4ZF7A

Crystal structure of ferret interleukin-2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
126
Chain Sequence
SSSTKEAQQQLEQLLLDLQLLLNGVKNYESPRMLTFKFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKHLTDIKELMSNINVTLLKLKGSETSFKCEYDDETVTITEFLNKWITFCQSIFSTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterisation of ferret interleukin-2.
pubmed doi rcsb
molecule keywords Interleukin 2
molecule tags Immune system
source organism Mustela putorius furo
total genus 40
structure length 126
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4zf7A00
4MHLA 3N0PA 3EJJA 3MZGA 1BGCA 1PGRA 2ERJD 1IARA 3HMXB 4NEJA 1IK0A 3DUHC 1SCFA 2LMSA 3G9VB 1EVSA 3L5XA 3N06A 2B8UA 3QB7A 5L6YC 1YKBA 1M48A 1WU3I 1EMRA 1LKIA 1QVNA 3UF2A 1HULA 1CYLA 5LQBA 2KZ1A 4ZS7A 4WRLB 3QAZA 2H24A 2Q98A 5C7XA 4PS4A 1NBPA 5D71A 3BESL 1F45B 1RCBA 2D48A 1GA3A 4YPGC 4NI9A 4O9HA 1CNT1 1J7VL 1FG9A 3EW3A 4NKQC 2B8XA 4FA8E 2B5IA 1PY2A 1M49A 4Z5RD 1ITMA 3DGCL 2O27A 1A7MA 1FYHA 1BGEA 1M4AA 3OQ3A 1RHGA 1PW6A 2O26A 1PVHB 3VA2A 1BCNA 1AU1A 1RW5A 3QWRB 1IL6A 1ILKA 1M4RA 1HZIA 1BBNA 2B91A 1HWHA 2Q7NB 3NCBA 4NI7A 3DLQI 1CSGA 3INKC 3NCEA 1CD9A 3D48P 3NCFA 1GNCA 4I77Z 1LK3A 1BGDA 2CYKA 1Y6KL 2ILKA 2LAGA 4YQXA 3SE3B 1AX8A 1RFBA 5D70A 5FHXA 3L5WI 1P9MB 1B5LA 1EERA 1M4CA 4O6KA 1ITLA 1AXIA 2B90A 1ITFA 2E9WC 1VLKA 3QB1A 1EKUA 3LB6A 1V7NV 2HYMB 4CNIC 3QT2C 1Y6NL 4YUEC 3PIWA 1BUYA 3SE4B 3BPNA 3D85C 1IRLA 2D9QA 4J4LC 2L3YA 5D22A 4DOHA 4ZF7A 1Z92A 1HGUA 1JLIA 3B5KA 5E4EA 4GRWA 3NPZA 1I1RB 3G6DA 1N1FA 4X51A 2INTA 1ALUA 2GMFA 1D9GA 1BP3A 5KNHI 1KF9A 1D9CA 3PIVA 2IL6A 4RS1A 4YDYI 3BPLA 1HIKA 1V7MV 3NCCA 3S9DA 1HWGA 1F6FA 1Z7CA 5D72A 3WCYI 1INRA 1ITIA 1A22A 1M4BA 1ETEA 3UEZE 3UX9A 3LB6B 1M47A 1EXZA 3Q1SI 2L3OA 2B8ZA 1IJZA 5D28B 5FUCA 2B8YA 1CN4C 1HUWA 3BPOA 1LQSL 3D87A 1Y6ML 3UF5A 4NEMA 1HIJA 3HHRA
chains in the Genus database with same CATH superfamily
