4ZEPA

Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
474
structure length
474
Chain Sequence
b'HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 189
structure length 474
sequence length 474
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zepA00
2WCSA 2W4XA 2E40A 4GKLA 4DWSB 3VIJA 1ZU8A 5HOSA 3THCA 1QI0A 2OWCA 4W87A 4AEFA 3AISA 2J4GA 3TTOA 5JIPA 2ZE0A 2ZXDA 1XYZA 5DO8A 2VX7A 2QMJA 4LYQA 2WMKA 3GNOA 4WIWA 3WUFA 3U57A 5FL1A 1M53A 1JL8A 2DGAA 4U2ZA 1E5JA 2CNCA 1G01A 1BPLB 1QW8A 5FD0A 3AMCA 1CPUA 2DT0A 3L4YA 4P8XA 1E6NA 5LA1A 2RGMA 4NF7A 2ZUUA 1ZJAA 1J0JA 1V02A 1E0WA 2PBOA 1JD9A 2W63A 1SFSA 5IFPA 5A94A 3AMDA 1XSKA 5A8PA 1X6NA 2J7EA 4MB5A 2V3FA 4ZEPA 4IPLA 1OINA 1JFHA 1J0IA 1ZBCA 3EDDA 4QFUA 1OGGA 1UZ4A 3SCPA 4FLSA 4WKFA 4GI8A 4DWSC 2Z1KA 2CHNA 3UG5A 1MWOA 2ZUTA 2J7BA 2WC3A 3CUIA 1J18A 3WQ4A 2ZXQA 4X0NA 3RIKA 2CPUA 3PTQA 4TVCA 2J77A 4RL3A 1ODZA 1W9PA 5EFFA 1KXTA 2EXOA 1JYWA 4EANA 4GZJA 2F2HA 2G3MA 1G0CA 2J74A 3AHXA 1K9FA 2G3JA 1PAMA 4OJYA 2D20A 3PZOA 2XFRA 4W84A 5A6SA 3WQWA 2EEXA 5A8QA 2J8FA 2IUZA 2GJXA 5A8OA 3JUGA 3WL0A 4ZE4A 1UHVA 3AHTA 3VKKA 3HJEA 1BYCA 4H04A 3AIQA 1X6LA 2C8NA 4PMXA 4Q22A 4W7VA 5E70A 4FLOA 3W4RA 4MNJA 2XSBA 3ZT5A 3T0DA 4W5ZA 4UFIA 3CUJA 5M5DA 2BNJA 5GNZA 4PMUA 5A69A 2E9BA 3ZR6A 1WPCA 1MW3A 4MB3A 2WVUA 3CUHA 3MU7A 1VFFA 1CNVA 1BGGA 1JF6A 1VEPA 3AIRA 5D9PA 4ACZA 3WSUA 3CGTA 3QOMA 5BYWA 2BV9A 1TZ7A 3DECA 3L4ZA 1J9YA 1UH3A 3B9DA 2WK2A 2EO7A 2XVLA 3W38A 3ZOAA 1W3LA 3L4TA 2D2OA 1OM0A 2GJPA 4U5KA 1UWRA 4A3YA 1J0HA 3CZKA 2WVVB 3NDZA 5D9MA 3WNLA 5E09A 1E6RA 4PYSA 4DUWA 1M01A 3N1AA 4U33A 1E3ZA 1P6WA 4GZEA 4MNKA 1NP0A 3I3DA 1K9DA 4MNMA 3FXYA 3NSXA 3UCQA 3GH5A 2VX4A 4LYPA 3ZSSA 1HKIA 3MS8A 2BS9A 3MSDA 3FN9A 4CCDA 3EYPA 1PZ3A 2QMKA 3WKZA 4GIAA 3ALFA 3ARSA 4C7FA 1IZJA 3W0KA 3BMVA 1UR9A 1CGTA 2DQXA 3LPOA 1BFNA 2NSXA 1H41A 3RO8A 3SIMA 4HA3A 2GJRA 1XCXA 5A8NA 2C0HA 4BF7A 1MXDA 4CD8A 4A4AA 1TFVA 1B3VA 3ARPA 5I78A 2G8ZA 2WMGA 4D72A 3U7VA 1PX8A 1QNSA 2OYMA 4J7RA 4V27A 4AIEA 1Q6FA 5A2CA 3VGHA 4P7OA 4CD7A 1R87A 4D71A 2BXZA 3A4WA 2XHYA 1UWQA 2VX6A 3AIEA 4W8AA 1B31A 3CHCA 2WZEA 4LX4A 4JIEA 3RILA 2O9OA 1O6IA 3AS1A 3B8SA 1TUXA 1VJSA 3MMDA 2A3EA 1V02E 3RJXA 4PMZA 3AHVA 3DHPA 1QNOA 4NI3A 4RE3A 1AVAA 2D0HA 1RH9A 3KE0A 5ABEA 1E6ZA 5BXPA 3FAWA 2GUYA 5DT5A 5JBEA 1E3XA 1XHGA 3ALGA 5CG0A 1VEOA 4HMEA 3WMBA 2OYKA 4AD3A 4JCLA 3WD4A 2XVKA 5D4YA 3VD4A 2PC8A 3AYSA 2WMJA 1UA3A 1ISWA 3POCA 5IFTA 4M8UA 3IJ9A 4FLRA 2W62A 4AZGA 3KWXA 3VDCA 3DYOA 1GQIA 2YDRA 4CU8A 1OD0A 1BHGA 4PMDA 1TMQA 1PX4A 4J3WA 2DSUA 3WDPP 3RM9A 3QHOA 1VB9A 3LMYA 4BQ4A 1NOUA 1UWUA 4UFHA 4HOXA 4DWSA 1LLOA 2WBGA 1UR0A 1W32A 2JF7A 5C71A 5GPRA 3K8MA 4NRSA 4WF7A 1ZB5A 1JNEA 2YOCA 4TX8A 1XH2A 5AYBA 3IANA 3ZIZA 3F4VA 3SEPA 2DSVA 2HISA 4MAZA 2X09A 2A3HA 1EQPA 1R7AA 3W24A 7A3HA 1W2VA 2E9MA 1LF1A 5I3DA 1V3KA 3VDBA 1HN1A 2VRKA 3SCQA 1JZ4A 3PZNA 2G3IA 4CD5A 4P7LA 1LJYA 1FP8A 4HPHA 1I1XA 4HTYA 2J8GA 4AMCA 1DWJM 1EQCA 4MNLA 1UD2A 2ZUVA 4AZHA 1CBGA 1GQLA 2PWGA 4U31A 1HJQA 1H5VA 2TAAA 1MW2A 5GNXA 5DFAA 1ZS2A 1HL8A 1GOQA 3GNPA 5I77A 4ZENA 1UQYA 2VL4A 2UY5A 4UFJA 1CLVA 3A4XA 4LQ1A 1CGYA 3L4VA 4L4PA 1VJZA 2WMIB 3AXIA 3ARYA 1ISZA 1E1EA 5CGTA 4PTMA 1MFUA 3W81A 3CPUA 2ZUSA 3WH6A 1WCGA 1PIGA 1N82A 1W1YA 1V03A 2W91A 1H3GA 1UWTA 1WZAA 4UOZA 5BXRA 1VFOA 3WH8A 1WE5A 2VMFA 1CXEA 3G6MA 1J11A 4NZCA 4FLQA 3PHAA 4H8HA 1GCYA 2EPKX 3BAWA 2FGZA 3ARVA 3BAYA 3CZEA 4CN6A 1WAWA 2W5FA 3WD1A 3WFZA 1Z32X 3UR7A 4PN2A 3RDKA 4PBGA 4W7UA 2EPNA 3WH9A 2WSKA 2A3CA 2WKGA 1W3HA 2XWDA 4MJ4A 3W25A 4BCEA 5HBFA 3VDAA 4JFTA 1Y7VA 3PZGA 4AZBA 1QI5A 1B3YA 3ARZA 1QPKA 5FL0A 4XUYA 1HL9A 5BRPA 1KB3A 2WWCA 2F61A 1UKPA 3QHNA 2E8ZA 5HXMA 3J7HA 1R86A 1ZBKA 4PTWA 3BAIA 5CXPA 1TE1A 1XD1A 2J62A 2PI6A 1FHDA 1US3A 1E4IA 4PSPA 4AZ7A 4P8UA 1EHNA 4TX6A 4TXEA 7TAAA 4UZSA 1C8QA 1W3JA 3CO4A 5I0DA 2B31A 4QAWA 4B9YA 6CGTA 4C7DA 1WZLA 5A6BA 2J7FA 4GPNA 3VNYA 1QOXA 2J47A 4JKMA 2WM0A 5BCAA 1E5NA 4EAMA 3MANA 4P7NA 4X9YA 2OLHA 1NWUA 2X0YA 3WF0A 5A6MA 1K9TA 1JGIA 4W8LA 3D3AA 4AZ6A 4AD5A 3AROA 2VZUA 3W37A 4P8WA 1J0KA 1JIBA 3VUPA 2O9RA 5JBDA 3VIMA 2VTFA 1E4MM 1GJWA 1R85A 4JKLA 4EKJA 1NOFA 3MSGA 4KRUA 2CESA 3W26A 3EDJA 4MDPA 2JEPA 1UH4A 3ARWA 1BF2A 1E56A 3ZMRA 1J0YA 2YBUA 5KEZA 1KXVA 1G5AA 4Z2HA 3B9AA 4CN1A 5JUVA 1QNQA 3AMLA 2X8RA 1V3LA 4HZ8A 4AZCA 5IHSA 3A4AA 3TTYA 5CLTA 4UQ9A 1JYVA 1XC6A 4TTGA 2CCRA 3MUAA 1E40A 3WUBA 1M04A 3FY1A 4DUXA 1UQZA 3QOKA 4MB4A 3CTTA 1QI2A 1QW9A 1UD4A 1E71M 5CGMA 1CXLA 3RJYA 1V3IA 1CEOA 3ZSTA 3BMWA 4F9DA 3IK2A 3GH7A 4HPGA 4S3KA 1SMAA 4GO9A 1B9ZA 2QV4A 2VO5A 3KL0A 2DH3A 4PUDA 1VBUA 3NIYA 1RPKA 2D1ZA 1B3XA 3VGEA 2VOTA 3MUIA 4KH2A 3SCTA 4BQ2A 1NARA 2Y5EA 3N9KA 3KL3A 2VCCA 2OSWA 2FHBA 3AMGA 3HMCA 3VVGA 3QR3A 2XIIA 4UFKA 1E43A 2VZTA 2CBJA 5DEZA 3WF1A 2OWWA 1BTCA 4ATDA 3CHEA 3T2QA 1JF5A 2QLYA 2BHUA 4YHGA 4JFSA 1OCQA 1VRXA 1GOWA 2FH8A 3CMJA 3WD0A 3WUEA 2BY2A 1CXFA 2D0GA 4HA4A 1UOKA 5LA0A 3GDBA 1GVYA 5FOOA 2XSAA 2YDSA 1V6XA 2RGLA 3WNOA 2YDQA 4WSJA 4H41A 1D2KA 3UEQA 6A3HA 3VO0A 1WZMA 2QHAA 1MYRA 3UG3A 2VT0A 2QPSA 