4ZEPA

Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
474
structure length
474
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 189
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zepA00
3EMZA 5GQBA 2HISA 2CERA 3VIJA 1V0KA 5E0FA 4ACZB 4MB5A 1WO2A 2XHYA 1OSEA 3ZR6A 4GI6A 1VBRA 3S6TA 5CGTA 3SCOA 3W29A 1P6WA 3PTQA 5CLTA 1OD8A 2DT1A 2GDUA 3UR8A 1BTCA 4B9ZA 2C8NA 5M3WA 1G5AA 2CEQA 2XM1A 2GJRA 1PPIA 3IJ9A 3MU7A 1C7TA 1CGTA 1HNYA 1CGVA 1PAMA 1QNRA 1TVNA 4ZXLA 1W1PA 3LPGA 3L4XA 4M82A 1OIMA 1X1NA 4AD2A 1XRVA 2G4FA 3LPOA 1PIGA 1QVBA 4Z2KA 5ABFB 3VILA 4PRWA 3TTOA 3VDBA 3NIYA 3E1F1 1UYQA 3NDYA 3WNOA 3N9KA 2QPSA 4ATWA 2EPLX 1TA3B 3OLEA 5DT5A 1JI1A 1HVXA 3ZT6A 1XCXA 3WL0A 1OT1A 4CD4A 2QPUA 4X0VA 1B9ZA 5AC5A 1HJQA 3DYPA 2EPOA 4GO8A 5A6BD 4TTUA 5HPOA 2J8GA 2X2YA 1HP4A 1CGUA 2CPUA 5E09A 2OSWA 2XUCA 2WMGA 1U30A 1B1YA 3VD3A 1RP8A 3SCPA 3W25A 3PZTA 4EE9A 1UH2A 3WF2A 4JL1A 3EBVA 1UD4A 1FHDA 3VDAA 1PZ3A 1V0MA 1JZ5A 5E6ZA 4C7DA 2OLHA 1PIFA 2YL9A 2ZUWA 1CENA 4X0NA 3VIGA 4CGTA 2GUYA 3ZQ9A 1XSJA 3CZEA 4PTWA 3A4WA 3THDA 4BQ5A 1LL6A 2ZIDA 5BXTA 3A4XA 1E72M 1JNEA 3VNYA 3PZMA 3QHOA 3AMLA 4AW7A 1M01A 2OWCA 2IUZA 4GPNA 1FFQA 1UKPA 3PZOA 1J0ZA 1IZJA 3EYPA 1CZ1A 3CUIA 3G6LA 2V5DA 5JBEA 5JIPA 2J7FA 3L4WA 2CHNA 1FP8A 1UA7A 1GQKA 1QW8A 4QFUA 1UH3A 5LA2A 2O9OA 2Q8XA 4QP0A 3QR3A 2WC4A 5FIPA 1M03A 1NWSA 1ODUA 1GNXA 4DM2A 2J7DA 4M29A 4WKHA 3WMSA 3CZGA 4DWSA 1WNOA 2ZXBA 3EDFA 2DIEA 1W2PA 1VJSA 3WDHA 3K4DA 1FH7A 3WF3A 4H8VA 4RE2A 4AC1X 2X1IA 3MMDA 3L4TA 1MQPA 4R27A 1XH0A 3VUPA 3SEPA 3OZPA 4JHZA 2J7CA 4OKDA 5DT7A 1K9FA 2VC9A 3JUGA 3TTYA 4QDMA 4PBGA 2ZUVA 4OBSA 4OOUA 3T0AA 1HL9A 1W3LA 4MTVA 4BA0A 1W9VA 2YA1A 2OYKA 2J25A 3KEHA 3CO4A 3MKKA 3CPUA 5EB8A 1V6WA 5CSYA 2XM2A 4CUCA 1KR1A 3U5UA 4CN4A 4HZ6A 5A8QA 5KZ6A 3MUIA 2JEPA 3T2QA 4UNIA 2E9LA 2YJQA 3W26A 1C91A 2J75A 4FK9A 2E9MA 2ZUTA 4GKLA 5HDRA 3ZSSA 4X9YA 5BROA 4D6JA 3BCFA 3A3HA 3WNLA 2UY2A 2A3CA 3AZTA 3WF1A 3ZT7A 4B15A 5EMYA 2D24A 2YLAA 3L4YA 2FHBA 2W4XA 1DWIM 5I0DA 3WF0A 2VOTA 3APGA 1QI4A 2CBUA 1DHKA 1HKMA 2W63A 3IAQA 4UZUA 1U2YA 1WDSA 2YIHA 3I3DA 4UOQA 1MW0A 2GJPA 1UR4A 3VD4A 2CETA 4OIFA 2UY3A 2RGMA 4KGJA 1ODZA 3F5KA 1DP0A 5A3HA 3RJXA 1K9EA 5ABFA 2VCAA 2V3DA 2X0YA 1B30A 2GJXA 4WSKA 3M6DA 1A3HA 4PMOA 1LJYA 1QBBA 1B31A 3AMCA 2DSUA 3VD5A 2WK2A 1R7AA 4J3TA 2PWDA 4PN2A 3FY1A 2ZX5A 1KXHA 3BSHA 1HJXA 2VZOA 4EK7A 5EFFA 1PZ2A 3A6OA 2EBNA 3EDEA 1UWRA 5CPQA 3MO4A 4QAWA 1V02E 3WEMA 1HP5A 1GORA 2VZSA 4W93A 4IM4A 4M80A 2VCBA 3QGVA 4GIAA 1XC6A 2DH2A 5AY7A 4U5IA 2E8YA 3MMWA 1E6SM 4GI9A 2FGZA 3AHXA 4TX8A 4CN1A 5I24A 1JDCA 1QOXA 4BQ3A 4MB1A 6TAAA 2BXYA 2J62A 1JXKA 5D9MA 1SMAA 2A3BA 1BYCA 3WUFA 5A1AA 3WQ8A 1QNPA 1E0VA 3CHFA 3W81A 5IFTA 4P7OA 3RCNA 3AROA 4UCFA 2E3ZA 4WKFA 3VDCA 1I1XA 1E3ZA 4UOZA 2J7BA 1E1EA 1W91A 5A6AA 4F8XA 4D71A 3ZJ6A 3ZJ7A 2FHCA 2CITA 1J0YA 1JZ8A 3GH4A 3WDRA 4HZ8A 2YKKA 2X05A 2GDVA 3VIFA 1E3XA 4BZYA 7TAAA 1V3HA 4UQCA 1MQRA 2ESCA 3ECQA 1XV8A 1UH4A 1HL8A 3DC0A 4NZCA 4D6CA 5FOOA 2ZXAA 3AI0A 1CXLA 2WMKA 2YLLA 1EDTA 1V6XA 3VX0A 5E6YA 4AISA 3DHPA 3K1DA 3MUZ1 1VENA 4MJ2A 3OA5A 1IT0A 3HMCA 3J7HA 4AD3A 4FF5A 3T2PA 2Y4SA 5M5DA 4CD8A 2UY4A 2EPMX 1W3KA 2DSVA 1U33A 3WMCA 1FA2A 3ARYA 3MANA 2DT2A 1EQCA 4UZSA 8A3HA 3DHUA 4WKAA 1E40A 1W2VA 3L2MA 2XVPA 5FL0A 5I79A 5BRPA 4OZOA 3PHAA 3BAYA 2WANA 2XVNA 3N17A 4UQAA 3NDZA 3SCRA 3TTQA 3WD3A 2WB5A 2F61A 2EQDA 4F79A 3WUEA 3B9AA 4IPNB 3AS0A 2G3IA 1WDQA 1XH2A 3LMYA 1ZBCA 1V6UA 3RILA 3VDHA 1V6VA 3WENA 2VO5A 5CLWA 5EBAA 4HOZA 4QLJA 2VRJA 3UESA 2OYMA 5C8BB 5IXEA 4MNJA 3AIRA 2J79A 1Q4NX 1UHVA 2EXOA 3BCDA 3PZQA 4UFIA 1YQ2A 5GNYA 5A2AA 1E6ZA 2BS9A 2WWCA 3WFLA 2ZUUA 1V0NA 1C93A 3ARZA 3N1AA 4Z2LA 1CXHA 2WW5A 1US3A 5DMYA 4V27A 1KFWA 4AZHA 3CZ8A 3EDKA 4Z2HA 4D1IA 4WSJA 1W1TA 3BAKA 5CJ5A 1E4NA 2ZXDA 1KQYA 3PTKA 2WWDA 1E6XM 3N18A 3T0BA 5IDIA 2WMFA 2DPEA 4HA4A 5ABEA 4LQ1A 2YBUA 3W27A 1E4IA 3AXIA 1WDRA 4R5EA 2QHAA 1BPLB 4AZCA 3ARPA 3RDKA 2YL6A 1OCQA 1W32A 2XFFA 2BXZA 3KWXA 1J10A 1VEMA 3W37A 4H41A 4JZ5A 2EEXA 3GXDA 4JFWA 3WNMA 4C7GA 4MAZA 5GPRA 1WZLA 1BYDA 5ABGA 1EOMA 4UFHA 4FLOA 5CXPA 5JUVA 3EMCA 1HXJA 1JYWA 3NCOA 4URIA 3AHVA 3SURA 5I6SA 1W9BM 2DSZA 3N13A 1E4LA 1TZ7A 1NQ6A 4BQ2A 3VGHA 1CNVA 1HJVA 3PZ9A 2J8FA 1H09A 3MS8A 3FHAA 2OWWA 3THCA 1HF6A 2XVLA 1MW1A 5BCAA 1EO5A 2UWFA 3BXWA 3AS1A 4IPLA 3ARSA 1OBAA 2AMGA 4JCMA 2VQUA 2VURA 2VRKA 2D22A 1LL7A 1W9DM 4CVWA 1ISVA 4WF7A 2W66A 2Y5EA 2JALA 1DWAM 4H04A 4XZWA 3NUKA 1UD5A 1HJSA 1B3YA 3OG2A 3WDJA 1E56A 2O9PA 6CGTA 1E15A 4ZENA 4K68A 4ZEPA 1EOKA 2WCSA 3DYMA 2WMIB 4BF7A 3AIUA 2WHMA 4PMZA 3GH7A 3ZOAA 1V02A 1NOFA 1PX4A 2D3LA 2BVYA 5FKYA 4MPKA 1VJZA 4J3XA 4MJ4A 2VVSA 1LQ0A 1QI5A 5E0CA 2WLZA 3VOCA 3FW6A 2F2HA 3EDDA 2B31A 1OGSA 3BMWA 4Q22A 3PZIA 3OLIA 1UD8A 1MW2A 2W92A 1KBBA 3VIHA 3ZR5A 1IZKA 1H49A 3A4AA 1JG9A 1QNSA 1V3KA 1ITXA 2WMJA 2G3JA 1CDGA 5F7UA 2WSKA 1M04A 2VNCA 2QLYA 3PBGA 4A3YA 2W67A 1C8QA 1ITCA 2ZE0A 3VIIA 1CXFA 4PTMA 3T08A 3AIQA 1E5NA 1E9LA 1G01A 5CZKA 5GNXA 3FN9A 3SCUA 4W7UA 4AXNA 2CBVA 3SCVA 3AHTA 1UR2A 3CGTA 1E0WA 