4ZFOA

J22.9-xi: chimeric mouse/human antibody against human bcma (cd269)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
215
Chain Sequence
QVQLQQSGGGLVQPGGSLKLSCAASGIDFSRYWMSWVRRAPGKGLEWIGEINPDSSTINYAPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCASLYYDYGDAMDYWGQGTSVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 17
publication title Potent anti-tumor response by targeting B cell maturation antigen (BCMA) in a mouse model of multiple myeloma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 215
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfoA01
4X6EA 2L0DA 2DI8A 1DQMH 2C1PA 1SM3L 4Y4KB 3ARPA 1BZQK 2DMCA 2EDNA 4GS7B 4P5TC 1J0HA 3ARXA 4ZPVA 4KKLC 9CGTA 3BKYL 1IC5L 1CVRA 2DKUA 1F4XH 3JV0A 4MB3A 4OZFA 4LBEB 4K3JL 1N2RA 3QQ4A 4IMKA 4BQ8A 5DJYB 2GJ6B 1NEUA 1UVQA 3EYSL 3AB0B 4OLWH 2AJSH 4LP4A 5I15L 4HUNB 4XBPA 3VFUA 2GSIB 4YC2B 5IEKB 3UBXG 3CK0H 4M4PA 4UIKL 2FEDC 5GGUB 1A7OL 5E6ZA 5FM5M 1WK0A 3LQZA 3WIHH 3D69B 5L0QC 5EUOB 5IMKA 4PGBB 1CL7H 4HKZB 4M7LT 4DKAA 4POZD 3DO7B 5CIPB 4KH2A 2EYSB 2W9DL 2NY4D 3B6SA 4S2SB 3V0WL 5KJRL 2P8LA 1KELL 3SCMC 3G5XA 4G8EB 3C5ZA 5ERWB 1ZA3A 2AQ1A 3HNTL 4ODXB 2FLBT 4PS4H 4P23A 4JLRA 4JFZL 2BVUA 3BXNB 4ZD3H 2V2XA 2N7BA 3NCYS 4QHKJ 2IMNA 4F3FB 4NHUA 1ND0B 2X4NB 3OQ3B 3U9PH 1PAMA 5CBEB 2CD0A 3OX8A 1E4KA 1A4JB 2UZIH 4HLZH 3OSKA 1X6NA 5FA3A 1CLCA 5K9JH 4KMQA 3ARZA 5BXFB 5I1EL 2BNRD 4OZGB 1IGMH 1P69B 5CP7A 5FHBL 4WY7H 3UTOA 1U8MB 4ESKA 4AYFA 2Q3ZA 1JGEA 2OTWB 4RMQA 3L5IA 3QFDB 3LD8B 4KI1A 4OFKA 1FO0B 1Q94B 3G6AA 1WFOA 1BOGA 1X5KA 1G7PA 1NMCC 3V4VL 4N9OB 3STBA 3UC0L 3DV4B 5KG9B 3MRIB 2P44B 2E9IA 3DI3B 4XAWL 3DVNB 3TVMA 3HRZB 3L5JA 5FM8A 5C09B 1B6UA 3QEGH 3QDGD 2NY1B 4M7LL 5CZXD 4R2GD 4WU7B 1ADQA 1DBBH 1S7XA 4HW6A 3FOMA 3HE7D 5HHVH 5C0CA 1YYLH 1IGIL 3VXUE 3OKLB 1UYWL 2VAJA 3JVGC 4ELKB 2EIZB 2XWTB 4ZAKB 3Q6GL 3N85L 5JIPA 5D7IB 1QR1B 3PHOB 2GCYB 4JRXB 4BH8B 5IB2A 3DIFB 3VGHA 1QBBA 4KMLB 2FO1A 1BBJA 5I74B 2QQKH 1DBKL 3PV6A 4DJMA 3C2AH 1VA9A 4W4NA 1C16B 1F90L 1I3RB 2IH3B 2O5YL 1CXLA 2DBJA 5DRWB 1YJDL 3H3PH 2XQBL 3BAEH 1IM9D 1MJ8H 5GGSA 1FVEB 2COQA 2P5EE 1XGRB 3T0XA 2FGZA 3STZB 2ADGA 1AQDB 3BWUC 3KHOA 1YMMA 3MRKA 4UT6L 3MCLH 1IAIM 5CZVH 4POUB 2I9LA 3OB0H 4LSVH 5F70A 2BOCA 1X6LA 3BP5A 3ALXA 3GUTB 1HKLH 1TENA 3IF1A 4HQQH 5D1QD 1OSZA 1P9MC 1CD9B 4OGYL 4NQCB 3QQ3A 4OCWL 1FVCB 4XTRD 3GHBH 5INCA 3BGFC 1Q0XL 4G80A 2NY3D 5C2UB 3IDGB 3MOQA 3ARYA 1T1WA 4RFNC 4ZUTB 3HN3A 4PJ5E 1E4WH 3WUWG 2N1KA 4N0YH 3MREA 4YQXH 4ORZC 2V5MA 4NKIL 4PBVC 4NQDB 2ZJSH 4JFQB 3F58L 2ZOKB 1LO3H 3IXTA 4LVOC 1H8SA 3VXMA 3D0LB 5ENWA 4EVNA 2AI0L 2VLRA 2DAVA 3KAAA 3QSKB 1I8MA 5JHDA 1TNNA 4G9DA 1YEEL 2G5BB 1XF4B 3KYKL 4MD4B 4FQHA 3T2OA 1BFVL 5DK2A 5KSAA 1N8ZB 4KJQC 1JPGB 4U1JB 3VWKA 3FOLA 1T21B 6CGTA 4XWGL 3WFCH 1KCLA 4R7NA 3U0PA 2AEQH 3JTSB 2VL5B 5TQ0L 3V5DA 2ESVA 1MI5E 5I1CL 2APVA 4XPFL 4OGAC 4MXWH 3RZCA 3SKJH 1FL5A 1NFKA 2KDGA 2GFBB 5HDQL 3CD4A 3MSPA 4U1LB 2CUHA 1MCQA 3MLVH 5D1ZD 3SPVB 3QCVL 4N9GB 4WO4A 4WIQA 3LN4A 3EAKA 4L3CB 1DANU 5BS0B 4N8VA 4KTDL 3S3JA 3UJTH 1NFDF 1CFSA 4X4YB 1C5CL 3MLZL 1QSVA 1ZLWK 5D2LA 1MOEA 2SEBB 4OTXH 2V7NB 1A8JH 3CDGA 3MNVB 1J0IA 4KTYA 4LSDA 4F7EA 2WINA 5JZ7D 4HT1L 1G7MA 1TCMA 5D7LB 4E42A 5HYSG 1LEGA 1W72A 4XVJH 1IGFH 1U6AH 2DQHL 4IOSD 4YUEL 4NN6C 1I85A 4F15C 3TP4A 1PZUB 4PLKC 3AXLA 1B9ZA 3P11L 5IG7A 5DJDA 2IPKA 3D6GA 3PWVA 1NBVH 4N8PA 1AXIB 3IU3B 5J3HD 1FNEB 3E3QE 3EZJB 4I8DA 4NBYB 2LV4A 1TZIA 1LK3L 1AKJB 3UO1L 5DYOA 3MBXL 2J8UB 5DQDL 1A1OB 2OL3L 4N5UA 4P2OA 3MV01 4KDTA 4NQSB 5K33A 4DZBB 1IAOA 1RZ7L 1ORSB 4OZGF 1FLTX 3DVFA 3I6LE 1MUJB 4FXGA 2E6JA 3QNYB 3CC5A 4LVOB 4BZ2L 3B2UC 4G6JH 3THML 1MAJA 1FFPB 1JNHA 1G6RA 3QNZA 2D7OA 2G60H 4QHMB 4XPBL 4D0CB 3SDAC 2GT9B 2GEEA 1UXSA 3MV8B 4NSKA 4Z0BH 4ZSOB 2R15A 3MZGB 3ALPA 1UCBH 4QRPB 1YEDA 4J4PC 5FOBB 2VXVL 3VH8G 1WFTA 3QIUB 3CUPB 4F33B 4FNLH 1IILE 2X1QA 1OAZL 4DVBA 1J8HE 4LSUH 2XN9A 4MVBC 5CJOH 3MOAH 2C5DC 2OR8A 4LQFL 4WV1C 4RGOH 3AREB 1KLGB 2HKFL 2R4RH 3KWWB 3L9RB 3QHZH 5J7CC 5D7IF 3WJLC 4PLJC 5ILTH 1CF8H 3SN6N 3EYQC 4BUGA 3PG2A 5HGHB 1FHGA 5HSFA 1SBSL 3VWJD 3TYGH 1MVUB 3EYOB 3TA3B 1A47A 1RK0B 1FZOB 1ULVA 4WTZG 3F7RA 4LSRH 3BFOA 2ZKHH 3SGDH 4G7YL 4Z7UF 3EIFA 3RKDC 4JHBA 2FO4B 2WNGA 4NJ9H 5F3BB 4GKZB 4MDJB 4K2UH 1MHCA 4CJ0A 2RCSL 4UBDD 2YEZA 4LBEA 4N68A 5DJYA 3MR9B 3O2DL 2H2SD 4X7DC 1MFBL 3NABH 4QY8A 4G8IA 3ULUC 4GKNB 2VDQL 4Q6IB 1NFDA 4Z7OF 5JW4M 1P7KB 2ARJA 1QD0A 4JFHE 4K8RL 4PGBA 5HDBF 1CICA 4KDWA 3UROR 1PEWA 1XF3A 3DO7A 3GFUA 1SJHB 4GOSA 4FQ2L 2J6EL 4S2SA 4XMLL 2PTUA 3C6LA 1MY7A 5F1NB 2F19H 3HC4L 3QEQE 4NNPL 5SX4I 4G8EA 3MGTB 2Y6SD 4FZ8L 1OTTC 5E2TL 5E6ID 4Z6AT 3WKMH 5DFWH 3SDAB 3C6SA 5FYKL 1J86A 3U79A 2I9TA 3T2PA 2F53B 4IRZL 3K4ZA 5FEBA 1S7QB 1A6AA 3HI5L 3B9KC 4F3FA 4YXHH 2BVYA 2PXYA 4YHZH 2IQ9H 5GJTH 2X4NA 5JHLH 2R9HD 5ICYA 5CBEA 1IMHC 4HHAB 4JO4H 5C6TH 3WFDH 3Q5OA 5HGDB 5C7XH 3AS2A 1A0QL 