4BQ5A 3VMPA 1UKOA 1DWGM 3K46A 4GXPA 1EGZA 4PEEA 3WN6A 2FH6A 3WF4A 1ESWA 2CBVA 3BC9A 4QP0A 2YIHA 2G41A 1DP0A 1JDAA 3GBEA 1R7OA 5BXSA 5A6JA 7CGTA 1VF8A 2AMGA 4E4PA 5A6KA 2PBGA 5KZ6A 2WMIA 2OSYA 3WDIA 4QDMA 1RP8A 3PZVA 4MJ2A 1CXHA 2E3ZA 1EDTA 4UQBA 2VJXA 1TG7A 3L2LA 3FHAA 4PCSA 3W82A 1OGBA 3PZMA 2FGLA 1UKTA 1C3FA 1KGUA 4CU6A 3ZO9A 4PRWA 3HU7A 1V08A 5E6YA 1DTUA 4W8BA 1IT0A 1FA2A 1WDSA 1KQYA 1JZ8A 2IXUA 1CGVA 1F4HA 1XH1A 3WUGA 3LPPA 4UQAA 2XGIA 4R5EA 1OD8A 3VTRA 4AEEA 1C7TA 3BAXA 3BGAA 4QLLA 1HT6A 2A3BA 1DWAM 2WWDA 1TR1A 1GOIA 4CD4A 4B16A 3O9NA 3MUY1 3A6OA 2YBTA 4B9ZA 1HIZA 1EDQA 5FKYA 2VZSA 1JZ2A 1XCWA 3SUWA 1KCLA 4PMOA 1KFWA 4D6JA 5A6LA 4JHOA 4NSBA 2QF8A 1UZ1A 5HPOA 1V6WA 2WVTA 3BLPX 3IJ8A 4JFWA 4D6HA 4PCTA 3CZJA 5I79A 1H2JA 5CZKA 3HN3A 3K8KA 3GM8A 1CGUA 2ZX5A 4JFVA 2J7HA 5M3WA 5ECUA 2CYGA 1VEMA 3N12A 3OGSA 4LXFA 2O9PA 3VIPA 3FAXA 3EDFA 1TCMA 3BCFA 4QLJA 3EDKA 3GXMA 4ACYA 2YJQA 4TTUA 1GORA 3SUTA 4AIUA 2BFGA 2J7GA 3VINA 1D3CA 3WNPA 1FFQA 1S46A 4OOUA 1W91A 4U5IA 1V3JA 4M1RA 4Z2JA 3QGVA 1F4AA 2CBIA 4ZE5A 4F66A 4LPCA 3FNDA 3E1F1 3T2PA 1LG2A 1UH2A 1JD7A 1OT1A 1WO2A 3AJ7A 3VOCA 1V0NA 4B3KA 1UYQA 4HMCA 1VENA 1GNXA 5IXEA 2VRQA 4D6DA 2CKSA 2DPEA 1B3WA 5A6AA 4QLKA 1MQRA 4UFLA 4UZUA 3NUKA 3M6DA 1KBKA 4IM4A 4WKHA 2YA1A 2YL5A 3BAKA 5M03A 3L4WA 5I5RA 2VR5A 2ZXAA 6TAAA 4R27A 4AW7A 5A2BA 3OLDA 3OGVA 2YA2A 2WHKA 1KXQA 3ZT6A 3M07A 1W9XA 1CXIA 3SCNA 3EMQA 2DT1A 3ZT7A 4W7WA 3L4UA 1UD5A 4N42A 3I3EA 2D24A 5BRQA 3RCNA 2J7DA 3RM4A 4HZ6A 3VGFA 2BVTA 3AIUA 1HP4A 4CCCA 2X1IA 4Q7NA 2Y8VA 2VVSA 5CQ1A 1MW1A 1GQJA 2WLYA 3GBDA 2CKRA 4AZIA 1BLIA 4ML4A 3DYPA 5IDIA 4D6CA 1E0VA 4Z2LA 4W86A 2VNCA 4BA0A 3WQVA 2XM1A 1ITCA 4H8UA 3TA9A 1PPIA 1U2YA 1MXGA 4AD4A 4KGLA 4W93A 1ZBVA 1ODUA 1LWHA 4U3AA 2J78A 4XB3A 2JE8A 1H0GA 1VFUA 2ZIDA 4K68A 2GDVA 1V6VA 3SCWA 2XFYA 3AS3A 3UERA 3ZJ8A 2DT2A 3K8LA 1CGXA 2X2YA 2VRJA 1CECA 2EPMX 1EOKA 2J79A 2FHFA 1VIWA 4AZ5A 3UG4A 2PF0A 3VD7A 3WEZA 4PMRA 1Q6EA 3WEMA 4B15A 3NCOA 3AMKA 1Q4NX 4J3XA 2WVSA 1HXJA 2ZXBA 4OIFA 4OKDA 1ZJBA 1PIFA 2Y2WA 4TOQA 3AS0A 3WD2A 2J7CA 3N18A 3BAJA 1HKMA 3WELA 3MUZ1 3WH5A 1FH7A 3BLKA 1NWSA 3WNNA 3GXIA 1GOOA 5ABHA 1FP9A 3O6AA 3VM7A 1OSEA 4E2OA 2E0PA 3NSNA 4H7VA 4J3UA 1LL4A 4AD1A 1QBBA 4UOQA 2Y4SA 3VMOA 3KZSA 3SURA 3VIHA 1J10A 3U5YA 3T09A 2PWHA 4HA1A 2AOSA 2BVYA 3WEOA 2VQUA 1UR1A 2W67A 5CPTA 1O7AA 5CPSA 2W66A 1GUVA 1E55A 1E6XM 2XPKA 5EBAA 4PTXA 1E6PA 2ZUWA 1KGXA 2W61A 2YLAA 1TVPA 4MDOA 3PBGA 5M17A 2Q8XA 3VIFA 1Q6GA 1W1PA 2XYLA 3VGBA 2HVMA 2WCAA 4XZWA 3WBAA 1NWTA 1BG9A 4AD2A 4MPKA 4J3VA 1MVYA 1NWRA 1JZ5A 1H1NA 2CERA 3KL5A 1FH8A 4U3CA 4BS0A 5AC5A 2E9LA 2PB1A 4M81A 4H8VA 3MV01 3W27A 4M24A 5A3HA 3IAPA 3UR8A 3GXDA 3CIVA 2UY2A 4DWSD 1V0LA 4BQ3A 1OIMA 3O2LA 5I6SA 2WVVA 1C92A 3PTKA 1L8NA 1HNYA 2OSXA 4B3LA 1V0MA 1D7FA 2XIBA 3PN8A 1NP2A 5IHRA 4OOZA 1QBAA 4Z2IA 1WDQA 2CHOA 1VBRA 4PSRA 3WMSA 2XFFA 4JL1A 2E8YA 4D6FA 1JG9A 1OBAA 3A3HA 1KBBA 2BVDA 3VIGA 3EMCA 4D6EA 1UUQA 3VX1A 1E4NA 1M7XA 3OG2A 1JI1A 4MAVA 3VGGA 2WW5A 3KEHA 1B1YA 4CVUA 1SMDA 2DSWA 3A47A 1CLXA 1GPFA 3VILA 2DDXA 4W5UA 5D8WA 3WDHA 4MB1A 1CENA 4TVUA 3SCRA 1UG6A 2XM2A 1GW1A 1QI3A 3AXXA 3TOPA 4EE9A 1WB0A 1PX3A 2VCAA 3CBWA 4CVWA 1XV8A 2C7FA 2YL8A 2X0HA 1FOBA 3M7SA 3SCVA 1DWHM 2IXVA 1G94A 4YHEA 4M80A 1HVXA 4M56A 2WBKA 2E4TA 2FHCA 3IJ7A 3F5LA 1KWKA 3APGA 5E9AA 2ZWYA 3AHYA 1E73M 1C7SA 3MMWA 4A3HA 2GDUA 2WHJA 2D0FA 4BZYA 3DHUA 3S6TA 2X05A 2EJ1A 1W9VA 4ZFMA 3W6LA 2BY1A 1R8LA 3ARUA 3EMZA 4P7QA 3POHA 1ECEA 3WQ8A 3VIOA 3THDA 4XZBA 1C8XA 3AZSA 3VDHA 1KR0A 1PEZA 1C8YA 3CH9A 3S2CA 2BY3A 3WBEA 2ZX9A 5A1AA 1I75A 4ZXOA 4GO8A 2WANA 5FIPA 4RE2A 3GYCA 1E1FA 1GHRA 2VR4A 1C93A 1LL6A 1H0IA 1ZL1A 2O92A 2V3DA 4CCEA 4DUVA 4GI6A 1B2YA 4F8XA 4UOJA 4AXNA 4E8CA 3WNKA 4JAWA 5A6BD 2BY0A 3ARXA 1EA9C 8CGTA 2V5CA 1EO5A 3TTQA 4J28A 4TUFA 4Y7EA 4X0VA 1H11A 1BG4A 3DYMA 5TD4A 4YPJA 4HU0A 1W9BM 3AXHA 2DH2A 4H2CA 3AOFA 3ARRA 1CXKA 1JZ7A 1LL7A 1FFRA 2XG9A 4M29A 1H49A 3WNMA 4KGJA 4QCFA 2UY3A 4UQDA 1RP9A 3WY1A 1W2PA 4XV0A 2BHZA 3PZUA 3ARQA 2GK1B 1JDCA 3ZM8A 4FF5A 2VCBA 1AQ0A 4MTVA 3CHDA 5CLWA 3NJ3A 5A8MA 4OZOA 1DWIM 1ISYA 2W92A 3EDEA 1HJWA 5GQBA 1V6YA 1JYNA 1KQZA 3OLEA 5I2UA 1BYAA 3T2OA 1GOMA 1CWYA 2ZOXA 2GSJA 1JXKA 1UD6A 4C7GA 1GQKA 4PMYA 4QCEA 4L4OA 5DF0A 3VX0A 2OYLA 3L2MA 1GVIA 1W9DM 2WLZA 1BGAA 1J12A 3WIJA 4GQQA 1MFVA 2WYSA 4YN5A 4OBSA 2WHLA 2WKLA 1UA7A 1BAGA 1WNOA 3CZLA 2XVNA 4JFUA 3CLWA 4JKKA 1V3HA 4AWEA 1U33A 3AZTA 1KR1A 1J01A 5CSUA 2WZIA 2V5DA 2DT3A 1V3MA 1WKYA 2O9TA 4W89A 1PJ9A 1UR2A 5D9NA 1E15A 2D3NA 1SYTA 1U30A 3BH4A 5ABFB 1W1TA 2A3AA 1LWJA 3T08A 1JZ6A 4UNIA 5E6ZA 4D1IA 3OGRA 2ZX6A 1HF6A 1BQCA 4FK9A 1H09A 2QPUA 3K1DA 2NW0A 1JNDA 2VURA 3SCSA 1OT2A 2CXGA 4D6IA 2D22A 3MO4A 1UWIA 1BVNP 4XX6A 4ATLA 1G1YA 1NH6A 3VIKA 2XGBA 4IISA 2F8QA 3OLIA 3N17A 3AIVA 5CPQA 3ARTA 1UD3A 1VAHA 3AFBA 3UESA 1EHAA 4UTFA 1QHPA 3WH7A 4S3JA 1EDGA 5GNYA 5EB8A 1BVZA 2EPOA 2WNWA 1X1NA 4UQEA 2UY4A 1EOMA 3WQ5A 3N13A 3ZQ9A 1B3ZA 3WDRA 1DEDA 1UWSA 4PTVA 1QI4A 1TA3B 3GTNA 3T0BA 3BCDA 4AD0A 2ZICA 1XYFA 2J25A 2Z1SA 