3G6MA 4MDPA 1JNDA 3WNNA 1JAEA 4AD0A 4B3KA 4TX6A 1C92A 1UKSA 2E0PA 3CUHA 4DUXA 3IAPA 4AZIA 1XSKA 4M8UA 2XWEA 4UFJA 2VCCA 1WP6A 4ACYA 2ZWZA 4TVDA 4AD5A 1V3MA 4MNLA 3WSUA 4D6HA 1KGUA 4UQBA 2YDSA 4JKKA 5LA0A 2BV9A 3K4AA 3AXXA 2FGLA 3ARRA 2FHFA 2VI0A 2ZXQA 3IK2A 1BGAA 3BC9A 4P7LA 1MVYA 3GNOA 2GFTA 3SUVA 2XG9A 3B9DA 4QLLA 3RO8A 4MADA 2ZWYA 3AHYA 4EANA 1GPFA 2NT1A 4ZE5A 2WMHA 1A47A 2JE8A 2E9BA 3PZVA 1BYAA 1KR0A 1Q6GA 2YDRA 2ZX7A 5A8MA 4W88A 1HN1A 2V3EA 4XZBA 4JAWA 3WIJA 4PCSA 2J78A 5DF0A 1E70M 1HJUA 2E40A 4AZ5A 5I77A 1H1NA 1KGWA 4W85A 5HBFA 1TFVA 2D0HA 1JZ4A 2FH8A 1GONA 3CMJA 2BFGA 2CBIA 1NP0A 1X6NA 3WH9A 3AMDA 3HU7A 4TXEA 1NARA 4AY1A 1GOMA 4UFKA 2YL5A 2WVUA 2GK1B 4HA3A 4HMCA 3SCNA 1BLIA 3BAIA 4ACZA 5A8PA 3AZSA 3WQ5A 3O6AA 1R7OA 1ESWA 3NSXA 4CCDA 3ARWA 4RL3A 4H2CA 3UETA 2WSPA 1H2JA 1R85A 4AD4A 3W38A 2WVSA 3N11A 2J7HA 2WCGA 2YOCA 1UWIA 1TCMA 3WQ6A 1AQMA 3CZJA 1E71M 3B9EA 3GXIA 3ARXA 2W5FA 2O92A 3ZMRA 1JYNA 3OLGA 3QOMA 7A3HA 3ZM8A 1CGXA 4J7RA 4W7VA 4NRSA 3ZJKA 4PMVA 1TA3A 1EGZA 3FAXA 1DTUA 4QLKA 1D3CA 3GM8A 3WDQA 3UEQA 3O2LA 1KWGA 5E70A 3W82A 3ARVA 3BMVA 4JFSA 2XFYA 3WQ4A 3D5HA 2WMIA 2V3FA 1D2KA 5A6BA 1E6QM 2XGIA 1JGIA 1QPKA 3SIMA 3UR7A 1UWQA 3CUGA 3N12A 4JIEA 1WAWA 3AMKA 4L4PA 1VEPA 2WZIA 3UERA 2WBKA 4IISA 4B3LA 5ABHA 1JYVA 3I3BA 1GQLA 3RIKA 3S2CA 1LG1A 1JF6A 2XSAA 1CGWA 2XFRA 3VU2A 3IJ7A 1JAKA 1E43A 3AS3A 3SUTA 2NW0A 1GZJA 4D72A 2WKGA 2WXDM 1SR0A 4HZ7A 2PWFA 2XYLA 2DDXA 3CTTA 2PWHA 3IJ8A 3OGRA 3NSNA 1G0CA 3RMEA 4AEFA 3OIHA 2DH3A 3MUAA 4NSBA 3AISA 1HKJA 4RE4A 1QI0A 2WVVB 4W87A 3UG5A 4UTFA 3MV11 1IV8A 1CBGA 4CU6A 4P8UA 2Y24A 4Q7NA 1BYBA 3D3AA 3L2LA 4A4AA 3PZNA 4MNMA 4D6IA 1CYGA 4OBRA 2VL4A 4P8VA 2DT0A 1GQJA 4TTGA 1E5JA 2WC3A 1ZJAA 4DM1A 3WH7A 1ISZA 2D2OA 3GZAA 3UG3A 1NM9A 4FLSA 2WKLA 1BG4A 5D4YA 1GHRA 3WNKA 1UZ4A 1ZBWA 3DYOA 5CPSA 3VIKA 4M56A 5A2BA 3CH9A 3CLWA 5CQ1A 1HKKA 2X8RA 3WKZA 3TP4A 1BAGA 2J7GA 3BSGA 1GOQA 6A3HA 3RM8A 3CUFA 7CGTA 4QCEA 2VJXA 3CHDA 1J0IA 4EKJA 4XUYA 4GQQA 4WIWA 1R87A 4EAMA 3B8SA 3VGGA 4CN6A 2BY3A 5CSUA 1WZMA 2VX4A 1LL4A 1JZ3A 3BGAA 3OB8A 2IXUA 3K8MA 2MANA 1KWKA 4HA1A 3CZLA 1TUXA 1MYRA 3MSGA 4N42A 5EFDA 1VFMA 1FFRA 3BAWA 2CXGA 3WD4A 1QHZA 1D7FA 3VKKA 1KXTA 2WNWA 2EPNA 4CCEA 3CMGA 3K46A 1KXQA 4NRRA 3VMNA 2ZUSA 4AZGA 1UR8A 2OSXA 1I1WA 1GOIA 1CLVA 1E73M 3VPLA 1Q6EA 1TE1A 5A8NA 2WBGA 1JF5A 3KL3A 3WUGA 4DUWA 1JI2A 1AQ0A 2PWEA 2YDQA 4D6DA 5I2UA 2J74A 3VNZA 1B3VA 5HXMA 1XGZA 1WE5A 1GW1A 1C90A 1DWFM 4PCTA 3WMBA 2GK1A 3GXMA 2TAAA 4PMNA 1LWHA 3VMOA 2DEPA 2XIIA 3EDJA 3WUBA 4Z2JA 1UZ1A 2XSBA 4CU7A 3VIMA 2JIEA 5HPCA 4W8AA 1W9UA 3TONA 3OLDA 3OBAA 5IHRA 1J01A 3AQUA 4AIOA 3MV01 1XYFA 4MAVA 5AYBA 5CGMA 3GTNA 2BVTA 3GXFA 3AXHA 4J27A 4U5KA 5D9PA 4Z2GA 3U7VA 1B2YA 3M07A 1EH9A 1QI2A 4MDOA 2E4TA 3ARQA 1UKQA 2WAGA 1TG7A 4CD5A 1EHNA 1V03A 4DWSB 4D6GA 2X09A 2QV4A 2FDMA 3WEZA 4DWSD 2JFEX 3CUJA 2A3HA 2XGBA 1UUQA 1V0LA 4W8LA 1JZ2A 3QHMA 4CVUA 3SUUA 2BY1A 3CHEA 2Z1SA 1JYXA 1B0IA 3AYSA 1VFOA 1DEDA 2Y8KA 2O9TA 4DUVA 1E6RA 3QHNA 1W3JA 2NT0A 4CU8A 2XVKA 3CIVA 1AMYA 2A3AA 4LPCA 5GNZA 5M17A 4UOJA 1FH9A 2BHZA 3F4VA 3KL5A 1UWUA 3L4ZA 1PX3A 3PZUA 4JFVA 3BAXA 1E1FA 3ALFA 4HMDA 4PYSA 4E4PA 2Y2WA 1OGBA 1UD3A 2XWDA 3M7SA 5DFAA 1E0XA 2C0HA 2WLYA 2XIBA 1H41A 3VINA 1QNOA 1J18A 2EO7A 3UCQA 2YA0A 5C71A 4WK9A 2WVVA 1WZAA 4H8HA 4P7NA 5C70A 2WHJA 3AFBA 1MFUA 3WN6A 2VT0A 3WH6A 4W89A 4J3UA 5FCZA 1OINA 5FD0A 5M03A 3GDBA 4V28A 1UWTA 4U3CA 1WKYA 1UKOA 1BSIA 2WM0A 4QCFA 4GINA 4J3VA 2E8ZA 4HU8A 3FXYA 3VVGA 1QI3A 1CTNA 1C8XA 3VGDA 4AIEA 2QMJA 1TVPA 1W3HA 3VGEA 3PZGA 3F5JA 1VEOA 1HIZA 3FHQA 3VD7A 2VQTA 1PJ9A 4PMYA 1AVAA 3WH8A 4UQEA 1GOOA 1I75A 2PBOA 4YN5A 4UQ9A 4JKLA 5A8OA 4JHOA 2JF6A 4H8UA 5D9NA 2CKRA 3FAWA 4HPGA 1Y7VA 1C3FA 4W86A 1X6LA 3WFZA 2BY2A 1B3ZA 2DIJA 3TTSA 4AD1A 4P8XA 2DQXA 2GJXB 2JF7A 1PEZA 1US2A 1BFNA 1NWUA 4FLRA 4KRTA 1SMDA 2WZHA 1E6NA 3W4RA 4PSPA 1RD6A 5A6SA 4JFTA 1JIBA 5HOSA 1JD7A 1H3GA 2XVGA 4CD6A 3AZRA 4J3WA 3HJEA 4OOZA 1W1YA 1QW9A 1XCWA 1SYTA 5FL1A 2VZVA 5CG0A 1KCKA 4D6EA 2F8QA 4GZEA 3PN8A 1UOKA 1ZU8A 3WEOA 5BWFA 1RP9A 5TD4A 2PC8A 1R86A 1VB9A 4XX6A 5I23A 3MUY1 4D6FA 4PEEA 4S3KA 1GUVA 2DSKA 3K8KA 2DGAA 3AJ7A 1VF8A 3T2OA 3TOPA 3I3EA 1UR1A 3ZO9A 4U31A 1HX0A 2VVNA 3IANA 2YA2A 1J0JA 1XH1A 1N82A 2G3MA 2UY5A 1CGYA 5CPTA 1MQQA 2PBGA 4E8CA 1LF1A 1EDGA 2AOSA 3KZSA 4YPJA 1UR0A 3N04A 1OWQA 2CIPA 1F4AA 2DSWA 1NWTA 4MB3A 1XD1A 1W9XA 2JIWA 4UFMA 4JFUA 1KBKA 1GHSA 2OYLA 3VIOA 2ZX8A 3SUWA 4TVUA 3M46A 1UR9A 4HMEA 3OGSA 4PMRA 3BLKA 2XPKA 3AS2A 1ZL1A 4ML4A 3RM9A 1M53A 1WZKA 5I3DA 1VIWA 3VGBA 3W28A 1G9HA 1NH6A 5BYWA 4HPHA 1V3JA 5A94A 1FHLA 4LYPA 4NF7A 5A69A 1JDDA 4Y7EA 1ZB5A 4KH2A 2VR5A 1VFUA 1BVZA 1WB0A 2V3GA 3ZSTA 4B9YA 2D0FA 1F4HA 2D1ZA 4PMDA 3W6MA 3L4VA 3WY1A 1GQIA 3AOFA 4N0RA 3CZKA 3NYDA 3A47A 5IFPA 3T09A 4W7WA 4CCCA 1EA9C 4FMVA 1ZBVA 1Q6CA 2V5CA 2PB1A 3AMGA 4M81A 3GNRA 1WDPA 4BQ4A 4PTVA 1PBGA 3CHCA 3WBEA 2XTKA 4LGXA 4P7RA 3ZJ8A 4D1JA 3N15A 2G41A 1L0PA 2WHKA 3PTMA 1E4MM 4WJXA 1GVIA 3WDIA 4GO9A 3LPFA 1K9DA 3WD1A 1ECEA 5I78A 1TMQA 4DWSC 1CXKA 