4ZEPA

Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
474
structure length
474
Chain Sequence
b'HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
molecule tags Hydrolase
source organism Geobacillus stearothermophilus
publication title Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose
rcsb
total genus 189
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zepA00
1JG9A 5IXEA 3SCPA 3QR3A 4J3UA 2OYKA 3W53A 4CN6A 3AZRA 3PZNA 4R27A 2J7EA 3T2PA 3VUPA 1KXHA 5KEZA 1B90A 4LYRA 3DHPA 1QNQA 2DT1A 1PIGA 1D2KA 1B2YA 3WNKA 4DUXA 3VINA 2NW0A 1UD5A 2YL8A 4UQDA 5E9AA 4F79A 1PJ9A 3VD3A 4MNLA 1V0KA 3PZUA 1US3A 3OB8A 2ZIDA 3AICA 2VCBA 1DTUA 3FXYA 2VI0A 1WDSA 1EHAA 1E4IA 2WXDM 1E4MM 3M46A 1XH1A 5A95A 3NYDA 2WVTA 1ECEA 3VIGA 1VFOA 3MU7A 1GCYA 1LWHA 2BXZA 1J0IA 1V6UA 3BAIA 1E6QM 1GORA 5IDIA 1QHPA 1BGAA 5IFTA 1CGVA 4AD1A 1BGGA 2BY1A 2WHKA 3L4XA 4UFHA 1HP4A 4HPGA 3N11A 1NP0A 3I3DA 1CGXA 4ZENA 2WCSA 1C8XA 1Z32X 4B3KA 1GUVA 1FH8A 3TOPA 3RO8A 4AWEA 4OOZA 2VUYA 5DEZA 3N04A 3EMCA 3WMCA 5BRQA 4GIAA 3EDKA 4UFMA 3ZT6A 1OT1A 1O7AA 5FOOA 1FFQA 4YHEA 2JE8A 3AHXA 1XC6A 4GKLA 2V5CA 1MXDA 2JEQA 5CGMA 2YDSA 3BSGA 5DF0A 2PI6A 3WIJA 3WSUA 1GVYA 1BF2A 2YIHA 1GJWA 2YL6A 3GH4A 3GDBA 4CCEA 3EDJA 4KRUA 2IXVA 3QOKA 1JNEA 1X6NA 3VO0A 4Z2JA 4D1IA 4AZ6A 1V08A 3BXWA 3W25A 3AFBA 2XWDA 3WENA 2FHFA 4LQ1A 4U2ZA 4CCCA 4H8UA 2VO5A 3J7HA 1LLOA 4WIWA 1E9LA 1HKMA 4W8AA 2A3HA 4NF7A 3AHZA 3DC0A 1ZJBA 1E55A 1DWAM 4MB4A 1XRVA 3GXDA 4IM4A 1VBRA 3MUIA 2OLHA 4AEFA 3VM7A 4CN1A 5M5DA 2Z1SA 4N42A 3TTOA 4GO9A 5FIPA 5A6BA 1B3ZA 2ZE0A 2BVDA 3K8LA 2X0YA 1US2A 4CD6A 3CZ8A 5DT5A 1QNSA 2YA1A 1LL4A 1MXGA 3UESA 2VX7A 3ZR5A 2XYLA 2VC9A 4R5EA 2GFTA 2XVLA 3M07A 2QPUA 3EBVA 1FHDA 4P7OA 3KEHA 1SFSA 3AMGA 4W86A 4ML4A 4CD7A 1BVNP 1K9FA 4CD5A 2JEPA 5GQBA 1CYGA 1J9YA 2WMIB 1H0IA 3PZVA 3ZJ7A 1J0HA 2A3AA 1CDGA 1M53A 1UYQA 4U2YA 3CGTA 3WUBA 3A4WA 1PBGA 4JFUA 1NOUA 1JZ3A 1BVZA 4GXPA 1JDDA 1V3LA 3GNPA 2XSBA 2NSXA 5CSUA 1GOKA 1GOWA 3QHNA 3T2OA 3POCA 2O92A 2WK2A 1H5VA 5DMYA 4W85A 2ESCA 2DIJA 2V3EA 4JHZA 5CLWA 1FA2A 4MTVA 2DSUA 1NOWA 2VT0A 1JYXA 3MANA 1B1YA 4KWUA 3EDFA 1HJSA 1MW1A 1W1YA 2E8YA 3W6MA 3WBEA 2JIWA 2X2YA 4D71A 4NRRA 2E9BA 1BYCA 1BAGA 1LG1A 2J8FA 5E0FA 3AMCA 3AIRA 4JAWA 2DSWA 3WQ5A 2UWFA 3L2MA 5IHRA 3MUY1 1UR8A 3ARRA 3OLDA 3ZT7A 3SCWA 5JBDA 5A6JA 3OGRA 2WVUA 2WMJA 2VRJA 2YBTA 3VD9A 1NOFA 4JFVA 5CLTA 1JGIA 3UCQA 1G0CA 4OBSA 2J75A 4PCSA 1UWRA 3FW6A 2D23A 3F5LA 5ABFB 1UWQA 3BGAA 2DH2A 2VOTA 4Z2KA 5LA2A 1W3LA 1VEPA 1E4NA 1NARA 3FHAA 2EO7A 1WZMA 4ZXLA 1V6XA 2XGIA 4E2OA 2VX4A 4U33A 1BG4A 4C7GA 1NWRA 3WD0A 5I77A 1UR1A 1F4HA 2ZX6A 1VFMA 4AZ7A 3VGFA 4M1RA 1KWGA 1GJUA 2CETA 4MADA 3U7VA 4E8CA 4HZ8A 3WFLA 2WAGA 3DECA 2J47A 1K9TA 1YQ2A 3U7BA 3FAXA 5A6AA 1NM9A 3GH7A 4H7VA 3VGEA 1E40A 2Q8XA 2WSPA 4MNJA 3VNYA 1U30A 1HIZA 1M04A 4H41A 4IISA 1E0XA 3QHOA 3SCSA 2ZXAA 2J7HA 1CXIA 2EJ1A 2MANA 4W7VA 2XFRA 3VIMA 5ABFA 4UQCA 2G41A 4AEEA 3A6OA 4YN5A 4JKMA 2V3DA 2VRKA 3K4AA 2Y8KA 5A2BA 4EK7A 3WNLA 3GXFA 2XVGA 4W7WA 3HN3A 1LL7A 3TTQA 1MYRA 4J3WA 4W84A 1HL9A 3IJ7A 2BY2A 2WC7A 5JUVA 1V0MA 2XIBA 3TTSA 4Z2HA 1A47A 4PMQA 2GDUA 5F7UA 5AYBA 2D1ZA 3RM8A 3MUZ1 2PWHA 2BY3A 1JZ5A 1DP0A 4E8DA 2VL4A 4GZEA 4J3XA 4URIA 2PWDA 3WDQA 1B3XA 1J18A 3FNDA 3MS8A 1M01A 2UY5A 4M29A 1KXTA 4AD3A 5A8OA 3IAQA 4DM1A 1MW0A 2O9OA 4J3VA 1W9XA 5AC5A 1HKIA 5HOSA 5BXTA 4B9ZA 2WCGA 3SCVA 3VGGA 4HP5A 1J0ZA 2PWFA 4JKKA 1N82A 2WLYA 3AIWA 2WMIA 1VAHA 2QV4A 4PTXA 3ZT5A 4BCEA 1JZ7A 2Y24A 1W9BM 4MNKA 1PX3A 5E0CA 4X0NA 3S2CA 4D72A 3GZAA 5IFPA 4PUEA 3NDZA 4K68A 2AAAA 1E73M 2CBJA 1WE5A 2ZOXA 1NWTA 3THDA 3UERA 5DFAA 4IPLA 3II1A 1O6IA 1E6NA 3FAWA 4WJXA 1U2YA 1VJSA 4AW7A 1GVIA 1E5NA 2W61A 2FHCA 2WW5A 6TAAA 4KH2A 1QI0A 1IT0A 5HBFA 4BQ4A 4PBGA 2A3EA 3BH4A 4LYPA 4PEEA 4HOZA 3EMQA 4PYSA 4QCFA 3A4AA 1B3VA 2BS9A 1E3XA 1FP8A 3S6TA 5I5RA 5ABHA 2CHOA 1YHTA 1B30A 3VD4A 1EDQA 4JKLA 3QOMA 2WNWA 3IK2A 2Y8VA 3W26A 1TA3A 3B8SA 1QI2A 3OLGA 3WDIA 2WHLA 3PZMA 1Q6DA 3GH5A 3WEOA 1E3ZA 5I6SA 4OIFA 5A6LA 4FF5A 3WKZA 3OA5A 4D6GA 4Y7EA 1XCXA 2WPGA 6CGTA 4ZXOA 1FH7A 2W63A 2YOCA 4A3YA 2D3LA 3ZJ8A 4GPNA 5TD4A 4PMUA 3AHVA 1ISVA 3MKKA 2E3ZA 1OIFA 2RGMA 4AYSA 5JIPA 5EBAA 5A1AA 4UCFA 3L4WA 1BG9A 2X05A 5CJ5A 3VPLA 1JDAA 1CXFA 1NP2A 4J28A 3W27A 3ARZA 1PPIA 3PZ9A 3WH5A 4EE9A 4J3SA 3T08A 8CGTA 1UR2A 1MQQA 1UD4A 1UWIA 4U3CA 2WCAA 1EDGA 2XSAA 2WLZA 4JCLA 2JIEA 1GPFA 4MJ2A 5I2UA 3VDBA 1HNYA 1RD6A 3CZJA 1ODZA 5A8MA 4ACZB 1R8LA 2JALA 2WANA 2XVNA 3NSXA 2J7CA 3AQUA 3APGA 3WF4A 4D6CA 2DGAA 1AQ0A 2VNCA 4M56A 1HJXA 3ARWA 1I75A 1ITXA 4DWSB 3WL1A 1CTNA 5D9MA 5I0DA 3OGVA 3K46A 4TVUA 1JNDA 5CZKA 2BY0A 1PEZA 1HF6A 3ARPA 1UH4A 3BAWA 4CUCA 1DHKA 1MFUA 1XV8A 1JD7A 2VZSA 1C92A 4B3LA 2CYGA 1Q6FA 1EXPA 5HPOA 2ZXDA 5CQ1A 3VGBA 3QHMA 2EPOA 2FHBA 4WSKA 1KCKA 3LPFA 1H49A 4OZOA 2CITA 2C0HA 4DWSA 2XIIA 2TAAA 5HXMA 1UR9A 3CZLA 4AISA 1KB3A 2X8RA 3BLPX 3VIJA 2CNCA 1UR4A 3TONA 9CGTA 5AY7A 1WZKA 3L2LA 3RJXA 1CGTA 2CHNA 2J62A 4GO8A 1JYWA 4UQ9A 4JFSA 2EPMX 3K8MA 3VX0A 2DQXA 1VB9A 4D6FA 2W4XA 3TP4A 4MB1A 3PZIA 3AHTA 3NCOA 1JZ4A 