4TSBL 2DQTH 2R2EB 1I7ZA 2R1YA 4C56D 4OZGA 4HFWB 3EDJA 1TZGH 1U8MA 1A6UH 3HC0B 1TVDA 1BJ8A 5IWLC 2YD1A 3GSNL 5I1KH 1Q94A 1U91B 4RWHA 4LEOB 1LDPH 1T4KB 3L1OH 3MA9L 3DV4A 3O6FA 4K7PX 4LCIL 5SWZB 3ULSA 1QSFE 3DPBA 3DVNA 3T08A 4F8QA 4NKDB 2NX5E 3SKOA 3NFSL 1CGTA 4GAJH 2OLDA 2IGFH 4UINH 1AXSB 2NYYC 3H9YA 3QXDB 5C09A 4XP4L 5IB4A 1IC7H 4WI4A 1A9EB 2H32H 4YLQT 3OF6A 3GI8L 4AEHH 3RBSA 3E8UH 4JFED 3OKLA 4EN3B 3HA0A 3LB6D 4ZAKA 1QR1A 5I76B 3MA7B 2DM2A 3AVEA 3P9MB 5D6DA 1FGNL 3T3MF 2IPUG 4KRMB 3DIFA 4MCZB 4G6MH 1L7TH 3PWPD 3U1SH 4YDIH 1T5WB 4P0DA 1C16A 1L0YA 2J8UF 4P9HC 4D0DB 5JOFA 1NMAL 3GSVB 4P4KD 3QDAA 3TZVD 4NOFA 5EUKA 1N7MH 4Z7UA 2LTQB 5CMAA 4GBXC 4PJ5D 3MXVL 3OKDB 2FATH 4TYUA 4L8DB 3STZA 5I30H 2EICA 5DHVA 2CKBA 4K9EH 3NACL 1OD9A 4PJXB 3ZE2E 4NKMB 2RAMA 3P30L 3BPNC 4ONHA 5GIRB 3MLSH 3B9KB 5FB8A 3GUTA 3D85B 3H9SD 5GRJL 1T89A 5I1HL 1LWRA 4NJAH 5IW6A 4HS8L 5IUSA 1NEZA 5ESQB 2XY1A 4RQQB 1QFUH 5KVGH 1WJ3A 1FVCA 3QIWC 2WZPD 4M6NH 4H88H 3IAGC 1QLFA 2ZCHL 1H3PL 5B38B 2Z8SA 4NCC2 4OQTA 3UTSD 1QHOA 4ZUTA 3V6ZB 4PGDA 1WT5C 5IQ7L 1A3RH 3CH8A 3T4AA 5HPMB 3FQTB 4JKPL 1R5IB 3OR7B 4PJHE 4JJ5A 1HCVA 1NGQH 3C5ZC 1O7VA 2AK1L 1I8IB 2IH1B 2L4OA 4HK0B 4HWUA 4A6YL 3D0LA 4O02L 3H3BC 1A14H 4P23C 4UUJA 2JCCE 3P0VL 2G5BA 4LLYA 3ZYOA 4MD4A 1Q1JL 1YY8B 3O6KL 4PGCB 3RTQA 4AZ8A 5EO1B 2ZUVA 3LEVH 4L4JA 3H7LA 4UTBL 3IFLH 2EDKA 5AZ2H 4CVUA 2OSLA 2VL5A 4ZUUB 3WDHA 3D39A 5TFSL 1L9MA 4JZNA 3LIZL 4DQOL 1I7UA 2VLKA 4HS6B 4XNMB 4LCWD 1E6JL 1MCKA 4MNQB 4U1LA 4U1SB 5TE4L 5J0BA 3PF2A 5EC1A 2YUXA 4OBRA 4PG9B 5E2WH 1H8OA 3WHE0 2H26A 3VXPB 4L3CA 3P0YH 3B2VH 3CGTA 1R3LB 3RX5A 4X4YA 2B4CH 1QZ1A 4OLVH 1FLRL 3UPRA 1U3HD 1MCWM 5KAQG 2V7NA 4M62L 1XH3B 4GBXB 4HGWA 3TVMC 1DQQB 4UIMB 5ISZB 3QG6A 3OAUH 2CO7B 4OCSL 3PIQB 1BQLL 1AP2B 3BPNB 2MMXA 4M7KH 5AYUL 4HJJH 2X4RB 5BMFL 3D9AL 3PWNB 4GRLA 4OZHE 5T3XL 4OZIA 4N5EC 2B2XH 1U42A 1IM9B 3CDCA 4HWEH 5L2KE 3K1DA 3O2WL 3RI5F 2PO6C 4S10A 12E8H 1HHHA 1YPZF 5I0ZA 3QFJD 3QIWB 2P5WB 4M03A 1HWHB 1FDLH 4OFYA 3BKCL 2VTFA 1CQYA 5IF0B 4MAYA 2HLAA 1VFUA 4PRNA 4ODHH 4BQ9A 1W2KT 4CU8A 2BHZA 3L3OB 3NZHL 3QDMA 5D1QB 3ZDYE 1AKJA 2AXFB 3GEWB 1KBGL 1CTOA 4RRPG 5E2UL 5C9JB 5C0AE 2AKRA 1A1OA 4P46D 2R8SH 2O61B 3UJJL 3TJEL 2EDLA 3H8NA 1J8HD 3FQNB 2O5ZH 1AGEA 1ORSA 3GO1H 1Z9OA 2F5AH 5DZLA 2H8PB 4YHYC 3GM0A 3REWA 3EKCA 3VRIB 3NOIA 4FQCL 4JDTL 2RQ8A 3CNKA 4GUPA 4KI5F 2MCPL 4W6YB 2WUBH 4QHMA 1YQVL 4Y19A 3UTTB 4GW4B 1A6PA 2AK4E 1U58B 3MV8A 4XP1L 4O51A 4HCRA 4ZSOA 1S7SB 3SDDD 3LKQB 2Z92B 4QRPA 4LDEB 5E8NB 1KIRA 3GB7A 1J88A 3FFDB 5A2LH 4YDKL 4NGHL 2OJZL 2LU7A 3OXRB 1DSFL 1AO7B 1WZLA 3IETB 3GIVA 3FMGL 3OR6B 1FBIH 5EU6E 5DJXB 3FKUS 1T22B 1OPGL 1YYMH 3AREA 1UACH 4ODSH 1T2QH 3ARRA 4U1NA 3GMRA 1FNLA 5HGHA 5A3ID 4I9WE 5GHWH 5IJVA 2NY0C 2J4WH 5CP3A 3HAEG 3EYOA 1KC5L 4PYHA 1RK0A 3CFBA 5HI4D 4YPJA 1L9NA 5DRNA 4QKXB 1NFIA 2W0FB 1I7RA 3AY4C 3N06B 1HNGA 2P7TB 3H7BA 2HTKD 2A9MH 2VDML 2DQCL 3KS0J 5L8JB 4KTEH 4HUKB 3QEHB 3RY6A 1UXWB 4NNYA 1W0WA 1NUDA 2ZUUA 2C9AA 1N5YH 3QUMA 5D4QA 4MDIB 4PJXF 4RFEB 3RZCC 5BZWB 2IFFL 1XR8A 3Q0HA 4PGEA 3OJDA 3HG1B 5LQBL 1LO0H 4WO4C 2DQIH 1BF8A 3TBTB 4PRPD 1MVFA 1T0MB 2P4AB 3O45B 4GKNA 1KIPB 1Q9LA 3AAZB 3QUYA 4Q6IA 5C07D 3DX6B 4O4YH 4CVXB 3V52H 1BECA 4OF5A 1R24B 3BO8A 3IXAB 1MFNA 4IRSA 5GS2D 2BNQE 3S37H 1V3MA 2DICA 2R1WA 3X14B 1E6OH 1WAAE 3IJYB 1SJHA 4H26A 2EXYC 4LARL 4DTGH 2I25N 3WD5L 1JP5A 1BFSA 1QSEA 1WUNT 2P8MA 5HHQB 1RUMH 1OP5H 3MGTA 3B5GA 3QO1B 5E1HB 2D3VA 5C6WH 3VGGA 5A16B 4ZFZB 4QRTB 3I6GB 1GOGA 3CDYA 5EPMB 3FB5A 2MHAB 1YPZA 1RIUH 2XZAL 4M48L 4LASL 1BM3H 5EIVA 4DUVA 1IBGL 3ARVA 1WFUA 4RIRB 1UM6H 5T5NG 1XEDA 2ZOLA 43C9B 2WLYA 3V5KA 4JRWA 3FO9A 4HHAA 1CGXA 2YD9A 4R4FL 4K3DL 2FIKB 2HG5A 4NDMB 3UYOD 5C0BD 2FJFA 1EUTA 2R2EA 4FMKA 3WIFA 1BWWA 4G8GD 4Q9RH 2EYRB 5JOPE 4HIXH 2X6MA 4GRMB 2VXQH 1JTTA 4FS0A 5F8QC 3R8BB 2NY0B 4FTVB 1SEQL 5JQ6L 1RJLB 5AD0A 1YN6B 1FNGA 3K8LA 4FQ1H 2NXZC 1XCQB 1D5IH 4F7PA 2VXTL 3DI2B 5SWZA 2XIDA 4R96B 1ACYH 3DETC 3ZKNC 4ONGH 4NKDA 1TZHB 4L4VE 4IDJL 3I75B 3QXDA 3VWJB 3RL1B 2IADA 4Y8DC 2H41A 1J1PH 4MXQD 5EORH 1JPFA 5GGVH 1Q72L 1BD2E 3EO0B 4IOIA 3F7YB 3GBNL 3WLWD 4MJIE 4K8RD 3L95B 4NFDA 4BSVA 1PLGL 3S34H 2DYPD 2CDEB 5C0DA 1JTPA 4WRLA 5IMOB 2BVQB 3HR6A 2FHCA 1YEIH 4PREB 4K3EH 1Y18A 4LLDA 2A2QT 4MCZA 4U6YB 3RDTC 4I48B 2AEWA 3BWAB 3DVIA 5FYKD 4GG8B 2NXYB 3B9VA 1T5WA 5IHBA 4YDLC 2ADJB 3VXRE 5F89B 4ZTPH 3HPLB 3BZEB 3BP7B 5GJSH 5IFAH 1KLUB 5FV1L 1C1EH 1S3KH 4HJ0D 4JN1L 5J6GB 4PFEA 3F7QA 1S5IL 5E8DH 4L9LC 3S4SG 4NKMA 2EDOA 4WFGD 1Y6NR 4ZTOH 1ZK9A 5F9JB 2VR5A 4HV8B 3BJ91 4QF1B 1R3JA 2DKMA 2OI9C 5TF1H 3MBEB 1MJUH 2MKWA 3KHQA 1RJZA 2KPNA 4XWOC 5FYJE 1U8JA 1MJ7H 2DS4A 4JKWA 4F58L 5IESH 3QXAB 3M1BA 1KUMA 3VFMA 3OXSB 1MQKL 4RZCB 4OKVB 2EYTB 1CICC 1A6WH 4H20H 4I3GA 1NCTA 1V7NH 4YX2L 1QA9A 1SMOA 1GL4B 5C71A 4I77H 4X7SH 2NXZB 3WIIH 5M95B 2E9JA 2ZUXA 3HMWL 3O3DB 3V4UH 3HR5A 1HIML 1VEOA 5JO5B 3ZDXE 