1WO2A 4H6QA 3STEA 1YMYA 3LPGA 3MYPA 3E0IA 4UTMA 1SO4A 3R89A 3LUTA 2QAPA 2QCDA 1J12A 2QDDA 1ADOA 4RE4A 3IK4A 3RGTA 4LUTA 1OZQA 1WKDA 1X39A 1UUMA 3N2MA 1TJRA 3V1HA 3FS2A 1J8VA 3W87A 2J4GA 1EO7A 3AJXA 4QLLA 5K4XA 2ALRA 4KIEA 3VUPA 1GOOA 4OBRA 1J79A 2ACRA 3UF9A 4MOZA 3T4WA 4J3WA 1VFSA 3AALA 3NO5A 1TE6A 2OTDA 1RQEA 2ZICA 4IFOA 3H2MA 1CXIA 2WMIB 2FFIA 5A69A 4LU0A 1NTHA 1PBGA 4C6FA 4M7SA 2XVGA 3PUDA 1LLZA 3TYCA 4GQQA 4C1NB 3BAWA 1SFJA 4B3LA 3GD6A 5CZKA 2HE5A 3BZJA 4M29A 5HNRA 2FIQA 1AFSA 1QBAA 3IAPA 3I6RA 2IKHA 4NY2A 4JXCA 1PYMA 1O66A 4R9XA 1GKPA 1SW0A 1BHGA 3A21A 4QLKA 3A64A 3D3AA 1DWJM 3RJYA 4UOQA 2OT1A 1AD1A 3Q67A 5AVNA 2BVYA 4B5NA 3WLHA 4UOJA 3LHWA 4FOJA 4L1WA 5BU9A 4RNIA 1LZOA 2GVLA 2NLIA 3CM4A 1VFHA 3SFKA 3P0XA 3APGA 2YCLB 1DIOA 2PDBA 1HO1A 1JCJA 1Q6LA 1B4KA 3FLUA 3O8AA 1ICPA 1KBLA 2HVNA 4CEXC 2ZC1A 1FDZA 4HTBA 3BH4A 1MRQA 3TEVA 1OT2A 3IJ6A 2VP8A 3VCNA 5D4YA 4UFHA 3G8EA 2R1MA 3RCYA 4IIDA 2AOSA 3BK0A 2XINA 1TWIA 4DLMA 2X2YA 3VM5A 2CZEA 2W62A 2YBVA 3P8JA 4X0NA 3UG4A 3UZWA 1EJXC 3KCLA 1HG3A 3FA4A 1DV7A 2VEMA 1JRCA 3MUY1 1O7AA 1SJCA 4CEUC 4F4RA 2OWCA 2ZVRA 4GJIA 4FX7A 4O11A 4K2SA 4J1OA 1YNPA 4EPEC 2BASA 1MQPA 4NI8A 3VGGA 4ZA0A 1AQMA 3FHQA 2B81A 4U2YA 1FWAC 4MWAC 3LHYA 4ATLA 4WGXA 1DKWA 2DJLA 3DHFA 4H9YA 1KR0A 3UZXA 3BAIA 2PDIA 1KFEA 4MKNA 2WC7A 4NX5A 2AAMA 1LUCB 2O92A 1OX5A 5HMDA 4BK9A 1L6GA 4HNNA 5EA9A 3QY8A 1GEHA 4KETA 3UESA 1QI3A 2C7FA 4GIYA 4JGDA 4O18A 1E15A 4Z2KA 4I5RA 5CLTA 5A6JA 4B9YA 3RUBL 1OGBA 4AMAA 1E9ZB 2WANA 2NX1A 2Z28A 3T0CA 3R11A 3V75A 2NZLA 3QGAC 4DF2A 2QDHA 5BWAA 3XISA 2FHCA 3ARWA 4LNCA 5MKGB 4DPPA 1GVYA 4CN1A 5REQB 3VKDA 2O0TA 4D6HA 4L9XA 4RXGA 3NQEA 1AVAA 4KGLA 3CTLA 3WQPA 3LPFA 3W72A 4KS0A 1UR1A 4IL0A 5KZEA 1J4EA 4BCEA 3PBYA 4DYEA 5TF0A 