1JAKA 2YL6A 1PBGA 3ZJKA 5LYRA 3PZQA 4W88A 2PWFA 1ISXA 4D1JA 1ISVA 3T0AA 1CZ1A 2YL9A 3CUGA 1E0XA 2WAGA 4URIA 5F7UA 2WMFA 4IUGA 5E0FA 3CZ8A 1HJSA 1MQQA 2BXYA 3W28A 1HKKA 1UKSA 4U2YA 3WF2A 1ZBWA 3W29A 4AZCB 1CIUA 1JFXA 2VZOA 4P8VA 2XJ7A 3CHFA 3FW6A 3I3BA 1XH0A 1XGZA 3FHQA 2DIJA 3VD5A 3BXWA 5CJ5A 2VI0A 2YLLA 3VM5A 1JDDA 1W3KA 1XRVA 1HJVA 4JZ5A 4CD6A 3WMCA 1PZ2A 4IPNB 2XUCA 1BYBA 2ESCA 1XD0A 3AICA 1Q6CA 2D3LA 2JEQA 5JBFA 3ZR5A 2V38A 1DHKA 4KWUA 4GQRA 3BSGA 4DM2A 2WXDM 1IZKA 1E72M 1YHTA 3AYRA 2V3GA 5C8BB 1HJUA 2JIEA 4Z2KA 3DC0A 3F5KA 4UCFA 4V2XA 3QHMA 3VD9A 1AQMA 3OBAA 1B0IA 1GJUA 3AIBA 3M46A 4AY1A 3VNZA 2WZHA 4LYRA 2G3NA 3L4XA 5E0CA 1HVQA 1JI2A 4GI9A 5D9OA 4UR9A 3II1A 1EXPA 3AQUA 4CKQA 3PTMA 4OBRA 3U7BA 4HOWA 1EO7A 1JYXA 3NYDA 3W53A 3N04A 3ZJ6A 1NM9A 2BHYA 4TVDA 2NT1A 4E8DA 2OWXA 3VIIA 3AS2A 4HZ7A 5EFDA 4LGXA 1E6SM 1CYGA 1QHOA 4NRRA 1QVBA 1G9HA 2GK1A 3OB8A 3OLGA 2GFTA 3TTSA 1JAEA 2VC9A 3MKKA 3LPGA 1A3HA 3SUSA 4AC1X 3N15A 5AYIA 3D5HA 4D6GA 1V6UA 2WC4A 1QHZA 2PWDA 4DM1A 3ZJ7A 1LQ0A 4CGTA 9CGTA 1MW0A 2V3EA 3WENA 1CGWA 1WDRA 1K6AA 4PUEA 1A47A 3SUVA 1M03A 1UR4A 4V28A 4AISA 1CTNA 5FCZA 3WL1A 2CEQA 8A3HA 1KGWA 1J0ZA 2ZUNA 3AI0A 5I23A 5A95A 2CIPA 2ZX7A 2Y8KA 3NDYA 1KWGA 5DT7A 2DSZA 2YA0A 4J3TA 4UFMA 1GOKA 4ZXLA 1EIBA 2DEPA 2VUYA 4JCMA 5HDRA 2XWEA 1OB0A 2EPLX 3OZPA 4ATWA 3CZGA 3K4DA 4F9JA 3AHZA 1VFMA 2JF6A 1E6QM 2XTKA 2GJXB 4Z2GA 3PZIA 1YQ2A 2FDMA 4KRTA 1UR8A 3MV11 2JFEX 5BWFA 2EQDA 1H4PA 2J75A 1QNPA 1V0KA 3IAQA 5ABFA 1I1WA 1WP6A 1Q6DA 3RM8A 1GZJA 3UETA 1WZKA 3RMEA 5D8ZA 2UWFA 5EMYA 5I24A 2AAAA 5DMYA 1L0PA 2G4FA 3SUUA 4WKAA 3PZ9A 2CBUA 2WMHA 1E9LA 1NOWA 2GVYA 4EK7A 4JHZA 4ACZB 3WDJA 3BSHA 3WQ6A 1C91A 4CU7A 2JIWA 3VPLA 2CITA 1C90A 1MQPA 2DIEA 1AQHA 1BYDA 1JXJA 1WDPA 5AC4A 1W9UA 1SR0A 2DSKA 4AIOA 4PMQA 1BSIA 2PWEA 1HKJA 1US2A 1CDGA 4UQCA 4F79A 5HPCA 3SCOA 3TP4A 2NT0A 3CUFA 4J27A 4WK9A 3CMGA 5BXTA 5A2AA 2ZUMA 2JALA 1UKQA 4GINA 3GNRA 2MANA 3ECQA 2VX5A 4HMDA 3N11A 4GZIA 1TA3A 4CUCA 4RE4A 1UD8A 2XVGA 2D23A 3OA5A 4PMNA 4WJXA 5BROA 3GXFA 5LA2A 3GH4A 2ZX8A 4HU8A 2EBNA 4M82A 3GZAA 4AYSA 2VZVA 4HP5A 4P7RA 4KMQA 5AY7A 1OGSA 3WD3A 3OIHA 3B9EA 3VMNA 2WPGA 3VGDA 1KXHA 1XSIA 2WHMA 1K9EA 1LG1A 1FH9A 1KCKA 3MMUA 3U5UA 1ITXA 1OIFA 4OUEA 4W85A 5ABGA 1GHSA 1JZ3A 2WCGA 1TVNA 1HJXA 1HP5A 3W6MA 2XVPA 1E70M 1FHLA 3RPMA 3EBVA 4WLCA 4JL2A 1B30A 1W1VA 4CN4A 1QNRA 2VQTA 5HNNA 2YKKA 3PZTA 3G6LA 2ZWZA 2Y24A 4N0RA 1OWQA 4HOZA 3K4AA 1NQ6A 3LPFA 3WDQA 3AZRA 2WSPA 5C70A 3VU2A 3AIWA 3OZOA 4MADA 2VVNA 1DWFM 2CETA 3NSMA 4PMVA 4WSKA 1GONA 1XSJA 3TONA 1E4LA 1AMYA 3VD3A 3WFLA 1B90A 1RD6A 5CSYA 4J3SA 1IV8A 3WF3A 2WC7A 3F5JA 3SCUA 1HX0A 1EH9A 4FMVA 5JIWA 2WB5A
chains in the Genus database with same CATH superfamily
2E40A 3VIJA 4WOZA 1J5TA 5DRCA 3U6WA 1XYZA 3N6HA 2Y7GA 2QMJA 3CQHA 3KOWA 5FL1A 2DGAA 4UB9A 4QEEA 1E5JA 2CNCA 3VKBA 4XD6A 1ENUA 4C6PA 4B5XA 4DXKA 1BPLB 3PPHA 5I3FA 4MOZA 1Q6LA 4PUUA 3G3MA 3TYCA 2ZUUA 4REQB 1V02A 3TMQA 1C9DA 1RQHA 5CSSA 2HCVA 3BOXA 4LNCA 1UMYA 2YPIA 1XSKA 4WJ8A 1X6NA 1OINA 3UVIA 5FACA 4Y9NA 1OGGA 7XIMA 1IYXA 1E1CA 5F4SA 3VABA 4DWSC 3S1WA 1RCXB 2CHNA 4B92A 2J7BA 3WQ4A 4X0NA 3L5AA 4NKCA 5LIWX 3PTQA 1A5UA 2J77A 4K6AA 1QAPA 4QXIA 2ZBTA 1TZ9A 1KXTA 1XG3A 3VE7A 2FFCA 2REQA 4GZJA 3T7VA 3AHXA 1G0CA 2FZNA 2G3JA 3BARA 4OJYA 2D20A 3VXGA 5A6SA 1Z8AA 2PTDA 1QWKA 3JUGA 3F4WA 5H6HA 4I6KA 4OVXA 2B0MA 3HZ3A 1BYCA 3P3BA 1KFEA 4IPJA 3G1RA 3NZRA 4DJDA 3TN6A 4FLOA 5C2GA 2XSBA 4LUTB 5M5DA 2E9BA 4F0LA 4KWWA 1XFCA 3MU7A 1OYBA 2E1DA 4OUIA 4MUPA 1VFFA 4OU1A 2C1GA 4FPSA 3T05A 5D9PA 2KZHA 3FCPA 1DXFA 3CGTA 1SR9A 2BBFA 3KVJA 1H61A 1LT8A 3TQ0A 1J9YA 1KV5A 4H9XA 2XVLA 3KM8A 4GIRA 2PS2A 3L4TA 1OM0A 4U5KA 3V35A 1UWRA 3N25A 4JTRA 4A3YA 2WVVB 2I9UA 3QSRA 4S3FA 4PYSA 4DUWA 1NFPA 1O1HA 1OZMA 4GZEA 2Z7GA 3HURA 2BLEA 3NSXA 1KM5A 2VX4A 1EEXA 3UJEA 4A2RA 2BS9A 3MSDA 1PZ3A 4C1LA 4C7FA 2YFOA 4DX3A 3W0KA 1CGTA 5I03A 3TLLA 3LCLA 3SGZA 4YIWA 4X9SA 4A4AA 1RK5A 5I78A 4D72A 1PX8A 1QNSA 3M16A 3F1QA 2NXGA 1EBHA 3ICJA 1SZFA 2BXZA 4JIIX 3W07A 2E5CA 2XHYA 2E6DA 3CASA 3HM7A 2R9RA 5CZ0A 4W8AA 1B31A 2WZEA 4JIEA 3A12A 3AS1A 4DYEA 2VDHA 2CWXA 2D0HA 1RH9A 4N9BA 2OGJA 4LUSB 3TFXA 2QULA 2GUYA 5DT5A 4XTIA 3P0WA 1XHGA 1TPWA 1VEOA 1PHWA 2OYKA 3BG3A 2PCEA 2XVKA 3LCFA 2PC8A 1ZCOA 2WMJA 1UA3A 1ISWA 5IFTA 3REQB 3I6TA 4I3GA 2CLLA 1PZ0A 1GQIA 4UNLA 3F4CA 3H4WA 3H2FA 1OK4A 1MDRA 3WDPP 3QHOA 2XZ9A 5LIUX 1VB9A 3LMYA 2YDAA 3CL8A 1MEIA 4GRSA 1LLOA 1UR0A 1W32A 3MCOA 2JF7A 5DANA 3K8MA 4NRSA 3W7HA 2Q71A 1VLIA 2ODOA 5AYBA 1TRIA 2DZWA 3F4VA 4KFPA 3SEPA 2X09A 2V2CA 1EQPA 1R7AA 3W24A 3WQFA 2IQ0A 1LF1A 3WJXA 2V9DA 3VDBA 1HN1A 2VRKA 3N29A 3SCQA 1YNPA 2X1SA 3PZNA 2CZFA 4CD5A 1QASA 4P7LA 1VCVA 4XZNX 1I1XA 3HPFA 3F03K 3GNNA 5EMKA 4AZHA 4U31A 2NV1A 2ZZ7A 1X98A 3MCNA 5AZ0A 5DFAA 3STGA 3LHUA 1ZS2A 3PAJA 4Q7BA 1L6WA 4UFJA 3Q58A 4OV4A 4I9MA 1EL3A 1FKWA 3M5XA 4QBXA 3ARYA 1UZHA 3CPUA 4FX6M 2VDIA 1O12A 1W1YA 4NZ3A 5F4WA 3QR0A 5CPNA 1WZAA 4PULA 3WBWA 2P1FA 2J66A 5REQA 1IT7A 3G6MA 3R11A 1GCYA 3BAWA 2PLJA 2FJUB 2FGZA 5CH9A 3TYAA 3PNUA 