2BNRA 3IKKA 3QPQC 2HH0L 4X8JA 3FQXA 5K59E 5IVOA 1AR2A 3E6HB 4QOKE 3VXUB 4EI6A 4XBEL 1T7XA 5DJCA 4PY8J 1A4KA 4LHQB 4WDIB 3HS0A 1GH7A 1RAMA 3QPXH 5HYJE 4TRPH 4AIZB 3T0DA 3JZ7A 4I3SL 4JQXC 4ZUUA 1P4LA 3ZKMD 1MCOH 4KJPC 4WUKL 3DOSA 4WTXA 1MFCH 5E99H 4Z5RA 2B0SL 4XNMA 3IDNB 1XT5A 2RR3A 2CDGA 1CZ8H 8CGTA 1H5BB 3VXQA 2BVPA 2FBJH 3QDGA 4PG9A 2P5EB 1OTSC 1X5YA 4P3WA 4ZOBA 1UEYA 3HE7A 2Z4QA 1IEBA 1QVOB 1BGXH 5HYQA 1NGWB 1RUKL 3FB8B 1R3LA 2QADD 4N0UE 4XX1E 4YGVB 2E6PA 3O6FC 1CDCA 2IAMD 5EC2A 5FM4A 1WZ1L 2XZCL 1LO5B 3UBXA 1CFTB 4UIMA 4ZDHA 1JPTL 4L9LB 3I85A 8FABA 4I1NB 4NO5A 1AJ7H 3T1WA 4YPGB 1DLHB 5GRVK 4XCFH 5KS9A 1IM9A 5EZJB 5E08H 2A6DB 3RWGA 3CVHH 4WWKD 1RU9H 3N9GH 1CXFA 4PJ5B 4XC1L 3K2UL 5JIIA 4PD4K 2DB8A 4BK5A 2JB5H 4HH9A 1CT8B 5IF0A 3ROOB 2ORBH 2YBRB 3WXVL 5D1QA 3RVWC 4JHWL 4Z95H 5TDOB 1J1XH 3U0TB 4KJYA 2BDNH 1HHGA 4BSWB 5F9WC 1U95A 3EO9L 3GJFH 5JTWA 3OGOE 1TTGA 3FO1A 5FYJH 4DOHE 3OZ9H 1MHHA 1CL7I 2MJWA 1RURH 1N6UA 3CVIH 5IROC 1R3IL 5IGXH 4U6VH 2V17L 3LRHA 4G3YH 3WO4B 1GIGL 3P4OB 5KSBF 3C09C 5A43C 5FYLE 5HGAA 1MI5B 5HVWA 4JGUA 4FQQA 2AGJL 4GAYB 3VD3A 3CH1B 4GW4A 5IQ9B 5CS7A 3HHRB 2VC2L 3DURA 5IV2A 1H8NA 2R2HA 2WBKA 1MFDL 1X44A 5EA0L 3OKNB 4HIIA 1GVIA 3LKQA 1NAML 3EHBC 3TN0D 4WU5B 1DL7L 4RAUB 4ODWB 1UM5H 3HB3C 3F12B 2XRAH 4TUKL 5FGSA 5FA4B 1N26A 3L3HB 3OR6A 5J06A 4Q0XH 4EI5C 1YC7A 1S8DB 3NA9L 5DJXA 1HXYA 3C5SB 3S96B 1LEIA 4OLEA 3RX8A 2DDQL 3TLRA 1K4DB 4O2CB 2FECL 4CVZB 1EUUA 3STLB 1DQDH 4LPCA 4BZ1H 1QLEL 2XZQH 3PABA 1NAKL 1QYGL 4RMSA 1RUAH 4RSVA 4AMKL 1C5BH 3WIHA 5D1ZA 3RTQC 5L8LB 1O7SA 5F7YC 5GGTL 2X5PA 4KROD 4P9ML 2W0FA 4OCNC 1KFAL 1J05A 2P7TA 2G2RB 2VDRL 2VKWA 5A2JH 1NCCL 3RVXC 3SKMA 2VLME 1ZSDB 4MSWA 5HI5C 1G9EA 2ATPB 2HKHL 3D3VD 4O9HL 1UWXK 5DJAB 3EYFB 4X6FB 4K9EC 4YGAB 1ERNA 3C08L 1DR9A 5GZOD 5AWNH 1KEGL 2CXGA 1TJHH 3TV3H 1J9CT 5I18L 4HKJA 3DX6A 4CVXA 3MV9E 4Y16C 1R24A 1JFQH 5B22A 4GSDL 4I0PC 3IXAA 1JIBA 3QCUH 5I2IB 3G08B 4P5KB 1RULL 3BDYH 1A7NH 3MRQB 3SY0A 1P1ZA 3ROLB 3IJYA 3CPLA 4HUXA 1D6VH 3VFGH 1IL1B 4KVCL 2C3VB 3ZTJG 1N6QH 3RI5K 2IANE 3NFPB 4OM0L 3VFPA 2BSRB 4UV4H 1XIWC 4GRLC 4PRID 1NGZB 4YAQA 3WUWA 2I5YL 5A16A 4V1DE 1J8HB 3VFTB 3VFOB 1K8IB 2Z31C 1ZWIB 2BSSB 5C0RH 5F7UA 4O2FB 4L8SA 3SDCD 1RZJL 3JV6B 3RU8L 4V2CB 3OAYH 1UWGH 4BUHA 1A1NB 4KQ4L 1UZ6E 4MAYC 4QNPE 1XGQB 1KCVL 1KN4H 1QFOA 2A73B 5MI0C 3MJ8B 3RRQA 5FYLH 2A83A 2BZDA 5IW3A 4FFWC 2BHUA 1YDPA 4X6BB 4EI5B 3O4OC 4QTHB 1IC4L 4L4TD 4J6RH 1HYSD 4MCYB 1VFAB 3NN8A 3WMSA 3LHPL 4QXTB 5JLZA 5JPMA 2H32B 4Y2DB 2CIKB 1G1YA 4ZPTB 1JHKL 3SDDB 1YEKH 3QUZB 4JM2C 5DMKB 2OQJB 1NBYA 4GRMA 5DJ0A 3ZDZE 4NO3A 5E5RB 5F97E 2ARWA 5F7KC 1D5ZB 2K3TA 3U2SA 5ITFA 1B90A 3QDJE 5KSBA 2BSTA 3MLRL 4ZYKA 2ZCKL 3MV7D 5BV7H 5I1GL 1KB5A 3ZO0A 4LKXB 4S1DD 5AG9A 3IFOB 4KPHH 2VDOL 4U7KA 2VABB 4XCCH 1MH5B 2B4CC 4AIXA 2Z0BA 1T7VA 5EBWB 3U36A 3MYJA 4JFDE 3VWJA 3RL1A 2DMBA 3U82B 4FRWA 4HZAA 1NCDL 4L1HA 3L7EA 3SE8L 5FXCH 5I19H 5DQ9A 3OKMA 3PP3K 3OPZL 3B83A 3QQ9D 1F2XK 4PJCA 1VENA 5HYSA 1P7QD 5IB1A 2PYFA 1EJOH 3MTRA 4JDZB 5C2BH 2XWJB 4Y16B 4PREA 4APQB 3QEQB 1PD6A 2FX7H 3IT8D 4TNWF 5C0IA 4E5XA 4GXUM 4QXGL 5B21A 4GG8A 5T3ZL 4G6AC 3W0WE 4I5BB 2VDKL 4EZMA 4DUXA 1IC5H 4HXBH 3TO4B 3BZEA 3NTCL 4K3JH 1A5FH 1PG7L 2X4OA 4E0RA 4TPRH 4GKSA 1XIWB 1KULA 5I15H 5IOPA 4ZODA 2DWDB 4J1UB 3RY6C 2QR0B 5F7HA 4Z9KB 2A6KA 2AS5M 2XG5A 1U3JA 4I2XE 4UIKH 4LDLB 3A0OA 2Z31B 2HJKA 1A7OH 4OF7A 5IR1B 4NRZB 1FJ1A 4GLRH 3FN0H 4OCLC 3JSSA 2R69L 1QBLL 5DLMH 2ZSVA 3QI9B 1DCLA 2F54E 5MI0B 1N3NB 1OAXL 2IG2L 2D0FA 3ZSTA 3MBEA 5KVFH 1KF9B 1U8QB 4M7JL 2W9DH 3QXWA 3RIAF 3V0WH 5KJRH 4R90L 3PWLB 2W0LA 4G6KL 4PJDE 3DO3A 3QXAA 5EIIA 4GFTB 3QEUB 2OS7A 1VFBB 4IRSC 5FGBA 5K9QI 3HNTH 3OXSA 4JM2B 4RZCA 4KJWD 4ONOA 1CLYL 4F2MA 1QSFB 5BJTB 1RD6A 4IRJB 4XMPL 1OT1A 2NX5B 3LQAL 4NHCH 5FUOL 1U36A 5DD6B 3T0BA 4QRQB 5EFIA 1AGBB 5C8JB 3LCYA 1BHGA 4FN0A 4GG6F 5IFJA 3IRZA 4RISL 1PZ5B 5SX5K 3SO3B 1OSPH 4C56A 1XF2A 3GMQB 5EO9A 5ADPL 5I1EH 2CK0H 3VD4A 1WISA 1WBZB 3GM8A 1JJUA 4YHIA 4OIIL 1CVSC 2V7HB 3TNMB 3CSGA 2FYYB 1QO3A 1BFTA 5DHYA 5I8CA 3PE9A 4JRYD 4NRYB 1WLHA 2OR7A 1JK8B 3V4VH 5IB5B 3KPMA 3CJJA 1M7IA 2V2TB 3VFSA 1NJ9A 3IDNA 4XAWH 5B8CB 1A6ZB 5F96L 4MGXA 4NZTH 1XGYH 1ZKAA 1H5BA 2A6IA 1HHJA 5HHXH 1DE4B 3SKUD 1QBML 2X4TB 1KPUB 2HLFD 4L3EE 3DUUA 1UJ3B 5E2JA 4Z7WE 1CGSL 2YPKA 3IB4A 2Q86A 3FB8A 1OTUD 5GSVB 4XGZA 1B0WA 3O11B 4YGVA 4QRUA 1FFOB 2EDRA 4OCYL 1KG0B 1P4BH 3ZTNL 3Q6GH 2XKSA 3O3BB 5DO2D 1RIVL 4WEMB 3PWPA 5CJBA 3MRDA 5TE6H 3SGDI 4AEEA 1DFBH 1A3LH 3TNNA 1BIIB 5CCKL 2DQDH 4P4KA 3OJMB 3BT2L 1FIGH 1BMGA 3TZVA 4QHUA 2O5YH 5I66A 1WTLA 1SYSB 5DMJB 4Z76A 3S8WA 5DC4B 4PJ5A 5GGQH 2XQBH 1ZHLA 4PRHD 1T3FB 3FFCE 2JB6A 5DRXA 2JJVA 3HE6B 3ZT7A 2VR4A 3U48A 4MQXD 3OGCB 3RVTD 4LHUG 4PJHB 1F6LL 5DF0A 1MCSA 3M8OL 4POYA 3IDXL 4LEXH 3RY4A 3LEXB 3ISWA 3S35X 3H9SA 2PNDA 5TDOA 1LNUA 3P73A 3MO1B 2JCCB 1ZV5A 2R0KL 5KZCB 1VFOA 4LHJB 2Z93B 