5HULA 1TPB1 4MY8A 4ZQRA 1DHKA 1ZFJA 1KM0A 3CU2A 4Q8WA 3KWSA 4KKXA 2VQUA 2VC6A 3ITYA 3TYBA 4Q4MA 3TOYA 4S39A 4LB3A 4K36A 1PZ2A 3UPBA 5I3FA 5C7HA 3CXOA 1ELSA 1SR9A 3CLMA 3EXRA 3M07A 1E3XA 4NILA 1VH7A 4YNGA 4YWIA 2IKIA 4HU0A 5D9PA 5LNWA 1ZL1A 1JYVA 4H4IA 2FZNA 4JIQA 2F61A 4LAZA 1FX6A 4DWSA 4IIEA 3W6MA 3FYYA 2OX1A 2FDSA 3AYSA 1G4SA 3PBMA 1LBMA 4LS2A 1H7PA 1H1NA 2J7HA 3NZQA 5DEZA 3LXCA 4R53A 1MZHA 3NZGA 1VHCA 1C8YA 1UD3A 2XHYA 2VUYA 4C7GA 4PC8A 4EANA 5HR6A 4W8AA 3O2LA 5IFPA 4W8LA 4B5SA 3CC1A 2FDMA 4D1IA 1S1RA 3ZM8A 1UR0A 2CCRA 2Z27A 5D32A 4CQAA 2C0HA 1SW7A 4Q4KA 2EG6A 3WJWA 1EWDA 4MB5A 5CPSA 3PZIA 3ALFA 3L5MA 3IJQA 3UXLA 3EB4A 1DP0A 3FVDA 4F40A 1UKQA 1XGDA 2F8QA 5AOUA 1V3KA 2J78A 4P7OA 3VFLA 4DYKA 1JZ8A 4XUGA 5BRBA 3IJDA 1FKWA 4JEQA 4Q4OA 4G7FA 3HGOA 2VGIA 4N7QA 3O7UA 2QJGA 4C65A 3L65A 2YIHA 4ACZA 1W0MA 3ES7A 3VE9A 4AF0A 2DT3A 3WMBA 4XZBA 4UZSA 4DO4A 5D2YA 3LCLA 2C3ZA 2FTWA 5M1TA 3MV01 4PBGA 1XLDA 3E2SA 3LU2A 4KWOA 4J3ZA 1SW3A 4X61A 4NJJA 3BJTA 1WAUA 1VBHA 4D6JA 5FJTA 1QWKA 3K4WA 3WG6A 2Z26A 4XKMA 2Q8ZA 3PTDA 1GPFA 5E0CA 2VEGA 1ADSA 1HJUA 4ZOAA 3TONA 2PDPA 4UFLA 1O5RA 1NFPA 1SJBA 4GZJA 1XQKA 3V7PA 4FEZA 4TQTA 2FTPA 5D38A 2DZTA 4ML4A 3P67A 3F4DA 1NWSA 5IHRA 1MUMA 3KTCA 4Y8EA 3QRHA 1UD8A 1OF6A 5AYZA 4XAGA 2J88A 3AYTA 3PANA 3EWDA 3S6TA 2YDAA 1EFZA 4B4FA 4PTWA 2DQWA 4J40A 4NQ1A 4UMCA 3RU6A 3OLIA 4P61A 3DBNA 4GZ7A 2QJIA 3SCUA 1FWBC 3VD9A 3SRKA 4BA0A 3AMKA 1PDZA 5CG7A 5AHNA 2QDEA 4PA8A 4AVNA 4H9TA 5E9AA 1GOXA 3NL2A 3B8VA 2VX5A 4AX7A 4PB3A 3QVQA 4ML9A 2Z1SA 4R7OA 5CLWA 2GYIA 2ACUA 4Z2IA 1QW9A 1A5MC 4IP5A 4X63A 3I3BA 4FOKA 4IIHA 3R13A 3PG8A 1W9XA 4JTFA 2HDJA 3O16A 1TV4A 4AB4A 3PAJA 3SN1A 3Q45A 4AZ7A 5BXPA 1XIEA 1R85A 1XBXA 7REQB 3GZAA 4UQBA 3TW6A 1Z6KA 4QQ3A 3S5SA 