3RCMA 3CZEA 1Z32X 3LXCA 4JIQA 4PBGA 2EPNA 3MYOA 2A3CA 2WKGA 5CBJA 2C71A 1VQTA 4AHPA 4QRNA 1GK8A 3QVQA 4RDZA 4XUYA 1HL9A 1KC7A 5LXXA 1TCDA 2VFGA 5F2IA 1YBQB 2OODA 3I4KA 4R7OA 4OBTA 4DN1A 3Q2DA 1Z42A 5HXMA 5ENLA 1OCBA 2J62A 2PI6A 1SGJA 1US3A 4Q8NA 1E4IA 2A0NA 4EP8C 4AZ7A 4P8UA 1EHNA 3GC4A 1DJIA 3FLUA 3O6CA 3BLDA 5K3VA 5AHIA 5I0DA 4FO4A 4QAWA 3U4AA 1WZLA 4GPNA 4HK6A 4PC8A 3ELFA 4JQ4A 1E5NA 2VP8A 3MANA 4Z0SA 4L5ZA 3SN0A 3GG8A 2QCHA 3AROA 5CPMA 4CLMA 4H01A 1KFBA 2VM8A 4EF8A 2XIOA 3NQFA 1SJBA 1GJWA 5BOEA 2GL5A 4IWWA 2CESA 3EPOA 3SY8A 1A5LC 2H6RA 4ROPA 1MRQA 1VFTA 4TX9A 2FDSA 3HGOA 4HHPA 4ZSUA 2DIKA 4ERIA 1VKFA 1G5AA 4H9YA 4Z2HA 1TPDA 2PURA 1V3LA 4HZ8A 2PTXA 5IHSA 3GE7A 1XYAA 3H21A 5CLTA 1VCFA 1XC6A 1JYVA 2JGQA 1E40A 1R38A 3KUMA 3G0XA 4UTUA 3G24A 1QI2A 1UD4A 5GJMA 2RHGA 4JY9A 1CXLA 3MSRA 5IBXC 3GHTA 1P48A 1OFQA 1ZHAA 4MHBA 1GVFA 1CEOA 1YE6A 4GOAA 4X3ZA 3BMWA 4QG6A 3BW4A 3NZPA 4H83A 3IK2A 3JZUA 3QW4B 4BEUA 2AKZA 3GH7A 4O57A 1L9WA 1YDOA 4B5UA 2QV4A 2RUSA 4PUDA 3LZ3A 3NIYA 3GTIA 3MUIA 3V4BA 3SIZA 3R5EA 3A9IA 4Q4PA 4BQ2A 1MRAA 3TAOA 4LRTA 4YCOA 4XAZA 5JVLA 3JR2A 2VCCA 2FHBA 4FXRA 4PBEA 3RLGA 2V2DA 2EG6A 1E43A 7ODCA 4KIRA 3WF1A 5U4NA 2OWWA 1BTCA 4ATDA 3CHEA 3T2QA 3N73A 5D2XA 2E25A 1VRXA 4JN6A 4HA4A 1G67A 3PY2A 3Q65A 5CAKA 1XI3A 2XSAA 3WG6A 1WA3A 4GQGA 4WSJA 3UEQA 1QXLA 3VO0A 2QHAA 1MYRA 4AEOA 4PUNA 3B05A 3VMPA 3TE9A 1UKOA 4FHAA 1EGZA 3PWAA 3WF4A 4PH6A 5C7HA 4RK8A 4XKYA 3N2BA 1VF8A 2V67A 2OO6A 4IL0A 2OZTA 2WMIA 5H91A 3WDIA 4QDMA 1DXEA 1DBTA 1EDTA 1ZNNA 3KP0A 4UQBA 2OJPA 1TG7A 3L2LA 1OCJA 4PCSA 3W82A 4CCZA 1OGBA 3IS4A 2Y5SA 3PZMA 2FVLA 1XDMA 4WSHA 1OCNA 3PNZA 4CU6A 1FX6A 2YXOA 4PRWA 1DTUA 3KDNA 1IT0A 1FA2A 1CGVA 4RDVA 4IUOA 1XH1A 1B3OA 2V5JA 1A53A 1THFD 1VHCA 2XGIA 5F1VA 3VTRA 3V5OA 1C7TA 3MWCA 3BGAA 2A3BA 2NUWA 3GC2A 1GOIA 4B16A 3MUY1 4O10A 1YPFA 3A6OA 2GDQA 3LEPA 2G3FA 3C2OA 3HMJG 3TC3A 1QPNA 1BD0A 1XCWA 2WQPA 1EGMA 2CLPA 5A6LA 3RLUA 2VENA 1S2UA 4I5XA 3C8FA 1LM1A 4NAEA 4ICCX 5C6MA 3B0UX 3IJ8A 4JFWA 3WBYA 4D6HA 1X1ZA 4NVTA 3GXTA 2E68A 3VOGA 2Z0IA 2I14A 2J24A 1H2JA 5CZKA 5I3HA 3SR7A 3K8KA 3DKJA 2J7HA 1ME9A 1P1MA 1O5RA 3ZLGA 1RA5A 4RXGA 1X7FA 3N12A 3R79A 2O9PA 3VIPA 2IKIA 3EDFA 4NU7A 7ENLA 3BCFA 3GFZA 1NFBA 4QLJA 4NP7A 3W23A 3U0HA 3GXMA 4C6EA 1NDVA 3HO8A 1GORA 4IIHA 9RUBA 4NZ4A 5KZDA 1UP2A 3WNPA 5D04C 5DRIA 4NX5A 1W91A 3LB0A 5F2GA 5G5IA 4JX6A 1ZP4A 1DJYA 4KCTA 3LLDA 3E49A 3AAMA 3E1F1 3R89A 4DUOA 2TYSA 3D47A 3TZFA 3G8RA 5KETA 3C52A 5BMWA 3DH7A 3DCPA 2B4GA 2FIQA 3WLNA 1ZALA 1O94A 1KM0A 2DPEA 2PDFA 3WK0A 2WJDA 1LZOA 1TPFA 1J2BA 1KBKA 4IM4A 4WKHA 2YA1A 3LBMA 1XUZA 3BAKA 3QJAA 4OQVA 3AXKA 2VR5A 3S2NA 3MP4A 3OBEA 3OLDA 2HROA 1LWIA 2RDXA 3APYA 1TV4A 3SCNA 3EMQA 3ZT7A 4O8RA 1ZGDA 4I7VA 4YVVA 3FJLA 3LXBA 5BRQA 1WXYA 3M0HA 4YLWA 5TAOA 2BVTA 1HP4A 2Y8VA 3U2EA 2CKRA 4DRSA 1BLIA 3PS7A 4JQ1A 2FVKA 4LJ3A 1E0TA 1JCJA 3CT7A 3S5ZA 1PPIA 1U2YA 1MXGA 1TB3A 1XQKA 1ZBVA 1DOSA 4DQWA 1ODUA 3KFTA 3H26A 1LWHA 1Y5WA 4JTKA 5TF0A 4WXYA 4ASTA 4XB3A 5H8UA 3VI2A 1H0GA 1VFUA 1QNVA 4CQ8A 1RV8A 1VD6A 2BTMA 3C3UA 3AS3A 2BP1A 4OECA 3ZJ8A 4WY0A 2DT2A 2X2YA 2VRJA 2V30A 2W9MA 1JPIA 4AZ5A 2VWSA 2RDTA 3UG4A 2CLOA 2QGHA 4JX4A 3VD7A 2G95A 3GB6A 4A29A 4BI7A 4PMRA 1Q6EA 3MCMA 4DLFA 3AMKA 1HXJA 2FMNA 4TOQA 3NVDA 3CQJA 1XLIA 4J4KA 3W22A 3LCWA 4RZ6A 5BZAA 1XYBA 4DBDA 1OY0A 2NQZA 3GXIA 3S6DA 1GOOA 5HJXA 5CZSA 5KINA 4CQBA 1I0BA 3TJIA 1TX0A 3DFHA 1LL4A 2ISFA 3SURA 3B8TA 1Q4WA 2PWHA 4IFKB 3WEOA 1S5VA 2VQUA 1UR1A 2FZBA 2GGGA 5CPTA 5CPSA 1XL9A 4AF0A 1F5ZA 1HL2A 1KGXA 4HNCA 2QW5A 3PBGA 5M17A 1NIUA 1E51A 1W1PA 3P81A 3RNDA 5BOFA 4WR3A 3H2MA 3KLLA 1MVYA 1NWRA 1JZ5A 2QJIA 2E9LA 4H8VA 3MV01 2DZXA 4M24A 3UR8A 3GXDA 4DWSD 5DELA 1XLGA 4XBSA 5I6SA 2XSXA 3NOYA 1HNYA 1ICQA 3F7JA 1TELA 4IIEA 4HYVA 2XIBA 3PN8A 1NP2A 1HG3A 3KOFA 4OOZA 1XPYA 1A49A 1QBAA 1SZGA 2Z1WA 3GTFA 1J93A 4PSRA 1F2JA 3WMSA 3PB2A 3ZVHB 1ZP3A 3M64A 4UMAA 3GZ3A 2E8YA 1ML1A 4D6FA 1JG9A 3CT2A 1H7OA 2PDUA 4GXWA 4E3TA 1SO4A 4HYWA 3EMCA 3SSJA 3VX1A 1E4NA 1JI1A 2QAPA 3KEHA 1FWAC 3LNPA 3T81A 4UMCA 1K8CA 2DSWA 4AU0A 1FTXA 3QPEA 3QEZA 2Z28A 3GDRA 2GQ8A 4W5UA 4KIEA 5FJRA 4LB4A 3OQ8A 3TOPA 1C8VA 3DG7A 5IOBA 4O1FA 1TWSA 4CVWA 1FOBA 3EGJA 3M7SA 2H8XA 4O53A 2DJXA 2QXWA 3GY1A 4RNHA 4YHEA 5M1TA 3SO7A 4M56A 5DCDA 4Y9MA 1SZNA 2V5LA 3IJ7A 3F5LA 3APGA 2ZWYA 3AHYA 3HG3A 1E73M 1TJ1A 3EX4A 3PANA 4GIYA 2X05A 1Z41A 4Q8UA 3R6IA 3M5ZA 1R8LA 1J6PA 3WQ8A 3HBLA 3THDA 3ANVA 1R3TA 1KM4A 1KR0A 1PEZA 3CH9A 3OTRA 1OX4B 4KWSA 4MJMA 5K7JA 3S2CA 3U4FA 2BY3A 3S2MA 4H7CA 4ZXOA 1FWCC 4GO8A 4NI8A 3LRMA 1KV8A 4RE2A 1POKA 1C93A 2QR6A 5EPDA 1UP3A 3GTXA 2P8CA 1S3HA 4MLJA 2Y63A 4RX0A 2AL1A 3R4IA 4AX7A 4CCEA 1V51A 4GI6A 3HG2A 3GC5A 2ZZ5A 1TPEA 2R1KA 3EPNA 4UOJA 1DJGA 4HBKA 4JAWA 3M0YA 3ARXA 4A8RA 4J28A 1AH3A 1H11A 2PTWA 3B8VA 4XVEA 2HV5A 5AHNA 2PMQA 5K4ZA 4JBRA 1MSSA 3SN4A 3LM7A 4H2CA 3TQKA 5G4WA 1O95A 3B4YA 4J2MA 3GVQA 3RN6A 3UXDA 3MBFA 3P82A 1W2PA 4XV0A 5D38A 3PC0A 3PZUA 4GVFA 1JDCA 4CQ9A 1AQ0A 2IPWA 3FYPA 3NJ3A 4OZOA 1JCLA 3S5YA 1DWIM 1ISYA 2EHHA 2W92A 4Y2WA 