2PF0A 4RE3A 2GVYA 5ECUA 3WQWA 2ZICA 3AIWA 4JKMA 3FNDA 1UG6A 5JBDA 5A6JA 1G94A 4UQDA 1ZBKA 3QOKA 3VD9A 4GQRA 1GJWA 1UD6A 3GNPA 4PSRA 2VZTA 4H7VA 1KQZA 4ATLA 3MMUA 1H4PA 2VX7A 4TOQA 5BXPA 1XSIA 4IUGA 1GCYA 1PX8A 4GZIA 2YL8A 3VTRA 1LWJA 2ZUMA 1RH9A 1HJWA 1V08A 1TR1A 2FH6A 1DWGM 4GI8A 2NSXA 1CEOA 2J7EA 3AICA 4V2XA 5D9OA 4AEEA 1CIUA 2CCRA 1Z32X 4MB4A 2IXVA 4XB3A 3ZIZA 4S3JA 1E55A 2PWGA 4W5ZA 3F5LA 4Z2IA 3VGFA 5AC4A 1W1VA 1S46A 3AIVA 1O6IA 1R8LA 1L8NA 2OSYA 3TA9A 2WC7A 4AZ7A 5BRQA 2VX6A 3AYRA 4L4OA 1NOWA 4E2OA 1CXIA 4U3AA 2CKSA 2C7FA 1CWYA 3RPMA 2J77A 4KMQA 4U2ZA 1CPUA 2XJ7A 3KL0A 3RM4A 3ARTA 4UR9A 4JL2A 1NOUA 4ZXOA 3WD2A 1OIFA 2V38A 3U5YA 2D3NA 2GSJA 2WHLA 1SFSA 3AIEA 1GOWA 1QBAA 4AZCB 3MSDA 2D0GA 2DT3A 2VRQA 5BXRA 2Z1KA 1ISXA 1GVYA 3OGVA 1XYZA 1OM0A 4U2YA 1DWJM 1W9PA 2W91A 2O9RA 1V3LA 4W8BA 2D23A 5A95A 3VM5A 4P8WA 4YHEA 2VR4A 1XD0A 4OJYA 1VRXA 4YHGA 4GXPA 2QF8A 3SCQA 1K9TA 1BQCA 3WF4A 2PI6A 1YHTA 2VX5A 3SCWA 2G8ZA 3LPPA 1UQYA 3RJYA 1EXPA 1OT2A 1G1YA 1CLXA 2WVTA 3AIBA 1BGGA 5IHSA 1C8YA 4KGLA 4NI3A 2J47A 4W5UA 2VMFA 4AWEA 1B90A 1V6YA 4CD7A 2D20A 5D8WA 2BHYA 2YBTA 1Q6DA 4LXFA 1OGGA 2BNJA 9CGTA 1EQPA 3GYCA 1FOBA 1MFVA 4F9DA 1MXGA 2W62A 1KGXA 4KWUA 2CBJA 2OWXA 1UA3A 4TUFA 1HKIA 4FLQA 3L4UA 4BS0A 3W0KA 3GH5A 5BXSA 5A6MA 1O7AA 1XHGA 3CBWA 3GBEA 1UWSA 2AAAA 3POHA 2X0HA 5A2CA 4J3SA 1KCLA 2WCAA 1B3XA 4E8DA 4TVCA 4KRUA 4A3HA 4CKQA 3WNPA 1BG9A 3WBAA 3ARUA 1B3WA 4PMXA 4OUEA 4AZBA 1MW3A 1QHOA 1JZ7A 2VTFA 4PUEA 3POCA 3U57A 1EO7A 5I5RA 4F9JA 2EPKX 4PTXA 4M24A 3WDPP 1ISWA 1J9YA 4XV0A 2BVDA 2G3NA 1VAHA 1C7SA 1JZ6A 1NWRA 4ATDA 1CXEA 2VUYA 4C7FA 1BF2A 1VFFA 3AHZA 5LYRA 1JFXA 2WPGA 2ZUNA 1JFHA 4GZJA 1GJUA 4PMUA 1H11A 3WELA 3VIPA 3WH5A 4P7QA 1H0GA 3VO0A 2HVMA 4LX4A 1K6AA 1JD9A 2CNCA 3NSMA 1EIBA 4AZ6A 3NJ3A 4AYSA 4HP5A 1J11A 2JEQA 2QMKA 1WPCA 1UD2A 1FH8A 4MNKA 5JBFA 2CYGA 1NP2A 4B16A 1V3IA 1OB0A 1ZJBA 3VX1A 1RPKA 5A6KA 4UFLA 1M7XA 4HU0A 4F66A 1LG2A 2A3EA 4J28A 4U33A 5A6LA 1LLOA 1J12A 4AIUA 5KEZA 2CHOA 1ISYA 1JL8A 8CGTA 1BVNP 2J4GA 5E9AA 3SUSA 3BAJA 2WYSA 4HTYA 1Q6FA 2ZX6A 4PUDA 2EJ1A 3WQVA 1DWHM 3VMPA 3T0DA 3U7BA 4WLCA 3ZT5A 1OD0A 4HOWA 1J0KA 1AQHA 4ZFMA 1FP9A 3II1A 3SCTA 4M1RA 3EMQA 4LYQA 3HN3A 3W53A 2W61A 1JXJA 1QHPA 1ZS2A 4LYRA 5DO8A 1UKTA 2CESA 2WZEA 4W84A 4PMQA 3WL1A 3KE0A 3OZOA 3UG4A 1EDQA 1MWOA 4AMCA 4BCEA 1J0HA 1JDAA 1VBUA 2ZX9A 4HOXA 3VM7A 1H0IA 3WD0A 1HVQA 2VZUA 1WCGA 1E6PA 3W6LA 3ALGA 3GBDA 1EHAA 1KXVA 1QNQA 1HT6A 3K8LA 5LA1A 5JIWA 2Y8VA 1MXDA 5AYIA 3BH4A 3O9NA 5HNNA 2ZOXA 1UQZA 2BHUA 3BLPX 3SCSA 2BY0A 3W24A 5D8ZA 5DEZA 1GOKA 4ZE4A 1KB3A 3DECA 1BHGA 2RGLA 4JCLA 1H5VA 1CECA
chains in the Genus database with same CATH superfamily
3EMZA 3R2GA 2BGQA 3C3UA 5GQBA 3G2GA 2IQDA 3VIJA 1J79A 2OKOA 3M0ZA 5E0FA 1WO2A 2XHYA 3MHUA 3ZR6A 1XIHA 5CGTA 5FJRA 3L0KA 3UR8A 5M3WA 4S3AA 4BI7A 3PUEA 2GJRA 3IJ9A 1DIDA 1A50A 1HNYA 1CGVA 4XZNX 3E2RA 4WDTA 3FGCB 5I06A 1C9WA 1QPNA 2G4FA 1QVBA 4Z2KA 3QV9A 1XYCA 4ZO8A 4PUUA 3VILA 3OG3A 3LRKA 4MWAC 3TTOA 3VDBA 2VGBA 3F7JA 3TJIA 3N9KA 4ATWA 2ISWA 4Q4RA 5E0KA 4M51A 1SO4A 3BLOA 1OX4B 4WDWA 1HVXA 3TLLA 4HD5A 2BLEA 3O3RA 5AC5A 3DYPA 1AK5A 4TTUA 1HP4A 2XUCA 3SRFA 1B1YA 1FWFC 3STPA 3GIPA 2PDYA 1ZP4A 4EE9A 3B0UX 1UD4A 4IJBA 3DFOA 3KXQA 1IHIA 3UR2A 4DF2A 5AYZA 3VIGA 1DE5A 3CZEA 4BWLA 3IVTA 3AC0A 4BQ5A 1SJBA 3C2VA 1S2CA 5BXTA 1E72M 3HZ3A 3O6YX 3V36A 4JNZA 1RLCL 3CQJA 3SJNA 1UKPA 3PZOA 1A5BA 1J0ZA 3BLEA 3ITTA 4O8AA 1CZ1A 4DYKA 1U83A 4ZODA 2QDGA 1GQKA 4CQAA 2O9OA 5FJTA 3GX9A 3QR3A 4MVAA 3FDGA 3NXFA 4ORMA 2WZMA 1ODUA 1GNXA 1R3YA 1NIUA 3LSCA 4RZBA 3EDFA 1W2PA 1VJSA 3K4DA 1A5LC 2I5IA 3WF3A 4H8VA 3RK8A 3ONBA 1MQPA 4R27A 3SEPA 1M6JA 2ASHA 3TZNA 5KINA 2O56A 3E49A 1XI3A 2J7CA 5DT7A 3VKJA 4RR4A 1R3RA 4O1BA 4QDMA 2ZUVA 1EPVA 3KTSA 3SJ3A 3LLXA 3VNMA 1S5WA 3G1HA 4GACA 3T0AA 1HL9A 4H9UA 4BA0A 4J3ZA 1K02A 1RUSA 2V8ZA 3G1SA 2FPVA 2FPTA 3KEHA 3CPUA 4KS0A 2XM2A 4CUCA 3BWWA 3EB3A 3UA4A 3CB8A 3NA8A 3NQFA 3SY5A 2YXGA 4Q4QA 1Q8AA 2ZA1A 2HNHA 1PO9A 4UNIA 2YJQA 2E9MA 1F8IA 3IJDA 4X60A 3H23A 3W7RA 4X9YA 2VGIA 1N8FA 4D6JA 3BCFA 3WNLA 2AQWA 1TIMA 2ACUA 2VFHA 4BJHA 2YLAA 1EL3A 5CC3A 4GH1A 3CL7A 4HHPA 1JPDX 1DHKA 3DU0A 3IAQA 1U2YA 3I3DA 4NZFA 1A0DA 3QQ1A 3VD4A 1O60A 3PB0A 3ZYZA 3TROA 2RGMA 3F5KA 3RJXA 4C1KA 1K9EA 4FNUA 4DJED 3MUCA 3LQLA 4A3RA 2YFOA 2PTZA 1HGYA 1QBBA 4IWWA 2ZVRA 3AMCA 1T99A 2WK2A 1OX4A 3O07A 2ZX5A 3GIQA 1JCYA 2GJLA 3TE9A 3M0IA 5DN1A 4HNOA 6ENLA 1P1MA 1UPPA 2ZTJA 2WNZA 1UWRA 4NU7A 3MO4A 4YVVA 4QAWA 1K3UA 1V02E 3VNDA 1Q7QA 3IS4A 2VZSA 2NSOA 3E74A 4IM4A 5AHEA 2VEGA 4JTJA 2AQOA 1PUDA 1KRBC 2FKPA 1Q6OA 2ABBA 3A22A 3WK3A 3LU2A 3AJXA 3LX9A 5I24A 1XLIA 3DESA 1E51A 4LAMA 3EKLA 2QNEA 2AGTA 1ZHAA 3S1UA 2BXYA 2J62A 3UCCA 1JXKA 3ZVIA 3WUFA 1R5YA 3WQ8A 3HIJA 1W1B1 4HMNA 3GWQA 3TSMA 1FDZA 1TWZA 4S3BA 2Y6ZA 4IPPA 3NM3A 3CV7A 5HK4A 1G4EA 3ENLA 1PCWA 2ADAA 3UWQA 5I3KA 4WKFA 3N2OA 1VC4A 4LUSB 2ZFAA 4M19A 5CEWA 3BJFA 1JQVA 2JQXA 3VI2A 4GKTA 1W91A 5A6AA 4LOCA 1SW3A 3GDMA 2QDHA 2CITA 4POCA 2FZ9A 3S3GA 4BZYA 1OF6A 4H00A 4B2DD 2ZDSA 1KRAC 