3N0PA 3HMXB 1IK0A 4BXXD 5D58A 2LMSA 2B8UA 3H3VE 1PV7A 1WU3I 4PYPA 1EMRA 1LKIA 1QVNA 1HULA 1PV6A 1Y14A 2H24A 1Y1WD 1NBPA 1GA3A 1F45B 4YPGC 4O9HA 2B5IA 4U4TA 1PW6A 4IKVA 4OAAA 2Q7NB 3NCBA 4NI7A 4BY7D 3DLQI 3H0GD 1LK3A 4A3GD 3FKID 4YQXA 2JA6D 3SE3B 2O6IA 5IP9D 1AX8A 4GBYA 1P9MB 2B90A 3LB6A 1V7NV 5C4XD 3PIWA 5TS9A 3BPNA 5D22A 3B5KA 5E4EA 5D6KA 1N1FA 4X51A 4NN6A 2PSMA 1D9GA 1BP3A 5KNHI 4A3BD 1HIKA 2V8NA 1F6FA 3AYHA 5D72A 4QIQA 1ITIA 2B63D 3UEZE 4XNJA 3IRHA 4IKWA 3HHCA 5FUCA 2B8YA 4W6VA 3HHRA 1BGCA 3O7PA 5D59A 4EXPA 1M48A 4A3ED 2VUMD 3UF2A 5LQBA 3HOYD 4WRLB 5IYCD 5C7XA 4PS4A 4YB9D 4LRLA 4NI9A 1FG9A 4NKQC 2B8XA 4FA8E 2Z3QA 2JA5D 1PY2A 3I4ND 1ITMA 1BGEA 1M4AA 1RHGA 4TPHA 1BCNA 1AU1A 3QWRB 1ILKA 1M4RA 1CSGA 1GNCA 1BGDA 2CYKA 2ILKA 4LEPA 2Y5YA 1VLKA 5EQHA 1EKUA 4YUEC 5EQGA 4J4LC 1IRLA 5C3ED 2L3YA 4A3MD 1JLIA 3DI3A 3HOZD 1ALUA 5FLMD 4A3ID 1KF9A 3WDOA 1HWGA 4JREA 5IYBD 1Z7CA 4ZW9A 1A22A 1M4BA 1WCMD 1M47A 4D2DA 2L3OA 4A3CD 1CN4C 4U4WA 3D85C 4IKYA 4UVMA 3EJJA 3MZGA 1PGRA 2ERJD 2CFPA 5C44D 3N06A 1YKBA 2OQPA 4EXNA 4JA3A 4TPJA 1CYLA 4A3FD 3QAZA 4NN5A 2Q98A 5D71A 4A93D 1RCBA 2D48A 5IYDD 4ZWBA 3EW3A 3HOVD 4OH3A 4A3LD 2JA8D 3DGCL 2O27A 1A7MA 4IKZA 2O26A 1PVHB 3VA2A 1HZIA 1BBNA 2B91A 1HWHA 3INKC 3NCEA 1CD9A 4I77Z 1Y6KL 1RFBA 5D70A 1M4CA 4O6KA 1AXIA 4GS7A 2E9WC 1ITFA 3PO3D 4CNIC 3QT2C 5C65A 1Y6NL 2XUTA 3OG6A 4DKFA 4GC0A 3PO2D 3HOXD 4ZF7A 4Q65A 1Z92A 1HGUA 4YBQA 3G6DA 4APSA 2INTA 2GMFA 1D9CA 2IL6A 4RS1A 4YDYI 3S9DA 4D2BA 2XQBA 1Y1VD 1INRA 2CFQA 3Q1SI 4U4VA 2B8ZA 5D28B 4ZYRA 4D2CA 1LQSL 4IKXA 4MHLA 3HOUD 1IARA 4NEJA 3DUHC 1SCFA 3G9VB 1EVSA 3L5XA 3QB7A 5L6YC 2R93D 2Z3RA 2KZ1A 4ZS7A 4LDSA 5GXBA 4DKCA 3BESL 4A3JD 1CNT1 1J7VL 4A3DD 1M49A 4Z5RD 1FYHA 3OQ3A 1RW5A 1IL6A 3DI2A 4ZWCA 3HOWD 4BBSD 3D48P 3NCFA 2LAGA 5EQIA 5FHXA 4BY1D 3L5WI 1B5LA 2JA7D 1EERA 1ITLA 2R7ZD 3OG4A 3QB1A 4IU9A 4JR9A 4DKEA 4DKDA 2C35A 5IP7D 2HYMB 4NN7A 1BUYA 1PW4A 3SE4B 4DOHA 2D9QA 4XNIA 4TPGA 4GRWA 3NPZA 3TGXB 1I1RB 4IU8A 5A2OA 3PIVA 3BPLA 1V7MV 2R92D 3NCCA 3O7QA 4J05A 3WCYI 3I4MD 4BBRD 1ETEA 3UX9A 3LB6B 5A2NA 1EXZA 2Q14A 1IJZA 1HUWA 3BPOA 4A3KD 3D87A 1Y6ML 4GBZA 3UF5A 4NEMA 1HIJA