1CWYA 1BVWA 2J88A 1IF2A 5G2HA 4EX4A 3FEMA 4C7GA 4YJ5A 2WNZA 4PMYA 3QY6A 3GHUA 3S42A 2PDMA 1W5MA 3VX0A 1Q66A 3T42A 3TR2A 1PYMA 2Q8LA 5DX7A 1PDYA 1J12A 2ZDRA 3WIJA 4LBSA 4FNQA 2OVLA 3WZ0E 1BAGA 2GSHA 3C3NA 5FF7A 4G2DA 3LN3A 1D3GA 1WYIA 3CZLA 3KVMA 4O19A 2XVNA 4JFUA 3CLWA 4ECLA 3F2DA 1V3HA 2I9EA 2JBMA 4AWEA 1R3QA 3GG1A 3WQPA 2WO5A 4IX2A 4NL1A 2PD5A 2WZIA 3EEZA 1V3MA 4NAFA 4W89A 1UR2A 5JXQA 1SYTA 2PSNA 1QK0A 3I6EA 4LS2A 3ZS4A 4UNIA 1WQ5A 1A80A 3H7RA 4P61A 2ZZ6A 1H62A 4C91A 5FSEC 1PCKA 1XBXA 1NJJA 2BB0A 3GXPA 2QPUA 2R82A 5ABTA 3TW7A 2VURA 3SCSA 2CXGA 4XX6A 1G1YA 3FA3A 1Q85A 5HJYA 4FXJA 2L5HA 3P74A 3AIVA 4HNVA 4IP7A 3UWVA 4Z17A 3WH7A 4O52A 4N6FA 2POTA 2ZYFA 3ONBA 5EB8A 1PL9A 2F84A 4DF1A 2UY4A 3WQ5A 1T96A 3NOEA 1DEDA 4AH7A 3BCDA 4RW5A 3NPXA 4R33A 3I10A 2DZVA 4ERAA 1FUYA 1S1RA 1K6WA 2FPYA 1Y5XA 4W88A 1GVSA 5EA9A 4JTQA 4QE4A 1ISXA 4D1JA 1ISVA 1W8GA 3UF9A 1X8CA 5BW6A 2WAGA 3IJQA 3ZWSA 3W1QA 4GVGA 3GIYA 2XZ7A 1HJSA 1MQQA 2BXYA 1DKWA 1HKKA 5FJOA 4AZCB 3LHWA 2GLKA 2VZOA 4P8VA 3CHFA 2F6UA 1XGZA 3BXWA 4GY7A 3KZPA 1MEHA 4XVDA 4WGXA 4E2BA 5JH1A 1NFGA 1LBMA 2YLLA 3GHSA 1PV8A 1FY6A 4H8NA 3ATYA 1W3KA 2VGFA 4Y9OA 4G7EB 5JMUA 2XUCA 1D7KA 5U7SA 1XD0A 1B54A 3MWAA 1T7LA 3ZR5A 2V38A 2HMCA 5LGXA 5AVHA 4HA0A 4GQRA 3BSGA 1DJZA 1QW7A 2WSYA 1RQBA 4WDWA 1RLDA 2V3GA 3EWBX 2CLMA 3UZJA 2VEMA 2ASHA 3R8GA 3VD9A 2YXXA 1B0IA 1Q6OA 4HSNA 3M46A 1O68A 4AY1A 3VNZA 2P76A 5E0CA 3V0UA 1HVQA 4ADSA 1JI2A 1EYEA 1W1A1 4UR9A 4JHMA 4FP1A 3AQUA 4IGSA 4OBRA 4OE7A 3A3WA 2SFPA 4LWWA 1HKWA 2QDGA 4TVDA 2XH7A 1TJRA 3GW3A 2QUMA 1UR3M 2Q02A 3I7QA 1E6SM 3MHUA 4QNEA 4UTTA 4NRRA 3S8HA 3M6YA 4DNMA 1M6JA 4S1FA 4LVAA 3SGGA 1JUBA 2G97A 2GFTA 1JAEA 3MKKA 4GX8A 2FGBA 3N15A 2V81A 2WC4A 1AJ2A 1QHZA 5HULA 3ZJ7A 3WENA 1CGWA 1WDRA 4ZOBA 3A9BA 1UR4A 2OT1A 3WL1A 4IICA 4R7JA 1Z48A 3CEPA 1J0ZA 3CMFA 2C1IA 4GGHA 3WLJA 5I23A 2CIPA 2X40A 3K30A 1KWGA 1W17A 2DSZA 3R8HA 1FCBA 4J3TA 3FKKA 5HINA 1EIBA 2DEPA 3GQYA 2VUYA 5CAHA 2REQB 2XWEA 3DIPA 1OB0A 1Q6RA 3OZPA 1DTNA 3K4DA 4K38A 2Z7KA 1VFMA 2QZRA 2HNEA 2QCGA 2JF6A 2OCZA 5T26A 3PZIA 1YQ2A 2FDMA 4HIBA 3P93A 4RDWA 1H4PA 3RX4A 2J75A 5ABFA 3W7OA 1S2TA 3RM8A 1J8VA 3EOSA 2UWFA 4UR8A 2Z1BA 2DQWA 5DMYA 1L6GA 1L0PA 1K8ZA 1T5AA 4JNZA 4M5PA 2GVYA 4ZB2A 4JHZA 5G2WA 3WDJA 3BSHA 4C60A 1EJ7L 2QS8A 4B4HA 2WNNA 1NF0A 2UZ9A 5FJTA 5KZEA 5EL1A 1VCGA 1AQHA 2VXNA 1JXJA 5AC4A 3ITXA 1V7YA 1W9UA 1SR0A 4AIOA 3IGHX 2PWEA 4LS0A 1CDGA 2CLFA 1VR6A 2OZ3A 1EP1A 2F9RA 3TCSA 3VYLA 4C6BA 1LCOA 3CUFA 1XBZA 2H8ZA 3CMGA 2JALA 4RV3A 2P3ZA 4ZQRA 1UKQA 1IGSA 4HMDA 3EXTA 2HVNA 4JPGA 4GZIA 3NQCA 5AN7A 2PDHA 3CO8A 5EYWA 1Z6KA 4WJXA 5BROA 1KKOA 1K7FA 5CC5A 3GXFA 1TR9A 5LA2A 2ZX8A 3EXSA 3PPCA 2EBNA 1LOSA 3RMJA 5J8LA 2VZVA 4HP5A 3B8UA 4H7ZA 4BF5A 3HQ1A 3B9EA 5CJMA 3VMNA 1K8YA 3M0MA 1T0OA 3WLMA 4LUJA 4HVXA 1HGWA 1P7TB 1TTPA 4W85A 3GD6A 3MO7A 3D0CA 1HP5A 1E70M 1W37A 4GG9A 3RPMA 3CS2A 3SRFA 4WLCA 4FNUA 3WLTA 4CN4A 2VQTA 2V0TA 3I4EA 4N0RA 3TN3A 5DMLA 1WXJA 1OWQA 4QJ5B 5LNSA 4X2RA 3WDQA 2WSPA 3C2VA 2YX0A 3AIWA 2EG7A 4QS5A 4H19A 3BVJA 4WSKA 1XSJA 4KFOA 1N8FA 3E0IA 4EPKA 1B90A 1RD6A 3O15A 5CSYA 1RJQA 4J3SA 1IV8A 2WC7A 1KM1A 1HX0A 4FR1A 2WCSA 2W4XA 5DLCA 2EG8A 2V69A 4PE8A 1ZU8A 3THCA 1QI0A 4W87A 3RGTA 2J4GA 5JIPA 1ITUA 2ZE0A 1JVNA 3C4UA 1FKXA 2WMKA 3GNOA 5AHMA 3OBKA 4C6QA 3WUFA 3U57A 4MIMA 1KO0A 4N2YA 3A13A 4JTCA 1B4KA 1G01A 3HPXA 1QMLA 3LI1A 3W1UA 1SUXA 1HZYA 2ANUA 3AMCA 1H51A 3BJTA 1CPUA 2VD8A 2ZZ2A 4P8XA 2I57A 1FWGC 3L65A 3GDTA 4LAZA 3MKCA 1H63A 4Q4SA 1UASA 1J0JA 2W63A 1GQNA 3NL6A 4E2VA 1MXSA 3T1GA 3EKLA 3ZFHA 4FEZA 2J7EA 2V3FA 3UWQA 4ZEPA 4HCDA 2AKMA 4WKFA 2Z1KA 3UZYA 5HA7A 2HE8A 4WJEA 3UG5A 5DMNA 3CPGA 4QJ1A 2ZXQA 5F1UA 2CPUA 4IJBA 1TPH1 4NUWA 5EFFA 6REQA 2EXOA 1JYWA 1I60A 1IGWA 1PHQA 1IWBA 2G3MA 1K9FA 1EKOA 1PAMA 3PZOA 3EOUA 1FWNA 4GX9A 4QDWA 1ZY9A 3N2MA 2QCLA 4LAMA 5E9XA 5A8QA 1XLDA 2J8FA 3LSCA 5REQB 2G0WA 1OK6A 1I45A 5A8OA 4ZE4A 1UHVA 4HTBA 2A3LA 4LV9A 3U2CA 3V36A 3CM4A 2YW4A 3IUHA 3QYSA 3MVTA 4PMXA 3TQVA 3VA8A 4QIUA 1FWBC 3T0DA 3VKJA 5T9BG 4JOMA 1GVEA 3P80A 2ZCGA 3ZVIA 4I9TA 1U5HA 3ZR6A 1WPCA 3G1VA 2WVUA 1CNVA 3G0UA 3P60A 4PCPA 4B5WA 4ZODA 4ACZA 1F6KA 3PJTA 3CAWA 3QOMA 5LHEA 3DECA 4BHYA 2DP3A 4ZQCA 3VKDA 1WKEA 2W79A 3B9DA 2NV9A 2EO7A 3RU6A 1YKWA 3W38A 3ZOAA 1NDZA 1W3LA 2R94A 2D2OA 3L0GA 4I8DA 1XIDA 2PDLA 1J0HA 2PZNA 1XLJA 3IGSA 3NDZA 4XKMA 3W7GA 5E09A 1W1ZA 4DF2A 3PG9A 3KX6A 4U33A 3LGGA 2X1UA 1BRLA 2PWVA 4H4IA 4LYPA 3ZSSA 3MS8A 3EYPA 3GU9A 3WKZA 4QTGA 4I9AA 1RY8A 1XC4A 4FF7A 1IZJA 4S3GA 5J04A 1A4LA 2NSXA 4J9JA 3SIMA 1WBHA 4NJHA 2GJRA 1XCXA 4ZOAA 3VNIA 5DXXA 4NJIA 4CD8A 1TFVA 3PWGA 3ARPA 1GG1A 1QPQA 2G8ZA 3U7VA 2DZTA 4J7RA 4V27A 4WHBA 3H7VA 3G18A 3VGHA 4P7OA 2ISWA 1R87A 4CD7A 3PPGA 2NQ5A 3B0VC 3NL2A 3GUGA 3TNBA 3CHCA 2C1HA 4LVFA 2ZRZA 2DZUA 4ZGYA 2A3EA 3CAQA 1V02E 3DHPA 1QNOA 2IKGA 3B06A 3BGJA 3CPRA 5ABEA 2V68A 1EP3A 1E6ZA 2Z25A 2OX4A 4MZYA 3CNYA 4EF9A 1E3XA 3NL5A 5K2ZA 5D2YA 5AVNA 2CW6A 1SQ7A 3QXBA 3WD4A 4J5NA 5D4YA 3VD4A 3SRDA 5HAOA 3WQGA 1XBYA 2XINA 5LIYX 3POCA 1ZPTA 4IL2A 4M8UA 3IJ9A 