1J5OH 4M93C 4OCWH 2MFNA 2ATKB 4JPIB 2RBLA 1SY6H 1ZT4A 1T04B 5KVDL 3UTSA 3KXFD 4C58B 1K6QL 1OM3H 3K1KC 3IFPA 4DKEH 1FYTD 2NY4C 4HJGA 3CH1A 2R29L 5I8EB 1U8OB 3FO0H 4O5LL 5GGRY 4C54A 2VKXA 1WIOA 2H3NB 3KPSE 3CMGA 1P2CB 5J11B 1IT9H 4G42A 1D9KC 4U4BA 1TVBB 4WU5A 2Y07H 3LV3B 3G6JE 4RAUA 4C83A 3F58H 5KAQF 4UU9A 5DHXB 3F12A 2NCMA 5FA4A 3AMLA 1ORQB 5GXBB 4CADA 1NPUA 1YEEH 1J0YA 2EDDA 3KYKH 1BFVH 4XCNB 4KV5E 1S7WB 4PJBA 1S8DA 25C8L 2YKLH 3C5SA 4H8WH 3S96A 5KSUA 4XP9H 3CIQA 3STLA 4JQIL 4YE4L 4GG6A 1PQZA 5TQ0H 3WE6B 5C0FB 5I17B 3BH8B 4E41E 4LCWA 1D5MB 4OZHB 5L2KB 1EPFA 4HF5L 1T0NB 3BQUD 5HDQH 2Y5EA 1MRCH 5IB3B 2BX5A 1I1AD 4KK6D 3RGVC 3CSBA 1DLFH 4H5SA 3DMMB 5D6CA 3RP1A 1HH6A 5MHSE 2IAMB 2XOTA 1ZSDA 4KTDH 1EHNA 4J3SA 1U3HA 2ATPA 1C5CH 1G0DA 4OQ1A 4OJFL 3LKRB 4K94L 5C0AB 1EHAA 4XHJC 3VD7A 5F72S 1NDMB 5GISH 2C3WA 5F9AC 2RB8A 4Q9QH 3GHEH 15C8L 1OGTB 5CZXC 1F4AA 4HT1H 2VZ1A 5CJXC 3VA2C 4YXLH 3LH2L 4LHUD 3HE7C 3U6RA 4MNGE 4YHKL 4G9FD 1JHTA 2HT4D 4P3CL 1OAQH 1V3JA 1XR9B 4K7FB 4XXDB 1ZLSL 2XA3A 3QFJA 2DQHH 4M43L 4YUEH 4XXCA 1NC4D 1B3JA 2V5TA 4LGPB 1CS6A 1NGPH 3BKML 3WFEL 3MRQA 4M93B 2AXJA 3ROLA 5DZOA 1ES0B 1TTUA 4LAJH 2VWEC 2AK4B 2OXHA 2G5RA 2C3VA 3VXSD 3WLBB 1FE8H 2CIIA 4ONFL 4PJIF 1EXUB 4P46A 3VFNA 2F74A 5HGGS 5EBLB 1NLDL 3AUVA 1FRGH 1J8HA 3MRFB 3UO1H 1VCAA 5DQDH 3G04B 2X41A 1FNAA 4O2FA 3O6LH 5EU6B 4XVUD 1RZ7H 1D9KB 4HBCL 4CN1A 3DRQB 3T1FA 3I50H 3GNML 1A1NA 5MEOA 4B5EA 3LZFL 4U6XA 1H0DB 1SMAA 2IBZY 3C5JA 5I1LB 2QQNL 2X40A 1QOKA 2X70B 2W91A 4KKBD 3BEVA 4MCYA 1VFAA 3VE0A 1FFNB 4RAVA 1FAKT 4QXTA 4X0KB 4Y2DA 3D18B 2GHWB 4ALAL 4XPBH 3BN9D 3SDDA 2HJFA 5DMKA 4OZFG 2OQJA 2NY3C 5T1KD 4XCYB 1FFRA 3D2UD 5I73B 2QV2A 4JFFE 5D2NE 2WWKO 4LIQL 1X5XA 2AABH 2FEEL 3UZEA 1JMZA 1RFDL 5IFHL 1AHWA 5FAAA 4I3RH 4S1QL 5CGYC 1S7UB 3HI6L 2VABA 4MJ5A 4LQFH 3V6OE 5F3HB 5D9SB 4ZNEE 4OD3H 1GSMA 1OGAD 3QUKB 3VRJB 4PP1D 3HNSL 3FO2A 3OB0K 4KVNL 5BO1L 3DGCR 3QO0B 1SBSH 1KT2A 3H9HB 4I18A 5D71L 3MFGB 4OGZA 3VU2A 4QHKI 2BNQB 1ZLUH 4NQUA 1S9KC 3G5VB 3NA4A 3H0TB 2DTML 4L8CB 2KKQA 3IDMB 2XWJA 3HZMB 4MZ2A 2UWEA 3ZYIA 1VGKB 4PJHF 4U3HA 5CEXA 4QYOA 2QSQA 2Q3AA 3RWFB 3WS6C 2FH8A 5D1ZC 1AGDB 3PGDA 2VSCA 2JCCF 3V6FB 4HG4K 5MP6L 1TJGL 1MCPL 4LSSL 3X11B 1PX4A 4OF6A 2B20A 1ZGLB 5DD5H 5C07A 1CD1B 1B0GA 5ETUB 1MFBH 3IRPX 3L3IB 4RRPA 5EBMA 2VDQH 5BVJB 1LMKA 4WEBL 4LVNC 4NRZA 4ZO9A 2BRRL 1T83A 7FABL 3D48R 1L4IA 1NMBH 1M6OA 1N3NA 2A1WL 5MEPB 4JN2B 4OLXL 2J6EH 4XMLH 3U7AA 4GAGL 2EEAA 3EUUA 2WP3O 4J3UA 4YJZL 5JXED 2DQEL 4K23H 5E2TH 1FO0L 2OP4L 1Q9OB 2AJUH 5DGRA 4ZUVB 1KJMB 2CLZB 1RK1B 1NGXB 3P4NB 1HINL 4OT1H 5IT2L 4IRZH 4UTAL 5J3HC 4IRJA 1JGVL 4QRRE 3IU4L 3HI5H 5T1DL 3S9DB 2BHYA 2FWOB 3T0WA 4L4VB 3AC0A 4PJIA 3QBTB 5C0BA 4M5YH 5C8JA 1NH6A 4Z18A 2PTTB 1BD2B 5HBBA 2A0LD 3LKOB 4MJIB 4OZHF 1A0QH 3GMQA 4G8GA 4X6CE 1WFNA 4TSBH 4QRSA 5HJ3A 3X12A 3ULVD 5F7LB 3GKWL 2AAVA 2AJXH 2VH5H 3EFFA 1RPQA 4PY7B 4U1MA 5JUEL 3HAEA 4OM1L 5BQ7B 3V2AR 3GSNH 1CCZA 2FB4L 5T3ZD 1FVDA 4YFEA 3SJVD 3CXDL 4E9LA 3O2DA 2PW2A 3I9GL 3BEWA 5B8CA 3VXRB 4JO3L 3CVHB 1I3GL 4AG4L 3WJJC 4WW1A 1W8NA 5F7MC 2FRGP 3GRWH 2YC1B 4XPHH 1UKTA 5TJWK 1BVZA 2DYPA 3MV11 1TCRA 4YZFE 5GSVA 4Q6YA 3O11A 3C9NB 1R3KA 1ZS8B 3GI8H 5T1LB 1GHFH 3U46B 4JDVB 1KJ2H 4OD1L 1KEML 5J13B 1EGJH 3UAJD 4HKBA 1F13A 3TT1H 4HUVA 1RHHA 3GJFB 4KK5D 1HHIA 2JJSA 3O3BA 3T77B 1XGUB 4LVNB 4JZJB 1NBQA 3F6IA 4JPWH 1BIIA 4DCQA 1KXVC 1JGDA 2NY6B 1IAKB 3MUHL 4AY0A 3QWOA 3ET9F 3HCVB 5T3XE 1EZVX 1N0LA 1SYSA 1X5HA 1QRNE 1NMAH 3NFNB 2C1OA 4O2EB 4CL7A 3O9WB 2EDWA 1JGLL 5FYKU 3HE6A 4W6XB 4LLUB 2K1MA 3ARWA 3MXVH 2AXGB 3OGCA 3VGFA 1CD8A 2PCPA 1DUYA 3NACH 2WANA 3KYNA 3LMJH 4PJGE 4YHOL 4LL9A 3DX7B 2W59A 2Y7QA 4UOW0 3VG0L 4GH7B 1HYRC 1YUHA 3FB7B 5C0CD 3MO1A 2H2SC 3KYMA 4Q9CA 1U92B 4QOKB 4TOYH 4NBZB 1FL6B 4YHLL 2EO9A 4NWUH 1E27A 3QG7L 5CWSB 5ID1A 1G0YR 1Z0NA 1Q8MA 5HYJB 1ZHKB 2ATKA 3GI9L 3JUYA 4JPIA 3ZYZA 1T04A 3DRTA 2ZCHH 4WHDA 1NDGB 4GRWE 2FJHB 3RIAK 4N1HB 5JNYA 1A64A 4QHNA 5I8EA 3ZE0F 1MFAH 5E9DD 2Y6SC 5BV7C 4N90E 4Y4FD 3TF7C 5E6IC 2H3NA 3D87B 3REVA 3BE1H 4X4MA 1GPOH 5ESVB 2AK1H 2DF3A 1P5UA 1FV1A 1LDSA 4LU5L 1BX2B 3FQWA 4O02H 4N0UB 3KYOB 3W11D 2X7LA 3P0VH 4LLVB 2E7BA 3WSQH 1Q1JH 1S7TA 2VJXA 3K8KA 3O6KH 4P2RD 3JBG7 3MLUH 1ZANL 1VACB 5EOCJ 1WAAF 4AEFA 4UTBH 4BH7B 1INEH 2R0ZL 3MGOB 5JORA 5IBTL 1CQKA 4WFEE 4ISVB 1D5MA 3LIZH 4DQOH 4FQPA 2WBWB 3UX9B 3TBVB 2P24B 1ZLVH 2Q8AL 3DROB 1E6JH 4CNIB 5IB3A 3BHBA 4NZUH 1T5XB 2D7QA 3RWHB 3ARFD 3DXAD 3PP4L 5D1XC 3MRPA 4X7EC 3PWUB 3JWNC 4BYHA 2IAMA 3MOBH 1BBDL 5BCAA 1KJVB 3PQYE 4BSJA 3G5ZB 3Q48A 4LCCB 5C3TA 4R3SA 5JHDD 1B2WL 3A6CL 3T0ED 3FQRB 1HILA 4FXLA 4Y5YB 4D0BA 1DBML 4PV8A 3S4SA 4DOHB 1MNUH 1CWVA 2CRYA 2NW2A 1OQXA 2XXCB 1RZIA 2DIBA 5BMFH 3D9AH 3E6FB 1GOHA 4FFYL 2B8OT 5I0DA 4WWKA 3QUXD 5J56B 1QACA 5T3XH 1CK0H 4UOJA 3IDIB 5C1MB 3EYUL 1XGTB 4Q58C 4NUGL 3MJ6A 3L7FB 3WEXB 1FZMB 4FQJL 4NUJB 4ZFFB 2KQNA 3BKCH 2GTWA 