chains in the Genus database with same CATH topology
4MHLA 3N0PA 3EJJA 3MZGA 1BGCA 1PGRA 2ERJD 3HOUD 1IARA 3HMXB 4NEJA 4BXXD 3DUHC 5C44D 1SCFA 2LMSA 3G9VB 1IK0A 1EVSA 4EXPA 3L5XA 3N06A 2B8UA 3QB7A 5L6YC 3H3VE 1YKBA 2R93D 2OQPA 1M48A 2Z3RA 1WU3I 4EXNA 4A3ED 1EMRA 1LKIA 2VUMD 1QVNA 3UF2A 1HULA 1CYLA 5LQBA 2KZ1A 4A3FD 1Y14A 4ZS7A 3HOYD 4WRLB 3QAZA 5IYCD 2H24A 4NN5A 1Y1WD 2Q98A 5C7XA 4PS4A 1NBPA 5D71A 4DKCA 4A93D 3BESL 1F45B 1RCBA 2D48A 1GA3A 5IYDD 4LRLA 4YPGC 4A3JD 4NI9A 4O9HA 1CNT1 1J7VL 1FG9A 3EW3A 4NKQC 2B8XA 4FA8E 2B5IA 3HOVD 2Z3QA 2JA5D 4A3DD 1PY2A 3I4ND 1M49A 4A3LD 2JA8D 4Z5RD 1ITMA 3DGCL 2O27A 1A7MA 1FYHA 1BGEA 1M4AA 3OQ3A 1RHGA 1PW6A 2O26A 1PVHB 3VA2A 1BCNA 1AU1A 1RW5A 3QWRB 1IL6A 1ILKA 1M4RA 1HZIA 3DI2A 1BBNA 2B91A 1HWHA 2Q7NB 3HOWD 3NCBA 4BBSD 4NI7A 4BY7D 3DLQI 1CSGA 3INKC 3NCEA 1CD9A 3D48P 3NCFA 1GNCA 4I77Z 3H0GD 1LK3A 4A3GD 1BGDA 2CYKA 1Y6KL 2ILKA 2LAGA 2O6IA 3FKID 1AX8A 4YQXA 1RFBA 5D70A 5FHXA 3SE3B 5IP9D 4BY1D 3L5WI 1P9MB 1B5LA 2JA7D 1EERA 1M4CA 4O6KA 1ITLA 1AXIA 2B90A 2R7ZD 4GS7A 2E9WC 1ITFA 3OG4A 1VLKA 3QB1A 3PO3D 1EKUA 4DKEA 4DKDA 3LB6A 1V7NV 2C35A 2JA6D 5C4XD 5IP7D 2HYMB 4CNIC 3QT2C 1Y6NL 4YUEC 3PIWA 4NN7A 1BUYA 3OG6A 4DKFA 3SE4B 5TS9A 3BPNA 3PO2D 3D85C 1IRLA 2D9QA 4J4LC 2L3YA 5D22A 4DOHA 4ZF7A 5C3ED 3HOXD 4A3MD 1Z92A 1HGUA 1JLIA 3B5KA 5E4EA 4GRWA 3NPZA 3TGXB 1I1RB 3DI3A 3G6DA 1N1FA 4X51A 4NN6A 2INTA 2PSMA 3HOZD 1ALUA 2GMFA 5FLMD 1D9GA 1BP3A 5KNHI 1KF9A 1D9CA 3PIVA 2IL6A 4A3ID 4A3BD 4RS1A 4YDYI 3BPLA 1HIKA 1V7MV 2R92D 3NCCA 3S9DA 1HWGA 1F6FA 5IYBD 1Z7CA 3AYHA 5D72A 2XQBA 1Y1VD 3WCYI 3I4MD 4BBRD 1INRA 1ITIA 1A22A 1M4BA 1WCMD 1ETEA 3UEZE 2B63D 3UX9A 3LB6B 1M47A 1EXZA 3IRHA 2Q14A 3Q1SI 2L3OA 2B8ZA 3HHCA 1IJZA 5D28B 5FUCA 4A3CD 2B8YA 1CN4C 1HUWA 3BPOA 1LQSL 3D87A 4A3KD 1Y6ML 3UF5A 4NEMA 1HIJA 3HHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHL A;  