4W5UA 2DH3A 3OZPA 2XPKA 3WUFA 1K9EA 3NSNA 5CPTA 3ZSTA 3GNRA 1BLIA 4LPCA 2B31A 5DT7A 4L4PA 3NIYA 3U57A 4ZE4A 2HISA 3AIQA 2JF6A 3F5KA 4PTWA 1CECA 2VZTA 4D6EA 1HVQA 3ZOAA 2BVTA 2EQDA 3VMNA 2YA0A 1W9UA 3ZQ9A 1ESWA 4U31A 4AZBA 2EEXA 3CHCA 1MVYA 3AXIA 2GVYA 3B9DA 3PTKA 2AOSA 2VJXA 3WMSA 2WC3A 2DEPA 3JUGA 3WEZA 1EO5A 2CBIA 1TA3B 1UD8A 4PRWA 2WM0A 2EPNA 2WYSA 1Q6CA 2OSYA 4CKQA 1BYDA 4Q7NA 3CIVA 1BYBA 5I24A 2WC4A 2ZUMA 2EBNA 1NWUA 1VRXA 2NT1A 1CXKA 2G8ZA 4HZ6A 1C7TA 1HJUA 4HU0A 4P7QA 2CCRA 1XD1A 5A8NA 3CHFA 2WVVA 3W38A 3A4XA 5CPSA 2Y4SA 2CBUA 2GSJA 4JL1A 1B9ZA 3AMLA 3OG2A 2J74A 1DWFM 4UR9A 3T0DA 4AC1X 1G1YA 3IAPA 3BMVA 2UY4A 2WMFA 1W2PA 3MO4A 3EYPA 4JFTA 1VEOA 1QHOA 2VX6A 4M24A 1W3KA 3CUJA 1B3YA 4YHGA 4ATDA 2YL5A 4WLCA 3AIUA 2AMGA 1OGBA 1CNVA 4CU6A 8A3HA 1IZKA 1B3WA 3PBGA 5AYIA 4ACZA 4W5ZA 1C93A 3VKKA 1CXLA 4A4AA 3SUTA 1PZ2A 2WSKA 2VVSA 1UD6A 2WVVB 3PHAA 5I3DA 5DO8A 2CBVA 3AZSA 4UFJA 3WNMA 3GNOA 3UR7A 1UD2A 3VDAA 1WP6A 1VFFA 1V6VA 1QW8A 4UZUA 3WDHA 2OWCA 4TUFA 1WKYA 2YA2A 1CLVA 1VENA 2VVNA 2VCAA 3VVGA 1WDRA 3ZJKA 1JI1A 1OINA 2ZX8A 4JCMA 4WK9A 4JFWA 1QHZA 1JXJA 1UR0A 5C71A 2HVMA 1R85A 1E15A 1EQCA 3IANA 1KGWA 4XV0A 4S3KA 5CXPA 2EPLX 5ECUA 3THCA 4JZ5A 3L4TA 4PMXA 1HP5A 3OBAA 3N9KA 3NUKA 3AS1A 1F4AA 3BMWA 3O2LA 3G6MA 5M03A 2QHAA 4CD8A 1WB0A 1V6WA 1Q4NX 2J7DA 3OZOA 2BHYA 3ZSSA 2G3IA 1S46A 3WH7A 2W92A 1W3JA 1VBUA 3NDYA 1WDQA 3LMYA 5A69A 1WO2A 1E1FA 4AY1A 4U5IA 1HT6A 4UQEA 1R7OA 3UR8A 1UA7A 1OBAA 4M80A 4EANA 3VIFA 2QMJA 2F61A 2DT2A 4S3JA 1M7XA 1BFNA 1OCQA 3AMKA 4MNMA 4AD2A 4UQBA 5FD0A 1XSIA 4KRTA 1E5JA 2ZICA 3D5HA 2E9MA 4BQ3A 1ZL1A 1AQHA 1B0IA 1J12A 3T2QA 3VDHA 1NWSA 2OYMA 1XH2A 3VIHA 4BA0A 1QNOA 1WZLA 1GW1A 2XHYA 2EXOA 4BQ5A 2VURA 4HTYA 6A3HA 5LYRA 4Q22A 1FOBA 2ZWYA 3WUEA 1EOKA 1MW2A 4KGLA 5FKYA 1UA3A 2WWDA 3IJ8A 2VZOA 4H8VA 1JI2A 5I23A 3GXIA 1JFHA 3L4UA 3WD1A 4NSBA 4AZIA 1GOOA 2DIEA 4XZWA 4F9DA 4FLQA 3N1AA 1KGUA 3CUGA 1MWOA 1K6AA 1XSKA 4UNIA 4P8UA 1RP8A 2D0GA 3SUVA 3BCDA 2XM2A 4PTMA 5C8BB 3RILA 3SUUA 4PSPA 4AZGA 3PZGA 4CCDA 3SIMA 3VGHA 5CSYA 5A94A 5D8WA 4W8LA 4ZFMA 1UZ1A 4LXFA 1E6XM 3TA9A 3AS2A 3VIOA 2J79A 4XUYA 1OT2A 2FGLA 1UD3A 2OSWA 2QMKA 4HPHA 3WD4A 5JBFA 3KL3A 4QAWA 1E6RA 4FLOA 3WQWA 4FMVA 4W7UA 4BF7A 1HVXA 4ZE5A 3FHQA 1XCWA 3BAYA 3KL0A 4GQQA 1H1NA 2D2OA 4XZBA 2VQUA 4IUGA 1KFWA 1J0KA 1SR0A 3PZQA 2QPSA 5HPCA 3AJ7A 2BNJA 2BV9A 3L4YA 2PC8A 3K8KA 1KXQA 2VR5A 1DWGM 5A2AA 1XD0A 2DSKA 4WKFA 1QBAA 5A8PA 4CVUA 4H8HA 4M8UA 1CEOA 3WN6A 2PWGA 4NRSA 3TTYA 4AZCA 2W91A 2ZUNA 1TMQA 4HMCA 3ARVA 5EFFA 1CENA 4BS0A 1CXEA 4UOZA 4P7RA 3G6LA 3MV01 3W81A 4D6JA 3GBEA 1W1PA 1FP9A 1Q6GA 4MAVA 4LX4A 2XUCA 2JFEX 4AIEA 2X0HA 1TVPA 4KGJA 3PZTA 2VZVA 3L4VA 3K4DA 4KMQA 2OWWA 1QVBA 3KWXA 1PX4A 5HDRA 2J25A 1I1WA 3UG4A 1V3KA 4DUVA 4L4OA 1ZB5A 5CPQA 2OSXA 1MW3A 3MMWA 4RE4A 4AZCB 2YDQA 3VX1A 1TG7A 3ALFA 2ZUWA 3AI0A 4D1JA 4EKJA 1M03A 3EDDA 3N13A 7TAAA 3SCQA 1OIMA 2WHJA 1H0GA 4BZYA 2BXYA 3AISA 2E8ZA 2YBUA 4RE3A 1W32A 1KR1A 4HU8A 3GXMA 5M17A 4WKHA 1ZBCA 3WF3A 4IPNB 4XX6A 3N12A 1DEDA 2J77A 4TX6A 4TTGA 2F8QA 5E70A 4ZEPA 1W2VA 1GNXA 1WCGA 3VD5A 4MB3A 5E09A 5A8QA 3W37A 4TX8A 3L4ZA 1JF6A 4TTUA 1Y7VA 3W28A 2PBGA 3ECQA 5GNYA 4CD4A 4PMOA 4QLJA 3CPUA 1UWSA 1PX8A 3QGVA 1JFXA 1E71M 5BROA 1BPLB 2FH8A 1EHNA 2J7BA 2WZIA 1J0YA 4HOWA 1NQ6A 4JIEA 1C7SA 2J4GA 1V02A 1JAEA 4HMEA 1P6WA 3N18A 2ZX9A 1MQRA 1LJYA 2FDMA 4F8XA 3AMDA 4H04A 1ZBWA 3AHYA 5C70A 2WWCA 3WD2A 3LPPA 4J7RA 4AZ5A 1HKKA 4MJ4A 1VEMA 2C8NA 3DHUA 4NI3A 2DSVA 2QLYA 3UEQA 2WB5A 5D9OA 1JL8A 1J0JA 2J78A 1E6ZA 3RJYA 3KL5A 3ARTA 3WF1A 3ZJ6A 1TZ7A 3RIKA 4GZJA 4CU8A 1AQMA 2D0HA 2WVSA 5D9NA 2V3GA 2D24A 1E43A 3VU2A 4WF7A 3K1DA 3DYOA 1ZS2A 3BSHA 3CZGA 4W89A 4UQAA 2O9TA 4GI9A 1VJZA 5I78A 4J3TA 1E6SM 1TCMA 3VIPA 2YDRA 4CN4A 1V0NA 4QLLA 4QLKA 2Z1KA 1ISYA 5A3HA 2X09A 4H2CA 1J11A 3WH8A 1PZ3A 5EFDA 1AVAA 2G3MA 1OD8A 3SCTA 5I79A 1V02E 3FY1A 3VOCA 2ZUSA 3VDCA 2ZXQA 3AOFA 1W1VA 5BWFA 3PTMA 2ZUVA 4OJYA 2A3CA 1E1EA 1VIWA 3VTRA 3PZOA 3W4RA 4MDOA 1KBBA 2CKRA 1X6LA 3UETA 4OUEA 3U5UA 3HJEA 2DSZA 5GNXA 2UY2A 5IHSA 1W91A 1WPCA 1OM0A 4AIOA 4PSRA 1U33A 4M82A 3RPMA 2E40A 5GNZA 4ACYA 1EGZA 3RDKA 4P8WA 3ARQA 3ZR6A 2YJQA 1G01A 4AD4A 3VGDA 1H41A 1BSIA 1I1XA 2E0PA 4F9JA 3MSGA 4ATWA 1ZBKA 4PMYA 1QOXA 1QNPA 5A6MA 4V27A 2IUZA 1V3IA 3CHEA 1W1TA 4HA1A 2GDVA 5CG0A 1EO7A 3T0BA 1V6YA 2XGBA 3KZSA 1RPKA 1UH2A 3WNOA 1SMAA 1E72M 3EMZA 3BAXA 1JD9A 2IXUA 4TVCA 1DWIM 1SMDA 3ZIZA 1WDPA 1LQ0A 1VF8A 4MB5A 3OGSA 5E6YA 1UKOA 2UY3A 1EDTA 4LYQA 1HJVA 2W66A 2V3FA 2ZXBA 3CZKA 1X1NA 4UFKA 4LGXA 3WNNA 2GK1A 4B9YA 1V0LA 4AIUA 1C91A 1HKJA 1HX0A 1C90A 2D22A 2WKLA 2W5FA 1C8YA 3GTNA 2Y5EA 2XFYA 1UHVA 4XB3A 4PMDA 3WH6A 1H09A 4X9YA 4B16A 1CGYA 3LPOA 2OYLA 1GQKA 1XYFA 4AD5A 4DM2A 3HMCA 1G9HA 1K9DA 3CMGA 3M7SA 3CUFA 2XG9A 3VNZA 1NH6A 4PMRA 4QFUA 3FN9A 3ARSA 4CU7A 5LA1A 4J27A 3B9EA 3AROA 2YKKA 3ARYA 1WAWA 3WDPP 3AZTA 3T0AA 1KQZA 2GK1B 3DYPA 3VMOA 4PTVA 5M3WA 4CVWA 1JYVA 1KWKA 2CERA 3MUAA 2DT3A 1FH9A 4HMDA 1ZU8A 1XH0A 2CXGA 4P7LA 3CUIA 1LF1A 5A6BD 4ATLA 4DWSD 1OGGA 1CPUA 3SCNA 2DDXA 4PMNA 2WBKA 