4A6YA 4G43B 4YWGL 4XP6H 2E7MA 2QSCH 5SWSE 3WLBA 3OKOB 2BRQA 2VAAA 4JGMA 4P4KC 3WFHB 2FCBA 4H1LG 1QFWH 5FV2A 3TZVC 5E2UH 2IQAB 3C60C 3GMMB 3UJJH 1CGWA 1NGYB 1B6DA 4UMGA 5EU6A 3RA7H 3I6KA 3RPIB 4AM0B 1A9BB 4H0GA 5DR5L 1FSKC 3HMXL 3DJ9A 1H0DA 3WYRA 3EOTH 1Y0LA 5E03A 4OLZL 3MODL 4JDTH 3FB6A 5JW4N 5DVLA 4GRWH 1LE9B 5D7JC 4KRPD 5EO0B 3SOBL 5FOJA 2FDBP 3OJ2C 1FFNA 4MAUL 5DUML 2MCPH 3QCTH 2YRLA 3J8F7 5HYEA 1GGYA 4NM8L 3GIZH 1KN2L 2APFA 1HEZA 2X10A 3QT2A 3LRSB 3TN0A 4XCYA 1U8PB 1G7JB 5IVZB 3TYFA 3TJHC 4QCIA 4JR9L 4G6FB 4NGHH 1P4IL 2OJZH 4OV5A 4R4NC 1HDMA 1TPXC 1P7HL 1U8LA 3MFFA 1ZVSB 4WENB 3BIBX 3TT3L 5INDA 4YIQB 1CDIA 3WDJA 5C92A 4KUZH 5F3HA 4ZOEA 3HZKA 2VIRB 3DV6B 1SEBA 1YN7B 2GK0B 2V9RA 2W0PA 1CLZL 1XFPA 1ONQB 4MD0B 4PTTB 5I75C 3BPCA 5DJ2A 2W92A 1ZOXA 3DSFL 5CEYB 4PJ8B 4W70A 5EU4B 2RFXB 2PYEE 1UG9A 4Z7VE 4H25B 2VDMH 2DQCH 3LY6A 4JAMB 1VGKA 2MSPA 1YJDC 3D3VA 2IANB 4PV9A 3RVVD 4HDIA 3ZDXF 3RWFA 4MQ7B 4V1DB 4S1SL 4N0FA 2XN9D 5K59F 5LQBH 4HWBA 5D7SH 1F11B 5GS0D 1CD1A 5DT1L 5DK3A 5ETUA 1OHQA 3RZWA 3L3IA 4M9PA 4PJFA 5E8PA 2LU4A 3I3BA 2JK5B 3C60B 1XF5B 4JANA 3QA3A 4FQLH 2IALB 4XB8A 1MQ8A 1PY4A 1Z5LA 3ARDC 5T1MB 1FSKB 1Q9WB 1X5LA 1PYWA 4U1HA 5GS1C 2VDLL 3RKPA 5MEPA 1RVFL 3R06B 4LARH 4HUWA 3WD5H 1R0AH 3BZFB 3MRCB 1WBXA 4YHML 3QDJB 4AL8L 2DLFH 1KTDB 5HHOE 3SDCA 5LBSL 5ITBH 4Y4KD 1HOCA 4L8BA 1AQKH 4ZUVA 1NCBL 1CU4H 2NTSP 1IFHL 5E95B 3TFKC 4M48H 3UTPE 1U8NB 1IBGH 2I07B 2GJ6D 2V2WA 5DXWA 4CAGA 4OAWB 5FCSH 4KK9D 1MWAB 3O4LE 4JFDB 3DX9A 4L4TA 3WHE1 2PTTA 1BD2A 4KXZH 2EDJA 4ZQKA 3PGFH 1CTNA 2DL9A 3OKYA 2VLJE 3K81A 4Y5VC 3PL6D 4CMHB 1MAML 2X4UA 4OLYH 4EDWH 4M1GH 4PRBA 4TUJB 4OCRL 2HFFB 1I1CA 4HIHA 3ZMRA 1YECL 5JQ6H 3MV7A 1A6VL 2W1NA 3S36H 1TVHA 4P3DB 4PR5A 1OARL 1RJYB 1KENH 1GGBL 3EGSB 4ERSL 1IGTA 4TN9A 1MRFL 1MF2L 3W0WB 2C7UA 2VXTH 1CE6B 4XVTL 2J2ZA 1S7RB 3KLHD 1OVZA 1KIQB 4PGZA 2Q8BL 3W9DA 4NN5B 3TPKA 4CU6A 3KPNB 3X3FL 2WWMD 2HFEB 1CFVH 4IDJH 1F45A 1H3GA 3O3EB 1JYWA 4NBXB 3GBNH 5EOQH 1UB5B 2ICWI 5HHME 1HQRA 5CHNA 3VFRB 1KSRA 2VXUL 5T1LA 1PLGH 2AJZA 3DTXB 1GZPA 3V7MA 4NC1C 5ICZB 1J0KA 1FZJB 2F54B 4F7TB 1CGVA 1U0QA 3BGAA 5EB9A 4R26H 1I9IL 4JZJA 4PJDB 4F7CB 5D7KE 4XMKH 2Q1EA 3ARDB 5HI4C 4LF3B 1K2DB 5GS1B 3JWDL 2F5BL 5BW7A 4KZDL 4NQXB 4HXAL 4OBSA 2YPLE 3HCVA 3EZ8A 2ITDA 3V5HA 2HTKC 1I8KB 4O2EA 3MMEA 4PJAE 3MNZB 2BERA 3O9WA 2HJLB 2E9BA 4LLUA 2X4QB 1H15B 4PTUA 5C09D 3HZYA 4ZFOB 2ICES 2QHLA 2NY1D 4P5TD 3ECBB 4L5FH 4KKLD 2B5IB 3DX7A 2XTJC 5CGMA 2C4FT 3N1GC 4M4RA 5DUPL 4H0HB 3T2QA 2CR6A 3G5YB 3RUGE 1PKQE 4JPVL 2FEDD 2E7LA 4JRXD 1ZHKA 3CFEB 2BVTA 2XQYK 4TQEL 4QLRA 2DQUH 4Y5VB 4KY1H 1BAFL 3F7VA 1AR1C 1LGVA 4WNQB 1DZBA 1NDGA 1T83C 2DIJA 3RWCB 5IMMB 5DJZA 4BFIB 3SE9L 2VMFA 1KIUA 2VN7A 4MQTB 4JPKH 5HDLA 1MY5A 4MA3A 5ESAA 2Y4SA 1DJSA 3S37X 2DL2A 3QNXB 3LN5A 4XH2B 3FT4B 4L3EB 4HG4J 1C08B 1HIMH 3HZVB 4GMSH 2N7AA 4MHHI 3ULUE 3WS3A 3E2HC 4FQXB 4BELD 3PQYD 4JREC 3RWJB 1FG9C 4PP2B 4NQCD 5LWYH 4JRYA 1LE5B 4LK4A 4S1RL 4LNRB 4WCYH 4J12A 4CW1B 5KSVB 3NCYP 3VGAB 1WC7A 3RL2B 5DK0A 3TBVA 3OKKB 4Y7MA 5IK3B 1T0PB 5IEHA 3FFCB 2O5XH 4Y5XC 1OP5K 4NQDD 3O3AA 3Q6FB 1UZ6F 4GKOA 1T1YB 3V4PL 1MCHA 5DI8B 3SEPA 2VQ1B 2V5SA 1KJVA 2AJ3A 4LCUB 5J6HB 1AGCB 4LCCA 1I1YB 2XZCH 2HYMA 3KPQB 4IIQA 1GGIH 4WFFE 4Y5YA 3T4YA 1TETL 4YHPA 2J5LC 1JPTH 3TBYB 2X09A 3ZDZF 2A9NL 4RMTA 2ZUTA 4W68A 2EH8L 3BPLC 2ZUQC 5ALBL 4PG2A 3DUSB 3FT3B 2B39A 4BKLA 3LEYL 4X9BA 5FDWA 3FZUC 4PRHA 3VFVA 3WCYA 3UJIL 3IDIA 5J1AB 3CX5J 4ETYA 2GSGA 3K2UH 3EJZC 3WEXA 1LO4L 1YEGH 3LKPB 1KCKA 1GXEA 4ZFFA 5CINH 4MA8L 3S3SA 3KPSB 1VSCA 4G43A 5DEGA 1OW0C 3WXVH 5BS0D 3G6JB 4FXKA 3L3GB 1E28A 3UDWA 4JHWH 2J3SA 1UZ8B 2IQAA 5A2FA 1ZVHA 5HYIA 3Q5TA 5D93C 2Q76A 1DQML 4GLRI 1V05A 3MLXL 43CAB 3IJHB 5A2IH 3WXWL 3EJYC 3FRUB 4DW2H 1F4XL 4DVRH 5D7LD 1U8HB 1GIGH 1ETZA 4OLWL 4P2QE 2AJSL 1BFOB 5CEZE 3T65B 5J57B 4Y2OA 4LLMB 1LE9A 4E41B 2DJ4A 5HTSA 3JV4B 4CMMB 4Y4FB 1I9RH 3WIHL 1U3ZA 2VC2H 1MJJA 3LRSA 1OAYH 2FJGB 3ARBC 4X98A 1U8PA 2VNCA 1CL7L 3TBWA 5DQJA 5GZND 3UZQA 3I3EA 5FGCE 1IVLA 3RJDA 3UYRL 1OCWL 4RFOH 3VDBA 2IWGA 5EZLB 3MUGA 2QKIA 3ULUH 2XZZA 1AKJD 2YD7A 4MWFA 4ZXBC 4Y5XB 4JFOA 3ELAT 3NA9H 4PS4L 5D96C 3MJ7A 1ZHNA 5L6YH 3GMLB 3S88H 3DV6A 2GK0A 4ZD3L 4TSAH 5KANG 4MNGB 4PJDF 1QLEH 3KPOB 4MD0A 3BQUA 1AD0B 5DFVC 1NAKH 1QYGH 3BPOC 1I1AA 4D9QD 4QEGA 1MIMH 3KDMA 4KJQD 4DUWA 2UZIL 3L3KA 1H9VA 5GGTH 3BP4B 4P9MH 3ZKMC 3MV8D 1KFAH 2W0KA 3OJVC 1QEWB 4ZUWB 2ZUQB 4JZOA 3R8QA 1IAIH 2H2PD 1IGML 2LFGA 2VDRH 4QRPD 3N1MC 4WY7L 3QIUD 2GJZB 4Z0XB 5J1TC 3TO2B 1BP3B 1UENA 5H37G 2K7PA 4N0CD 5CJ5A 4ELMA 3IVKB 3C08H 2MCG1 4G9FA 1ZE3C 2B1HH 1F11A 2IEPA 3ILPA 3ARED 2X4PB 1CBVL 2J88H 1XF5A 5I18H 5D93B 1NC4A 2IALA 3F6LA 3PHQB 2LVEA 4GSDH 3O8XC 3VMOA 1RULH 3TA3D 1DBBL 2BNUB 1B0RB 1NAMA 4WUUE 5IMLB 3CZJA 1S9XA 1YYLL 2GYSA 4HWZA 3DHMA 2O93L 1I7TB 5JA9A 3MRCA 4AENA 2MQCA 4OM0H 2EE6A 2A74B 4JFFB 3WV0A 5D2NB 5T5FH 1KYOK 