2YCIX 1QT1A 1UA3A 4ZO9A 4Q6JA 1OG0A 4W5ZA 4ZTXA 3GLCA 2CZVA 4AWEA 2KAUC 1TZ7A 2ZQ0A 1AJ2A 3EDKA 1O1HA 3GY1A 3QV7A 1ZBWA 3S9YA 4EP8C 4DUVA 1WKFA 1W5MA 3C8FA 1XH1A 1WPCA 4OGZA 4S2CA 1FP8A 4FXSA 3W7HA 3A9BA 2VR4A 3UJ2A 3U8GA 4YTRA 1E56A 2YFOA 2E1DA 5JBEA 3LGGA 1GTHA 1T40A 3ZT7A 3WY1A 1TPEA 4NNCA 3LXBA 4V15A 2HVMA 2OODA 4D2JA 5FF0A 1Y7VA 4JIHA 2OR2A 3GDRA 1CW2A 3TROA 1Q3NA 1XBVA 1VF8A 4XIMA 5C6MA 2OLHA 4ADSA 2AL2B 3AIEA 2ZRVA 1YTEA 5TNVA 4O8AA 4ORMA 2G4FA 1W5QA 4ROQA 3MO4A 3PFMA 3GUWA 1GOKA 3UXIA 2PUZA 3FXGA 1L9WA 1Q6GA 2ATSA 2VCCA 3G0SA 2NQ5A 5I02A 3TYDA 1UHVA 2VDIA 4C7DA 1JCTA 4ZQOA 3QMRA 1GKQA 3KZSA 1GCYA 4CQDA 1R7OA 3V16A 3K30A 3HQPA 4WX2A 5BYWA 1E1FA 1M7XA 1LRTA 4C1KA 1LQAA 4GI9A 3KEHA 4DJFA 4EWND 7ODCA 3NQGA 1MFUA 5I06A 1P0NA 4RW5A 4PCTA 1E0TA 3PPCA 2JE8A 1ISWA 1OK4A 2A5HA 1QVBA 1UZ1A 3R0DA 3TMQA 4REQA 4U3CA 4AXKA 5HJYA 1F8IA 3K8LA 4V1XA 2VJXA 4W86A 3OVGA 2VZOA 4W9TA 3PP7A 3KW3A 4ZCWA 3R4IA 4PZVA 4O1BA 3VMPA 2XYLA 1R3SA 5ABFA 3D5HA 1YADA 5I2UA 1HP5A 3ITOA 4AFYA 1WX0A 3IWPA 4RW3A 3I6EA 4LXFA 3NSNA 3NDYA 1GQJA 4ZE4A 2G5WA 3O0KA 3VC6A 4V28A 1AG1O 1AQFA 4U3AA 2VRQA 2D73A 2CLOA 2EF9A 1SZGA 1E70M 1JXKA 1JJKA 2F2HA 2WZMA 3GG0A 1KV5A 4NHVA 2DH2A 1FCUA 8TIMA 2PURA 1E6ZA 1UKOA 4F9JA 2QPUA 2XSBA 3GKAA 3O15A 1E1CA 1Z42A 2Q09A 3VCRA 3OHMB 5CJ5A 5AYIA 3SZ8A 4I7WA 1QO5A 2ZRUA 3WLQA 5HNTA 1TV7A 4HOZA 2ZXAA 3L2IA 3WLKX 1EYWA 3TP4A 3W2NA 4DELA 4B92A 3PK7A 3E0FA 3BVJA 4LC8A 3WMCA 1C91A 1WBHA 2E28A 4B15A 1NDVA 3OGSA 4IIFA 4QFUA 2RJGA 4Q8MA 4IQLA 4L4LA 1VJSA 1V3MA 2XGBA 5BZAA 4XZIA 1DJZA 3IGXA 2PBGA 3H2FA 2Z6JA 1K9DA 1H7OA 1V0NA 2FGBA 3WDPP 2CU0A 4LV4A 5IDIA 1RXOB 3B9EA 1KB3A 1J6OA 3RPDA 1JZ2A 1FWNA 1GORA 4O53A 5AHLA 1FWDC 5BOOA 3PJWA 4RNFA 4AQLA 3SGGA 3UJSA 4Z17A 