3WQ6A 4E4PA 1EA9C 5D4YA 3WQVA 4C7FA 2J8GA 2VCCA 3CMJA 1UWTA 2QF8A 2PF0A 3BAKA 1GHRA 1B31A 3A3HA 1JXKA 1JZ8A 1TUXA 1HJQA 2WZEA 1CXHA 4QCEA 4TOQA 1XYZA 1W9PA 4MDPA 3DYMA 2O9RA 4OBRA 1CWYA 3ZM8A 4P8XA 3W82A 1GOQA 3WY1A 3E1F1 4PN2A 1C8QA 4WSJA 3VD7A 3AYRA 1EH9A 2O9PA 5EB8A 3WD3A 1E6PA 1BTCA 1UQZA 3HU7A 4OKDA 3WELA 1HXJA 5LA0A 4HZ7A 4OOUA 2VZUA 4X0VA 3CHDA 2GJXB 2JF7A 3O9NA 1QI3A 2XVPA 5EMYA 1HJWA 1FHLA 1KXVA 2GJRA 4Z2GA 4U3AA 5BYWA 2A3BA 3RM9A 3D3AA 4UOJA 4HA3A 1W9DM 2FGZA 1L0PA 1R87A 5BCAA 1JIBA 4HOXA 2X1IA 3ZMRA 4C7DA 5E6ZA 1KBKA 2XJ7A 3KE0A 2YLAA 3CBWA 1PIFA 1GQLA 4Z2IA 1QW9A 1G5AA 1OD0A 4FK9A 3T09A 4A3HA 2GJPA 4W87A 3WF2A 4GINA 1IV8A 2VMFA 3VM5A 1D3CA 1J01A 2VR4A 1IZJA 4DWSC 4CGTA 1JAKA 1W9VA 3ARXA 2DT0A 2WBGA 1RP9A 3AS0A 3RCNA 1DWJM 1PAMA 1CLXA 5FL1A 3GBDA 1UQYA 2VRQA 2E4TA 3RM4A 3W0KA 4AZHA 3VIIA 2ZUUA 4P8VA 3MSDA 2G3JA 2XM1A 1KR0A 1UOKA 4F66A 1V03A 3W29A 1ISZA 4UFLA 1GQIA 5ABGA 3AS3A 3AIBA 3I3EA 1GONA 1H3GA 1GHSA 1XGZA 1H2JA 1E0WA 5A6SA 3AYSA 3PN8A 3VIKA 1LG2A 2VTFA 2GUYA 2WHMA 1DWHM 1KCLA 3SCRA 3SUSA 1A3HA 1AMYA 1L8NA 3AXXA 1FFRA 1RH9A 5BXRA 1ISWA 5A2CA 4D6IA 3SEPA 2D20A 3PTQA 3WMBA 1V3JA 1ZJAA 2V5DA 4RE2A 2G3NA 2PWEA 3W24A 3WQ8A 1HN1A 1CGWA 4BQ2A 1JZ2A 3NJ3A 1UKPA 2PB1A 5AC4A 4TVDA 2CESA 2V38A 1OSEA 2XTKA 1H11A 1V3MA 1CBGA 2D0FA 4AMCA 3IJ9A 3WQ4A 5BXSA 4V2XA 4GQRA 2F2HA 3ALGA 1V3HA 4RL3A 2BHUA 2DPEA 2XVKA 1GOMA 2CKSA 1LWJA 2XFFA 4P7NA 4PCTA 2WMKA 1UG6A 3CTTA 3O6AA 1UWUA 2Y2WA 3AIVA 1GOIA 4D6HA 3WDRA 4MAZA 3F5JA 3U5YA 4HA4A 1OGSA 2CIPA 4QDMA 3OLEA 4PUDA 1WNOA 1ZBVA 3WF0A 4U5KA 2CEQA 2C7FA 1E70M 4WKAA 4AD0A 3AIEA 7CGTA 3NSMA 3W6LA 5ABEA 4W8BA 3MMDA 4N0RA 1QPKA 1J10A 3F4VA 3WDJA 1UKSA 2WMGA 4FLRA 1UH3A 1BYAA 5CGTA 4DUWA 5JIWA 1UZ4A 2BFGA 3MV11 3ZO9A 1VFUA 2E9LA 5KZ6A 5D9PA 3WNPA 4UFIA 1XSJA 3WBAA 3RMEA 3OIHA 3BCFA 3B9AA 3A47A 1HL8A 3LPGA 3GYCA 3CLWA 2PBOA 1ITCA 1JDCA 1R86A 1TR1A 1JZ6A 4Z2LA 1H4PA 4GZIA 3M6DA 1C3FA 4TXEA 5HNNA 1SYTA 2G4FA 1E0VA 3BC9A 2VX5A 3GM8A 1EOMA 3CUHA 3UG5A 4PMZA 4FLSA 1LL6A 5BXPA 2GJXA 3MMUA 3SCUA 4M81A 4UZSA 1QNRA 4JL2A 2WMHA 3EDEA 2J7GA 3BAJA 1KGXA 1QBBA 1TVNA 1D7FA 4GI8A 2W62A 1TFVA 2ZX5A 3WEMA 1CIUA 2BVYA 3BLKA 2WZHA 5GPRA 1EQPA 5BRPA 3CO4A 1BHGA 3AXHA 1TE1A 1MFVA 3WFZA 3SUWA 1UUQA 1QI4A 3N15A 2J7FA 4QP0A 3SURA 2FH6A 5A6KA 2ZUTA 1GQJA 1KQYA 4UOQA 1G94A 4W93A 1WZAA 2NT0A 2RGLA 4PMVA 3WUGA 1JF5A 2YL9A 4GI6A 4UTFA 5JBEA 2VQTA 1JYNA 3ARUA 5FCZA 5D8ZA 1OWQA 1W3HA 1R7AA 1ODUA 2WKGA 2ZWZA 1QI5A 1UKQA 1BQCA 4EAMA 1Q6EA 1UKTA 4W88A 3CH9A 2XWEA 3UG3A 2EPKX 3POHA 1XHGA 1E4LA 3VILA 4V28A 1E56A 4AXNA 3CZEA 3OLIA 2OWXA 1EIBA 2ZX7A 1CZ1A 4D6DA 3WH9A 1MQPA 2YLLA 5FL0A 7A3HA 1ISXA 3SCOA 3I3BA 3VMPA 4JHOA 4MPKA 2BHZA 2CPUA 2W67A 1GZJA 4B15A 2D3NA 1OB0A 3N17A 3WL0A 1CGUA 4YPJA 4NZCA
chains in the Genus database with same CATH superfamily
1XLKA 3L5MA 3SCPA 4J3UA 1WUFA 3B8IA 4F0MA 1I0DA 3HZ3A 4EXAA 4MGGA 1I6NA 2R1NA 4ADUA 1QU4A 3IPWA 4DUXA 2YL8A 3MZNA 4UQDA 5E9AA 1PHQA 1PJ9A 4MNLA 3S9YA 1J96A 5JVLA 3CL8A 3PPHA 4KBXA 1M3UA 2POTA 5CG7A 1ZLPA 1WDSA 2FZMA 2I7GA 1E4IA 5HNUA 3ZXWA 3C0QA 5FEZA 2WXDM 5G4WA 2QQ6A 2RJGA 2CFFA 3VIGA 4JGDA 4KFOA 3MU7A 2X1UA 1GORA 4JTEA 2J6VA 4NASA 5CJNA 4AD1A 1ZGDA 3F2CA 2BY1A 2Z29A 3I7QA 3AAMA 1NP0A 4YWIA 2WCSA 1C8XA 1VC4A 2O55A 2P88A 4R53A 3RO8A 4AWEA 2H90A 4OOZA 2VEPA 3EMCA 1V79A 4WCJA 3WMCA 4JTTA 4UFMA 1XISA 1OT1A 2AQOA 4GE8A 2JE8A 3AHXA 1XC6A 4XZIA 3M41A 5IRPA 1MXDA 5E1QA 3LTSA 2PDQA 3T4CA 2E09A 3UVIA 3MZ2A 1IXPA 3O6YX 2B81A 2I16A 3S1GA 4H9XA 4YVVA 1XKJA 1X6NA 3CWNA 4D1IA 2OT0A 1LLZA 4KIRA 5DCBA 7XIMA 3G1VA 1V08A 3KRZA 4C6EA 3AFBA 2XWDA 4GABA 1RJPA 3WENA 2FHFA 4LQ1A 5A8GA 5REQB 1LLOA 1QK0A 2QVHA 2CLEA 4Q33A 3BQ6A 1W56A 2H6RA 4EF8A 3DC0A 4FS9A 2J8TA 3MP5A 1DWAM 2YCLA 2Y7GA 4WXZA 3ID7A 1IEQA 1JCMP 4IM4A 4GQ0A 1RJQA 4CN1A 5JQ9A 5U7SA 2B7OA 2OVLA 5A6BA 1WBHA 2BVDA 2X0YA 4UIOA 4CD6A 2J9YA 1LL4A 3UESA 2VX7A 4LUTB 4M6PA 4WVXA 2QPUA 4P7OA 1RZMA 4W86A 1SFSA 3LOTA 4FAMA 3TLLA 4ML4A 4CD7A 1K9FA 3R8RA 1AK5A 2GOUA 2PCEA 2WMIB 3LNPA 4FOUA 4JQ2A 3GRIA 3IGXA 2Y5SA 1UYQA 1NDYA 2VC5A 3TJXA 3TV8A 1VR6A 4GYJA 4Q8PA 3WUBA 1IWPA 3A4WA 3TFCA 1FHUA 4LB4A 3RX3A 1A4MA 1QFEA 3SY8A 4WDXA 3MUXA 3GNPA 1SZRA 2F6UA 4A29A 3QHNA 2P3EA 5FJJA 1ZZMA 2WK2A 4MVAA 3UR2A 1H5VA 2VGIA 2QEZA 2DIJA 5D09A 2OPJA 4JHZA 2DSUA 1HGWA 2OEJA 2YYUA 2VUNA 2GGJA 4KWUA 4KWOA 4GY1A 1W1YA 3W6MA 3WBEA 3SN1A 4TX9A 3RLHA 3Q94A 1ZPTA 4HNTA 1RVKA 2J8FA 2E7FA 3AMCA 3WQ5A 4JAWA 3L2MA 1VYSX 1UR8A 7ENLA 2ZVRA 3OLDA 4O50A 5JBDA 4HNNA 2WVUA 3U2ZA 2YX0A 1B3OA 2VRJA 1ICPA 4A8RA 5CLTA 3TZNA 3EWWA 5M2FX 4HSHA 3F5LA 2VOTA 1B4KA 4Z2KA 4RCXA 4ZXLA 1V6XA 4E2OA 1TV8A 2WZTA 4C7GA 1AZ2A 1NWRA 3WD0A 4A2RA 3TWBA 4C60A 3M7WA 4M1RA 3UY8A 5CAKA 4ZFCA 2ZRWA 3FJ6A 4E8GA 3WFLA 2WAGA 3UY7A 1YQ2A 2JGYA 3GH7A 1CW2A 1HW6A 2ZCGA 3NQEA 4MNJA 1DJZA 1U30A 3VNYA 1E0XA 1V7AA 1FQ0A 1CXIA 3C2EA 2EJ1A 2XFRA 3VIMA 1UP2A 3ABRA 3CAWA 4UNKA 3NG3A 1Z89A 2DQWA 3G18A 4YN5A 3I6RA 1EPVA 3BMXA 3QJAA 3EPNA 4QR6A 5A2BA 3BCJA 3TMQA 3I10A 3PM6A 4IT1A 4IPIA 3L66A 3LGGA 2VGBA 3FIGA 2WC7A 3EOUA 4RDYA 