1KTDA 3GSNB 4PLKD 4YNYA 2I5YH 1IRAY 2YK1H 4LLAA 1T20B 2X05A 1YEJH 3ARBB 2AXHA 1FG2A 5AUMB 1MCDA 1KLFA 1RZJH 2L7UA 2QQKL 5AZEH 3RU8H 4ENEC 5DS8B 2APBA 2I07A 5BRZE 4F7MA 5HGBA 2R56L 4OAWA 4KQ4H 4Z77A 1MWAA 3H3PL 2HMID 3SQBA 3BAEL 5CEZH 1MJ8L 4ZXBB 2BXYA 4U1IB 4YO0B 1IC4H 1JWSB 2E3VA 3LHPH 2A38A 1N5AB 5T1KA 3SGJA 5CZVL 4LSVL 2R0WL 3D2UA 5FECA 1KJ2B 3ILQD 2P8PB 4P9HH 1HKLL 3B3IA 3B2UD 4TUJA 5EU3A 4BFGA 4OI8A 4IOFC 4YDJB 4JFXA 2GJJA 2VZVA 1IGYB 1YNTB 1KTRL 1RJYA 2ZCKH 2Y5TB 2NY2B 3SDAD 3M17A 1DQLL 1I1FB 3GHBL 4WFHD 2HVJA 2VDOH 2F53D 4DZ8B 4NRXB 1KXQE 3KPNA 1JV5A 1R3HB 2W07A 2HFEA 1WZKA 2FD6L 5JW4R 2JELL 3CFKB 4N0YL 1E4XH 4PJ9C 4TVPD 1N6VA 2XA8L 2X1WL 4MVBD 3QIBB 5H2BB 4M7ZB 3O41B 3GJFK 3N1PC 3VFRA 4J7RA 5B38G 2ZJSL 4X6DA 1YMME 1TIUA 4AQ1B 5ICZA 1LO3L 4C4KO 4PLJD 2F54A 3PXHA 1MCIA 3EYQD 4F7TA 3MROA 1S9WA 2Q7YA 4PJDA 4X9HA 3O8XB 1JPSL 2EDBA 4LF3A 3G6JF 1CE1L 4KI5D 1CXHA 3GSUA 5DJ8B 3WFCL 4HIEB 1FCGA 5CJQH 3HC3H 2VDKH 5FUZL 5I16A 1EO8H 2APWA 4JE4B 4PB0H 5F8RC 3RKDD 3MNZA 4UDTB 4MXWL 2XNAA 1PG7H 3SKJL 4QRRB 4KV5F 4M1CD 3U4AA 1FN4B 5C0EB 3WDIA 1X7QA 2BY0A 4HC1H 1T7YA 3MRLB 5HHNA 4NQVB 2IJ0C 2QSTA 4X6CB 4YR6A 5F71A 5GZOC 1QBLH 3G5YA 3UJTL 3VRLE 1ZTXH 3VXME 5IHLB 4EN3D 1XF1A 2VLRE 1MRDH 1OAXH 2H9GA 2IG2H 4Q2ZB 4AH2B 3OBAA 5ADOL 5LGJB 1UB6A 4M7JH 4QTIL 1V7ML 3MGAA 5DA4A 4G6KH 5HHPA 4LKCA 1XZ0B 4G8FB 5GGSY 3V7AE 2HWZL 4KKCC 4WGVB 3RWCA 2YZ8A 4BFIA 1D6EA 2ESVE 1CLYH 2CDFA 4XVJL 1EX0A 3SE4C 1IGFL 4Z8FH 1U6AL 3DX8A 5CSBA 3LQAH 1OTTD 1RZGB 5FUOH 1Y6MR 3DNKA 4XH2A 3ZHLA 4XCEB 5EN2A 3PL6B 5ID0A 4YHNB 3MRNB 1LO2L 4OIBA 1MHPH 1NBVL 3TCLA 5I1IL 1ADQH 1TDQA 2W9LA 3B9KD 2ZUWA 3D85D 3BH9B 1HH9B 5JW5B 1C12B 1QLRA 1N64H 3EOAB 2DKSA 5D2LE 1F42A 4RDQF 4PJ9B 5CKAA 4OIIH 3QJHB 4M3JA 1FIEA 2ITCB 2HT3D 1NC2B 2GUOB 4WW2C 5DMIH 1HYSC 3SJVA 2YMXL 3WN5A 4D8PA 4CW1A 3RHWF 2E8ZA 3P9LB 4IJ3B 3RWEA 1AD9B 3TH3T 2JLLA 4Y4HC 1RUPH 4JO2L 5FO9B 1WICA 1QRNB 5F96H 1EEYA 5GRWA 5FO7B 2G60L 4DGIL 5IVXA 1QBMH 3MLYH 1MEXL 2OXGA 3A67L 4U1KA 2Z35A 4EUPH 3NZ8B 4S1DC 5E8OB 1OB1A 4LLQA 1ITBB 4HAFA 3B4NA 4Z0BL 1T7ZA 5KVEH 1AIFB 1ZT1B 1UCBL 4IMLB 3FONB 4XRCB 4LCUA 5CSZA 3VDCA 5F1KC 3V0VB 5J6HA 1AGCA 3DYPA 5LGHH 1I1YA 1I3VA 3BD5A 1B4JH 3OAYK 4RA3A 1S9VA 3ZTNH 3CFDB 1JF1B 1RIVH 3MOAL 4X99B 4JFPB 1I8LA 1AC6A 4MJ4A 5CCKH 2A77H 3QHZL 4TUOB 1OF2A 4GRWB 5ILTL 3ZKXC 1CF8L 4OLUL 4NM4L 3LVEA 3O6MH 3LS5H 3VXTA 1KGCE 4MNQD 4YXKL 4EDXA 4U6TA 4P5TB 1WCBB 4LSRL 2ZKHL 2FIRT 4X9IA 3KPRE 3G6JA 3K2MC 1A6TB 1MCEA 3IDXH 3UXFA 3FJTA 2AEIT 5BW7C 3EJJX 5CBAB 3QWQB 5IBLC 3X13A 2R0KH 4GBXD 5JDSA 2WBJC 5ISZD 1Z9LA 1R5VB 2VLLA 5L0QB 4XAKD 4AK1A 2YUWA 3W39B 1K6QH 1RI8A 1AE6H 4R0LC 4YDVA 4X5XB 1KCUL 2ENSA 5E9DA 3BUYA 3SCMB 4CMMA 4Y4FA 2R29H 1F3JB 3QIWD 1HXMA 2P5WD 3TESA 1SJEA 1LP9E 3HPJB 3P77A 3WNMA 3PDOB 4HFUH 1YNLL 3KLAB 1F58H 4Y4HB 2YUVA 4A2MA 4LIQE 2F19L 3PQYB 5DMGC 4P2RA 5FDYA 4JQVC 3WL9A 3DGGB 3AU1A 2GY5A 5J1SC 4X83A 4HLZG 5E5UB 5I1JH 5CD3A 4PYGA 5T33H 4XBGB 3H9ZA 4NO2B 3U7WL 2Q6WB 4LPWA 4PRDA 1T6WA 3CFJB 4X7FC 5MERA 1HSAB 3GSRB 4MNGA 5K9OB 4YE4H 2DOCA 3BMWA 1F8TH 1FNHA 1S7VA 3KPOA 5GJTL 4YHZL 3TBSA 3UPAA 5JHLL 3EOBA 5IKCB 1W72H 1AD0A 1IGJB 2EIEA 4ETQA 1NFDE 3SQOH 5LXGH 1BZ7B 4JO4L 5C6TL 1REIA 3UTTD 1WBYB 3ARFA 3DXAA 5HYFA 1NMCB 3TIDA 5E5MB 3RBGA 3VI3E 2DQTL 1KNOB 4ODUA 3FTGA 2BCKB 4MA1C 4ZUWA 4KUCF 2VITB 3DBXB 5SWSB 1HQ4B 3SBWC 4ZS6D 2UYLB 3T0EA 1D3CA 4K94H 1AO7D 5I1KL 4WJ5A 4GW1A 5B3JE 5MEQB 4BZYA 3ES6B 3ORJA 3EO1A 3LH2H 4LLWA 2G9HB 3UTZB 1BVLA 4YHKH 1M7DB 3QUXA 4OZ4B 1E0OB 5BRZD 2Z91B 4JG0H 4KHXL 1TFHA 2NY7L 2M1KA 1R5WA 1RJCA 1FNSH 3T8XA 3PHQA 1YMHB 5SWQA 1ZLSH 2WBJB 3GMPA 3GSOB 2WQ8A 1CFQA 2H6PB 1G6RH 4J8RB 5IMLA 3RWIB 1U8KA 4AEHL 3EYVA 3E8UL 5DTFB 3D0VB 3L5HA 4OZGE 2NTFA 4LMQE 4YEEA 4ONFH 4LOUC 4R0LB 2A74A 5JMRA 4GXUN 4KKNA 4WHYH 5JOEA 2XACC 2FX8H 5EUOF 3ZKQD 1MLBA 2LQRA 3NCFB 1L7TL 1NANH 1W0VA 5AUMA 4MQXC 2EKSB 2HN7A 3RVTC 5IBUB 3HG1D 2GITB 3U1SL 4YDIL 2QQQA 2IF7A 4JY5L 1DN0B 3GGWB 3QDHA 4NN7C 5TGBA 1OP9A 4ODTL 3GNMH 4JJHA 5KW9L 2EDHA 4ZNEA 3LZFH 2OZ4A 3QP3A 2DMKA 1HSBA 3KPTA 1N7ML 1VESA 1GZQA 2FGWH 2N4IA 2QQNH 2BFVL 2DQFB 5JIKA 3LDBC 3Q3GA 2FATL 5I30L 4DKFL 1G7IB 1JWSA 1JF5A 3H42H 2DWEB 3NCCB 3CZFB 4ALAH 3BGFB 4KK8D 2PYEB 3MLSL 1MIEL 1I9EA 4Z7VB 5L9DL 4NJAL 3LKSB 4RFNB 3IDYC 1JI1A 5FK9A 4PJ7E 2WLZA 5IM7B 1QFUL 4LIQH 5AYQA 3IJSB 2CLRA 4XZUB 4M6NL 3ESVF 5F6HI 2UVEA 5LGKA 1TLKA 2V9QA 1DQJB 4G7VH 3LKNA 3T04D 4KHTH 2OTPA 4WI8A 3CFKA 3HNSH 3BP6B 3LOWA 1IARB 1URLA 4Z7UE 4AT6B 4OB5H 4B7IA 5DDHB 2X42A 5I1DA 2ZCLH 1NGQL 3O41A 5D71H 4PPTA 2QSVA 5I8OH 4X80H 5EBGA 4B53A 5IW1B 4LSQL 1HN1A 3AROA 1A14L 2DTMH 3AM8A 3KYAA 5FHAH 5L2JB 5ICXB 2NY0D 4FTVD 4P2CG 5B39B 2QLVB 4HX1A 2FL5B 1EFXB 3IFLL 1BLNB 5HHOB 5DJ8A 4KK6C 1U93A 5DJ6B 1GGTA 2GTZA 4RNRB 3RWDB 1UA6L 3BVNB 4I4WB 4JKLA 2HVKA 4LSSH 4RCAA 4ZO6A 5JA8B 4YFLI 4H1LA 2VXSH 4OD2B 1FGVH 4UQ2A 3O4LB 3SGKA 4IS6B 