3N0P A;  3EJJ A;  3MZG A;  1BGC A;  1PGR A;  2ERJ D;  1IAR A;  3HMX B;  4NEJ A;  1IK0 A;  3DUH C;  1SCF A;  2LMS A;  3G9V B;  1EVS A;  3L5X A;  3N06 A;  2B8U A;  3QB7 A;  5L6Y C;  1YKB A;  1M48 A;  1WU3 I;  1EMR A;  1LKI A;  1QVN A;  3UF2 A;  1HUL A;  1CYL A;  5LQB A;  2KZ1 A;  4ZS7 A;  4WRL B;  3QAZ A;  2H24 A;  2Q98 A;  5C7X A;  4PS4 A;  1NBP A;  5D71 A;  3BES L;  1F45 B;  1RCB A;  2D48 A;  1GA3 A;  4YPG C;  4NI9 A;  4O9H A;  1CNT 1;  1J7V L;  1FG9 A;  3EW3 A;  4NKQ C;  2B8X A;  4FA8 E;  2B5I A;  1PY2 A;  1M49 A;  4Z5R D;  1ITM A;  3DGC L;  2O27 A;  1A7M A;  1FYH A;  1BGE A;  1M4A A;  3OQ3 A;  1RHG A;  1PW6 A;  2O26 A;  1PVH B;  3VA2 A;  1BCN A;  1AU1 A;  1RW5 A;  3QWR B;  1IL6 A;  1ILK A;  1M4R A;  1HZI A;  1BBN A;  2B91 A;  1HWH A;  2Q7N B;  3NCB A;  4NI7 A;  3DLQ I;  1CSG A;  3INK C;  3NCE A;  1CD9 A;  3D48 P;  3NCF A;  1GNC A;  4I77 Z;  1LK3 A;  1BGD A;  2CYK A;  1Y6K L;  2ILK A;  2LAG A;  4YQX A;  3SE3 B;  1AX8 A;  1RFB A;  5D70 A;  5FHX A;  3L5W I;  1P9M B;  1B5L A;  1EER A;  1M4C A;  4O6K A;  1ITL A;  1AXI A;  2B90 A;  1ITF A;  2E9W C;  1VLK A;  3QB1 A;  1EKU A;  3LB6 A;  1V7N V;  2HYM B;  4CNI C;  3QT2 C;  1Y6N L;  4YUE C;  3PIW A;  1BUY A;  3SE4 B;  3BPN A;  3D85 C;  1IRL A;  2D9Q A;  4J4L C;  2L3Y A;  5D22 A;  4DOH A;  4ZF7 A;  1Z92 A;  1HGU A;  1JLI A;  3B5K A;  5E4E A;  4GRW A;  3NPZ A;  1I1R B;  3G6D A;  1N1F A;  4X51 A;  2INT A;  1ALU A;  2GMF A;  1D9G A;  1BP3 A;  5KNH I;  1KF9 A;  1D9C A;  3PIV A;  2IL6 A;  4RS1 A;  4YDY I;  3BPL A;  1HIK A;  1V7M V;  3NCC A;  3S9D A;  1HWG A;  1F6F A;  1Z7C A;  5D72 A;  3WCY I;  1INR A;  1ITI A;  1A22 A;  1M4B A;  1ETE A;  3UEZ E;  3UX9 A;  3LB6 B;  1M47 A;  1EXZ A;  3Q1S I;  2L3O A;  2B8Z A;  1IJZ A;  5D28 B;  5FUC A;  2B8Y A;  1CN4 C;  1HUW A;  3BPO A;  1LQS L;  3D87 A;  1Y6M L;  3UF5 A;  4NEM A;  1HIJ A;  3HHR A; 
#chains in the Genus database with same CATH topology