3DYOA 2YDRA 1MZHA 2GOKA 3IIVA 1UROA 1AZ1A 1TMQA 1DVJA 3CWHA 2Y7EA 2NVDA 4BQ4A 3S1XA 3IJLA 1NOUA 4HOXA 4DWSA 3CUXA 1LP6A 5GPRA 1XKYA 1TPC1 4JTIA 2A79A 3SQSA 3DGRA 1ZB5A 1OX5A 3ANUA 5HMDA 1RCOB 4M7TA 3M1ZA 3ZIZA 4GC3A 2A3HA 4GBDA 1EPVA 4M6QA 4QE1A 1RBOB 3O8AA 1L2UA 3M0KA 2V6AA 3UJRA 1FP8A 4HPHA 4LALA 4HTYA 2J8GA 3QV8A 4MNLA 4O18A 3EWYA 1UD2A 1GQLA 1HJQA 4R53A 1OC6A 3NQ2A 1QK2A 2AGTA 3GNPA 1GOQA 1UQYA 4C1NA 2UY5A 3A4XA 4LQ1A 4XKYB 4K7VA 3W1MA 2F38A 3L4VA 4HHMA 1VJZA 2WMIB 3AXIA 1E1EA 2V5BA 2ZUSA 4A8IA 1JR1A 4MKSA 1UPPA 3MB9A 1HKVA 3FEQA 3UD6A 1F07A 1H3GA 1A5AA 1D9EA 2XN1A 4GYPC 4UOZA 1VFOA 3WH8A 3IGUA 3M41A 2VMFA 1CXEA 1J11A 4NZCA 2PDXA 1TTJA 3LENA 4H8HA 1TV8A 5FJUA 3GIPA 2C0AA 1H50A 2PU0A 4JNYA 1R2TA 4HT3A 4ORMA 3WFZA 3F2BA 2CZEA 2FZDA 4W7UA 3WH9A 2WSKA 3UXLA 1W3HA 3OODA 3W25A 4BCEA 1QO5A 3QMRA 1F3EA 2FZ8A 5I3GA 3QW3A 1FQ0A 3PWIA 3ZLHA 1GYLA 2F7FA 3IPWA 2CLKA 1TQJA 2WWCA 3KXQA 4IIBA 3QHNA 4GABA 4NQ1A 4C65A 5CPOA 3J7HA 1R86A 3DEQA 4PTWA 1W5NA 4K1WA 3XISA 1XD1A 1FHDA 3WJYA 1JPMA 1VP5A 7TAAA 4UZSA 4BI6A 2B31A 6CGTA 1AW5A 1EUNA 2A6NA 1SU5A 2YGYA 2J47A 2WM0A 2DZSA 1LBFA 3O05A 1KBLA 1LBLA 3NG3A 3KCLA 4DBEA 3W84A 4X9YA 1EWDA 1NWUA 2X0YA 4DJED 5F4XA 4WDUA 4CEUC 3THQA 2J9XA 1XYCA 4AD5A 4JTTA 3GSMA 1KTNA 2VZUA 3WJZA 1VJIA 3QZ6A 1JIBA 1O60A 4JXCA 1D8CA 1W54A 1OF6A 3VIMA 2YXGA 1OZQA 3HV9A 3TJ4A 1E4MM 4EKJA 4HPXA 1VYPX 4LF2A 6XIAA 1FDZA 4QISA 4Q6XA 3C2FA 5AHLA 4RZ5A 1AG1O 1UH4A 3ARWA 2BMBA 3IUDA 5KEZA 3B9AA 1DORA 5FF0A 2YZRA 1QNQA 4A3UA 4TU1A 3WLRA 4YXGA 3EB4A 2IMRA 4IMDA 4JYFA 3TDFA 2BXVA 2QYGA 3QOKA 1E71M 3R7MA 3LTPA 3H2CA 2E28A 2QT3A 3RJYA 3UZ5A 1YPIA 3BGGA 3WLPA 3NQMA 2OLSA 3PB0A 4F9DA 2GGIA 4GY0A 4JGDA 3EX6A 3LGDA 3MQTA 3GK0A 3VCCA 2E77A 3KVKA 1B9ZA 3H2OA 3OIXA 4QG8A 4AC7C 2DH3A 3C2EA 3ABXA 4B3ZA 2D1ZA 4IT1A 1H1ZA 4WY0F 3LYEA 4NJJA 1NARA 3WMLA 1PKMA 3HPZA 4KF1A 3P14A 3BV4A 1XIMA 4YTTA 2X2GA 5TIMA 4D8LA 4UFKA 3KBMA 2VZTA 2CBJA 1F3WA 2FTPA 4N9CA 2YW3A 2Z29A 3DFNA 3KOZA 3WYZA 1J6OA 3GNDA 4HPNA 1JF5A 3KRBA 3B97A 1OCQA 1GOWA 2FH8A 4E38A 2BY2A 1CXFA 2D0GA 3OG3A 1PTDA 1GVYA 1PDZA 2INEA 3TW6A 5FOOA 5I3JA 2YDSA 3LV6A 4UUIA 2RGLA 3OZMA 1D2KA 4HN4A 4WY0B 6A3HA 3UG3A 2QPSA 4BQ5A 1G4TA 1DWGM 3K46A 1XLFA 4F40A 2Q6ZA 4PEEA 2FH6A 4JTFA 4QP0A 4B2DA 1N8WA 2EKGA 3S0CA 2MUCA 3WLOA 1KFCA 2BOGX 2PBGA 3SJNA 4QSFA 1EFZA 5CEWA 2XISA 2OSYA 3WK2A 1XLLA 5CGQA 3G0SA 2P88A 3PBYA 1TIMA 3FHAA 1J2WA 4JY8A 5G1MA 4ZFCA 1C3FA 3V1PA 3ZO9A 4A05A 3WLHA 1IEQA 1V08A 3W72A 1H7PA 1WDSA 1KQYA 2X41A 1GG0A 3LPPA 4ZVJA 4UQAA 2AQVA 5LKYA 4AEEA 3JW7A 5LIXX 3L12A 3N3MA 1P0BA 3BAXA 3TXZA 1O1ZA 1HT6A 1KCZA 2C91A 1DWAM 2D2JA 2E09A 1QO2A 4JDYA 1W1B1 1YXYA 2Z00A 1EJTC 1YRRA 1EC9A 1VZWA 2VZSA 2WNQA 1KCLA 1TV5A 3HV8A 7PTDA 4JHOA 4NSBA 1MEWA 2VOMA 2QF8A 3SSZA 2DV0A 3PJXA 3C6CA 1V6WA 1YTKA 3TYEA 5CCZA 3N19B 1YTDA 2WVTA 3BURA 1SVDA 3P62A 3HN3A 1M3UA 2ZX5A 4JFVA 2ZA2A 5CG7A 5M3WA 4H9TA 3QQ0A 4XBKA 4GH3A 1VEMA 5FJJA 2VFFA 2QDHA 3OGSA 4LXFA 3TV8A 3M0LA 3N2TA 5RUBA 4IJCA 3U3HA 3EDKA 4I90A 4PUWA 4DO7A 2YJQA 2OXNA 5HWNA 5IBXA 3UJFA 1D3CA 4B5NA 1FFQA 3G8EA 3APTA 3MY9A 5G2IA 4Z2JA 2FPVA 1P0KA 2CBIA 4O1DA 3VNLA 3G1SA 2JGYA 5KSWA 4Z42C 3FNDA 5C55A 2BOEX 3T2PA 4MF4A 2G50A 1UH2A 4JR5A 1OT1A 2ZVRA 4JQ3A 1V0NA 4O0QA 3KTXA 1UWAA 3BANA 4B3KA 4DBSA 5DCBA 5AECA 4HMCA 3ID7A 4FOUA 4MZ8A 2VRQA 3L0NA 3MP3A 1R5YA 4PL1A 4D6DA 1A0DA 2PTZA 1I4NA 1OYAA 1XRFA 3E6EA 5T9CE 5A6AA 4UFLA 3G2GA 4LSBA 4ZO6A 4DZAA 3F4DA 5KITA 5M03A 3IGXA 2ZXAA 2OEMA 2QCDB 1TUFA 4R27A 4AW7A 2AQWA 3XINA 3QGAC 1W9XA 3D6NA 2NSOA 4JTJA 2RFGA 1XIHA 3NPWA 3T8QA 2Y8UA 3I3EA 2D24A 3RCNA 4DB7A 1EUAA 1H7WA 3L5LA 9XIMA 2X1IA 2PDKA 2WLYA 3LD5A 3VK5A 3CQKA 4ML4A 3CWOX 5MKGA 2O55A 1U5JA 2ZTKA 4LF1A 4Q8WA 3MJYA 1ITCA 3NO1A 4E0CA 4H8UA 3RFAA 4W93A 4PA8A 2B81A 4Q8MA 2Z1VA 3LCXA 3FSTA 3SFWA 3PBUA 2J78A 2VDGA 3OHIA 3UXAA 3LDVA 3CV7A 5CKSA 3E96A 2NX9A 3QV7A 1CGXA 3AUOA 2EPMX 1EOKA 2J79A 2FHFA 3W7KA 3RRAA 1OFDA 1YW1A 3ABOA 3ANYA 3P6LA 3OYXA 1XIJA 3WEMA 3NCOA 2WVSA 2Z6IA 4OIFA 4OKDA 1ZJBA 1PIFA 3EA1A 3N18A 4ICMA 1F9CA 3FJNA 4NJGA 1PYFA 3WH5A 3T07A 1FH7A 3BLKA 2ADAA 3W7EA 1LUCB 5ABHA 4DEFA 1M1BA 6TIMA 3GDKA 1AH4A 3C56A 5H8MA 4ENLA 2Z2AA 3NSNA 4DO5A 4L9ZA 2ZC8A 2GQ9A 3IWPA 1OHLA 3IVTA 2DORA 2RDWA 1HGYA 4B90A 2Q3OA 2Y4SA 3VMOA 3RR1A 1ICPA 3MUXA 4EPBC 3NTYA 4YNGA 1NEYA 5TNVA 2HK1A 1V7AA 5FF2A 3UR5A 3CU2A 4D2JA 4AXKA 2WSRA 4QEHA 4US5D 4DLMA 3GU2A 3N14A 3H8AA 3RXZA 2GVEA 5A6TC 3TYBA 3PBWA 1KKRA 1VH7A 3WBAA 3WJWA 3WK3A 1BG9A 1Q7ZA 4WUIA 1FH8A 5AC5A 1WDWA 3NQDA 3W27A 1XLKA 1RD5A 1WAUA 5A3HA 1C29A 2HRWA 3EOOA 2OELA 2PGEA 3HB9A 1P43A 4BQ3A 1OIMA 1RY0A 3O2LA 4H6EA 2WVVA 4D9PA 3R8RA 1F74A 3HQOA 1L8NA 3W02A 2QEZA 4GYFA 4B3LA 1V0MA 1A4MA 1D7FA 5FJIA 2A4AA 4F0HA 4IOTA 5D32A 3O0KA 3AC0A 1EJSC 1CI1A 2I17A 4Q32A 3G1FA 1ZAIA 2XFFA 3UYIA 4A22A 1P0DA 3BW3A 2NXIA 3TK7A 1TVLA 4MY9A 3UZWA 2GSEA 4YWIA 3O6DA 4E8GA 3HTWA 2HQAA 1M7XA 3OG2A 3FXGA 2C15A 3VGGA 4NZFA 1B1YA 4RPQA 3EB2A 2OKTA 1XYMA 1NVMA 2HTMA 2DDXA 2ZA1A 3UXKA 1FHUA 1FWDC 4FA3A 5PTDA 2OO0A 1GW1A 3R94A 1QI3A 3AXXA 