1SSGA 1P0DA 3SECA 3PWAA 1L6WA 1A47A 4XD5A 4GCXA 2C1IA 3RM8A 4LWWA 2GJLA 3CUXA 2VL4A 4URIA 4J3XA 2PWDA 4AH7A 3E9AA 1J18A 4LH8A 4M29A 3FEMA 1HO1A 3IAQA 3N4AA 2R82A 4QAIA 4J3VA 1GK8A 1W9XA 3FOKA 5AC5A 1HKIA 3QMSA 1E0TA 3MCNA 4JN7A 1PKLA 4HP5A 2CLHA 4JKKA 1N82A 1U1HA 3AIWA 4ZOCA 1VAHA 2QV4A 4PTXA 3ZT5A 4BCEA 2XH0A 4PZVA 1PX3A 1TPC1 2HK1A 4D72A 5IFPA 2ISSA 2QGYA 4YTQA 1WE5A 1NWTA 4MWAB 3ITYA 2DFAA 2HMCA 2A0NA 4PUKA 5DFAA 1LUCA 1O6IA 3S46A 1U2YA 1GVIA 4IJCA 4Z1CA 4ORIA 1ZJIA 3RX2A 4PBGA 2A3EA 1SO6A 2E5BA 4QQUA 1J5TA 2EG7A 3EMQA 1MZRA 1B3VA 1T96A 4ZQCA 1XIEA 3QGKC 2BS9A 3QYQA 3BANA 2HBXA 4QJ4B 1QPNA 1E3XA 3ENLA 3S6TA 5I5RA 4QISA 1B30A 1FCUA 3HURA 1DXEA 3RRAA 2EAWA 2WNWA 3IK2A 2Y8VA 1EJRC 3B8SA 2NUXA 1SFJA 4MUPA 2VGFA 2WHLA 3QBUA 5A6LA 1P0EA 3U2OA 4Q4KA 1FWDC 4ZXOA 4GJJA 2W63A 3NZRA 5EKYA 2D3LA 4GPNA 4PMUA 4DJFD 5BMXA 1YDVA 2PLJA 3HPZA 5HWMA 1TTQA 4ROQA 2PDWA 4XKYB 4UCFA 2PDKA 1QJWA 2H3BA 4O1EA 3CQIA 3THQA 1LWIA 2PLMA 4JR5A 1JVNA 1AJ2A 1EP2A 3R58A 3PZ9A 4UWMA 3WH5A 4INFA 3E5PA 1ML1A 3GS6A 1UR2A 3C0JA 1MQQA 4U3CA 1EDGA 4JIPA 3TK7A 1TQJA 4JCLA 1OYCA 4EACA 1GPFA 2ZZ5A 2HXUA 4GIRA 2NXGA 5A8MA 4ACZB 2WANA 1XLLA 4O16A 3NSXA 3AQUA 4DO4A 1RQBA 3OIXA 2A6LA 1AQ0A 1CTNA 4YXGA 3QMTA 4C65A 5I0DA 1U1UA 4TVUA 1JNDA 2DZUA 1MEWA 4F2BA 3EEZA 5I3JA 4LCRA 1HF6A 1AH0A 3ARPA 3BAWA 4CUCA 1FWBC 1B57A 1RBOB 1MSSA 1EGVA 4ERGA 3UT0A 1PKMA 2ATMA 2CXEA 3H2AA 2CYGA 2VWTA 2QDEA 2NUYA 1EXPA 3S5SA 3C0LA 4ERIA 1H51A 2Z00A 1XUUA 1R3QA 5FEPA 4Z0SA 5CQ1A 4H3DA 2VFGA 3VGBA 2PGFA 4FSAA 3WQEA 3KAOA 2PP1A 3WLJA 2XIIA 1UR9A 2X8RA 9RUBA 1YXYA 1N8IA 2YPIA 3CIWA 3RJXA 1CGTA 4RR4A 2CHNA 3TWAA 3ES7A 3RLVA 4L5ZA 4UQ9A 4Z1BA 3M0ZA 3KRBA 3VX0A 4FX7A 4XSLA 1FXPA 3VNIA 2QZRA 4FALA 4HU3A 1Y5XA 4W5UA 2DH3A 1NF7A 4BY3A 1TTJA 3GNRA 4FXJA 2B31A 5DT7A 1NIUA 1EJWC 4DQWA 4JOMA 3U57A 2H3DA 3T07A 4A22A 1G4EA 2VZTA 4QBXA 1HVQA 3ZOAA 4L61A 2I5IA 3VNDA 1D9EA 4PCPA 4U31A 1MDLA 1G4TA 2Z28A 2EEXA 3CHCA 3K4WA 3AXIA 2GVYA 1EBHA 3CH0A 1SQ7A 2JGQA 5I00A 1OZMA 2MNRA 2WC3A 5GJNA 1TA3B 1FWHC 1XGDA 3GVGA 3HGRA 3M0JA 7PTDA 3VOIA 3GU2A 1FWIC 1Q2RA 4GVIA 3ATYA 2TODA 1LT7A 2ZUMA 1K7FA 2EBNA 4UB9A 1RVGA 4Q8VA 2G8ZA 3MA8A 4HU0A 1TJ2A 3W7PA 3STPA 3W38A 4GNVA 2Y8UA 3IRSA 4ZOBA 4FP1A 3WQPA 1K8ZA 2XN1A 2GSJA 1RLDA 5CBIA 3S6DA 1F7BA 3W1PA 4FPSA 4JL1A 1DWFM 5AHIA 4ZOEA 2DVTA 4AC1X 1G1YA 5XIAA 1W2PA 3O7UA 4V1YA 5FSDC 3MSYA 3OQEA 3EX4A 4JY8A 3BLDA 3CUJA 3EEGA 4RZ6A 4OHQA 1B3YA 3TH6A 3WLLA 3AIUA 3QV6A 2AMGA 2QVNA 1CNVA 4C90A 3LERA 3QYSA 5CC3A 1B3WA 1XIHA 1Q2SA 3AUOA 1MRAA 1R3YA 1C93A 1PZ2A 3TR2A 1UD6A 5I3DA 4JQAA 3LHUA 3SRFA 4HJWA 1WKEA 4BF9A 4HKPA 4L1WA 2PDLA 3EOLA 1VFFA 3KX6A 1V6VA 1H7NA 2QDDA 1QW8A 1IHIA 4TUFA 1VENA 2VCAA 1WDRA 4IQEA 3WLTA 4L9ZA 3NPVA 1X1ZA 4LF2A 5H6HA 3ZJKA 3CPGA 2ZX8A 1UIOA 4DEFA 2ZZ4A 4CNUA 3E74A 4QSHA 4Z0JA 3UWWA 2AKMA 3WCZA 1XIGA 3FA4A 1FVPA 3LGEA 3IANA 3DDMA 3QV8A 5CBJA 1KO0A 2WKJA 4S3KA 5CXPA 4ZSTA 4PB3A 4FO4A 3L4TA 4ZVJA 4G6CA 1S2VA 3G1AA 3BMWA 4CD8A 1WB0A 1V6WA 1VH7A 6ENLA 4YS1A 3OZOA 5LIUX 3G22A 4WRHA 1PCWA 1S46A 2W92A 1W3JA 2FMNA 5C9RA 1VBUA 3LMYA 1XLJA 3KVLA 3GG1A 3VCCA 4S1FA 3UXDA 3SQSA 4MKNA 5BMWA 1ENUA 4QS6A 1OBAA 4M80A 4EANA 3VIFA 2QMJA 3MYOA 1WUEA 4MY9A 2F61A 3VKJA 2DT2A 4G1NA 1M7XA 2V2DA 1BFNA 4MNMA 1K8XA 3TZFA 1F8MA 4BQ3A 3V5OA 1B0IA 2DZSA 3QN3A 3DU0A 1WZLA 1GW1A 4HTYA 4N9CA 5LYRA 1FOBA 3SQMA 1MW2A 5C7VA 3A5FA 1S5NA 1D8WA 1JI2A 4X61A 4E2DA 2C15A 3KVMA 4AZIA 4XZWA 1M41A 3RMJA 3N1AA 4HGXA 3FGCB 1POJA 1XSKA 3MHFA 4MFDA 3DGBA 3SUVA 3BV4A 4PTMA 5HANA 4S3EA 4I7UA 3TAOA 1TV3A 2NQLA 2PE4A 1SR9A 3KHDA 2WM1A 3KBNA 2KX9A 3TA9A 3STEA 2H8ZA 2JK2A 1OT2A 1S5TA 2QMKA 3BG3A 3N25A 2C1HA 4QAWA 1ZFJA 4UTWA 3KVKA 2ZA3A 4K2SA 4PTDA 2BOFX 4E3VA 3UZXA 4HMNA 2QV5A 4KFPA 3LRMA 4GQQA 4XZBA 2QNEA 5DY3A 4GFSA 3PZQA 2CWNA 2GGGA 3EB2A 2BV9A 2PC8A 1XD0A 2YW3A 3GTFA 4EF9A 2DSKA 4WKFA 1R30A 1UR3M 1QBAA 1JULA 3IVTA 3WN6A 2PWGA 4NRSA 3XINA 1U5VA 3ABZA 3QQ1A 3LRKA 1EWEA 2W91A 3LM7A 3Q67A 4QX4A 2ZUNA 3GHRA 4HMCA 5AFDA 3G24A 3BICA 1SW0A 3D0CA 4DYJA 2H8XA 2IPJA 8TIMA 4ZB5A 4B5WA 1ZTVA 3S5ZA 4S39A 2A6NA 4LEQA 1FP9A 2JFEX 2X0HA 3F4NA 1VPXA 5HWNA 2HPIA 3N2MA 4DJDA 2PMQA 4E4FA 5AHFA 3PZTA 3L4VA 3MCOA 3BG9A 4RW3A 1V3KA 3TSBA 3CB3A 4DUVA 2VEGA 5MHBA 4ZSUA 1MUWA 4LVBA 3MMWA 2X1RA 2SFPA 4AYGA 1T8QA 3N14A 1JCTA 2F84A 3ALFA 3AI0A 2YXXA 3M5ZA 3EDDA 5GJMA 4S3BA 3V0UA 2WHJA 1H0GA 1QPQA 2BXYA 3AISA 3TTEA 5HATA 2E8ZA 2CU0A 3G0XA 4HU8A 5M17A 4F4RA 4WKHA 3VC5A 2HE5A 4B5NA 4XX6A 3HPAA 2J77A 5E70A 3BOFA 2W27A 3GW3A 3W37A 3L4ZA 1JF6A 3KS6A 4TTUA 1OY0A 3W28A 3A22A 3ECQA 3AO0A 3W7HA 3O05A 1THFD 5E5CA 1VP5A 5C2XA 2A2IA 4IQDA 3F2DA 4QS5A 4HOWA 4O14A 4JIEA 1C7SA 4HMEA 2ZX9A 1M9HA 3AMDA 4AG0A 1XLIA 3CV6A 5LSMA 4K37A 3WD2A 1FWCC 3WK2A 4F2TA 5CPMA 4J7RA 2PUZA 3GVRA 3V0SA 1HKKA 2VWSA 1Y0EA 4I9AA 2QLYA 1R3WA 4OQVA 1JL8A 5FF4A 1J0JA 1TPFA 3ZR4A 2FZBA 1NFGA 1ZHAA 3EKLA 4GZJA 3UPMA 1KFKA 1AQMA 3NEVA 4ZA0A 4XZMX 3TYUA 4AX6A 2V3GA 2D24A 3VU2A 5AN7A 3DYOA 4W89A 3UZ5A 3WBXA 4UQAA 1VJZA 3TQ0A 5I78A 4J3TA 2YDRA 3AWOA 4O13A 3CWOX 4UR8A 2Z1KA 2G5WA 2X09A 