2YCKX 4MUPA 1AMKA 2Z27A 1C9DA 1J5SA 3A4JA 3OU8A 4Q3MA 1BXNA 4OT7A 4GYKA 3D46A 3QH2A 1V6XA 2FTYA 1LRTA 3GR8A 5EMJA 3V4BA 1VENA 1IT0A 3W7KA 3QKEA 4AD3A 5LIKX 4FF5A 5M5DA 2HCVA 1JCJA 4I9TA 2VXNA 1D7KA 1W3KA 2DSVA 2QUMA 2Y88A 4H2HA 1U33A 1F76A 1P5BA 4LB3A 3W2LA 1DKWA 3TQPA 4KCWA 1E40A 3U3HA 5FL0A 4AY8A 4FX6M 3CPRA 3UW6A 3AO0A 4XO7A 3BAYA 3GHUA 4FS9A 5CC5A 4C6KA 3T8QA 3NDZA 5TNVA 3WD3A 2F61A 3QPYA 4H19A 3I7RA 3SSZA 5PTDA 1XH2A 4FP1A 1V6VA 1EJSC 3RNDA 4WGXA 3L12A 3V16A 4F0KA 2X2GA 3F2BA 2VRJA 3BURA 3LI1A 4FALA 3E2VA 1UHVA 5EYWA 5BW6A 3BCDA 2QCGA 1YQ2A 5AYXA 1E6ZA 3Q65A 3PM6A 2YW4A 1SJAA 2Y63A 3WFLA 1UMYA 1C93A 4ASTA 3ARZA 3V35A 1GVFA 1Z42A 3QYQA 1KFWA 5IBXC 2FMOA 4QGCA 4D1IA 1R2TA 1RXOB 4HJWA 5CJ5A 2F2KA 3VDGA 3W1TA 3MYOA 1B5TA 3KBMA 2DPEA 2X7VA 3M5XA 4LQ1A 1ZJHA 3PULA 4WEVX 1BPLB 4AZCA 1EC9A 3RDKA 2Z6JA 1TJ0A 2BXZA 3KWXA 4DF1A 4QG6A 4H41A 3S47A 3TV8A 4M6PA 1DPMA 1Y5WA 4MAZA 3DUGA 1EOMA 4FX8A 4QS5A 3R43A 3KRSA 3B8UA 1EB3A 2VP8A 1JYWA 3NCOA 1WXJA 4URIA 1W9BM 3MB9A 3UA3A 4LBUA 5CZJA 1E4LA 5LNWA 1TZ7A 1NQ6A 4BQ2A 5LNRA 2V81A 4NZ4A 1HJVA 1SSGA 1FHVA 2OWWA 1DJIA 2TODA 5BCAA 4ZGYA 5D2WA 4RNJA 2UWFA 3BXWA 1DV7A 4IPLA 2PSNA 3S1VA 1OBAA 2AMGA 4JCMA 4LUSA 3T8LA 4BEQA 5D02A 1X7IA 4MZYA 1RJPA 1VZWA 2JBMA 1DWAM 4H04A 4XZWA 3KWSA 3OVRA 2V5LA 2O9PA 4GX9A 4JIPA 5AVNA 1T40A 4ZENA 5AFDA 3MVTA 1IXNA 4GXMA 2PDQA 4LAOA 3BV7A 4JQ2A 2CLLA 1Q6QA 3NQBA 2WCSA 2BB0A 3T81A 4PMZA 4XZLX 2QJHA 4B92A 1PX4A 2BVYA 2CWNA 2YBVA 1IZCA 3WMLA 1XFCA 3HG4A 2YB4A 3EZ4A 2GGEA 4GUFA 2VVSA 1LQ0A 3W07A 4L6DA 3VOCA 3FW6A 2F2HA 3KBJA 5BOEA 3H7RA 4Q22A 3PZIA 1ONRA 3BGJA 1IZKA 3A4AA 1JG9A 3VOHA 4H6QA 2WMJA 2G3JA 3N2MA 1CDGA 2PTWA 2A21A 1M04A 3PBGA 2XIOA 5D37A 4A3YA 2W67A 1ITCA 1TUFA 4C6CA 3VIIA 1CXFA 1UJQA 3W1UA 1Q8JA 3T08A 2RDWA 1E9LA 3SCUA 3UZXA 2XDFA 1ZAHA 2PAJA 4MKSA 3AHTA 3CGTA 5BRBA 1E0WA 4MDPA 4AQLA 3FKRA 4JX5A 2D73A 4JN7A 1SZFA 2PEVA 4B3KA 2Z28A 4UR7A 5I02A 1EPXA 2OPJA 1C92A 2QS8A 3L65A 3GHSA 4RV3A 2E0PA 4C6DA 3K30A 4XSMA 4DUXA 4LTSA 3TC3A 2NUYA 4EPKA 3IAPA 1XPGA 1AD1A 1MO0A 4UFJA 4XO6A 4TVDA 4WY0F 1ZQ5A 4R9OA 4MNLA 3A24A 4D6HA 2AL1A 4NZ1A 1OFOA 4ML9A 4PBFA 3AXXA 3ARRA 4V1YA 2ZXQA 3KOWA 1Q5MA 3GNXA 2GSEA 3P74A 2XG9A 1T41A 4QLLA 3RO8A 2NXIA 4H9VA 3PWAA 3AHYA 4C6OA 4ZE5A 1S5VA 1R2SA 3GNDA 3OEXA 4UUIA 3PZVA 3WK2A 1LOSA 2PDFA 3MMTA 1LTDA 1WOAA 2V3EA 2J78A 4KCUA 2ACRA 4KESA 1A3WA 4QNEA 4DO5A 1KGWA 3KRUA 5FF3A 4IZGA 3RX3A 1G7UA 3W7QA 2TRSA 1NP0A 3DFTA 4J2MA 3C2RA 3S5OA 1XBZA 5T26A 5C9WA 3EGJA 4TXEA 1LBLA 4O0QA 1NARA 4K6AA 1GOMA 1OK4A 2YYUA 4HA3A 4HMCA 1ZENA 2V2HA 3SCNA 3BAIA 2D2JA 4Z17A 3URBA 3FS2A 2NV2A 1JUEA 3AZSA 3PTDA 5I03A 1R7OA 4DBUA 4E2DA 3UETA 2WSPA 4MY1A 4A8LA 3ME3A 3APTA 3CAVA 1YX1A 4EPEC 3H2OA 1QTWA 1L6WA 1YE6A 3P8JA 1IIGA 3GXIA 3VFLA 2GLKA 3RAOA 3LENA 1JCTA 4O53A 1JYNA 2OZ8A 2XIMA 2J88A 3WJYA 3QOMA 7A3HA 2YCEA 2W0UA 4O1AA 4W7VA 5C7HA 3U6WA 4E4FA 1TA3A 3LXAA 3FAXA 3EEGA 4QLKA 3QKZA 4JQAA 3ABSA 3DIPA 3GM8A 3E0IA 1KWGA 2DZVA 3QV6A 3KLKA 2V67A 3PUOA 2XFYA 4RPPA 2OLSA 3TXZA 4LRTA 3E9AA 1C29A 4JIEA 3LBCA 1TR9A 1WAWA 1Q65A 2ZYFA 4B3LA 4QAIA 1F74A 1W17A 4IUOA 2V2CA 2XIQA 3VU2A 1SFTA 3LCFA 1EJ7L 4D72A 1OC5A 2PWFA 4O54A 2XYLA 4XQ6A 2V63A 1OEPA 1G0CA 4Q8TA 1TVLA 3OIHA 2WVVB 4W87A 3UG5A 2DVUA 1VIZA 4CU6A 1FWNA 1IXPA 3D3AA 4GIRA 4MNMA 1CYGA 4OBRA 1J5TA 1DJXA 4B5WA 1GQJA 3DX5A 3T40A 4IMCA 1CX9A 3P62A 1TV7A 2WC3A 1ZJAA 3WH7A 3CYJA 4Q32A 4NJHA 1BG4A 3BOXA 1GHRA 4JXCA 1UZ4A 1EX5A 3VIKA 1UIPA 2CLPA 1HKKA 2X8RA 3WKZA 3MA8A 3WLMA 3BSGA 3NR0A 4QCEA 3CHDA 1J0IA 2QUUA 4GQQA 4WIWA 4GH3A 8RUCA 3BSMA 3B8SA 3IK4A 4BHYA 3KRBA 4YS1A 3IGSA 5C6MA 3WQPA 3HG5A 3NEVA 3PJWA 1PL9A 6PTDA 1JZ3A 3OB8A 3CHVA 4ZFCA 3K8MA 2WSRA 2PGFA 4HA1A 3CZLA 5DY2A 3DOPA 3MSGA 5EFDA 4EAYA 3THQA 2CXGA 1CB7B 1QHZA 3S42A 2X16A 2EPNA 4KWWA 4NRRA 1RBAA 2RJHA 4AZGA 1TQXA 4Y90A 1GOIA 1E73M 1PB0A 3W7JA 4IGNA 2WJDA 1UPMB 2WBGA 2HXUA 1JCMP 3BOLA 1PZ0A 3CWHA 1QFEA 2J74A 1H7OA 1A49A 4HU4A 2GZXA 1S5TA 2TAAA 3BK0A 4GQGA 1E9IA 3C2YA 3HGRA 1NF7A 4JTIA 5HPCA 2B7QA 5C0QA 1B3OA 4AIOA 2QGYA 3MV01 4ZQCA 1F3WA 4FOJA 4MAVA 5I3FA 3GTNA 3NL5A 2BVTA 5A6TC 4A8IA 2ALDA 2CFFA 2C15A 2OQLA 4GJ1A 1WXZA 4DJEA 3U7VA 1QI2A 2E4TA 3ARQA 1UKQA 2WAGA 1EHNA 4DWSB 2FDMA 2A3HA 4WX2A 2XGBA 4NT0A 1IF2A 1V0LA 3GR4A 1HGWA 1W5OA 3FA5A 1J93A 2BMBA 1B0IA 3AYSA 4D2JA 2Y8KA 4DUVA 3HGOA 1E6RA 4YVXA 1B4KA 4X61A 3LCIA 3N9RA 4CU8A 1W37A 3H4XA 5KZDA 3VK5A 2TMDA 1BXBA 3H6OA 3HPZA 3CIXA 1M7OA 4I7VA 5M17A 4UOJA 2BHZA 1ELSA 4UMBA 1UWUA 3LK6A 1PTDA 4HMDA 1VYRA 4REQB 2VGGA 1UD3A 2XWDA 2HQAA 2PGRA 1F2JA 1K8YA 5DFAA 1E0XA 2WLYA 4KFPA 2YA0A 2ONEA 4DO6A 1F73A 2WVVA 2HV5A 1IEVA 1EJRC 2VT0A 2C0AA 4W89A 1W54A 5FD0A 3GDBA 1R2RA 1WAUA 4JTRA 3NGFA 4EACA 1BSIA 3GE7A 4J3VA 2Y0FA 1QI3A 3PY2A 1CTNA 3V0UA 3DBNA 1W3HA 2VYOA 1HIZA 4TV6A 3FHQA 1IGWA 4PMYA 1AVAA 2OOGA 1I75A 4IIDA 4YN5A 3H7UA 2CKRA 1W1ZA 3FAWA 2R1PA 4HPGA 5EKYA 1Y7VA 5EY5A 4B2DA 1C3FA 4W86A 1X6LA 5BOFA 2CHRA 3TTSA 1FY6A 5FESA 4G9PA 4AD1A 4P8XA 3VE9A 2GJXB 5GJPA 2DVTA 1NWUA 4FLRA 3V1PA 4O4WA 2WZHA 4PSPA 