4XVSL 5E2WL 4WEBH 3MNWA 5F1IB 2FSEB 3HUJE 3P0YL 3B2VL 2VLJB 3OKEB 7FABH 4NN7B 4GAFB 4OLVL 2A1WH 4LDOB 1DN2A 1I75A 2Y25A 3U4EA 4R9HA 5LGJA 3SDYL 3LDBB 4NN6B 4F15B 1EHLL 4GAGH 1J0JA 4P49A 2DQEH 4Y4KA 3B8SA 2VZSA 1JYVA 3GDBA 2FZ3B 5CLWA 5K9QG 4M7KL 2CSPA 2NXYD 1K8DB 2IBBA 2EXYD 2GJ6A 3D39E 3GK8L 1QFWI 1HINH 5IT2H 1GOFA 2VLKE 3IDYB 4K71C 2GSIA 5F9OH 4HWEL 5IEKA 5GGUA 4MJ2A 5IJKA 1MCRA 4OFIA 3PL6A 3D69A 1FDLL 3NIDF 5EUOA 4U6HB 5HHMB 4HKZA 5CIPA 4RMVA 1TTFA 1SYVB 2VQUA 2EYSA 2CJUH 4X7TB 4BQ6A 1HI6B 5JW5A 1C12A 4P4RB 3GKWH 2R8SL 3MBED 4OCXL 3QJHA 5DRZB 3NPSC 1KB9K 5ERWA 5AAWA 2O5ZL 5EOTB 1AGFB 2F5AL 5DGQA 1SHMA 4ODXA 5HVFB 4U3CA 1C7SA 2A6JB 3P9LA 2W60B 3BXNA 3I9GH 1JZ5A 3ARGC 3RJQB 2YPLB 4D9LL 4JO3H 4CN4A 1ND0A 3NAAH 4OZIE 4PJAB 1KYOJ 1OQOA 2WUBL 4CUCA 3MLTB 4J3OC 1ZAGA 3FN9A 3VD9A 1A4JA 2NXZD 5E8OA 3P4MB 1DVFC 5BXFA 1AIFA 5DHVH 2CKBH 4WV1B 4XRCA 2BOBB 3QDME 4JM4H 3EW3B 3VXUD 4U2YA 4NWTL 3DVGB 1PKOA 2OTWA 2XKNB 1Q0YL 3QFDA 3RUGB 4Z7QE 1OWRM 3GSQB 1FO0A 1PKQB 2AJVH 1FBIL 4XNZC 4O58L 2OR9H 3MRRB 2OBGA 3S5LB 3BRFA 4UAOC 2R23B 5KG9A 2EXWD 3MRIA 4ODSL 4PB9L 2MTPA 2R1XB 1NLBH 5E8EB 5GHWL 4M61B 4YBQD 1M71B 3ZHDA 3HRZA 2ZUYA 3VI4E 4OQTH 1WEJL 1JGLH 5CGTA 3L6FB 4P5TA 4Y19E 3UTQB 3JTTB 2P5ED 4WU7A 1WWWX 2JJTC 2NR6D 3N50A 2FBOJ 1RZJC 5FO8B 3F62A 1GGCL 4P57B 5CBAA 3GJEB 3VG0H 5DD1H 4ELKA 2IBZX 5IIEB 4K71B 2EIZA 2XWTA 4JVWA 1GYAA 3LQMA 4X9GA 1OY3B 4MA7L 5D7IA 3PHOA 2GCYA 5E7BA 4JRXA 3O0RL 3ZZ1A 4BH8A 3QG7H 5FKPB 3WNNA 4NO0B 1Z9MA 1R5VA 2EZ0C 3V6BR 4Z7VF 4JY4B 1U2HA 2W65B 1I3RA 2IH3A 2ZG1A 5DRWA 1NBZB 1ZLUK 3W39A 4MNHB 3HLAB 3O81A 4X5XA 5KVMC 1LD9B 1FVEA 2IC2A 3V52L 3MCKB 3NPSB 1XGRA 1F3JA 4MX7B 5JXEC 3S37L 3BYYA 4KU1A 1AQDA 2VERN 5DVMA 1E6OL 3HPJA 5I1AB 5D72H 1MHEB 4DTGL 4LU5H 3ARGB 1DBJL 4XT1C 3PQYA 4IMKC 4KXZI 1DUZB 4NQCA 5DVNA 1T1ZB 5BOZG 1XCTB 2X4SB 4NO2A 1RIUL 1BM3L 3IDGA 4EQ3A 3QPQD 3IDUA 1UM6L 5IP4A 1MI5D 5IKCA 2YSSB 2ICWJ 5DURB 2EEBA 4XPGL 2EDQA 1JWMB 1BZ7A 3ETBF 4XNZB 2Q8AH 5J9PB 4NQDA 3N0PB 1KNOA 3RHWK 2QQLL 1BEYL 4JFQA 4KJPD 1FH5L 2ZOKA 1M4KA 2VITA 3PP4H 4Q9RL 1HQ4A 4HIXL 3CU1A 1QSEE 1WWCA 2EO1A 1XF4A 4D3CL 2VZOA 1KPVB 1N8ZA 3A6BL 4RGNE 1E4JA 4NPYB 3A6CH 3IDJB 5TDNB 5AEAA 4FQ1L 4GQ9L 1JPGA 4U1JA 1QKZL 1AC0A 1T21A 4XNYL 1YPZE 3ES6A 3JTSA 2DJSA 3U30C 1E4KC 3ZL4H 3JVGA 2Z91A 5TDPB 4JG1L 4P2QB 4HEME 2GFBA 4KK5C 5EORL 1J1PL 5GGVL 3GSOA 4YK4C 3G6DH 2JIXB 3SPVA 1N0XL 4NUGH 4N9GA 4KQ3L 4FG6C 2MWCA 4RWYH 4FQJH 5BS0A 1I8LC 2ZPKH 4HCRH 2I60L 3IFNL 5FGCB 1C5DB 3RX7A 1S5HB 2SEBA 1F4WL 3GMNB 1RZKL 4QXUL 3FQUB 1YEIL 5JXAH 3LQAC 3MNVA 4K3EL 1UQSB 5EH1A 4X6EB 3PUCA 4FP8H 2EKSA 4MJ6B 2GITA 5TQ2L 4NC2B 3NPZB 1JZ2A 5D7LA 5I8KL 1DEEB 3I6LD 4ZTPL 1CDUA 3LRGA 5GJSL 1N2RB 5E1AB 5IFAL 3MODH 1I3UA 5ALCH 1UVQB 2DQFA 4XBPB 3SOBH 1JWUB 3CSPA 4MAUH 5E8DL 5DUMH 4NT6B 2DWEA 5CP3H 4IM8A 3ZE1F 3Q2CA 1KN2H 2EDXA 1MREH 1RIHL 2PYEA 3IU3A 5CD5D 4PJAF 1FNEA 3FRPG 4U3XA 5IMKB 3LKSA 1T1XB 1HE7A 4M6ML 5KTEH 2J8UA 1P4IH 1NCAL 3B6SB 2P8LB 4NQSA 4DZBA 2MPAH 3QUMH 3C5ZB 3TT3H 3T2NH 1ZA3B 4DFHA 1MUJA 2CUMA 3QNYA 3EHBD 3S97C 1DQJA 1CIUA 5EZIH 3RUGF 4P23B 1A6WL 4HWBL 4JLRB 3HB3D 4JCLA 1LVEA 1FFPA 2VQTA 5ECJE 4AT6A 4NHUB 5DDHA 4I77L 4EI5D 4MYWB 4D0CA 2GT9A 2PR4H 2AQ2A 2V5YA 4UOW1 3MJ9H 4CDHA 4Y2DD 3OX8B 1KJ3H 3U30B 4GMTH 2DBLL 5IW1A 4WUUB 3QUZD 2I24N 5FA3B 1TITA 5FOBA 2P46B 1RSFA 3QIUA 3CUPA 1CGYA 4F33A 3HRPA 3BSZL 3BDBA 3N1QC 5CP7B 3JUZA 3QPXL 4YK4B 1EFXA 5LCVH 1BLNA 1JGEB 3D1MC 5CZKA 1YNKH 4ZMAT 4S1SH 3G6AB 1K3IA 3HMXA 4RNRA 3ULUF 2VZ3A 3ARFC 3BVNA 4I4WA 1EH9A 1KLGA 3L9RA 3KWWA 4HIJB 2YZ1A 5E99L 2KZ1B 1NL0H 3QRGL 3L5XH 5BRZB 4AIOA 4MS8D 4HPOH 5HI5D 1CZ8L 4OD2A 1JI2A 2CK2A 3TVMB 4J2XA 2FBJL 4IS6A 1MVUA 4ODBD 5GS3A 3TA3A 5JQHC 4FQIH 5F1IA 5KSAC 1FZOA 3OKEA 1BGXL 4JFHD 2BNRE 3FOMB 1Z3GL 3VWKC 3GZKA 1GC1L 2FO4A 3UYPA 2K9UA 2GQHA 2PO6B 4Y16D 4APQD 5F3BA 4ZS7H 4GKZA 3RVUD 3QEQD 4MDJA 4YHMH 4AL8H 1OLLA 2FZ3A 1ZLVK 5IB2B 2V6HA 5JR1H 1NCBH 1AJ7L 5HD8D 3MQIA 4X4ZA 3MR9A 4HWNA 4Y8AA 3TO4D 3PV6B 3SO5A 3TWCL 2DD8H 5CKGA 1HK6A 1XIWD 2GI7A 1RU9L 3BI9X 1KACB 3N9GL 4JHAH 1P7KA 4GT7A 3QDGE 1EK3A 4EUPB 2Z31D 4LAQL 2J8OA 4YHYB 1YEFH 4U6HA 1QBAA 5L88H 2ADGB 4AEIL 1YMMB 3MRKB 4X7TA 1WV7T 2I9LB 1ZT7B 2PTVA 3QI9D 4Z95L 1J1XL 2BOCB 3BP5B 5F1NA 2BDNL 2GKIA 2G75B 3NCJH 3IF1B 1OSZB 4CDGC 1YECH 2DM7A 3U9UB 3SDAA 3PP3H 5FYJL 3CLFH 1K5NB 1YQ2A 3OZ9L 4RMWA 1I85C 2VWEE 1AI1L 3QQ3B 1RURL 3CVIL 3BUTA 5IGXL 4JM2D 2F53A 4J4PA 5INCB 1MRFH 1S7QA 4G80B 3O2VH 4LPXA 1IC1A 1QSFD 5KS9E 1R6VA 4CKVX 4PJAA 4IRJD 1T1WB 2Q8BH 3VMPA 2NX5D 3X3FH 4K94C 4F8TA 1RMFH 3MREB 3P4MA 5HGDA 4P2OC 2FECI 4KDTC 1GGUA 3FN3A 4WV1A 4LRNH 3WJLA 4OFPA 1UM5L 2XQYG 4HFWA 3HC0A 3IXTB 3VXMB 5ENWB 4EVNB 2VLRB 1JNNH 3RUGA 1I8MB 1PKQA 4RBPH 1U91A 2W9EH 4FQHB 1YEHH 5L7XH 1I9IH 5DK2B 2EH7H 5KSAB 4LEOA 2ZP0T 1T4KA 3MRRA 3S5LA 2CKNA 1IAII 5TH2B 2KBGA 3VWKB 3FOLB 3JWDH 1ZGLP 4R7NB 3U0PB 2R1XA 3OMZA 1DQDL 