2BXVA 1J11A 2RKXA 4TU1A 3WH8A 2HVNA 3FY1A 3VOCA 3BO9A 4XZ9A 5DCEA 5MKGA 3H12A 3NO3A 2INEA 1AA1B 2ZUVA 4LVAA 2A3CA 2NLIA 3CYJA 3HOJA 4FNPA 1UW9A 3LK6A 2CKRA 2O4MA 3GNNA 5LIWX 3U5UA 3HJEA 1TX2A 1RA0A 4AVFA 1WPCA 4AIOA 1DTNA 4M82A 2WSRA 4XIAA 5GNZA 4JTGA 3HPSA 3ZR6A 2YJQA 4AD4A 3VGDA 1H41A 4HHPA 2PDNA 1H5YA 1Z8AA 3MSGA 3NOYA 1QNPA 3TYEA 5A6MA 1C8VA 3CHEA 3MHUA 3T0BA 4Y6GA 5K4ZA 3TQPA 1OCNA 3AWNA 2DZBA 3UVAA 1E72M 3BAXA 4EXBA 4L1XA 3M0IA 4MY1A 1SMDA 3BW2A 3TX9A 3EPMA 1WDPA 1LQ0A 1A5OC 3GTXA 1EDTA 4LYQA 1HJVA 4KT2A 4KEMA 3T0CA 4LGXA 5I3IA 5EMJA 3PR2A 1BWLA 1M1BA 5DMLA 3LYEA 4K8EA 2P76A 1HX0A 5XIMA 1C90A 3FKRA 4C6JA 3M0XA 2W5FA 3R1ZA 4GH1A 2QCDA 2NQ5A 3BWWA 3ONCA 1UHVA 3IJ6A 4PRTA 4N4QA 4NIRA 1CGYA 3E0VA 2QXWA 1GQKA 1XFCA 1XYFA 4DM2A 3HMCA 4G2DA 4QDPA 4QDWA 4LU0A 1X1OA 1NTHA 1RY0A 2NXIA 1VCFA 2WZMA 4H7ZA 3FN9A 1XDLA 3TE9A 3FJNA 3LHTA 5LA1A 1XBZA 1F5ZA 3PK7A 3EX6A 3AZTA 4IX0A 1QOPA 3T0AA 3MBFA 4IMDA 3H2EA 3WK1A 5M3WA 4CVWA 4LAOA 3W87A 1JYVA 4PCFA 1DV7A 3W1QA 1P1MA 1YXDA 2DT3A 4O18A 1WBJA 1ZU8A 4DJDC 2QCDB 4PBEA 5C0QA 2FQIA 1L2QA 1AQFA 2R8WA 1YYAA 3UU0A 1LF1A 3GKFA 2CC0A 3C86A 1OF8A 4ATLA 1YXCA 3TVAA 3YPIA 1CCWB 4DWSD 3RF9A 5C6MA 3SCNA 3T81A 2INFA 4XTIA 1WQ5A 1XBXA 1EWDA 3WQVA 3MI3A 2NX1A 1UWTA 1B31A 3DG3A 4N9EA 3A3HA 4G7EA 1W17A 2GJNA 3WLKX 2BGQA 4U10A 1CXHA 4QCEA 4TOQA 1W9PA 3B4UA 3DYMA 2OOFA 3IJLA 4JTAA 1CWYA 3ZM8A 3WY1A 3DKJA 3B8UA 3CQ0A 3E1F1 1C8QA 3AYRA 4PEKA 5EB8A 3WD3A 4CNPA 4M7SA 3HU7A 5IM51 5LA0A 1HXJA 4HZ7A 4OOUA 2VZUA 5L6UA 4Q7IA 1VYPX 3CHDA 3B8WA 3O9NA 1QI3A 3I6EA 2DV0A 1HJWA 4GC3A 1KXVA 4Y9MA 1PYFA 1TWIA 4YNGA 3R94A 4F0KA 1W9DM 3W71A 5CH9A 1L0PA 3EXTA 1JIBA 1F8IA 1H1ZA 4IGSA 4C7DA 3CQKA 5F2GA 3FXGA 1WDDA 4ZOAA 3LRLA 4H1ZA 2ZDRA 4K36A 2XISA 3H22A 3WF2A 1W0MA 3WZ0E 5G4HC 3MCMA 2VMFA 5FA5A 4CGTA 4NAFA 3AS0A 3NA8A 3RCNA 1CLXA 3GBDA 1UQYA 1Z9AA 3TC7A 2VRQA 3W0KA 1TMLA 4P8VA 4YYFA 2Y62A 1KR0A 3CMFA 3K5XA 2HXTA 3W29A 4BFAA 4Q4OA 1ISZA 4JTKA 4JTLA 3W2LA 1OABA 1GEHA 3UWZA 3L68A 1K7EA 1KNWA 5A6SA 3I7SA 3AYSA 1OFRA 3VIKA 4BF5A 2NV9A 2GUYA 2WHMA 3SUSA 1XW8A 3MI6A 4LRSA 5BXRA 3SJ3A 4AF0B 1WXZA 4MY8A 1OCJA 2VR2A 2GLKA 4JN8A 2OXNA 2G3NA 2PWEA 3WQ8A 3CPRA 3L12A 4BQ2A 3UW6A 2PDMA 4YJ5A 1VFTA 4HPJA 3WLHA 2V38A 1P1XA 1DORA 4JEQA 4DJED 1H11A 1Q65A 1OF6A 1V3MA 3BLEA 3OTRA 3GVWA 1BXNA 5BXSA 2HS8A 3VOFA 4A05A 3CAQA 2BHUA 1JPHA 3GFYA 1UWUA 5D04C 3UGRA 3WDRA 5I02A 4QDMA 4S3CA 3KFTA 1O1HA 4PUDA 5DMMA 1SU5A 1WNOA 2CEQA 4LUSA 1PE1A 4X22A 3H54A 4AD0A 3AIEA 7CGTA 4BK9A 3STCA 3VNJA 5T9BG 2C71A 2O4QA 3GUGA 5ABEA 1QPKA 3WDJA 4XZLX 1XG3A 4OV9A 5IBXC 1BYAA 3N2BA 4OECA 5JIWA 4HQVA 1Z3NA 6PTDA 3DFYA 1J8VA 3BARA 1XIBA 3UJ2A 3GTIA 5HJYA 1HL8A 3GYCA 1F6KA 1OC5A 3SRHA 1TR1A 1JCLA 3S5YA 1R9ZA 2G4FA 3BC9A 2UV8G 1BRLA 3C3NA 4LUIA 4MZ1A 4PMZA 1IWAA 4GOAA 3MMUA 4UZSA 4V33A 2WMHA 2QJHA 5HMEA 1L6FA 1GKRA 1TVNA 1TFVA 1FRBA 3EPOA 4PUUA 3PJTA 2IPFA 2WZHA 1NVMA 2C0AA 5DX7A 3CO4A 1BHGA 1KM4A 3LCFA 3PC0A 4AB4A 2WPBA 1CT5A 1Q8JA 1QI4A 5CJMA 2FH6A 4I3GA 3PPCA 2ZUTA 4LVDA 1GQJA 1ZUAX 2ATSA 1KQYA 4UOQA 3CV2A 1WZAA 4ZQPA 3KCLA 3WUGA 3LHZA 1JF5A 4UTFA 3WJZA 3NQ2A 1JQVA 1YDNA 1W5QA 3VK5A 3B9NA 4NJIA 4H4IA 3PULA 4IXXA 4WJEA 1ODUA 1XCFA 2WKGA 1MI3A 1X97A 1ONXA 4IICA 1Q45A 4DXXA 4J35A 3I65A 1Q7ZA 1PHWA 2ALRA 2XWEA 3UG3A 3W01A 4GD0A 2BOGX 1A5KC 3VILA 3GDKA 4UTKA 1AD1A 1TPB1 2AMXA 2OWXA 1YEYA 1EIBA 2TSYA 6REQB 3WH9A 2REQB 1MQPA 3B4YA 1LCOA 1WA3A 4HHLA 1ISXA 4IIDA 3NURA 5E9XA 3VMPA 4LF1A 4MPKA 1ME7A 3GG8A 1Q7MA 3DI1A 3WL0A 3CIXA 2PZNA 4IFRA 3V7PA 2PPGA 4YTSA 4KERA 5CZ0A 3QR3A 1VS1A 3W53A 1O60A 3AZRA 4J5NA 4QJ5B 3H70A 5F4XA 3WLIA 5KETA 1KXHA 1B90A 1QNQA 1PIGA 5EMUA 1B2YA 2JKAA 2NW0A 3IUIA 4C6MA 3U0HA 3VD3A 1VIZA 3H2MA 2ZIDA 3OB8A 3AICA 3FXYA 3SB0A 5LNRA 4PC8A 1YPFA 4B4HA 1XH1A 5CPNA 4N9DA 3MHGA 1XBVA 3O0KA 3CT7A 1DYSA 1GG0A 2WVTA 2VD9A 4IG2B 4K7VA 1GCYA 4LC6A 2ZC8A 1YNYA 1J0IA 3GSMA 4I6VA 3IIXA 2HRWA 3M0LA 1AJ0A 2OQLA 3RUBL 3FFSA 1QHPA 5LXEA 3R2GA 3F2BA 1LDCA 4WUIA 2OLSA 1CGXA 4ZENA 4A2SA 3NOEA 1M7JA 3NAVA 3RITA 1GUVA 3LZ5A 4FNQA 1T40A 3N04A 3B40A 1RQHA 4B4FA 3NPUA 1EJXC 5L9FA 3EDKA 3VKDA 5FESA 4RNHA 3DXIA 2R1PA 4C6OA 1TWZA 4JTFA 4Z1DA 2VDIA 4DI9A 2ABAA 3IV3A 4A3UA 2JEQA 1XYCA 2HCVA 4I7VA 2YCIX 4UTIA 3OU8A 4O1AA 3TW6A 3GH4A 3NWRA 3GDBA 1QMLA 4CCEA 3DFNA 1TMHA 4EXQA 1A5AA 4DBSA 2OGJA 2NVAA 2Z6JA 2HDJA 3QOKA 4ZBCA 3VO0A 1ZAIA 2VEFA 3UA4A 3N6HA 3NQ7A 1YPXA 4WIWA 5F4WA 4Q8QA 1U83A 4JQ3A 2XH4A 2NVDA 1FWJC 1SPQA 2A3HA 2AQWA 2G4JA 2OZ0A 2ANUA 3TYZA 3C52A 4NF7A 1DJGA 3P62A 4O17A 3HPXA 1ZAJA 5C2GA 3F4WA 4PUWA 1ZAHA 3MKVA 2Z1WA 3H7UA 2X41A 4LUYA 2OLHA 3PNUA 4AEOA 2F7FA 2Q6ZA 4UC5A 5FAJA 3HF3A 3TTOA 3O6DA 3SI9A 3FDGA 1B3ZA 2ZE0A 4OU1A 1US2A 1XICA 3CZ8A 5DT5A 2V30A 2P50A 3GYEA 2XVLA 2WSQA 1FHDA 4I8DA 5JXQA 2E68A 4FOJA 4CD5A 3GB6A 4PL2A 5GQBA 2I9EA 1AG1O 3M4HA 4AAJA 2A5HA 1H0IA 3PZVA 1GVRA 3ZJ7A 1ICSA 1EEPA 3OZYA 4R3UA 2PLKA 5DMNA 4QJ1A 1PBGA 3OZMA 1NOUA 3IGHX 2B0MA 2ZE3A 2DUZA 4EWND 4GXPA 4L7ZA 2NSXA 1GOKA 1GOWA 2CZEA 1K3UA 2O92A 4UUIA 3USZA 4YU1A 4GUFA 4GYKA 2ESCA 2V3EA 4LAKA 5BW6A 1O4UA 