1RD6A 1Z6KA 3QGAC 5A6SA 3O1NA 3TW7A 1NDYA 3SR7A 1PDZA 1L6GA 2QR6A 1JD7A 1H3GA 2ZRUA 2XH2A 3HPFA 1Z89A 1W1YA 2XN1A 3V18A 3C61A 4JTLA 1G4TA 5TD4A 1TWIA 1VB9A 4B91A 3TJXA 4D6FA 4YTSA 4S3KA 1SPQA 1U5JA 1RQHA 3TOPA 1X1ZA 3WLIA 2OTDA 4RPQA 4R53A 4U31A 3VUSA 5H6HA 3BUVA 1XCFA 4IG2B 1J0JA 3IGXA 1ICQA 1XH1A 1F8MA 3IUHA 4DAFA 3LD5A 3S2LA 4GABA 2UY5A 1O5RA 1CGYA 3CM4A 1MDLA 4DY1A 3LZ5A 1OQFA 1QRQA 4H7CA 4NNBA 4H1ZA 2CIPA 3P8IA 4UFMA 4KFOA 4DJFC 2OYLA 1OC6A 3SUWA 1RY8A 2DY3A 3RLHA 4EX4A 2QVNA 4QQ3A 1POKA 4JQ1A 4NYUA 1M53A 3CV6A 2QCMA 2QULA 2WV8A 4BF5A 1NH6A 2BBFA 4UMAA 1VR6A 1V3JA 4FNTA 1FHLA 1LOQA 4GQBA 1DJHA 1JDDA 4PRRA 1LDCA 5I3IA 4KH2A 4JYEA 1WB0A 2V3GA 4NY2A 3L4VA 1JJKA 1GQIA 1TPDA 3E96A 2RUSA 3A47A 5IFPA 4UNKA 1N8WA 4CCCA 4C6PA 4FMVA 3HGSA 3W23A 3MJYA 2P8BA 2PLJA 1TPWA 1TV8A 4KEVA 1S2WA 2EKGA 3CMFA 3BICA 1JPKA 3CHCA 2XTKA 4O8RA 1WDWA 5DX7A 4JTQA 4YMZA 2INZA 2VGFA 2WHKA 1E4MM 4OU1A 2PWUA 3WD1A 6REQB 1TMQA 4GYPA 3H53A 3IPWA 4F2TA 1CXKA 5F4XA 2PF0A 4REQA 1EP1A 2GVYA 5ECUA 3WQWA 3EB4A 4C6MA 2ZICA 2INEA 5BMWA 4WRHA 5LNUA 3TFCA 2D69A 4QHRA 2VUNA 5A6JA 1G94A 4LUTA 2NX1A 1ZBKA 3S5YA 3RUBL 3VD9A 4KCVA 1UD6A 4YCPA 4WUIA 4FNQA 3ZWTA 2VX7A 3JVAA 4TOQA 3IARA 3UWWA 1YTEA 3VNIA 3OQEA 2PLCA 3EOEA 1MEWA 3AU2A 3W3OA 1HJWA 2A7NA 2FH6A 3OVPA 4GI8A 3AICA 4V2XA 3L68A 1DQUA 5D9OA 3PJTA 4AEEA 2GL5A 4LAKA 1OC7A 2CCRA 5JH2A 3R5EA 1O1ZA 2A3LA 1R46A 2IXVA 1QK2A 5F1VA 5FA5A 2FFCA 3APYA 3F5LA 3GUGA 4BKNA 3VGFA 4Z2IA 4HBKA 5AC4A 3DBPA 1GWJA 1L8NA 2OSYA 1OF8A 4Q6JA 2F6UA 5SWUA 2VX6A 2Z25A 1XYAA 2CLHA 4GUJA 2QUTA 1CXIA 2C7FA 2IKHA 3RPMA 4Y8EA 4U2ZA 1OJXA 2XJ7A 3RM4A 1XRSA 2E6YA 2R1NA 3TU9A 3ARTA 3ANYA 4LYKA 4JL2A 3I4EA 1KBLA 5G1YA 1OIFA 2D3NA 4P2VA 1LLZA 2EJAA 2WHLA 3H12A 1SFSA 2XH4A 1GOWA 5TF0A 4EPDC 2DT3A 1K4HA 7REQA 3TYDA 3W71A 5BXRA 1GVYA 3CO8A 1UB3A 1XYZA 3KS6A 4U2YA 4IG2A 1IE7C 1DWJM 4W8BA 2CU0A 3QSRA 4HHLA 3P93A 4P8WA 4YHEA 1WX0A 1XD0A 5LXEA 2I1OA 4GXPA 4DO7A 1LRQA 1OX5A 3S1XA 1BQCA 2B4GA 3UWUA 2G8ZA 4X3ZA 1EXPA 1G1YA 4V1XA 3TA6A 4GBUA 4AWEA 1B90A 1ME9A 3N3MA 1OG0A 2BHYA 2YBTA 1Q6DA 4LXFA 4GY1A 5K9XA 3ZVHA 2BNJA 9CGTA 3OTRA 1UW9A 1MFVA 4KWUA 4TUFA 1UA3A 4JN6A 4FLQA 4BS0A 1O7AA 4PTNA 3GBEA 3FX4A 3TN6A 3UFYA 2X0HA 4CEUC 4QITA 4TVCA 3WNPA 1R9ZA 3ARUA 4IMAA 4OUEA 2WSYA 4GBDA 1A0EA 3GFXA 4H6RA 1JZ7A 3POCA 3B0YA 2EPKX 3NL2A 4M24A 2BVDA 3TOYA 2J24A 1CXEA 1VFFA 3G24A 3TKFA 3QZEA 2FB2A 2F6XA 3VIPA 5CBJA 4P7QA 1ZRQA 1R0MA 1H0GA 2OELA 3WLLA 3R0UA 4ZB5A 1OX6A 1LQ2A 3GHTA 4KEZA 2X41A 1KM1A 4AZ6A 1XGDA 1SO3A 3JRKA 2AGKA 3NJ3A 4AYSA 4W4QA 1J11A 1XL9A 2QMKA 1WPCA 1NP2A 1ZJBA 1RPKA 2I9EA 2NX9A 1J2WA 4A35A 4IQDA 2I5GA 4MM1A 2A3EA 3RRXA 3VKDA 4M0XA 3NEHA 1B54A 5HULA 4AIUA 3OOQA 1JL8A 3T9PA 2J4GA 1TYGA 2ON3A 3WCZA 4I6KA 2Q3RA 3OIXA 4K2SA 4PB5A 3LCHA 2ZX6A 4PUDA 4QEEA 5J5DA 1TJ1A 1S2UA 1S39A 4HOWA 3DFPA 2BGNE 1SFJA 1XDJA 5EMUA 4MYXA 1FP9A 2FZMA 1KFCA 2FVKA 3F2DA 4DLFA 4UXDA 3P67A 4M1RA 5FEPA 5CCZA 2G97A 1QHPA 1ZS2A 4JHMA 1YNPA 1LRNA 4PMQA 5D04C 2OJPA 3KE0A 3UG4A 3NNTA 4NHVA 3B0VC 3IIPA 3N25A 1I6NA 1J0HA 1FRBA 1H0IA 3ZLHA 4AWTA 1BKHA 2VZUA 2D2HA 1E6PA 1OABA 4GD0A 1RCOB 1HT6A 2CLFA 5JQ9A 2Y8VA 3OW1A 3FVDA 5AYIA 5HNNA 4WJEA 4EIVA 1TTJA 1T8XA 2OB3A 3W24A 5D8ZA 4ERIA 3B9OA 2FZ8A 1V6TA 4IXXA 2WPBA 1BHGA 3R58A 1H5VA 2VFIA 2QKFA 3UJFA 3BLDA 3RGTA 3WG6A 3QY7A 3SCOA 5J8LA 4KF1A 1QATA 1OD8A 2Q71A 2W79A 3DKJA 4YNGA 1G5AA 2XM1A 2YCLB 2GOKA 2AL2B 3SW6A 3MU7A 1C7TA 4O18A 1QNRA 3V5FA 4ZXLA 3GK0A 1W1PA 1OFDA 2PPGA 3L4XA 1QMLA 1OIMA 1X1NA 1XRVA 3LPOA 1VP5A 4L4LA 4B4HA 5HAOA 1Z69A 2GPTA 3E1F1 1UYQA 2C79A 3SN1A 2QPSA 2EPLX 2QQ6A 1PKMA 3VFCA 3TYBA 2NQ9A 4TU1A 1ZUAX 2W9MA 4CD4A 3SFWA 4ZOEA 1U5HA 5A6BD 1LUCA 1CGUA 3RX2A 1FXPA 2CPUA 4JY8A 2OSWA 2ISVA 1U30A 1UROA 1LYXA 3VD3A 1RP8A 4M7TA 3SCPA 1ZZMA 9XIMA 3WF2A 4I90A 4HPJA 3C56A 3EBVA 1FHDA 3VDAA 1PZ3A 4Q4SA 4I9JA 4BY3A 1PIFA 2YL9A 4UIOA 1V79A 1F3XA 4B90A 1W3IA 4O28A 3ZQ9A 4GUGA 5ECVA 3A4WA 3TX9A 4XWUA 2ZIDA 3AXMA 2F6KA 3K2GA 4A8NA 3BTNA 1V77A 3SFKA 1GG1A 4H83A 3MQTA 4DI9A 1M01A 3DG3A 4J4KA 2OWCA 3M5VA 2FGBA 4N02A 6ALDA 1RAKA 4JTUA 1WV2A 3EYPA 3CUIA 3G6LA 1I2RA 3TMQA 5K2ZA 4IFOA 5JIPA 1YTKA 1X39A 4WJ8A 2CHNA 1GVSA 4FXSA 1FP8A 4QFUA 5LA2A 1SU5A 2Q8XA 4QP0A 2QAPA 5U4NA 1TCDA 2WC4A 4L80A 4XD3A 3TN3A 4NJIA 5LGZA 4GK8A 3LS9A 4C90A 3KX6A 2J7DA 2X40A 3ABOA 4WKHA 4GJJA 4PGLA 4BWLC 2X7WA 3RCYA 3TK7A 3WDHA 1FH7A 1AZ1A 1FCQA 1MI3A 3UJEA 3MMDA 3M0XA 1XH0A 2A4AA 3SM0A 1PTAA 3RLGA 2EG6A 1G69A 1XLCA 5HMFA 4IJCA 5FJUA 1K9FA 1SM9A 4N9CA 2VC9A 3JUGA 3PSWA 1G4SA 4Q4KA 3ORWA 1W3LA 1FWBC 3LGGA 3TJLA 3RFAA 3EOSA 2ACSA 1TO3A 4OFCA 5D32A 2AQVA 4LW7A 3LM3A 4MGGA 5CSYA 4DPPA 4Y96A 3U5UA 2ZC1A 5KZ6A 3BG9A 3FYYA 1QASA 4LAUA 3T2QA 4HK6A 2EAWA 2E9LA 1P7TA 3DG6A 4GKLA 3R13A 1M1BA 4AX6A 1J6PA 2ACQA 5BROA 1KFEA 3A3HA 3AZTA 3WF1A 5EMYA 4PUKA 4K1WA 5DBUA 3PANA 2FHBA 1Q63A 2W4XA 3ITGA 2UBPC 3Q4DA 5I0DA 2W63A 4M6VA 4UZUA 2GVEA 4C60A 3UQNA 1EYEA 4HN4A 4IL0A 4GY0A 3TEVA 4OIFA 4QG8A 2OQHA 4XD4A 4KGJA 4IFKB 1DP0A 1OADA 5A3HA 1OYAA 2VCAA 2V3DA 5TQLA 1FTXA 1VCVA 1U22A 