 3N0P A;  3HMX B;  1IK0 A;  4BXX D;  5D58 A;  2LMS A;  2B8U A;  3H3V E;  1PV7 A;  1WU3 I;  4PYP A;  1EMR A;  1LKI A;  1QVN A;  1HUL A;  1PV6 A;  1Y14 A;  2H24 A;  1Y1W D;  1NBP A;  1GA3 A;  1F45 B;  4YPG C;  4O9H A;  2B5I A;  4U4T A;  1PW6 A;  4IKV A;  4OAA A;  2Q7N B;  3NCB A;  4NI7 A;  4BY7 D;  3DLQ I;  3H0G D;  1LK3 A;  4A3G D;  3FKI D;  4YQX A;  2JA6 D;  3SE3 B;  2O6I A;  5IP9 D;  1AX8 A;  4GBY A;  1P9M B;  2B90 A;  3LB6 A;  1V7N V;  5C4X D;  3PIW A;  5TS9 A;  3BPN A;  5D22 A;  3B5K A;  5E4E A;  5D6K A;  1N1F A;  4X51 A;  4NN6 A;  2PSM A;  1D9G A;  1BP3 A;  5KNH I;  4A3B D;  1HIK A;  2V8N A;  1F6F A;  3AYH A;  5D72 A;  4QIQ A;  1ITI A;  2B63 D;  3UEZ E;  4XNJ A;  3IRH A;  4IKW A;  3HHC A;  5FUC A;  2B8Y A;  4W6V A;  3HHR A;  1BGC A;  3O7P A;  5D59 A;  4EXP A;  1M48 A;  4A3E D;  2VUM D;  3UF2 A;  5LQB A;  3HOY D;  4WRL B;  5IYC D;  5C7X A;  4PS4 A;  4YB9 D;  4LRL A;  4NI9 A;  1FG9 A;  4NKQ C;  2B8X A;  4FA8 E;  2Z3Q A;  2JA5 D;  1PY2 A;  3I4N D;  1ITM A;  1BGE A;  1M4A A;  1RHG A;  4TPH A;  1BCN A;  1AU1 A;  3QWR B;  1ILK A;  1M4R A;  1CSG A;  1GNC A;  1BGD A;  2CYK A;  2ILK A;  4LEP A;  2Y5Y A;  1VLK A;  5EQH A;  1EKU A;  4YUE C;  5EQG A;  4J4L C;  1IRL A;  5C3E D;  2L3Y A;  4A3M D;  1JLI A;  3DI3 A;  3HOZ D;  1ALU A;  5FLM D;  4A3I D;  1KF9 A;  3WDO A;  1HWG A;  4JRE A;  5IYB D;  1Z7C A;  4ZW9 A;  1A22 A;  1M4B A;  1WCM D;  1M47 A;  4D2D A;  2L3O A;  4A3C D;  1CN4 C;  4U4W A;  3D85 C;  4IKY A;  4UVM A;  3EJJ A;  3MZG A;  1PGR A;  2ERJ D;  2CFP A;  5C44 D;  3N06 A;  1YKB A;  2OQP A;  4EXN A;  4JA3 A;  4TPJ A;  1CYL A;  4A3F D;  3QAZ A;  4NN5 A;  2Q98 A;  5D71 A;  4A93 D;  1RCB A;  2D48 A;  5IYD D;  4ZWB A;  3EW3 A;  3HOV D;  4OH3 A;  4A3L D;  2JA8 D;  3DGC L;  2O27 A;  1A7M A;  4IKZ A;  2O26 A;  1PVH B;  3VA2 A;  1HZI A;  1BBN A;  2B91 A;  1HWH A;  3INK C;  3NCE A;  1CD9 A;  4I77 Z;  1Y6K L;  1RFB A;  5D70 A;  1M4C A;  4O6K A;  1AXI A;  4GS7 A;  2E9W C;  1ITF A;  3PO3 D;  4CNI C;  3QT2 C;  5C65 