5FSEC 4UTJA 1VKFA 4HT3A 4MTVA 1RK5A 1AL8A 1R2SA 3EDFA 2E8YA 2X2YA 4D71A 3FSTA 3B8DA 2E9BA 1BYCA 2X30A 4LW7A 2BGSA 4GUJA 3T7VA 5E0FA 1C9DA 3AIRA 2DSWA 2UWFA 3BPWA 3EOOA 5A6JA 2ICSA 1ZALA 2YBTA 1TKKA 3GLCA 3Q37A 3GX9A 4JFVA 4L80A 1X39A 2E77A 5EGRA 1G0CA 1F3WA 4PB4A 2DH2A 4R88A 1W3LA 1E4NA 5F2LA 1NARA 3FHAA 4RW5A 1WZMA 2XGIA 4QEEA 3LI1A 5AOUA 4I5RA 2Y63A 3BG5A 2Z0IA 3W1XA 3VGFA 1POKA 4MADA 4UXDA 3U7VA 1K9TA 1OYBA 5A6AA 5LNSA 1NM9A 3ISIX 1CB2A 3VGEA 1E40A 1BKHA 2Q8XA 1PXGA 3DFHA 3U2CA 2G3FA 4H41A 1S2UA 3RG6A 4FNUA 3U8GA 4LT9A 1LOLA 2CZVA 2WNZA 3QHOA 3SCSA 3S2LA 2Y85A 3D6NA 3K13A 3PJUA 5ABFA 1FY6A 4IH3A 1FWAC 4TMCA 1TCDA 2Y8KA 4H9VA 4EK7A 3TEVA 3WNLA 1NY1A 3GXFA 5HULA 2BTMA 3GFZA 5D38A 1OJXA 1YBQA 1JQXA 3IJ7A 2BY2A 4MF4A 3HJZA 1LORA 4Z2HA 3URNA 1V8EA 4JHMA 4O8RA 1HO4A 3FSUA 1LTDA 1A49A 2YCLB 2WQDA 4KESA 3O0FA 3MUZ1 3TCSA 3DI0A 2F6KA 1JZ5A 2D2GA 1W3NA 2PRHA 1ME9A 1DE5A 1FWEC 4IQJA 1NQKA 3WDQA 2ACSA 4HHHA 3FNDA 1M01A 1U1JA 4WGHA 3PY2A 3G1DA 3NM3A 5A8OA 1I2OA 3NQMA 3KOZA 5H8PA 5HOSA 4IX2A 2GYIA 5BXTA 1TV4A 1PO9A 2EPHA 3V1PA 5DELA 1FKWA 1TPEA 2WMIA 5DRIA 2Z1XA 2YGYA 1GTEA 1W9BM 2FZNA 3LCLA 5E0CA 3MSRA 4X0NA 1ZENA 1F9CA 4DVOA 2VDHA 4UTTA 5DN1A 1E73M 2CBJA 4F0RA 2FLIA 1EP1A 3THDA 4L6HA 3UERA 4IPLA 3UF9A 1E6NA 1SZEA 4WJXA 4AW7A 3QQWA 2WW5A 3Q65A 3E38A 3DFTA 4BQ4A 4H2HA 3BH4A 2GQ8A 3P0WA 3LDVA 4LYPA 1J2WA 4HOZA 1DJNA 5K4XA 4PYSA 3R13A 3U6WA 2C18A 3W2UA 1EZ2A 3NL5A 1FP8A 1XGEA 2V0TA 1GYNA 3RX4A 1B54A 4GXMA 3VD4A 3G3DA 1EDQA 4GGBA 2WSYA 4ZTXA 1TA3A 2Z1VA 3QH2A 3C2VA 2HE8A 1Q6DA 3EA2A 4OIFA 2W3ZA 4PODA 3WKZA 4Y7EA 1XCXA 2NX3A 3LXAA 2WPGA 6CGTA 1XJBA 1FH7A 5HQEA 3G1XA 5AC6A 2YOCA 5G1YA 3LQGA 2FB3A 3ZJ8A 3QKEA 1XIIA 4XIMA 4U4MA 1KV5A 3MKKA 1QTWA 2E3ZA 1OIFA 4XD4A 4AYSA 4IMAA 4S23A 3L4WA 5CJ5A 1RJRA 3VPLA 3LMZA 1JDAA 4GBDA 1KBLA 1CXFA 3PFRA 1XS2A 3ARZA 5DQPA 1PPIA 1L2UA 4GYPA 3L23A 3EZ4A 4J3SA 4JDBA 2QAPA 4AWSA 1UD4A 1TZZA 3E2SA 2WCAA 4E38A 2XIQA 1S5MA 2XSAA 3R25A 4QROA 2B4GA 3RLUA 2ZRUA 3UFYA 3HBLA 3CZJA 3KWSA 1ODZA 4GQGA 2HWGA 2QIIA 4IP4A 1R8LA 2PDXA 3PUGA 3L0NA 1XFBA 4H6KA 4MZYA 3W7RA 5AC8A 1Q66A 4H8NA 2YCEA 2VNCA 2XIMA 1QK2A 3MI2A 3ME3A 3E0WA 1L6GA 5D9MA 1XYLA 3K46A 2F38A 2BY0A 1MXSA 4I6KA 3IVSA 4BI7A 5BU6A 4REQB 4M19A 1XV8A 5AB3A 3G8RA 5C55A 1TJPA 2IKJA 1MEIA 4G1KA 4H9MA 4GH3A 3S9ZA 1Q6FA 3OVQA 4BEUA 3DBNA 1LROA 5EBUA 2ZXDA 1DKWA 1N8FA 3EXRA 2PDUA 1XLAA 5FF3A 1H49A 4LVFA 4OZOA 2CITA 1L6SA 3E5BA 1PIIA 3DFQA 5HXMA 3W1AA 3CZLA 3SAZA 3M64A 3A12A 4YTUA 1DIDA 5G2IA 2P10A 3TONA 3L2LA 2BG5A 3G5EA 4AY8A 1T6MA 1TPWA 3EX3A 4GO8A 4EX4A 5HINA 1P43A 4B92A 3KLKA 2EPMX 4JTUA 1FWSA 1XPYA 1XRTA 1R2TA 2POZA 1RXOB 2TYSA 4QM1A 3AHTA 3B03A 3OZPA 3KTSA 4C6QA 2R9RA 1RR2A 4MLJA 1FCVA 3LD5A 4WDWA 3NIYA 4O0ZA 4ZE4A 4IIEA 4IIHA 4PTWA 1H7XA 1EC9A 2BVTA 3VMNA 3ZQ9A 1W9UA 2IQ0A 1ESWA 2V82A 3NQAA 5AC7A 3IIVA 2INZA 4NJJA 2G95A 1VZWA 4XZHA 1K7XA 4S2BA 1XL9A 3B9DA 4DF0A 3WMSA 1UMYA 2I57A 4RNFA 1OFDA 4LAZA 1IEWA 1EO5A 1RPXA 2CBIA 1EXBA 4K6AA 3S4TA 4DAFA 4C1NB 3N2TA 1Q6CA 2OSYA 1TE6A 4Q7NA 2ZKMX 3PS7A 4MHBA 2V9DA 1I8JA 4LYKA 4I7WA 3PFMA 1VRXA 2NT1A 4H00A 4HZ6A 3FV9A 1EC7A 3T55A 4P7QA 1XD1A 3QKZA 1A5SA 2X2GA 3A5VA 5A8NA 2X16A 1TV2A 3A4XA 3M5VA 4B90A 3DC8A 3VA8A 4K8HA 2Y4SA 4CQBA 2G96A 1GVFA 3AMLA 3OG2A 4QNWA 4HJFA 3IAPA 3BMVA 1YADA 2UY4A 3G1SA 3EYPA 3EWCA 4M24A 3SJNA 1W3KA 3RPDA 4G9PA 4IFOA 5AZ0A 4BHYA 1G7VA 3BJSA 4DNHA 3TU9A 3W7DA 3IJIA 1G4PA 1OGBA 5K9XA 1OX5A 1UCWA 4OTKA 2E6FA 1IZKA 1Q7QA 1QNVA 5D30A 5I03A 4ACZA 1CXLA 1R3RA 2PSNA 3H6OA 2ZADA 2FPTA 2I17A 3OOQA 2V8ZA 5AECA 3AZSA 3WNMA 2QCCA 1F73A 1UD2A 3VDAA 3HQPA 2Y1HA 1WP6A 2R14A 4UZUA 3WDHA 4ICNA 2OWCA 4ZCWA 3A64A 2PDCA 3A4JA 1M65A 4AU0A 2YB4A 2Z27A 3U4FA 2FMOA 1JI1A 3B0VC 1KD0A 1QOQA 1OX4A 2V68A 4B2DA 1SVDA 3IJDA 1QHZA 1RY8A 5LIYX 1JXJA 3V3WA 2RH9A 1UR0A 2HVMA 5HR6A 1EQCA 4HNUA 2OR2A 4YYCA 2EPLX 5ECUA 1OFPA 3BW3A 3B8VA 3WG6A 4PL1A 2D2JA 3M0HA 4PMXA 2RDTA 3N9KA 3NXFA 4W9TA 1F4AA 3O2LA 2QS8A 3PSWA 4AVNA 1Q4NX 5D05A 1GZ1A 3R0UA 3ZSSA 1UPMB 1RCQA 4L65A 3KTCA 3NDYA 3GO2A 4C6PA 1GQNA 5K9CA 3PBYA 3UWEA 4DZAA 4U5IA 1HT6A 4UQEA 3REQB 6XIMA 3KOXA 1R7OA 3UR8A 4ZL1A 1YDYA 4N7QA 4CQ9A 1GWJA 4LNYA 5PTDA 2HVOA 3NXLA 4XVDA 1OCQA 4AD2A 4RK8A 3RAOA 1IXOA 2HNEA 5FD0A 5DBUA 1XSIA 2FVMA 4K8GA 3UQNA 2XIJA 2E9MA 4YVPA 1AQHA 1TELA 3OBEA 2OYMA 4JIQA 1QNOA 3LXBA 2ZRVA 3LCHA 2EXOA 1E51A 1XR2A 4Q22A 3EKGA 4E3TA 4CQCA 3PVFA 4KGLA 2V81A 4UTTC 2FVKA 1UA3A 2WWDA 3IJ8A 3BE7A 3R4IA 4JYFA 1PTAA 5FI8A 3REQA 3L4UA 3WD1A 4NSBA 4UMBA 1Z48A 4F9DA 3OYXA 4C6FA 1KGUA 3CUGA 2Z2UA 3JVAA 1BF6A 4NHVA 4UNIA 4P8UA 4MYAA 2XM2A 3SUUA 3PZGA 2IPWA 5FEWA 2UZ9A 4CCDA 4GNJA 3SIMA 2PD5A 5CSYA 3LX9A 5D8WA 3W1LA 4W8LA 5RUBA 1UZ1A 4LXFA 1E6XM 4HPHA 4A8NA 1BQGA 3GTHA 3UXKA 4HCHA 1FWGC 4K39A 4MWAD 3GHSA 1RUSA 4FLOA 4NAEB 5DXYA 4Q8OA 4DJEA 4IPJA 4FR6A 3BAYA 2Z24A 3KL0A 1H1NA 4ZGYA 1A0DA 3KLLA 4YLWA 3DHDA 4IUGA 1J0KA 4S3DA 1S2WA 1TO3A 3G0UA 2QPSA 5HPCA 3UWYA 3L4YA 5C54A 3K8KA 1XLCA 1NJJA 3QPEA 3EKZA 3QQ0A 1TPH1 3G1HA 5A8PA 3NZ1A 4CVUA 4M8UA 1ZP4A 1EUAA 4M6UA 1KM6A 1QWGA 5LHFA 4IWWA 