4FEZA 1A3HA 4ZOCA 3GU9A 2AKZA 2PWDA 2XGZA 1KXHA 3DHDA 3E5BA 3C2OA 1KCXA 1HJXA 5HMSA 1TTQA 1KBJA 1PZ2A 3QGKC 4DJDC 1EJWC 3A6OA 3EDEA 2G50A 7ENLA 2Y7FA 1Q2SA 1KRCC 3PK7A 1VHCA 1BVWA 4M80A 3WQDA 4NXSA 2P0IA 3W6YA 4GIAA 2EF9A 3GS6A 1PHWA 3R4IA 4AUBA 1AUSL 4AMAA 3E5PA 3PPCA 3OVGA 1FWEC 3MKCA 3UP8A 4MB1A 6TAAA 1MNSA 2Q8ZA 1I0BA 1V7YA 3M0MA 5D9MA 2W27A 4O0ZA 4XAGA 4H9XA 5D2TA 3LHYA 4J35A 4DF0A 3CHFA 1P4CA 1WQ5A 4OV4A 4CLMA 2VC7A 3VZXA 3GTXA 5IFTA 3RCNA 1VD6A 4UCFA 4S23A 3SQMA 1H1YA 5T8GA 1A4MA 1I1XA 4UOZA 2J7BA 1E1EA 4Y2WA 3NURA 4QDPA 4D71A 1IEXA 2FHCA 1JZ8A 1TPC1 3GH4A 1ALDA 3WDRA 3LV6A 3LUTA 1V3HA 4GYFA 3MTWA 3ECQA 3NOYA 1XR2A 2F9RA 1XV8A 3G0XA 1NDWA 1OY0A 3DC0A 3S4TA 4NZCA 3MBDA 4D6CA 3VOIA 3AI0A 4J40A 4C6QA 3A3XA 3DHPA 3HV9A 3MUZ1 3PUDA 1W0MA 3OA5A 5IM51 4ROPA 1S5MA 2G0WA 3A9IA 1V8EA 3BE7A 3F4CA 5E93A 1DYSA 1VBGA 1H62A 2Z6IA 1FA2A 1XKYA 4C6BA 3MANA 3PBYA 5JH1A 1YRRA 1EQCA 3N6HA 2PODA 4WKAA 4XUGA 1XQKA 4RDWA 4LY8A 4MHBA 2XVPA 4JBRA 1TKKA 1LZOA 2P5NA 5HUPA 3S9ZA 3N6QA 2WANA 1DXEA 1VYPX 1QWKA 2V5BA 3SCRA 2I17A 4QQUA 4M3PA 1WDDA 4IPNB 4QE4A 3LMYA 2TPSA 4AX7A 1V6UA 4LB4A 2QCFA 3WENA 1OFPA 5EBAA 2IPGA 3BJSA 4LU0A 4DB7A 3AIRA 2J79A 1Q4NX 3PZQA 4I7UA 1REQA 4UFIA 5C2XA 3LG3A 5A2AA 2QW5A 2H3BA 5FJIA 4IFKA 2NQJA 2BS9A 4GVHA 1KBIA 3G1VA 3W1RA 2HNEA 1XG3A 3IJIA 1US3A 5DMYA 4V27A 4K1GA 5D05A 1FXQA 1IXQA 1HUVA 3EDKA 3GU1A 4Z2HA 2XIJA 1A5CA 3BAKA 3SY8A 3BQ5A 4OGZA 1E4NA 2ZXDA 1E6XM 1F7BA 2J9XA 3N18A 2NLYA 2ZVIA 1S3HA 3T78A 4FNSA 4MFDA 1UMLA 7PTDA 2NVDA 2YR1A 5HMEA 3GTFA 1M9HA 1ITUA 2YL6A 1OCQA 2XFFA 4QM1A 3VOJA 1J10A 2VD9A 4JZ5A 5C9XA 4C7GA 5GPRA 4XD5A 1BYDA 5ABGA 1S38A 3BPWA 4BI6A 2PDBA 5C2CA 5LSMA 3SURA 2NQZA 3NWRA 2DSZA 3N13A 3ZWSA 6XIAA 1AH3A 3DFNA 2J27A 1CNVA 3IUDA 1GKQA 4IQEA 1H09A 3FHAA 3NQCA 3THCA 1HF6A 2XVLA 4QROA 3W72A 3NO1A 3Q58A 1IQ8A 3M16A 2PDCA 2VQUA 3O16A 4HZMA 2VENA 1W9DM 4CVWA 1OFRA 3KRZA 4GNJA 4HVXA 1UD5A 5FJPA 1P43A 1HJSA 3D6NA 3WDJA 2NVAA 4AFYA 3ZLFA 4IP7A 5CZ0A 2J8TA 1UZHA 4UCGA 1EX1A 1VQTA 4ZEPA 4QG9A 3NQGA 1EOKA 3N73A 3G1FA 2JGYA 2B0MA 3LCLA 1Z41A 2IMRA 1EIXA 2WSQA 5I07A 1VJZA 3W7LA 4MJ4A 3EB2A 1QI5A 5E0CA 4WGHA 4S3CA 3EDDA 3EWCA 3GVGA 5KZEA 1OGSA 2OO0A 1EF3A 3GG1A 3H22A 3O0KA 3BMWA 2JKPA 1EEXA 1UD8A 4WXZA 3VIHA 5EA9A 1H49A 1V3KA 3R8RA 5F7UA 4RZ4A 3K1GA 3C0LA 3XIMA 1C8QA 4C5ZA 1Q4WA 3O6CA 4N4PA 4PTMA 2PP1A 3EX3A 1GVRA 3UZWA 1G01A 1E0TA 3VZZA 3UJSA 4AXNA 2I14A 3LMZA 3A64A 1PZ1A 4DLMA 2CW6A 3R0DA 4AD0A 4RX0A 4TX6A 3LNMA 4PCNA 4HHHA 3GFYA 4MYAA 1DIOA 4S2CA 5FAJA 1XSKA 4M8UA 4AZIA 2XWEA 4QJ1A 1WP6A 4NAFB 3MDWA 1AL8A 3TYZA 3CQ0A 4YU1A 3WSUA 2DZAA 5C9UA 4XAPA 3HQ1A 3EOUA 4S3EA 1XYLA 5LKYA 4H4IA 2BV9A 3K4AA 1RPXA 1S1RA 2FHFA 2VI0A 1T7LA 3IK2A 3ITVA 1MVYA 3BZGA 3GNOA 5G4EA 3ELFA 3V75A 4RNFA 1GTHA 2PDGA 5C55A 4EANA 1GPFA 1A47A 3TYAA 1XBXA 5HQMA 2A2IA 4TMBA 4XIAA 3QC0A 1EZWA 2ZX7A 3REQA 4JAWA 2ZE3A 1HJUA 2VDHA 1H1NA 4DNHA 1TFVA 2D0HA 2FH8A 1GONA 1F3TA 1GK8A 3CMJA 1X8CA 3EA3A 2FZNA 4UNLA 1RY0A 3URAA 3TFXA 4E4UA 2VFFA 1KTNA 2PTXA 2ZC8A 3MCNA 4K36A 5DMMA 1OCNA 1S5NA 1BLIA 1VKFA 4B5TA 4ACZA 2ABAA 3DG7A 3WQ5A 1ZAJA 3GDKA 4AD4A 4LVDA 2EPHA 3R8GA 3GXPA 3LM7A 4RKAA 2J7HA 4RUBA 1VBHA 4GIYA 1HTIA 2VFEA 1AQMA 3B9EA 3MO7A 1WBJA 1TPVA 1FCBA 4LF1A 1P0BA 1A80A 4R7JA 1FWRA 3ZM8A 4UMCA 3TSDA 4M7SA 3URQA 1H7RA 2HE8A 4J9JA 3M0VA 4PUWA 4FOUA 1EGZA 2V9DA 3TYEA 5MKGB 4L9XA 1FBAA 3WDQA 3O2LA 4DIAA 3W82A 4TIMA 3W7IA 4AHQA 1JULA 3WQ4A 3ATYA 3RO6A 5A6BA 3TR2A 2QVHA 1E6QM 3SIMA 2DFAA 4B4FA 5DCBA 1SUXA 1KFLA 4HPXA 4L4PA 1VEPA 4IIFA 3UERA 2PFHA 2WBKA 3CAKA 3R12A 4J1OA 4KQNA 1LG1A 1ICPA 1H60A 1JF6A 1WUEA 1CGWA 4RK8A 3IGHX 3NFUA 3IJ7A 4GUIA 4LEQA 3UD6A 1E43A 3S46A 3NOEA 3HMJG 1ML1A 1GZJA 1SR0A 4HZ7A 1MZHA 2ZRVA 3W76A 1FWIC 1R3QA 2DDXA 4HQVA 4MPQA 3UYCA 3OGRA 3IJ8A 3ANVA 5H91A 3KBWA 4LEFA 1HKJA 2DP3A 4RE4A 1QI0A 3PS7A 3F4DA 1ZY9A 3W01A 2Y24A 2Z1VA 1BYBA 3L2LA 4A4AA 1TZZA 3E3HA 3PZNA 1BXCA 2VL4A 8TIMA 3L0NA 4JX4A 1E5JA 3PG9A 3CIWA 3PBVA 4DM1A 3QLDA 3KDOA 3UG3A 1NM9A 3MW7A 5D4YA 1XLAA 4RCXA 1ZBWA 3DYOA 3O63A 3KFTA 4M56A 2QF7A 4PCFA 1C8VA 3CLWA 4NAFA 5CQ1A 4F4RA 3AWNA 3TP4A 8XIMA 6A3HA 2JKEA 4M6QA 1UC4A 1DXFA 2A7RA 2B7OA 1VFHA 4XUYA 2QIIA 4TR9A 3L2IA 3FOKA 2XZ7A 3KDNA 2BY3A 5CSUA 2DUZA 1J4EA 2C91A 1A53A 3T0CA 2E28A 1KLYA 2IXUA 5HWJA 4KEMA 1YPFA 2MANA 1JGMA 1KV8A 1MRAA 1TUXA 3P7YA 4N42A 4ZO7A 1AG1O 1VFMA 4C6IA 3BAWA 4IXHA 3VOGA 3THAA 4WXYA 4DJFD 3FLUA 4CCEA 2DZWA 1YADA 1KXQA 1QDSA 5FEZA 3VMNA 3LGEA 1UR8A 4JTKA 1I1WA 4DELA 1BEUA 3VPLA 1TE1A 5A8NA 4DUWA 1AQ0A 4I9AA 2C1GA 1PKYA 1I60A 3STGA 3TVAA 3VNZA 5HXMA 1XGZA 1WE5A 3LRMA 3H26A 3GXMA 4EF9A 2XH7A 1LWHA 5IBXA 3TYCA 4ICMA 2XIIA 3C86A 3EDJA 3WUBA 4MIMA 4X22A 4CU7A 1XDLA 2JIEA 1NVMA 2XSXA 3TAOA 3W1XA 1W9UA 2BDQA 1J01A 1EKOA 2BOFX 4XSLA 4YYFA 4QE1A 1RBLA 5AYBA 3PAOA 1JCNA 4LV4A 1Q66A 2E67A 2JK2A 1VHNA 1EJVC 3G1RA 2PE4A 1Q13A 4U5KA 5E1QA 4Q8MA 5D9PA 2GGHA 2HMCA 1RV8A 5GJNA 1TG7A 4CD5A 2QV4A 2JFEX 5MKGA 3FJNA 2OT0A 4RDZA 1NJJA 1GQNA 2VM8A 4YIWA 4MLJA 1JZ2A 2W6RA 1OK6A 4ZOAA 1XKJA 4U4MA 2CLMA 