3ISIX 1T99A 1OD8A 1G69A 2WMIA 2V81A 1KC7A 4FIRA 1ZCCA 2X7VA 4HA4A 3N25A 4NZ4A 3T09A 1YNYA 5FEWA 3LLDA 3RXZA 1Q4WA 3BAXA 4K8EA 4MB3A 3P93A 3A5FA 4Q32A 3DENA 3VIOA 1EJWC 3H7VA 3XIMA 3ITVA 3BQ5A 1FRBA 1IF2A 2Y2WA 1GJWA 3A4JA 4A22A 5TIMA 3VOHA 2CKRA 1K9TA 4NUWA 2I1OA 2QPXA 2P1FA 5D8ZA 1SUXA 3UGVA 2DY3A 1J2WA 2XWDA 3W7DA 1PHQA 3KDOA 2XG9A 2PBOA 5CPTA 1A5CA 1SO3A 2P88A 1W9DM 5HAOA 3PFRA 4BKNA 4PTMA 1KLYA 1IGSA 4J9JA 1EPVA 3QMSA 3GXNA 1MVYA 1MQQA 4NJGA 4ZOBA 3TFXA 3B8WA 5G5IA 1EDGA 1N8WA 3CB8A 3WLLA 2BOGX 2A3CA 3HPXA 3OYZA 2VDGA 1E4IA 3EA3A 3S83A 2WHKA 2IQTA 4LUSA 4E3VA 1OHLA 2CLHA 2J8GA 4INFA 4DRSA 3CV1A 2NQHA 1B1YA 1OFQA 1OJXA 4KBXA 1DWFM 1O68A 2BS9A 1CEOA 1WA3A 2D69A 3HJZA 4D6IA 5EMMA 1OD0A 1LWHA 4WVXA 1O95A 1KRAC 3DEQA 3NPXA 3QSRA 1OG6A 2D20A 4CN4A 3FYPA 3DX5A 4ZXLA 2E6YA 4LYPA 5AC4A 3R0UA 2ZUWA 5A8GA 5EFFA 4NJKA 2OEJA 3GIYA 1CNVA 1T5AA 4CCEA 1LWJA 3MCOA 1YBQA 3CB3A 4TXEA 4PE8A 2Z2BA 1B9ZA 3KLKA 3C2FA 3BG3A 3T0AA 3A13A 4NAFA 4CVWA 4MNLA 1VCVA 1H51A 3ATZA 1RP8A 2W63A 1GWJA 3PPGA 4JNYA 3QF0A 3VD3A 3ATYA 4CQ8A 1U30A 3AXKA 3NQBA 2VHLA 4DM1A 3UXKA 2A7NA 2PSNA 4QNWA 3T40A 4LWWA 3GXDA 1OFOA 2IKJA 2X7WA 3WBYA 2GGGA 1ZJHA 1AMKA 1HNYA 5HINA 5D8WA 1DYSA 4AD2A 2BGSA 2ISVA 1TSIA 4D6FA 1AQ0A 3GDLA 5F1VA 4C6MA 3DGBA 4NZFA 3ME3A 2P3ZA 3GQYA 3LHTA 1XYFA 4P8WA 2WKGA 3GRIA 1H4PA 4C6OA 2ZE3A 1KV8A 4IP4A 3OTRA 4CCZA 1WXZA 4ZR8A 3KBJA 2WPBA 1V6XA 1FHLA 4GVGA 3WQEA 5MHBA 4PMJA 4ZBCA 4LGXA 5DMMA 3SAZA 3VGFA 1J6PA 2E8YA 1XIIA 2VEIA 3JU2A 4O1AA 3ICJA 3GVGA 4I9AA 2I5GA 3CPGA 3UNTA 3IAQA 4A3HA 3AQUA 1A49A 3E5BA 3G1DA 3PZTA 1IYXA 1HKWA 4JAWA 3VUSA 4LUTB 4DPQA 3NQMA 2ZX6A 1IEVA 2PFHA 2YX0A 3TYUA 4QCEA 5HOSA 3URQA 1GG0A 5C9RA 1UWRA 3QW3A 1VYSX 4A05A 3PTQA 1P6BA 3FA3A 4OVXA 5H91A 4LW7A 