A;  1Y6N L;  2XUT A;  3OG6 A;  4DKF A;  4GC0 A;  3PO2 D;  3HOX D;  4ZF7 A;  4Q65 A;  1Z92 A;  1HGU A;  4YBQ A;  3G6D A;  4APS A;  2INT A;  2GMF A;  1D9C A;  2IL6 A;  4RS1 A;  4YDY I;  3S9D A;  4D2B A;  2XQB A;  1Y1V D;  1INR A;  2CFQ A;  3Q1S I;  4U4V A;  2B8Z A;  5D28 B;  4ZYR A;  4D2C A;  1LQS L;  4IKX A;  4MHL A;  3HOU D;  1IAR A;  4NEJ A;  3DUH C;  1SCF A;  3G9V B;  1EVS A;  3L5X A;  3QB7 A;  5L6Y C;  2R93 D;  2Z3R A;  2KZ1 A;  4ZS7 A;  4LDS A;  5GXB A;  4DKC A;  3BES L;  4A3J D;  1CNT 1;  1J7V L;  4A3D D;  1M49 A;  4Z5R D;  1FYH A;  3OQ3 A;  1RW5 A;  1IL6 A;  3DI2 A;  4ZWC A;  3HOW D;  4BBS D;  3D48 P;  3NCF A;  2LAG A;  5EQI A;  5FHX A;  4BY1 D;  3L5W I;  1B5L A;  2JA7 D;  1EER A;  1ITL A;  2R7Z D;  3OG4 A;  3QB1 A;  4IU9 A;  4JR9 A;  4DKE A;  4DKD A;  2C35 A;  5IP7 D;  2HYM B;  4NN7 A;  1BUY A;  1PW4 A;  3SE4 B;  4DOH A;  2D9Q A;  4XNI A;  4TPG A;  4GRW A;  3NPZ A;  3TGX B;  1I1R B;  4IU8 A;  5A2O A;  3PIV A;  3BPL A;  1V7M V;  2R92 D;  3NCC A;  3O7Q A;  4J05 A;  3WCY I;  3I4M D;  4BBR D;  1ETE A;  3UX9 A;  3LB6 B;  5A2N A;  1EXZ A;  2Q14 A;  1IJZ A;  1HUW A;  3BPO A;  4A3K D;  3D87 A;  1Y6M L;  4GBZ A;  3UF5 A;  4NEM A;  1HIJ A; 
#chains in the Genus database with same CATH homology
 4MHL A;  3N0P A;  3EJJ A;  3MZG A;  1BGC A;  1PGR A;  2ERJ D;  3HOU D;  1IAR A;  3HMX B;  4NEJ A;  4BXX D;  3DUH C;  5C44 D;  1SCF A;  2LMS A;  3G9V B;  1IK0 A;  1EVS A;  4EXP A;  3L5X A;  3N06 A;  2B8U A;  3QB7 A;  5L6Y C;  3H3V E;  1YKB A;  2R93 D;  2OQP A;  1M48 A;  2Z3R A;  1WU3 I;  4EXN A;  4A3E D;  1EMR A;  1LKI A;  2VUM D;  1QVN A;  3UF2 A;  1HUL A;  1CYL A;  5LQB A;  2KZ1 A;  4A3F D;  1Y14 A;  4ZS7 A;  3HOY D;  4WRL B;  3QAZ A;  5IYC D;  2H24 A;  4NN5 A;  1Y1W D;  2Q98 A;  5C7X A;  4PS4 A;  1NBP A;  5D71 A;  4DKC A;  4A93 D;  3BES L;  1F45 B;  1RCB A;  2D48 A;  1GA3 A;  5IYD D;  4LRL A;  4YPG C;  4A3J D;  4NI9 A;  4O9H A;  1CNT 1;  1J7V L;  1FG9 A;  3EW3 A;  4NKQ C;  