1A3XA 1XPGA 3ITCA 3CBWA 2C3ZA 3V16A 1N55A 4ZA0A 1T8XA 3K13A 3SCVA 3AYVA 4CQAA 1HVXA 1V79A 4MY8A 1MUMA 3NXFA 4E3VA 2E4TA 3UGRA 3N2XA 1EWEA 3TSBA 4G7FA 2VC5A 3NPVA 2ZRWA 5E9AA 1RAKA 4D8AA 3MMWA 4A3HA 5LNVA 3IIPA 2VEKA 3MMTA 4GYKA 4FS9A 3DXIA 4D8ZA 2EJ1A 1W9VA 1TWZA 3PJUA 3W6LA 2BY1A 4C6NA 3ARUA 4EACA 3M5VA 2OOGA 3MT1A 4O28A 1C8YA 4JDBA 2A7NA 4I5RA 1JCMP 3RITA 4LC8A 1ZLPA 4F2TA 4LH8A 4Q8OA 1XINA 3RR4A 4GHRA 2QUTA 2ONEA 4RNJA 4F3HA 4G56A 1LL6A 2Y1HA 4F0MA 4CEXC 2VC7A 4P2VA 4NILA 1Z44A 4BKNA 2A2IA 1N7KA 1F6PA 3TH6A 2X7VA 5EU9A 5A6BD 5AZ1A 1QCWA 4ZTXA 2PLMA 8CGTA 1EO5A 4GJJA 3TTQA 1TPUA 1CCWB 3TZNA 4TUFA 3USZA 4GUFA 1KM6A 1BG4A 5TD4A 4YPJA 3S9ZA 4DZHA 3S5OA 1U1HA 1EGVA 3B04A 1W9BM 3AXHA 4JYDA 3W1NA 3P2VA 3QY7A 1AJZA 2P10A 1KLYA 3SZ8A 4HK5A 1JZ7A 3TNOA 3O0FA 3WNMA 2CHRA 2A7PA 3PULA 4KGJA 4FIRA 3UWWA 3WY1A 2CXEA 1R3VA 1UBSA 3ARQA 3VDGA 3O3RA 4UTWC 2QCMA 3C61A 1ZUAX 3N34A 3W88A 4ADUA 1X97A 1XQLA 4MTVA 3CHDA 5CLWA 1UBPC 4X22A 4HNLA 3N9SA 5I2UA 1NY1A 1GOMA 5B7YA 2I16A 3T4WA 1R9XA 1Q5MA 4Y90A 5FSDC 1GQKA 1KM2A 3NL3A 4H6RA 4QCEA 2ABAA 3A24A 3AJXA 4HSHA 5DF0A 1TTIA 2D2HA 1M7JA 4RNIA 3UY7A 3L2MA 2GVJA 3HG5A 1BGAA 4GQQA 1MFVA 3QRHA 3LZ5A 2WHLA 1UA7A 3AXMA 4LOCA 4Z1CA 4XAGA 3LQGA 3IRDA 2FZ9A 3UBPC 1FWIC 3P67A 3M0IA 1Y5VA 2B7OA 4Y9PA 4TV5A 2Y7FA 1E15A 5D9NA 1WKDA 3S9YA 1TTQA 1RZMA 3BICA 3FA4A 5ABFB 5HUPA 2A3AA 1BSLA 1LWJA 3T08A 3JZEA 4R9OA 1X38A 4U28A 1KM3A 3QV6A 3W86A 2ISVA 5JQ9A 4M6UA 4OV9A 4JIPA 4GNKB 1TE6A 4LUIA 2DJLA 4FK9A 3NR0A 1GTHA 1FHVA 4ZB5A 2EKCA 2NW0A 5G1YA 1JNDA 2RJGA 2PCQA 4N4QA 2D22A 4M0XA 1ME8A 1NH6A 3SECA 3VIKA 2F8QA 1AD4A 1XS2A 4UTIA 3VNJA 4IP4A 2XU2A 3UESA 1EHAA 1GGOA 1DPMA 1XX1A 2EGZA 2QUNA 3C0JA 1V8EA 5G4HC 1BVZA 5A8GA 4IMAA 1YYAA 1WOBA 4N7QA 3RU8X 3UJSA 5I00A 2BODX 1UZDA 3LBOA 5FF4A 1G4EA 3WDRA 4PTVA 4NXSA 3T0BA 4AD0A 4PL2A 2ZICA 2Z1SA 2YL6A 4JTHA 4L80A 5LYRA 3E2SA 4WGHA 2FMOA 4H2HA 1TREA 4F0KA 1GVRA 1XLAA 4URIA 3VZXA 4Q8VA 4LV4A 2WMFA 4IUGA 4HCLA 5DBUA 3PUEA 3W28A 2PDGA 5EMJA 1UKSA 1XKJA 2PD9A 3W2KA 3S1UA 1I2PA 3WF2A 1X39A 1IT8A 4ROQA 1JFXA 4IXHA 2XJ7A 1Q8JA 1ADDA 3FW6A 3I3BA 3FHQA 5C9RA 4GKTA 3T44A 1TQXA 2VI0A 4PUJA 3UPMA 1PXGA 3VM5A 1VHNA 4BI5A 4IX0A 1JDDA 1XRVA 1DL3A 3PSVA 3A4JA 2D73A 3CTLA 3DENA 4CD6A 1PZ2A 4IPNB 3B03A 4J3ZA 1BYBA 5K9CA 2ESCA 1DJQA 2IW0A 1Q6CA 2D3LA 4HHLA 3VOJA 3EWDA 1IZKA 1E72M 3AYRA 5C8BB 3UZZA 1HJUA 2J8TA 4GUHA 1GZGA 2HE5A 4Z2KA 3DC0A 1XJBA 1PTAA 1UOZA 3F5KA 4F2UA 3E2QA 1OEPA 1I2OA 3FGCA 4V2XA 3WQEA 1BKHA 4GIEA 3OPSA 1GJUA 2PPGA 1K03A 2E67A 3MZ2A 3WBXA 4LYRA 5FEWA 1VBHA 3L4XA 1UC4A 1EXPA 4S2CA 1GYMA 3WLKX 1Q13A 3PTMA 1JYXA 1JQXA 1A5KC 4E4FA 3W53A 3ZJ6A 4IFRA 3T4CA 3LLXA 1G7UA 4E8DA 1OJXA 2OWXA 4WOQA 4GGBA 3AS2A 5EFDA 4LGXA 1CYGA 1QVBA 1G9HA 1P0NA 3OB8A 3DOPA 3DGBA 3H54A 3SI9A 5I07A 3OLGA 3VNDA 1A3HA 3CH0A 3SUSA 1XF0A 1N8IA 3Q37A 3O63A 5CPLA 5AYIA 1EJUC 1V6UA 1RSCA 4HK7A 3UZXA 3UGVA 1ONXA 4C6KA 9CGTA 1MW0A 5KMYA 1A47A 1CTNA 5FCZA 1JCTA 8A3HA 1Q65A 1VIZA 2VGIA 3ES7A 4KESA 2YA0A 4UFMA 1QRQA 6REQB 2D2GA 4JCMA 3H70A 2VFEA 1IWAA 4BF9A 4M51A 3CZGA 1DIDA 4TO8A 1M7OA 3L68A 3W1TA 3L66A 3QPZA 1EXBA 2YYTA 3E02A 1M9HA 1V77A 3SY1A 1OC7A 5BWFA 4EWND 2GGJA 1W6TA 4KS0A 1QNPA 1V0KA 4US6A 1XLCA 1WP6A 4AMAA 1Q6DA 4GCAA 1SO3A 1WZKA 4G1NA 3B3DA 5D8ZA 4QNWA 5XIAA 1Z89A 3SUUA 4NNBA 1LROA 1XLMA 3OO2A 1E9LA 2WMHA 2I5GA 4ACZB 4LCQA 4LW7A 2TMDA 2B7NA 2JIWA 2CITA 1P5BA 2DUXA 3CWNA 2ALDA 1NF7A 4WD0A 1RR2A 3EA3A 1CB7B 4PMQA 4MWAA 3O6YX 1CB2A 4UQCA 1XCFA 3NGJA 3SCOA 4PUKA 3LNMA 4FX8A 4AB4A 4WK9A 1M68A 3I7RA 5BXTA 1PE1A 5A2AA 3UNDA 1BRLB 1DIEA 1TWDA 3LHYA 5AKQA 2MANA 1YXDA 3GNRA 4GINA 2AAMA 3N11A 1RA0A 1TA3A 2Q3RA 4CUCA 4RE4A 1CLKA 1UD8A 1OFRA 3OA5A 4PMNA 3T0TA 4JEJA 2ABBA 3OEXA 3GH4A 3QKEA 4IQJA 2PFHA 2X16A 4UTJA 3HG4A 4AYSA 2EF9A 4KMQA 4YTSA 1OGSA 4O16A 4B91A 3OIHA 2OG9A 2NV2A 4XWUA 3V18A 4WEVX 1B5TA 2WHMA 1S5TA 3DX5A 3MMUA 1ITXA 4OUEA 2QCNA 3QYQA 4FI4A 4OTKA 4RZ4A 3DFTA 4ZQPA 1HJXA 3W6MA 3URNA 1FHLA 3EBVA 4HU4A 5XINA 1B30A 2HPIA 3EWZA 3BK0A 3VE9A 3EB3A 3NGFA 3AZRA 1SSDA 2GPTA 4V1XA 2ZADA 4AY8A 1IWPA 3OOQA 3S83A 3OZOA 3R58A 3OW1A 2CETA 2A85A 3TONA 2HVOA 4MYAA 4ZZ9A 1E4LA 3VD3A 3WFLA 2P53A 4XG1A 3KOYA 4GD0A 2NLYA 3CV2A 4N6EA 4HGXA 3RK8A 1EH9A 3GRIA 4KCUA 1GW9A 4J1OA 1GZ1A 1XIGA 4GKLA 4DWSB 1U22A 3DKLA 3M0ZA 2FB3A 2OWCA 3SM0A 4AEFA 4PTDA 3LLFA 5DO8A 2VX7A 5LNUA 4LYQA 5D30A 1JUKA 4WIWA 2BGSA 3ABQA 2XN0A 1JL8A 3GFYA 4U2ZA 4DAIA 4R9XA 1AA1B 3DG6A 4XIMA 1AD1A 3TXVA 3L4YA 1E6NA 5LA1A 3VKAA 4WX2A 4QE5A 2RGMA 1X96A 3CV6A 5HANA 3W00A 1BKSA 1ZJAA 1PB0A 1SFSA 2IPFA 2XIMA 2QCCA 5IFPA 2YSWA 1GKQA 3AMDA 4ZOCA 3MW7A 4MB5A 4C1NB 2ZVIA 4IPLA 5HWJA 1JFHA 1TV7A 4QFUA 3EDDA 4XAPA 4XQ6A 4FLSA 1MO0A 1TMHA 2ZFAA 1ADSA 3CUIA 3RIKA 4TVCA 4RL3A 3AWOA 1I2RA 3IUIA 1VFSA 3BOLA 1QU4A 1RK6A 3EWCA 2F2HA 4FX7A 1KFKA 2PUZA 3GVRA 4W84A 1KLZA 3WQWA 3W76A 4GCXA 5K9XA 2WJEA 2GJXA 3WL0A 3LHTA 3AHTA 4UTTC 4AYGA 5HMSA 1EZ2A 3HJEA 4H04A 2C8NA 1Q7QA 1SO5A 3I65A 4W7VA 5E70A 4MNJA 1FWWA 4QM1A 4W5ZA 1KNWA 3CUJA 4LTSA 1AJ0A 2BNJA 3N3TA 3U2OA 4MB3A 