1VFOA 1YMYA 1DEDA 4JTTA 1AH0A 1Z48A 4KW2A 4MUZA 1W3JA 2NX3A 3QM3A 1NFGA 4UTWC 2XVKA 4R88A 3NG3A 1AMYA 3CIVA 4AAJA 4O14A 1SZRA 4DJEC 3UXIA 4LPCA 2YYTA 4NX5A 1FH9A 2PGWA 3KL5A 3L4ZA 4JD4A 3PZUA 4JFVA 3BAXA 4E4PA 4AC7C 4GC4A 2C0HA 3VINA 1DIKA 3UCQA 1UP3A 5C71A 4DN1A 1WZAA 4YTUA 4LANA 1M5WA 2PCEA 4PH6A 3I6RA 3WH6A 5DANA 2ZTKA 4ROQA 2PMQA 1XXXA 5CBBA 2GWGA 5M03A 5T9BG 5CKSA 1UKOA 4NZ3A 2ZZ3A 1AD4A 1F6PA 4GINA 3WQGA 3FXYA 3VVGA 2QCHA 3WK1A 4YTTA 4RLIA 4WVXA 3W00A 1C8XA 4JTFA 2QMJA 1FCUA 1VEOA 4O0KA 6XIMA 3MSYA 1PJ9A 5XIAA 5JVLA 3WH8A 4UQEA 1GOOA 1YDYA 2PBOA 4QR6A 4UQ9A 5A8OA 4JHOA 2JF6A 5D9NA 3EXTA 3C0JA 1MDRA 1ADDA 1G6CA 3KCJA 3CYVA 3OJGA 2E6FA 3E0WA 3G5EA 1QT1A 2JF7A 1BFNA 2PDLA 1WKDA 4US5D 1SMDA 4LWWA 3UJ2A 1Q6LA 2NLIA 5HOSA 2BG5A 5K3VA 4NJGA 5AKQA 4O50A 3MZNA 3AZRA 4JIHA 4OOZA 2MUCA 1QW9A 2QCLA 3UCDA 1SYTA 5ENLA 3MT1A 5CG0A 3FXGA 3N2BA 1KCKA 1XLBA 4D6EA 2F8QA 1X98A 3SRKA 3WEOA 5BWFA 1RP9A 3NL6A 2PC8A 1R86A 4GWEA 5DRCA 5I23A 1PS9A 4ERAA 4AF0A 2QAFA 2DGAA 3T2OA 3I3EA 1UR1A 3WQEA 1X96A 2VVNA 4BK9A 3LZ3A 2G3MA 2ZZ2A 3W22A 1Q85A 5KITA 5CPTA 4UC5A 2PBGA 4E8CA 1LF1A 3S2JA 2AOSA 3CNYA 3KZSA 3KUMA 1FDJA 3W85A 1OWQA 2DSWA 3U2OA 1NWTA 3LTSA 3WLNA 1XD1A 4JFUA 2AAMA 2ZX8A 2C1HA 3M46A 3OGSA 1ADOA 3TUUA 3AS2A 1CW2A 2CLEA 3RM9A 1WZKA 3W28A 5BYWA 4HPHA 2CLOA 4U28A 5CJNA 2PDXA 3IRDA 4P5UA 3H2CA 4NF7A 3FJLA 4AWUA 1NEYA 2D1ZA 3K5XA 3CZKA 3NYDA 1OYBA 3WBXA 1F5ZA 4XVEA 3F03K 1I2QA 4MZ1A 5EL1A 3B8TA 1ZBVA 1FUYA 3V0SA 3TC7A 3OA3A 2F84A 2PB1A 3AMGA 3GNRA 1WDPA 4GX8A 4IT1A 2V0TA 3OVQA 1VLWA 4PL2A 2UV8G 4D1JA 1DJGA 3OODA 2F38A 4MF4A 3BG5A 3DH7A 4WJXA 1GVIA 3USZA 1K9DA 1ECEA 2Z7GA 1IEIA 4DWSC 1UASA 1RA0A 3RU8X 3AU6A 1KM3A 3M0YA 3PVFA 1Q7ZA 5AZ0A 2GGIA 4IGSA 1WKEA 1IWBA 4UQDA 3UY7A 1RD5A 3C8NA 1TPUA 4MY8A 1YXYA 1KQZA 3MMUA 1PYFA 1ZCOA 1GYMA 4PFHA 1DHPA 1VRDA 1ZP3A 3CWNA 1GCYA 1LWJA 2PDKA 5E5CA 4D8ZA 2ZUMA 1EWEA 3NQDA 5HR6A 5HQLA 4K37A 5LIYX 1DWGM 3BZJA 1RCXB 4GYPC 2OQYA 1TWSA 1Z32X 1KO0A 4MB4A 2J9YA 1XLKA 2FVLA 4JTAA 4DPQA 3AIVA 3DKLA 4CQBA 1R8LA 2H9AB 1FWSA 5AOUA 3TA9A 4N9DA 4KETA 2NVCA 3QPZA 4AZ7A 5BRQA 3I65A 4N6EA 4LJ3A 4E2OA 2BX7A 1KW1A 1XLMA 1CWYA 1H5YA 4NJKA 3QBUA 2E25A 3KL0A 4Q4MA 5D38A 2WQDA 1XM3A 2CC0A 3T4CA 1MMFA 2LLEA 1M68A 3NQ8A 4GNVA 4ZXOA 1J6OA 2A7PA 3RXZA 1WA3A 2VKZG 3NZGA 3NQ2A 1PYMA 3EPMA 1TWDA 4AZCB 2D0GA 5E9XA 1N7KA 2VRQA 1NAL1 3EWUA 2E6DA 4E3TA 3P2VA 1W9PA 1KM4A 2D23A 3VM5A 5FF7A 1VRXA 1F05A 4B5SA 3DXIA 3SCWA 5G2HA 2BZNA 1UQYA 1OT2A 1DE6A 2WVTA 3AIBA 3W84A 1BGGA 5IHSA 4NI3A 4W5UA 1P1XA 3LCGA 1VFLA 4NG3A 4ZSTA 1FDYA 2D20A 2V82A 3S0CA 1W8SA 1K03A 3H7VA 1EQPA 3DFSA 4GYJA 3GYCA 2C6QA 4CNTA 4JTHA 3VKBA 4F9DA 3LOTA 4AY7A 2ZRYA 4A2SA 3GRIA 3KCOA 5J5RA 3WJSA 1H50A 2YFNA 3GH5A 2PDNA 1UWSA 1PSCA 2EHHA 1KCLA 4E8DA 4KRUA 1NDZA 1B3WA 1KRMA 2Q01A 4PMXA 3L5MA 1MW3A 1QHOA 2YX0A 1R6WA 3LHWA 4PUEA 4R9XA 2HDJA 3U57A 2DW6A 4ADTA 3IWPA 2J13A 5FI8A 1ISWA 1J9YA 4XV0A 3CB3A 1C7SA 1WXYA 1NWRA 3L7RA 1BF2A 1BWLA 1WOBA 1XX1A 3LQGA 2WPGA 4NAEB 2PA6A 1BSLA 1GJUA 1MEIA 4XTIA 5HA7A 1Z3NA 4FHAA 1W5PA 1RZMA 5EPDA 4BI5A 3S9YA 4JS3A 3VO0A 2HVMA 4LVBA 5DELA 5DY3A 5REQA 3L66A 3ICJA 2OKTA 5DCDA 1L6SA 1TX0A 3O06A 2H6RA 4C6LA 1WUFA 4HP5A 1UD2A 1FH8A 2CYGA 3UWZA 3O15A 3LYEA 4B16A 1OB0A 3ZFHA 3VX1A 1M7XA 1X6UA 4HU0A 3TWBA 4WHBA 1XWYA 1KM2A 3SAZA 4U33A 5A6LA 2FZBA 1W5QA 3EX2A 2CHOA 4LUYA 4W9TA 1ISYA 3MI3A 3OYXA 1DVJA 4QTGA 3N4EA 5E9AA 3GY1A 1QW7A 1EGMA 3W87A 2WYSA 1QNVA 3SSJA 2ZZ5A 3LLFA 3WQVA 1DWHM 4ES4A 3T0DA 3U7BA 3GTIA 5D09A 2GGJA 2H9AA 3COTA 1J0KA 4LT9A 4D9PA 4H6KA 4ZFMA 4DEFA 4GFIA 4KRZA 4GC3A 3II1A 4Q8VA 2QJMA 1SGJA 1YBQA 5XINA 3EMQA 2TSYA 3W53A 2W61A 4DYJA 1S1PA 2XFWA 3EA1A 5DO8A 4O19A 5M2FX 1PIIA 3OHMB 2WZEA 1XUUA 5DLCA 3WL1A 3LV5A 1EDQA 1MWOA 3PBUA 1OZQA 1JDAA 2ZADA 1VBUA 2ZX9A 1QXLA 2X30A 3DZ1A 3P6LA 1YLVA 3VOFA 3MSRA 3ALGA 3GBDA 1QO5A 1IYXA 4R34A 1QNQA 4QX4A 3HB9A 3K8LA 3MCOA 3OBEA 1FWCC 4A05A 1MXDA 3O9NA 1G67A 1FQ0A 2NQHA 4AIBA 4C6NA 3SCSA 2W3ZA 4PULA 4ZE4A 1RJQA 1CECA 3BMXA 1H63A 4ICCX 2VDIA 4ERGA 2ZRXA 3L67A 3M0HA 2CERA 3HTWA 1V0KA 4LRSA 1OSEA 1VBRA 1QPRA 1O95A 4JDBA 3S6TA 4HTBA 2VWSA 1P6WA 1QPQA 3PTQA 3NO3A 2DT1A 2GDUA 1BTCA 1IWAA 4DJDD 4JDYA 5J04A 1I4NA 2I16A 1CGTA 3BO9A 1PAMA 1TVNA 2I57A 2Y62A 4NX0A 1KC7A 1SSDA 9XIAA 3LPGA 3R10A 4M82A 4HKPA 2NQLA 1PIGA 5ABFB 3R0KA 3H21A 5H2ZA 3NIYA 2XZ9A 3NDYA 3WNOA 5HQEA 4JIIX 1TA3B 1O5QA 3SADA 4A22A 5DT5A 1JI1A 2P3ZA 2QCCA 3UT0A 1NFPA 4UTIA 1XCXA 3C3NA 1OT1A 3WL0A 2QPUA 4X0VA 1B9ZA 2IKJA 1HJQA 4GISA 4GO8A 4YVPA 4D8LA 5HPOA 1DJWA 2J8GA 2RAGA 5EGRA 4DJFA 1R38A 3TC6A 2POZA 3QXBA 1TREA 1UC5A 3W25A 3PZTA 1H7WA 1UH2A 3JZUA 4JL1A 2HPMA 1S2TA 1FHUA 1JZ5A 1M7JA 4E0CA 4HNVA 4NAEA 5E6ZA 4C7DA 3DDMA 4O15A 1PE1A 1CENA 4ZQNA 3KLLA 4CGTA 2FQIA 4LC6A 1V93A 4O12A 1XSJA 4LNYA 4PTWA 3THDA 1JNEA 2PDHA 4LS1A 3VNYA 3EX1A 3QHOA 3AMLA 4AW7A 3BJTA 2IUZA 3KP0A 1FFQA 4AVNA 1ZJIA 2WNNA 4R33A 2OFJA 1IZJA 1AJ2A 2V5DA 5JBEA 5BOOA 2J7FA 1DQWA 1P0EA 1UA7A 1QW8A 1HO4A 1UH3A 3RN6A 3UWEA 3GC4A 1XDMA 4J5NA 1NWSA 3FK4A 4M29A 3U48A 