5I23A 2BY0A 2G3FA 3IARA 4XZNX 2GSJA 2P53A 3TYAA 4GZEA 4AC7C 1SSDA 3NR0A 4LSBA 1NP0A 1TMHA 3WD0A 3GG8A 3OLDA 5DRCA 1DVJA 1XBZA 3BURA 2BG5A 3EDJA 4QNEA 4XG1A 1B0IA 2Y5JA 2HVOA 1U5JA 3L68A 1PPIA 3H4GA 3WD1A 4LY4A 3LRKA 1FWTA 2JBMA 3RCMA 4ASTA 3PPFA 4EK7A 1E6PA 2ZC8A 5BNKA 1YTDA 1F05A 3SGUA 1H7RA 1VLIA 3D3FA 3I3EA 2Y7GA 3RFAA 1HVQA 4DBUA 1PUDA 2YDRA 1L2UA 3TJLA 6CGTA 2DUZA 5CPMA 4DXVA 5BU6A 2R8WA 4C60A 4LS1A 4JBRA 5G4HC 2J47A 4TX9A 5CBJA 4IM4A 4N9BA 5JH2A 2HS6A 4HNOA 1EXPA 4MJ2A 4H8NA 4JKKA 4W7WA 2RKXA 4HPHA 1UC4A 4QE4A 1MDRA 2F2KA 4W7VA 1CI1A 3QV9A 4H41A 3LM3A 3IUIA 3V0UA 2HTMA 3FXYA 4GD0A 3ZVIA 1NDZA 1FWJC 2B7OA 4X60A 3LG3A 4FHAA 5C54A 3SRFA 5A2BA 3DKJA 2OQHA 4EWJA 3U3HA 4AY1A 4UTUA 2WMGA 1WUEA 1LOSA 1H61A 2IMRA 5K7JA 1XKYA 4AC1X 4PEKA 3CHEA 4FNPA 3LCGA 4PTVA 1JZ6A 3VDGA 1OK6A 5FESA 5LIYX 3G1YA 2YFNA 3P5ZA 4WDXA 2CETA 1I2QA 3R6IA 3H2OA 1QRQA 3S42A 4F3HA 3M0IA 2WJZA 4C1NA 3NSXA 2G37A 1XJBA 1EA0A 4H9MA 1S5MA 3W7QA 2NWRA 5I77A 1E4MM 3THQA 2DJXA 3DHPA 1W8GA 3PWAA 1WDPA 1S2TA 1Q6FA 1DPMA 4JS3A 1TJ0A 3VINA 2A3EA 4ORIA 1C7SA 4B2DD 1EBHA 1VPQA 4N4QA 1MEWA 3O6YX 1N2VA 1EWEA 1KCXA 4FNSA 3LXAA 2X1IA 3LBOA 4UBPC 3FKKA 3N34A 3RIKA 1SR0A 1XC4A 4JFTA 1OFPA 3QHMA 3GTXA 5TD4A 3S47A 3WH7A 4R33A 1JGMA 5C9XA 3LYEA 4UFIA 3RNDA 1XIJA 5FD0A 4E8DA 3ABXA 4MJZA 4WQ6A 4LS0A 3DXIA 3WJSA 2A3LA 2GJXA 3EB3A 1HN1A 2WBGA 2X1RA 3NIYA 1NVMA 1KBJA 2IXVA 1B54A 1NWTA 2YW3A 1DWIM 1Q85A 3UPMA 5TAOA 2WNZA 3ID7A 4BF9A 3MSRA 4GZIA 1W3NA 1TA3B 5IRPA 1ZHAA 3NEVA 3UYCA 3BOFA 4GY0A 3W7LA 4PCNA 3RYSA 3LNMA 3M5ZA 1NELA 5CZSA 2H90A 5XIMA 3AS1A 3QSTA 1W2VA 1EGZA 4WXYA 5GJMA 4OV9A 4XZWA 3EWCA 3FDGA 2QF7A 1VGAA 5FKYA 2R9RA 1GYMA 3RJXA 3GFZA 3IRSA 4OU1A 2V8ZA 1W1A1 2UY2A 4M1BA 3UVIA 1OX4B 1W8SA 5FIPA 3KM8A