1XXXA 2Y5JA 3GZ3A 3ARVA 5F4SA 4MUZA 1AW2A 1CENA 2Q01A 4BS0A 3TYBA 1CXEA 1REQB 4UOZA 3MW7A 4P7RA 3MV01 2PDGA 4NZJA 1S5WA 3W81A 4D6JA 3GBEA 5H1WA 2KZHA 4E2VA 4FNTA 4LX4A 4AIEA 1TVPA 1TR9A 1R38A 1OFBA 3WLPA 3P80A 4R9XA 3UYCA 4X2PA 4KGJA 2OWWA 5D2YA 1PX4A 4ILSA 2J25A 4DUOA 3W2KA 1MNZA 2QW5A 3GNDA 2OSXA 3L0GA 3EB4A 1H60A 4ZTYA 4AZCB 3E02A 5I3KA 1B4EA 4KF1A 1JCYA 1M03A 4YMZA 3OHMB 3ABSA 4DO7A 4RE3A 4RV3A 2YBUA 1M7OA 1Q63A 5BOFA 1EUNA 1LRNA 2OELA 1VFSA 1ZBCA 4FXFA 3A9BA 4C5ZA 1R2RA 3N12A 4TX6A 4ADSA 4F0HA 3UJEA 3LV5A 2YYTA 1W2VA 4B5XA 2BMBA 4TX8A 4HVXA 4UNLA 3QVQA 4BWLA 5GNYA 4F40A 2LLEA 4QLJA 1J2BA 5BROA 4LC8A 1BPLB 1A5UA 2PD9A 2FH8A 1EHNA 2J7BA 2WZIA 1J0YA 2IQTA 2I5GA 3C2OA 3CM4A 4GQBA 4QE4A 1P7TB 1V02A 1JAEA 5LHEA 2QGHA 4QNEA 2BVWA 2NWSA 3KXQA 1ME8A 2FDMA 3V75A 4H04A 3RNDA 3AHYA 3ONBA 1KV8A 3LPPA 1D3HA 4AZ5A 4M5PA 2GQ3A 4R33A 2C16A 3DHUA 2WJEA 1MNSA 4L9XA 2WB5A 2V2HA 1E6ZA 3UZZA 4L6DA 3IARA 3KL5A 1V93A 3H2FA 3QR1A 1OFAA 2WVSA 4CNOA 4K38A 4A21A 4C6KA 1P7TA 3O16A 3CQJA 3V36A 3TSDA 1KRMA 3A23A 3TIMA 3E49A 4IMFA 1V0NA 4QLLA 1VJIA 5T91A 1ISYA 1LZOA 2EGZA 4PCNA 5A3HA 1PZ3A 1AVAA 4NILA 1WOBA 2G3MA 3HV8A 4HHMA 1V02E 4A35A 4GHRA 4JBRA 1VHCA 3C5QA 2ZXQA 3HQOA 1Q6LA 4D9PA 4OJYA 4AUBA 1VIWA 1PB0A 1X6LA 1A0CA 3UETA 4F48A 5B80A 1OFEA 2OFJA 3BOXA 3FA3A 2UY2A 5IHSA 4TIMA 1JCNA 3RPMA 4AWTA 1TVLA 4ACYA 3ARQA 3PAJA 1W1IE 1YPIA 1RK6A 4AHOA 2E0PA 1I1XA 3CTLA 2RJHA 4F9JA 4L4MA 1VFHA 3LSBA 1V6YA 2XGBA 2DZPA 1RPKA 4N2YA 2GGEA 3EMZA 3OPSA 3N3MA 1JD9A 3R8GA 3L65A 1IEVA 4TVCA 3RPTA 2PRLA 3ZIZA 2ISFA 5E6YA 1M7PA 2PAJA 4D8ZA 2PU0A 4JX4A 3S5OA 3CHVA 2ZXBA 4UFKA 2QDGA 3WNNA 1E9ZB 3W2MA 3MT1A 4B9YA 1V0LA 4XVEA 4AIUA 3O1NA 1RALA 3N9RA 3PWIA 1K6WA 3A24A 2D22A 2FZ8A 3WLMA 2WKLA 4JTDA 3BTNA 1XIFA 2Y5EA 2XFYA 1DOSA 4PMDA 4N02A 1XUZA 4X9YA 4MIMA 4B16A 3QZEA 3LPOA 2OYLA 4DBEA 4AD5A 2PDIA 1X7FA 2ZRZA 1K9DA 1ALDA 2GWNA 3VNZA 1Q85A 2Q8ZA 3EX1A 4EPBC 4CU7A 1P0BA 3I4EA 1RHCA 2O7QA 2B7NA 2YKKA 3BOLA 3PWGA 3TW9A 2YDAA 4NVTA 4PTVA 3SBFA 3HMJG 3QPZA 1FTXA 3KCJA 3SDOA 3MUAA 1FWFC 2A7RA 2PTWA 1PZ0A 4GNKB 4P7LA 3EWZA 5A6BD 1EC8A 4E2BA 3INPA 4MPQA 1VYRA 2C14A 1JR1A 5D4YA 4FZIA 4C7FA 4Q8TA 4EWJA 3NO5A 4C6LA 2OG9A 3NO1A 2C91A 4IGHA 4JYEA 2YZRA 5D2VA 3CQHA 4PE8A 2O9RA 3O06A 1J6PA 2AAMA 1OFQA 3W82A 3W7JA 3VD7A 4X3ZA 1BRLB 2JF7A 1YTDA 1A80A 4NYUA 1TPUA 3B06A 5EMYA 4UTUA 3GD6A 4BKNA 1H63A 1EJTC 4U3AA 2W79A 2A3BA 4KEVA 4WEVX 4JN6A 1ZY9A 4HA3A 4M51A 2BBFA 3T8LA 1RCOB 1R87A 3PPGA 4A6GA 4HOXA 2X1IA 3ZMRA 2Y89A 4NZ5A 2BP1A 1KBKA 3D46A 3KE0A 1XX1A 4HYVA 2CLIA 1QW9A 3H2OA 4FK9A 2BLEA 3T09A 4A3HA 2GJPA 4R85A 4TMBA 2VHLA 1IV8A 2QYGA 4CNNA 4MLRA 1MO0A 3I7RA 4DLMA 1D3CA 2VR4A 8XIAA 3DAQA 1JAKA 1W9VA 3LN3A 4PUMA 1TRDA 3ARXA 2DT0A 1SFLA 3LS9A 3MJMA 5D02A 1XIMA 1YLVA 3DHFA 3JW7A 2E4TA 3RM4A 3ZLFA 1S1PA 2ZUUA 3S8HA 2ON3A 3GVQA 3UZJA 5AVHA 3MSDA 3QFWA 1VD6A 1UOKA 5KZMA 1V03A 3IIOA 5ABGA 2DZVA 2E1DA 3BZGA 3PB0A 1GONA 3IEBA 3WQFA 1H2JA 1E0WA 5FEXA 4HA0A 4N4PA 3PN8A 3R10A 4DELA 1LG2A 2REQA 3ITCA 1KCLA 3W1TA 2RDXA 1KCXA 4LS2A 3M16A 3W9ZA 5AYXA 1AMYA 1IF2A 1L8NA 2DIKA 1RH9A 2I14A 2A21A 3SFWA 5IOBA 3PTQA 2NQHA 1ICQA 1O5XA 4S2CA 3D3FA 4CEXC 1V3JA 2V5DA 1HL2A 2E6YA 1K77A 1RD5A 2FTPA 4PMJA 3W24A 4RLIA 1UMLA 1FUYA 3HB9A 1CGWA 1JZ2A 1UKPA 4Q4SA 2GUBA 5T9CE 2CESA 1UC4A 3SR7A 3NYZA 2D0FA 4AMCA 1A5CA 4V2XA 2F2HA 5KZDA 3OVGA 2XVKA 2ZDSA 3SRKA 3UG8A 1LWJA 2XFFA 4P7NA 2WMKA 3O6AA 3G0SA 4GYFA 4WY0A 4DNMA 2Y2WA 1RA5A 1XM3A 3GHTA 4MAZA 2CIPA 1HKVA 4NNAA 5LXXA 3P6LA 1ZBVA 3HGOA 4AHPA 4U5KA 3S2JA 1E70M 3L2IA 1O66A 2PGWA 3PJWA 2HZGA 1DJWA 3MMDA 4W8BA 4Y9PA 3F4VA 1EP3A 4FLRA 2P0IA 2FIQA 2J27A 4D8AA 4ZB0A 1TJ1A 5C7HA 1UZ4A 1VFUA 1YKWA 1PYMA 5KZ6A 4FIRA 1A5NC 1XSJA 3RMEA 3B9AA 3A47A 4AY7A 2VOMA 5CSSA 3CLWA 1J4EA 1R86A 4A8LA 1T5AA 4Z2LA 4GZIA 4XISA 4Q4QA 1SYTA 1OQFA 4Y2WA 3CUHA 4HNLA 1LL6A 5BXPA 2XU2A 2XFWA 4M81A 1QNRA 1XC4A 3APYA 4GI8A 3BURA 4H9UA 3DN5A 2ZX5A 3CJPA 3KTXA 1KM1A 3LB0A 3GAKA 5FJRA 4HIBA 4LY4A 3QF0A 5FJIA 3AXHA 3WFZA 3SUWA 1UUQA 3TN3A 3CWHA 3L7RA 3VE9A 1KM3A 3NZPA 4ZQNA 2RGLA 3SQLA 5JBEA 5BZAA 1JYNA 3ARUA 4O11A 5FCZA 1Z41A 4NAFB 4NXSA 3NQGA 3B04A 1V4YA 3HFYA 4LRTA 1ITUA 5CCZA 2E5CA 1R7AA 2OZ8A 4O52A 2ZWZA 1TJRA 1UKQA 3HFTA 1BQCA 1R3SA 1JUBA 1DPMA 4H7CA 4EAMA 1GOXA 5BOEA 1KC7A 1Q6EA 2A4AA 1US0A 3CH9A 2EPKX 1KTCA 1W5OA 1E56A 4DXKA 3CZEA 1TRIA 2B7QA 2QF7A 4D6DA 2ZZ1A 3BGGA 3GIPA 1OG0A 2V5JA 1XLGA 1VHNA 3SADA 3SCOA 3I3BA 3G1FA 3NNTA 2CPUA 2W67A 1GZJA 4B15A 4LY8A 1WXJA 3CC1A 4BI6A 1XDMA 4FXSA 4NZCA 2R94A 1HUVA 3W85A 1LYXA 1HZYA 5IXEA 1NSJA 4Z1YA 1JCJA 4KQNA 2NUWA 1RBAA 2J7EA 1RLCL 4KIEA 3VUPA 1K4HA 3V35A 5KEZA 1M68A 1I2QA 4I9TA 3WNKA 3WQGA 3VINA 1DVJA 1Z42A 4PR4A 1I0BA 2WOQA 3GFXA 1US3A 3PZUA 4ONVA 2VCBA 1DTUA 2VI0A 3H4WA 2QCLA 1YNPA 1EHAA 2GVEA 4AQLA 3QTPA 1KCZA 4HN4A 4GMEA 1IZCA 1E4MM 5AHEA 3M46A 3MPGA 3CT2A 1KLYA 2FFCA 3LHWA 3NYDA 1VFOA 1NFPA 4F0LA 3SFKA 2YZ5A 1H50A 2BXZA 2GWGA 3H26A 1E6QM 2WQPA 1X7IA 5IDIA 3UNDA 3PG8A 3EWDA 4ZQMA 3BK0A 1BGGA 2WHKA 5DY2A 4UFHA 2ZRXA 1HP4A 4HPGA 4YCOA 2YCJA 3N11A 4O1DA 1LOQA 