2B8X A;  4FA8 E;  2B5I A;  3HOV D;  2Z3Q A;  2JA5 D;  4A3D D;  1PY2 A;  3I4N D;  1M49 A;  4A3L D;  2JA8 D;  4Z5R D;  1ITM A;  3DGC L;  2O27 A;  1A7M A;  1FYH A;  1BGE A;  1M4A A;  3OQ3 A;  1RHG A;  1PW6 A;  2O26 A;  1PVH B;  3VA2 A;  1BCN A;  1AU1 A;  1RW5 A;  3QWR B;  1IL6 A;  1ILK A;  1M4R A;  1HZI A;  3DI2 A;  1BBN A;  2B91 A;  1HWH A;  2Q7N B;  3HOW D;  3NCB A;  4BBS D;  4NI7 A;  4BY7 D;  3DLQ I;  1CSG A;  3INK C;  3NCE A;  1CD9 A;  3D48 P;  3NCF A;  1GNC A;  4I77 Z;  3H0G D;  1LK3 A;  4A3G D;  1BGD A;  2CYK A;  1Y6K L;  2ILK A;  2LAG A;  2O6I A;  3FKI D;  1AX8 A;  4YQX A;  1RFB A;  5D70 A;  5FHX A;  3SE3 B;  5IP9 D;  4BY1 D;  3L5W I;  1P9M B;  1B5L A;  2JA7 D;  1EER A;  1M4C A;  4O6K A;  1ITL A;  1AXI A;  2B90 A;  2R7Z D;  4GS7 A;  2E9W C;  1ITF A;  3OG4 A;  1VLK A;  3QB1 A;  3PO3 D;  1EKU A;  4DKE A;  4DKD A;  3LB6 A;  1V7N V;  2C35 A;  2JA6 D;  5C4X D;  5IP7 D;  2HYM B;  4CNI C;  3QT2 C;  1Y6N L;  4YUE C;  3PIW A;  4NN7 A;  1BUY A;  3OG6 A;  4DKF A;  3SE4 B;  5TS9 A;  3BPN A;  3PO2 D;  3D85 C;  1IRL A;  2D9Q A;  4J4L C;  2L3Y A;  5D22 A;  4DOH A;  4ZF7 A;  5C3E D;  3HOX D;  4A3M D;  1Z92 A;  1HGU A;  1JLI A;  3B5K A;  5E4E A;  4GRW A;  3NPZ A;  3TGX B;  1I1R B;  3DI3 A;  3G6D A;  1N1F A;  4X51 A;  4NN6 A;  2INT A;  2PSM A;  3HOZ D;  1ALU A;  2GMF A;  5FLM D;  1D9G A;  1BP3 A;  5KNH I;  1KF9 A;  1D9C A;  3PIV A;  2IL6 A;  4A3I D;  4A3B D;  4RS1 A;  4YDY I;  3BPL A;  1HIK A;  1V7M V;  2R92 D;  3NCC A;  3S9D A;  1HWG A;  1F6F A;  5IYB D;  1Z7C A;  3AYH A;  5D72 A;  2XQB A;  1Y1V D;  3WCY I;  3I4M D;  4BBR D;  1INR A;  1ITI A;  1A22 A;  1M4B A;  1WCM D;  1ETE A;  3UEZ E;  2B63 D;  3UX9 A;  3LB6 B;  1M47 A;  1EXZ A;  3IRH A;  2Q14 A;  3Q1S I;  2L3O A;  2B8Z A;  3HHC A;  1IJZ A;  5D28 B;  5FUC A;  4A3C D;  2B8Y A;  1CN4 C;  1HUW A;  3BPO A;  1LQS L;  3D87 A;  4A3K D;  1Y6M L;  3UF5 A;  4NEM A;  1HIJ A;  3HHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...