3RG6A 3WO8A 2DUZA 1IEXA 3WCZA 4HU3A 3IJ6A 5BYWA 2BV9A 1TZ7A 1BF6A 3MDWA 2WQDA 1LQ2A 2C6QA 3VNKA 1YNQA 3RHGA 4LEQA 3VOFA 2PDIA 2GJPA 3TOYA 1PCWA 4LVBA 4GQ0A 5D9MA 3WNLA 1E6RA 1DJNA 4MM1A 4S23A 1E3ZA 1NP0A 3QR1A 3MI2A 3H53A 4Q3MA 3L23A 1O5KA 3NZ1A 2FKPA 4OGZA 1HKIA 1IIGA 5D2WA 1PWLA 4NIRA 1JPHA 3BMVA 1BFNA 1F3XA 1H5YA 4ONVA 5A8NA 2C0HA 4V1YA 4O0KA 1MXDA 3LOTA 2QDEA 3BQ5A 3C8NA 2OYMA 4AIEA 5A2CA 1H60A 3A4WA 2CZVA 3HQNA 2ICSA 1KTBA 2RAGA 1UWQA 3AIEA 3GNXA 2QJGA 5AYZA 4LX4A 5K9DA 2OZ0A 3CJPA 3RILA 1O6IA 4C5ZA 1Q45A 1HW6A 3B8SA 3STPA 1TUXA 3EZ4A 5C2XA 1JDEA 3RJXA 4PMZA 4IH3A 4NI3A 5BXPA 2FTYA 4GFIA 3CQ0A 3FOKA 3SN1A 1XICA 1EA0A 3G77A 3GR7A 5JBEA 3ALGA 4ZMGA 4HMEA 4AD3A 4JCLA 4YWSA 1VRDA 3AYSA 4W9TA 1G69A 1LQAA 2YCJA 2W62A 2Z24A 4AZGA 3KWXA 5EGRA 4HNOA 2YB1A 2PRMA 2A1YA 1OD0A 4QITA 3LXAA 4XSLA 3VCNA 1RQEA 1PX4A 4LVGA 1H7RA 2DSUA 1Q3NA 4MG4A 1CT5A 1AFSA 3BCJA 3TTEA 2EPHA 1F7BA 1E9YB 4UFHA 2WBGA 3MSYA 3H7UA 2TODA 1JNEA 2YOCA 1TV2A 3VFCA 3GFXA 4UNKA 4TX8A 1XH2A 2R14A 1GVOA 4CNOA 2QGYA 2ZZ4A 1TWIA 1XG4A 1PZ1A 2ACRA 2IQTA 1ZFJA 2OR2A 3KHJA 2E9MA 5I3DA 1GJPA 4NYUA 1JZ4A 3UVAA 5BWAA 1M5WA 3SGUA 4GA8A 3EKZA 3PM6A 4RW3A 4AMCA 1DWJM 1ITQA 4LBRA 3CB8A 3SRHA 1CBGA 3QF0A 1H5VA 1MW2A 2HXUA 5D2TA 1HL8A 2J9ZA 5I77A 4ZENA 2VL4A 4FXSA 1IXNA 3MJMA 1PKLA 3PR2A 2QUUA 1UCWA 4L4PA 4ZO9A 3W1AA 2WPBA 4AFYA 4MZ1A 5CGTA 1MFUA 3W81A 1I2NA 3CC1A 1WCGA 1PVNA 1L8PA 3BE7A 1PIGA 5K4XA 1RVKA 2V8ZA 3NPUA 3FVDA 1A5SA 3STCA 4FOKA 4C6OA 3U2ZA 2IKJA 4NHVA 5DY3A 4FLQA 3PHAA 1W3TA 4LU0A 2VD9A 3ARVA 3BAYA 1A0EA 2W5FA 3WD1A 5BRBA 5J5DA 1MNZA 4PN2A 2A21A 3UWYA 4E4UA 2XWDA 5HBFA 3H24A 1XGDA 4ERGA 1GKRA 3LTSA 3HF3A 1QPKA 2C13A 5FL0A 4UTHA 2VGGA 2F61A 3PBMA 1UKPA 5AFDA 1TPB1 3WK1A 4PODA 4JN7A 1ZBKA 3HPSA 1TE1A 4DO4A 4PSPA 4TX6A 3G1XA 1W3JA 6XIMA 3CO4A 2CC0A 5A6BA 4OWGA 3VNYA 3L0KA 1QOXA 4JKMA 1ICSA 5BCAA 4JTEA 5LHFA 2LLEA 1QWGA 3WF0A 2Y6ZA 4TIMA 4ZQOA 4NASA 1XIEA 1JGMA 1S5MA 4W8LA 3C0LA 2ZE3A 3IIZA 3W37A 2PDBA 4P8WA 1J0KA 1JPDX 3VUPA 1Q8AA 4BK9A 2VTFA 1OFPA 4M1BA 4JKLA 3P84A 1Y0EA 3E9AA 3W7CA 3BJSA 2JEPA 2WJFA 3NQ7A 1SO6A 1E56A 4Z1DA 3ZMRA 1J0YA 3W87A 4CNSA 3W83A 4CN1A 2DFAA 3LCHA 2FJKA 2D69A 4AZCA 3TTYA 1R46A 1US0A 4TTGA 1M04A 3WFAA 4DUXA 3TFCA 5EMUA 2OQYA 4AVOA 4MB4A 3CTTA 5CGMA 1YMYA 3S6OA 1LRQA 4IG2A 1AQFA 1V3IA 1SFLA 3TKFA 3VC5A 4PB3A 1P1XA 1RBLA 3ZSTA 2Q8ZA 2QQ6A 3E0FA 4XAFA 2FZMA 1NSJA 2AGKA 2WKJA 2AL2A 1SMAA 3WQDA 3ORWA 2PDJA 1BXBA 3V5CA 3W1XA 3KL0A 3STEA 2PC4A 3EWXA 3PTDA 1I6NA 1RPKA 3WLIA 3ZWTA 3A21A 5FEPA 3BMXA 1T8QA 1J4EA 2QAFA 2IS7A 4XK2A 5MKGB 3STFA 3HIJA 3KL3A 3H2AA 2OSWA 3AMGA 4DBWA 2FQIA 2HDJA 3VVGA 3QR3A 3E5PA 1FBAA 1V5XA 4H9ZA 4C1KA 2XIIA 3HQPA 4K7YA 4GYPA 4I9JA 4QQUA 2QLYA 4JFSA 3QQWA 4A35A 4PTNA 5LNWA 2VKZG 3CMJA 3YPIA 3WUEA 1VYSX 4G9PA 3W3OA 3GDBA 4Q4MA 3C0QA 1ZAJA 4E5TA 2PRLA 3PFMA 2YDQA 1XRSA 1WZMA 5CC7A 3PF3A 2VT0A 3W7NA 2NVCA 1PTGA 3WN6A 1ESWA 3BC9A 1W5QA 2YIHA 1JDAA 3GBEA 1R7OA 7CGTA 2AMGA 3SAZA 4MKVA 5KZ6A 2YB4A 4DWDA 1W56A 3R12A 3PZVA 1CXHA 3MBDA 1NTHA 4GYJA 2PRHA 4LAUA 2PGFA 3H23A 2FGLA 2W6RA 2W27A 2WZTA 1GOXA 4L56A 1KGUA 3DAQA 3MHFA 4IPPA 3HU7A 3C2YA 5E6YA 3INPA 4W8BA 1L6FA 2JKEA 1JZ8A 2IXUA 1F4HA 2Z2BA 3WUGA 4N02A 3SJ3A 1OD8A 4O1BA 3BL3A 5KZMA 2X7WA 3NFUA 1BWVA 1F6YA 1QT1A 4L6DA 1EBGA 3DI0A 4CD4A 4LY4A 4CQCA 3O9NA 3W1PA 4E6MA 2YBTA 4B9ZA 1HIZA 3LMZA 1AZ2A 4Z1YA 4DJEC 4PMOA 4C6CA 1X6UA 4D6JA 4H3DA 1UZ1A 5HPOA 2QIWA 1JULA 3R13A 3S4TA 1EB3A 2QVHA 2NWRA 3W7JA 1TJPA 4ZSTA 4PCTA 1LDCA 2HPMA 4NZ5A 3RX2A 2ZRXA 3GM8A 4XZLX 3MC5A 4L1XA 1XWYA 4G8TA 2CYGA 4J40A 3FAXA 2BGNE 3D3FA 4WVXA 4UMBA 2C16A 4X60A 1U1JA 2NX1A 4H9VA 1AW2A 4XSMA 4ACYA 4TTUA 2HEJA 5DXYA 4TMBA 3SUTA 4GUJA 2J7GA 3UWEA 1A0CA 2ACUA 4U5IA 5LIKX 1V3JA 4GISA 2VGBA 3QGVA 4F66A 4KPLA 4HNTA 4QJ3B 4CQDA 1LG2A 1I8JA 1G6CA 1BQGA 4S38A 1JD7A 2X30A 4IMCA 5JU6A 5I09A 4DJFC 5IXEA 4GJIA 4IJRA 5I3IA 3UG8A 2TPSA 1B3WA 5AB3A 2QJJA 3DZ1A 4PFHA 1P7TA 1MQRA 3P7YA 1LTDA 3RO6A 1FWHC 4UZUA 3NUKA 3TLQA 3M6DA 3FK4A 1XLBA 2NWSA 4F48A 5I5RA 3UWUA 1K1DA 1J5SA 2PF8A 5A2BA 5HWMA 2WHKA 1KXQA 4JX5A 1CXIA 5HR7A 3NZGA 4RXFA 1QPOA 2C18A 2J6VA 2DT1A 4L9XA 3VAVA 2G5WA 3L4UA 1UD5A 4N42A 3MDUA 4KFNA 2CZ5A 1HFBA 3WQCA 2OB3A 2J7DA 4HZ6A 2BWGA 3BLEA 3AIUA 2GWGA 5D2VA 4Q7NA 1MW1A 4DF0A 4AZIA 2H90A 4NNAA 4KEVA 4A8LA 4O12A 3BV7A 3LTYA 3PVFA 1E0VA 4Z2LA 3OJGA 2DU2A 2VNCA 3W2JA 1MUCA 3HGSA 3S2JA 1W5OA 5C9ZA 2PE4A 2XM1A 4GACA 3TA9A 4AD4A 1YDVA 3QKZA 4U3AA 5HQLA 3B8WA 3P5YA 4M19A 2ZIDA 4JTAA 1V6VA 3B8IA 3SCWA 5FA5A 1AUSL 2G37A 3UERA 3HJZA 4AX6A 1CECA 1XRTA 1FWTA 4IPIA 4OFCA 1QJWA 2PF0A 4OT7A 3LGEA 4IMEA 4KETA 4GJ1A 2ZXBA 3FVMA 2Y2WA 3AS0A 3N9RA 2RDUA 2J7CA 4YCPA 2EAWA 1BEUA 1HKMA 3P8IA 1IQ8A 4XD4A 4RKAA 3IV8A 4JICA 1NWSA 1PWMA 3FDGA 5FEXA 4JIRA 4H7VA 4J3UA 2BVWA 4AD1A 2TRSA 4FNRA 1C9WA 1K02A 1IXPA 1J10A 4LS1A 3T09A 4HA1A 2AOSA 2BVYA 2GWNA 1E1CB 1YPXA 2IPGA 1W0MA 1KA9F 3AUJA 2W66A 4JNMA 1GUVA 2YCKX 3W7PA 1TWWA 4O50A 3N4AA 5EBAA 1E6PA 3TJLA 2Q01A 1BXNA 5HMEA 3KBSA 2Q8XA 4TQTA 3VNMA 2BASA 1UMLA 3URAA 3L9CA 3TIMA 1VC4A 2HVMA