2EG6A 3TOPA 2A7PA 2OZ3A 3DEQA 2VUYA 3L0KA 3JRKA 4JY9A 2E28A 3T9PA 2OZTA 1O7AA 5JH1A 5FOOA 4NKCA 4R34A 3A13A 4JTHA 1QUMA 3BSGA 1ZCOA 2PI6A 3OODA 3WIJA 1UASA 4MJMA 3WSUA 1BF2A 1ZJHA 1GJWA 2YL6A 3KS5A 1YE4A 1ZP3A 3STGA 4XO6A 4KRUA 1TUFA 2IXVA 1PKYA 1F6PA 1JNEA 2L5HA 1P5BA 3R0DA 1JPIA 4AZ6A 3HPFA 2DP3A 2UBPC 4TV5A 1FDZA 3L5LA 4GC4A 4NUWA 4CCCA 2VEMA 4H8UA 4D8LA 2VO5A 3J7HA 4I9JA 3TJIA 1E9LA 4ICCX 1HKMA 1R0MA 3QSRA 3HV9A 4W8AA 1F3XA 1MEHA 3AHZA 1ZJBA 3LG3A 4JIHA 3P0XA 4MB4A 1QATA 1XRVA 4H9YA 3MUIA 3VFCA 3E0LA 4N42A 2HSAA 2VEKA 4FX6M 1SW3A 4GO9A 1F61A 4WX2A 4ZR8A 4X63A 1QNSA 2C19A 2OT1A 2YA1A 3ZR5A 2XYLA 1PKNA 2VC9A 4TR9A 4M7TA 3M07A 4AVOA 4RNIA 2ZZ2A 1BVNP 1YDOA 2JEPA 1CYGA 2VP8A 1K8CA 1SW7A 1J0HA 2A3AA 1CDGA 1M53A 3DUGA 3UCDA 1JZ3A 5F2MA 1BVZA 3OVRA 2PGEA 4DRSA 1V3LA 5CSUA 3GR8A 3V4BA 3POCA 4LANA 3U48A 3NVDA 3DESA 5DMYA 1YTEA 1GYMA 1ZSXA 1XYBA 1FA2A 4J9JA 1F3EA 1NOWA 4UMCA 2VT0A 3LV6A 3MANA 2Y7FA 4NNBA 3GVVA 4RUBA 3GXTA 2CLKA 1HJSA 5MF5A 3QY8A 4NNCA 3MYPA 4NRRA 3GUWA 5IHRA 3ARRA 2HPMA 3SCWA 1T99A 3OGRA 4F3HA 2WMJA 3S2NA 3QLLA 4M3PA 3T6CA 3VD9A 1W5MA 1JGIA 2NQ9A 4OBSA 1UWRA 1IGSA 1UWQA 2F6XA 4HCLA 3I68A 4LAUA 3B0UX 2EO7A 4Y90A 4DJDD 5LNVA 4U33A 2DVUA 1E1CA 1F4HA 3C3UA 2ZX6A 1VFMA 7TIMA 3W7KA 1KWGA 1GJUA 3NR0A 2QAFA 1PSCA 4E4UA 3DECA 3U7BA 2OB3A 3FAXA 4A8IA 4H7VA 5CKSA 3RU8X 4YL2A 1FWWA 1QDSA 2BZNA 5KTLA 1S5VA 3GKAA 1SJBA 3MUCA 1GPWA 4C5YA 2Y88A 2J7HA 1S39A 1ELSA 4W7VA 3MP3A 3GY1A 2ACUA 4J3ZA 4RXGA 1ZRQA 3RFAA 3W7OA 2VRKA 5J04A 4LOCA 4H19A 3XISA 4L56A 4YCPA 2XVGA 3HN3A 5TBOA 1DXFA 1MYRA 3FDKA 4J3WA 4W84A 5EU9A 5JUVA 3V5CA 1VFLA 5HUOA 1Q13A 4D2JA 4PA8A 3TTSA 4B3ZA 4PMQA 3QC0A 5F7UA 5EMMA 3ZWSA 1SGJA 2D1ZA 3IACA 4ZO9A 2VENA 5FJOA 4AX7A 3TOYA 1OK6A 2PWHA 3OO2A 3WLSA 3AALA 1FDYA 4PGLA 4E8DA 4FNRA 3N6JA 4IFKA 1S2AA 3LBCA 1VLWA 5BU9A 3WQOA 1QR7A 1LUCB 1UOZA 2ZTKA 3USBA 2F9RA 4GG9A 3UWVA 1P0NA 1KXTA 3M1ZA 1X38A 2AGKA 4AD3A 3KP1A 4DYEA 1A3XA 1MZHA 2VM8A 4DLFA 4O28A 2G37A 2O0TA 4GZ7A 1EX5A 4B9ZA 2WCGA 4XAPA 3VGGA 3GU1A 1J0ZA 2PWFA 2X1TA 3ABQA 1WOAA 1JZ7A 7ODCA 4IIGA 4PUEA 3NDZA 1AW5A 2J66A 5G1TA 1XQLA 2ZOXA 4DO6A 4IFKB 3EOEA 5H8MA 3P14A 4O1BA 1K02A 2V6AA 3II1A 2QJNA 4KKXA 2FHCA 2WO5A 2WJZA 3KW3A 1QI0A 1IT0A 1BVWA 1I60A 3W75A 4ZB2A 3LCWA 3W7MA 4QCFA 3SSJA 2NZLA 3MO7A 2XZ9A 3NM1A 2PURA 4CEUC 1D8CA 1J79A 2Q71A 5ABHA 2CHOA 4WQ6A 2JKEA 3QOMA 3OLGA 1F3TA 4C6DA 3BJFA 3AXMA 2Y7DA 3PZMA 5BNKA 3GH5A 3WEOA 5I6SA 4GRSA 2J88A 4FF5A 3V5FA 3OA5A 4NT0A 3PSVA 3OJGA 2QJJA 5TD4A 4DZIA 3TDFA 3AHVA 4NU7A 1ONEA 2RGMA 5JIPA 3NQFA 2ZZ7A 5EBAA 5A1AA 3CL7A 4HYWA 4J28A 3W27A 2P5NA 3MDUA 2EKCA 3CU2A 4GX8A 3ZVIA 3H4GA 5F1VA 4EE9A 3NTYA 4GJIA 3T08A 3P3BA 3CLMA 2ZYFA 1XIDA 1DIOA 4M0XA 3RO6A 1W3TA 3T4WA 4I90A 1L9WA 3SGZA 1ADSA 3R0KA 4MJ2A 3LHVA 3VDBA 1HNYA 5LNUA 2Y6ZA 1IIHA 4K3ZA 2GQAA 4XTDA 2J7CA 1UROA 3APGA 2R91A 4GGHA 3WF4A 1RCXB 4D6CA 4M56A 8XIMA 5G1MA 1HJXA 1UUOA 3ARWA 1QWKA 3Q2DA 3LCXA 3WL1A 4Q32A 2TMDA 2NWRA 5CZKA 3ES8A 3P67A 4NJHA 1UH4A 4OE7A 1BTMA 1DHKA 1MFUA 3GC5A 2PDFA 2Z2BA 3JZUA 4CNTA 1C92A 3C2YA 4WDTA 2A7NA 2OKOA 1EF2A 2QCNA 3W7GA 5J5RA 5HPOA 4B5TA 3N2CA 1DHPA 5FAGA 1EKOA 2HBVA 4GUIA 2EPOA 2FHBA 4WSKA 3LPFA 5DLCA 4A3QA 3E6EA 1XLDA 2PTDA 4G56A 2TAAA 3P82A 3W22A 3NPXA 4DI8A 4AISA 1KB3A 3BLPX 1R9YA 1SJAA 1GTHA 1F74A 3SN4A 2CNCA 1WZKA 1HFBA 3LTYA 3TN5A 3ANVA 1X98A 2QCHA 2JKPA 4JFSA 2BGNE 3DERA 1VB9A 4D6FA 2W4XA 3TP4A 3W76A 3EWBX 5I07A 1GJPA 4MB1A 3PZIA 1KBJA 3WUFA 1K9EA 3WJXA 3NSNA 5CPTA 3ZS4A 3ZSTA 2GSEA 4L4PA 4DJEC 2HISA 3S2MA 1CECA 1F6YA 4D6EA 3W1UA 4EPKA 1UZDA 2YA0A 5AHNA 4BI5A 4WSHA 1MVYA 3SY1A 4HZMA 4IJRA 4OWGA 4ZO6A 2AOSA 3TFXA 4P2VA 3G77A 2DEPA 1GVEA 3JUGA 3WEZA 2VELA 5HNRA 1ZQ5A 3NQCA 1UD8A 2FB2A 5GJPA 4PRWA 4DXVA 1KKRA 2FKPA 3EB3A 4GVGA 4KEZA 1BSLA 4FNSA 4CKQA 2C6QA 1R3TA 3CIVA 1BYBA 2C13A 2A85A 2WC4A 3DH7A 1NWUA 3VDGA 3NQ8A 1C7TA 4HK6A 1HJUA 1PTGA 2CCRA 1TREA 3EA3A 1I9CB 3TKFA 3ELFA 4HSOA 2OX1A 4GYPC 3W1NA 1B9ZA 4UR9A 5I09A 3T0DA 1H7WA 3K2GA 4PTNA 1QHOA 2VX6A 3WLOA 5FF2A 2PTYA 1YW1A 1JUKA 1TIMA 5IBXA 2V5LA 2OJPA 3NGJA 4ATDA 1W5NA 4QITA 4PRRA 1AW1A 1KLZA 1KFCA 4C6NA 4CQAA 5C2CA 5AYIA 1EB3A 4W5ZA 4RPQA 1GG1A 1SJCA 3DG7A 3NZQA 3CUZA 3QPYA 5TAOA 2WSKA 1VBHA 3PHAA 5DO8A 2CBVA 3T1GA 2Y61A 3GNOA 3UR7A 1XLHA 4EIVA 1UIPA 3EA1A 1DE6A 2YA2A 2CLMA 1DIEA 1CLVA 2VVNA 3MC5A 3VVGA 4HPNA 2OTDA 4NX0A 3BVJA 4BWLC 1REQA 1DJQA 1LLWA 4WK9A 1WX0A 3GQYA 4XAZA 1UZHA 4C6BA 2AQVA 3R8HA 2EG8A 3M5YA 3O07A 4NY2A 1AZ1A 1R85A 4MMWA 1E15A 1KGWA 4XV0A 1GVSA 3THCA 4JZ5A 4PUNA 3MB9A 4HNVA 3B3DA 1KRBC 3OBAA 3FA5A 2QULA 3WBWA 3NUKA 3AS1A 3G6MA 4ZO7A 2QHAA 1RBLA 1H7PA 5ABTA 4KCTA 5K2ZA 3BLFA 3IUHA 2G3IA 5KSWA 3WH7A 4AWUA 1WDQA 2VC7A 5A69A 3TXVA 1A53A 4AY1A 3ZYZA 3MDWA 4Z42C 1O95A 5HK4A 5EY5A 4QJ3B 3R6IA 3AMKA 3MQTA 5G5IA 2E25A 3ZVHB 2HS6A 1ZL1A 3E2RA 1J12A 3T2QA 4KFNA 2BWGA 1T0OA 1XIJA 3VDHA 2DZAA 2ABBA 4BA0A 3U3HA 4IZGA 2XHYA 1FCQA 2PU1A 3H4XA 4BQ5A 3EWUA 6A3HA 5HJLA 2G0WA 3WUEA 1EOKA 3SM0A 4YVXA 2XIOA 5CZTA 2GL5A 2PDPA 2JQXA 4H8VA 5H91A 1Q3NA 4QG9A 4I8YA 3PTDA 2PEVA 4QQ3A 2DIEA