3UU0A 3CZGA 2NWSA 1TPEA 1WNOA 2ZXBA 4A3UA 4RE2A 5FEWA 3UG8A 4AC1X 1G4PA 2I7GA 3L4TA 2QJJA 1R47A 4IL2A 3L21A 3C4UA 4UTTC 2ANUA 3NYZA 2NXHA 2R94A 4OOUA 3QTPA 2BTMA 1R3VA 2DJLA 4Z0JA 4MTVA 3M47A 3RF9A 2BWGA 2FZDA 2YA1A 5LIXX 3LHUA 3W7EA 4F0LA 3HQNA 4OTKA 3CO4A 3MKKA 1UIOA 3MP4A 4GG9A 2VOMA 2PRLA 4AWSA 1TV5A 4CN4A 5A8QA 3UZZA 2DVXA 3MUIA 3NDOA 2JEPA 3P5ZA 4NI8A 4IIBA 1C91A 2J75A 1TIWA 4ZOBA 4GVGA 2ZUTA 2G37A 2OG9A 4JQ3A 4HYWA 4JX6A 5CPOA 4MWAE 2UY2A 2A3CA 3ZT7A 4B15A 4PRTA 3UY8A 3BGGA 3WF0A 4GUHA 2VOTA 1EA0A 3APGA 1QI4A 2CBUA 3F4WA 4IQJA 1SZNA 2HE5A 2YIHA 1Q6RA 4ZB0A 4DHGA 1XIJA 3GSMA 4UOQA 5HUOA 1MW0A 2GJPA 2REQB 1UR4A 2GUUA 4S38A 3K4WA 2UY3A 4WZHA 1ODZA 2Y1HA 5ABFA 4M1BA 4QE5A 3F4NA 4WSKA 3M6DA 4US5A 1U1UA 1B31A 5EMMA 4G2DA 3S8HA 2EKCA 1TPH1 2ZZ6A 2Z2UA 5FJOA 5D30A 1VLIA 3PWIA 1GZGA 3BSHA 3CTLA 3MY9A 3CAQA 5EFFA 3B9NA 2P8CA 3DCPA 2J9ZA 1AJZA 2EBNA 3W7DA 5BMXA 5CPQA 4ZTXA 4IX2A 3KOFA 5KZMA 1SJDA 1L9WA 3WEMA 2R9RA 4Z1YA 4S1FA 4W93A 3FA3A 4G1KA 3QV7A 2VCBA 3QGVA 3M9YA 1WKFA 1XC6A 3A3WA 3RLUA 4CNSA 2TYSA 5AY7A 4UTJA 3BW4A 3MMWA 1E6SM 4QXIA 4JYDA 4GI9A 2FGZA 4Q7BA 3O8AA 3QZAA 4TX8A 3P80A 3G1YA 2C14A 1QOXA 4IMFA 3HURA 4EP8C 1T5AA 4FB7A 3STEA 1EGVA 3TXVA 4HK7A 4Q4PA 2A3BA 1T0OA 4UTMA 2RHGA 3UZ5A 4L6HA 4EXAA 2PD9A 1QNPA 1M7PA 5LZLA 3KAOA 3FEMA 1H51A 4P7OA 3AROA 2E3ZA 2PLMA 4PODA 5AHLA 3DAQA 3CUZA 1E3ZA 2CXEA 1KTBA 2CLIA 4HB7A 3V7PA 2V30A 5AC7A 4F8XA 1XC4A 3ZJ6A 3ZJ7A 5CPNA 2C1IA 1J0YA 5GJMA 3E2SA 4HZ8A 2YKKA 4ZTYA 2X05A 3VIFA 2HS8A 5CGQA 3VXGA 4K3ZA 4UQCA 1MQRA 2ESCA 2P3EA 2G3FA 3QN3A 1TTIA 1UH4A 3V3WA 4R3UA 3TMLA 1HL8A 3LGDA 5AHNA 5HANA 5FOOA 4K7VA 1CXLA 3WBYA 4WOQA 4LBRA 2VEMA 1EDTA 5E6YA 4AISA 2AMXA 2FIQA 4I5RA 3JU2A 3S6OA 3NQEA 3J7HA 2Y4SA 3PP7A 3PPFA 3FSUA 3VABA 3WMCA 4G56A 2OMAA 1ZFJA 8A3HA 3DHUA 1W2VA 3L2MA 5I79A 5BRPA 3QTGA 4JICA 3KOXA 4OZOA 3DI1A 2I5QA 3L5AA 3N17A 4PL1A 4UQAA 3E38A 3SRHA 3TTQA 1JRCA 2WB5A 1YIXA 4GNKB 2EQDA 4F79A 3WUEA 4FX7A 3B9AA 3AS0A 1TB3A 1WDQA 3QW3A 5D03A 3Q2DA 3VDHA 3RILA 5H8MA 1QR7A 4RNHA 1O68A 2HBVA 4D8AA 3UESA 2OYMA 5C8BB 4GFSA 2HSAA 5IXEA 3JW7A 2WJEA 2REQA 5C7VA 5GNYA 3PFMA 2WWCA 4AYGA 1ADSA 3IEBA 2ZUUA 3RX4A 1VS1A 3LSBA 4WR3A 1CXHA 1UJPA 4HNCA 1DBTA 3S5NA 1YPIA 4Z0SA 4AZHA 2FJUB 4WSJA 4S39A 1TV2A 1XIEA 1W1TA 4N2YA 1KQYA 1TJ2A 5IDIA 2WMFA 1YDNA 4HA4A 4Q8PA 5ABEA 2YBUA 1E4IA 1MUMA 4NQ1A 3AXIA 4R5EA 3ISIX 2QHAA 1KLZA 3NZRA 1W32A 4AG0A 2OEJA 1VEMA 3W37A 3GXDA 1W5MA 1V51A 1NQKA 1LBMA 3W2MA 1QO2A 4IOTA 5CXPA 1VFTA 1AODA 4YWSA 1GZ1A 1GG0A 4QJ5B 2QGHA 3ANUA 3W1QA 5I6SA 4H9ZA 1SW7A 4LV9A 3G22A 1AW5A 4H3DA 3KZPA 4LUTB 2EG7A 3PZ9A 2J8FA 3MS8A 1YXCA 4KERA 4PC8A 3W1AA 4HT3A 5L6UA 3GW0A 5HNRA 1EO5A 3W70A 2ZA3A 1SVDA 1FWWA 2BGSA 3AS1A 2VEKA 3ARSA 2GYIA 2EG8A 4HNUA 2VRKA 2D22A 1LL7A 5LIWX 2P1FA 4WF7A 1SO6A 2Y5EA 3NUKA 4E6MA 3UJRA 1K1DA 2E68A 1UBSA 3M43A 5LIUX 1B4EA 1IT8A 2ATSA 1XYMA 3S1WA 3F1QA 3H55A 1RBOB 7ODCA 2WMIB 4BF7A 1EJUC 3ZOAA 1H61A 1NOFA 4PEKA 3HJZA 3W7NA 2VC6A 5FKYA 4A3QA 2OVLA 4BEUA 4MPKA 6TIMA 1LT8A 1K8XA 3P84A 3H2MA 2Z2AA 3RMJA 3KOZA 2B31A 4KIEA 5LHFA 4O1DA 3OLIA 4PZVA 1MW2A 2W92A 1KBBA 3ZR5A 4JQ4A 1QNSA 3OHIA 1ITXA 7REQB 2WSKA 1CT5A 3RR1A 1UP0A 2VNCA 4G5DA 2OZ0A 2A6NA 2OEKA 4TV5A 4RW3A 2ZE0A 4E3VA 1S2AA 2Y7EA 5EMKA 4L56A 4LY4A 2QJGA 5CZKA 2PTYA 5GNXA 4PUJA 3BARA 3FN9A 2X1TA 3SCVA 3W2UA 3O6DA 3XISA 3WNNA 1JAEA 3OZYA 5F2IA 4OECA 3LEPA 3M64A 3PJUA 2KX9A 3EOOA 3CUHA 2FTPA 4KPLA 3ZVHB 4ZQRA 2IS7A 2WKJA 2VCCA 2ZWZA 4AD5A 5DXXA 2C19A 5T91A 2H3DA 1DL3A 1KGUA 5IOBA 2YDSA 3ZS4A 4JKKA 1EUNA 3IIVA 1L8PA 3PPGA 1Y0EA 3IIZA 2A0NA 2FJKA 2ZZ7A 1D3HA 2PURA 2A5HA 1JDFA 1YW1A 3WJXA 4P7LA 3NQVA 5DQPA 3B9DA 4KWVA 3NPWA 3JR2A 1W3TA 2WMHA 2JE8A 2E9BA 4LALA 1BYAA 3S1GA 4TQTA 4XZBA 4I8YA 3WIJA 4PCSA 1DJZA 1E70M 3URNA 2E40A 3QY6A 4XISA 3EA2A 1I2OA 3UXKA 2C16A 3LHTA 3P61A 4RZ6A 3QVQA 3WH9A 3CJPA 3HU7A 4GCXA 3G1AA 3BV4A 4AY1A 1SFLA 1B57A 4KWSA 2Q09A 2YCIX 4AHPA 2GVLA 2WVUA 2O7SA 2Z00A 4AHOA 1K4GA 4ZB2A 1H7PA 3UZJA 3M5YA 1V4YA 1EP2A 1ZSXA 3BANA 3O6AA 1ESWA 3NSXA 3ARWA 4RL3A 4H2CA 1ECQA 1H2JA 1R85A 2Z29A 5KSWA 4DZIA 3DGBA 4DJDA 3LA4A 5H8UA 3S6DA 2WVSA 1UZDA 5C2GA 1RR2A 1Y8BA 1TCMA 5CZSA 3JS3A 4JR5A 3FGCA 2HEJA 3ARXA 1A5NC 5CSSA 2QZRA 3T0TA 3OLGA 1O5XA 2NWRA 1BWKA 4FOKA 4J7RA 2BSLA 4PMVA 4RV8A 2R24A 1W8GA 2E7FA 1DTUA 1UOZA 3ARVA 3PB2A 4L1GA 4JFSA 3RHGA 3EPNA 1MSSA 2WMIA 2V3FA 2GVJA 3HFTA 4ZQOA 1YEYA 2XGIA 4X9SA 3UR7A 2GJNA 1UWQA 4IMEA 3GDRA 3AMKA 2WZIA 2DZPA 1TELA 1JYVA 3I3BA 4YXGA 1PTGA 4E38A 1BD0A 3LBOA 3TR9A 3W86A 3N34A 4BR1A 2Z4GA 3DN5A 2XFRA 3IV8A 1JAKA 2PS2A 2O0TA 5CH9A 3WLSA 1LCOA 3W2NA 5HNUA 1TV4A 4ZSUA 1BKSA 2WXDM 4TO8A 4JGDA 2PWHA 4AEFA 2ZRWA 3AISA 5D2XA 1R3WA 2Z24A 3SO7A 3MI6A 3P82A 2HWGA 5A5WA 1CBGA 1SW0A 1FWAC 4Q7NA 4L5ZA 3TNOA 4MWAD 4I5UA 3VC5A 2A1YA 1O4UA 5XIMA 3L9CA 2DT0A 4HCHA 3EPOA 1IXOA 1DOSA 1DJYA 1O66A 2D2OA 3GZAA 1JPHA 4WCJA 4LFYA 3WNKA 1NF0A 3D3FA 1RLDA 3CH9A 1CI1A 1BAGA 2J7GA 3QQWA 1Y65A 3KS5A 3CUFA 3A5FA 2VJXA 3RLVA 3EWXA 2DZSA 3DERA 3LTPA 3RPDA 2JGQA 3UVIA 1O94A 5CZTA 1QOPA 4ZCWA