3V5DB 2ESVB 1M71A 2ZUSA 1INDL 2XZQL 4OSUH 3AM8C 3RZCB 1AXSA 1RUAL 1C5BL 3RVVC 3UTQA 3JTTA 4JO1H 3GBML 4OI7A 1GJIA 4ORGB 1A9EA 1M7XA 1F3RB 5CLTA 1CDHA 2GY7B 4P57A 4WO4B 3NCEB 4UB0H 4EN3A 4IHOB 4N8VB 5SV3A 1CFSB 1G6VK 5I76A 3MA7A 3UCRA 3P9MA 2EE3A 5D2LB 3RAJH 4JPVH 1GAFL 4JY4A 4F7EB 1SQ2N 1G7MB 4D0DA 5AWNL 2Y36L 3GSVA 5TE7H 3SE9H 5B4MD 4E42B 1JE6A 1LEGB 3TV3L 1W72B 1AXTL 4Q9BA 3MCKA 2AEPL 3AS0A 3OKDA 3QHFH 4NZDA 4L8DA 3BDYL 3HE6D 1ACZA 4PJXA 2D03L 5DJDB 1D6VL 4GS7C 5GIRA 3RNKB 5ACZB 3VFGL 1TJIH 4OUOA 3B9KA 3PWVB 2EECA 3D85A 2HRPL 1JYXA 5ESQA 3BESR 3S6CA 1DUZA 1JF6A 4RQQA 5FCUH 5KZCD 1TZIB 3CAFA 2Z8WC 5DYOB 1J11A 2CRZA 5C0RL 2HRLA 2YD4A 1MCNA 4BFEA 4S1RH 5B38A 1L7IL 1AY1L 1UWGL 2FR4B 3I2CH 4FXGB 5HI3D 1FORL 3V6ZA 4JVUA 4RGMC 3VW3L 1T03H 5FYLL 5IWLA 1JWMA 1A3QA 5C0ND 5HPMA 3FQTA 3C6LC 4J6RL 3R0NA 5J9PA 1R5IA 3OR7A 2VZTA 3GBLA 1G6RB 1JNHB 4DN3H 3QNZB 3W9EB 1I8IA 2IH1A 2LABA 2DLEA 4HK0A 1YEKL 2JTDA 2E27L 3KLHC 3KPRB 3LS4L 3QH3B 1E4XI 1YEDB 2I26N 3S36X 1YY8A 4PGCA 4R8WH 1LEKB 2PXYC 5EO1A 1A7RH 4NPYA 1UJTA 4ZOAA 2CLVB 3U7YH 5HDOA 1CYGA 1TETH 5JW3L 1KV3A 2F58H 4NQEE 1AFVH 1VERA 1S78C 1IKFL 4XPTL 2FH6A 4F9PA 3JWOL 1IAMA 4XCCL 2EDTA 5I9QC 4HS6A 2RIKA 3R4DA 6FABH 4MNQA 4U1SA 1KB9J 2JIXA 1IQDB 5F1OB 5L2KD 3UJIH 3TM6A 3RDTB 2P49B 3LD8C 1UGNA 1LO4H 2OM5A 5I19L 3VXPA 2XWBB 5H35B 4MA8H 4YDLB 3DMMD 1LP9B 5C08E 1C5DA 1B4RA 5CUSH 1EJOL 4KAQL 1J12A 3FQUA 1VADB 1XH3A 4GBXA 5KSBE 1UQSA 3R1GL 1DQQA 2FX7L 1JTOA 5C0AD 4YBLC 5ISZA 2JKXA 1CR9L 4MZ3A 5KOMC 4MJ6A 3PIQA 1YA5A 3MLXH 1AP2A 2NY1C 1MHCB 3EDEA 3WXWH 2X4RA 1DEEA 4HXBL 2YEZB 4HMDA 3PWNA 5E1AA 1A5FL 1V8HA 4TPRL 2OI9B 2X89D 2C4XA 2F8VA 4QY8B 5D70L 4G8IB 1J8KA 1JWUA 1VKXB 3QIWA 4ZAKC 2P5WA 4NT6A 1NFDB 3C87A 5EIQA 1UADC 2ARJB 3FN0L 4LRIA 5D6DC 2AK4D 2FX9L 5I74C 5DLML 1CICB 1XF3B 4PJCE 3L3OA 4GJTB 1T1XA 4HEPG 4RGMB 2AXFA 1WT5A 5KVFL 5F1SA 3UYRH 1OCWH 5C9JA 1PVHA 2C4FU 4FA8A 2O61A 4U31A 3EDKA 1UH3A 3C6LB 3CSYB 1J87A 3FQNA 5KBNC 1DBAL 3VCLB 1CI5A 2H8PA 1KCSH 3KJ6H 5EU6D 1X9QA 1WSST 4D2NA 3VRLF 3VRIA 3C6SB 1D9KD 2I9TB 3MLWH 5FIEA 3RNQB 4TULL 4PRAB 1A6AB 3BMVA 2WK2A 2PXYB 4I9WD 4NHCL 1T89C 4PIRF 5ICYB 2P45B 3UTTA 4HC1A 2XPGB 3QAZC 1U58A 1S7SA 1V5JA 1OSPL 4WUUA 1G0XA 1BVKB 2Z92A 3BD4A 5F7EL 2ZNXA 5E8NA 1T66C 5I9QB 4EBQL 3FFDA 1HZHH 2CK0L 1I7ZB 2R1YB 2UV3A 1JHLH 3OXRA 4ZO8A 1AO7A 3IETA 2BJMH 4ZFGL 2HT2C 1MSPA 4WI3A 1ITCA 4JB9L 4ACPA 3RGVD 1X5AA 1D5XB 2NZIA 1T22A 2IFGA 2ARJQ 4HIJA 5D2LF 5BRZA 3O6FB 2Z8RA 3ULSB 1CD0A 1WCQA 1CBVH 4NZTL 1XGYL 3MXWH 3P9WB 4M3KB 1MWAL 5HHXL 5ACMA 4XHJD 4YBLB 3MPCA 3SKOB 4DAGL 1JNJA 2P1YA 5IB4B 3K0WA 5F7NC 3W82A 1I9JL 2BNQD 1BJ1H 3MACH 1I4FB 3QWRD 4C56E 4MMZC 5FM5O 3QEHA 1UXWA 4YH6A 2PO6A 1P4BL 3NH7H 4MDIA 4RFEA 5BZWA 3MYZA 4OCMC 4PJ7B 2BY1A 5TE6L 3HG1A 1EMTH 1DFBL 3IKCB 2D31B 4D94A 1A3LL 4N8CH 4OI9A 1KB5H 2E6QA 2DQDL 3TBTA 3KLSA 1FIGL 1T0MA 3O45A 1CLOL 1KIPA 3QULB 1BWMA 3V0AC 3AAZA 2R56H 5JOFB 5F9WB 5GGQL 5D8JH 5EUKB 4EUPA 4Z7UB 2GK2A 5CMAB 3X14A 4L29B 4Q97A 3ZYJA 5DHVB 5DUBB 2CKBB 2YD5A 4K3HA 1FZKB 4LEXL 4JFEE 2WUCL 4KGJA 4BQBA 3C09B 1ZT7A 2R0WH 4ONHB 5FB8B 5HHQA 2G75A 2OK0L 5JOPD 3JXAA 3QO1A 5IW6B 3U9UA 1NEZB 4XI5D 1K5NA 1MELA 3QAZB 4QRTA 3I6GA 4ZFZA 1T2XA 1G9NL 5EPMA 1J5OL 2MHAA 3PWPE 4XC3L 2EKJA 1DQLH 1SY6L 4R97C 4RIRA 1QLFB 5GZNC 2ID5A 43C9A 4LPTA 1OM3L 3MC0A 4DKEL 4YFDB 2ZNWA 4PGDB 2FIKA 4L4VD 2FD6H 2F8OA 3FO0L 1OP3H 3TC9A 2QTEA 3TH2T 2JELH 4NDMA 4XP5H 2XA8H 3T4AB 1BD2D 2AVGA 4ZFOL 1BJMA 4JJ5B 5CGYD 1IT9L 5E00B 4MJID 2ILLA 3HUJB 2Y07L 3G9VA 2EYRA 3H9SE 3INUL 3KR3L 4F57H 3LAFA 4FTVA 2AJYL 2OX5A 4L3AA 4U1GC 4UUJB 1RJLA 1YN6A 4LLYB 3RTQB 2YKLL 4H8WL 2CXKA 1LP9F 1PSKH 2HFGH 4FFVD 1XCQA 1JPSH 1NCWH 2DJUA 5EDXA 5TH2A 1CE1H 3AY4A 4XP9L 4R96A 2XICA 5DD3H 2OSLB 3MCG1 5FUZH 1EEQA 3UTSE 1TZHA 4XX1G 3D39B 3VXRD 5TPWH 2H2PC 4JZNB 1CDGA 3I75A 1I7UB 2VLKB 2R2CA 3QIUC 4PBWD 3EO0A 3F7YA 1MRCL 5EZOL 3U4BH 1F6FB 4ORGA 5AAMA 5EC1B 1DLFL 3L95A 4N0CC 1N59B 1GCFA 1MLCB 2H26B 2CDEA 5IMOA 3ULVL 2APXA 4IHOA 5T1LD 2BVQA 3AREC 2QHRL 3VA6A 3V9FA 2YHGA 1EAPB 4BA8A 1JRHL 5ADOH 1OOAA 4I0PB 3UPRB 3OV6A 4QTIH 5GISL 4U6YA 4HGWB 1V7MH 4I48A 3VI3F 3BWAA 5FYJD 4PJBE 1WF5A 4Q9QL 3CXHJ 1SM3H 3GHEL 3QG6B 3ESUF 3TA3C 1QNZL 1WTGT 5C9KA 2HWZH 4IBLT 4YXLL 2ADJA 3BKYH 5F89A 2NY6D 2YR3A 3HPLA 4GG6E 3BP7A 1KLUA 1QUNA 1ZEAL 3EYSH 1OAQL 4LCWE 5J6GA 2B1AL 4GRLB 3V8CA 2HFTA 4OZIB 2D0HA 3O9WD 5B3JF 1NANI 1F3DH 4CBPA 1NGPL 1HHHB 4U7MA 5F9JA 5ACZA 3RNKA 4OIAA 4HV8A 1LO2H 2J12B 3K8MA 4R97B 4RX4D 4QF1A 5I1IH 1YY9C 1JGUL 4MAYB 1FE8L 4MHHG 2HLAB 2AERT 4PRNB 1MFEL 4RMUA 5F6HJ 3QDMB 1EZVY 2HMIC 4QOKD 1FRGL 3RFZC 3O4OB 2AKRB 1KELH 3QUYC 4Q6IC 1HKFA 3O6LL 5HYJD 3W2DL 4XNQB 2YMXH 2UY6A 1AGEB 4NQED 4OKVA 2FR4A 4BK4A 1RZFL 3I50L 1KXTB 2EYTA 3REWB 2UUDK 1RY7B 4JFZH 3ILQC 5HPOA 4U1GB 4KKAD 4GQPH 4QWWC 3MJGX 4JO2H 4GUPB 4LGRB 3QFJE 2FEEI 4RGNC 4DGIH 3O3DA 1MEXH 3A67H 3W9EA 4Y19B 5JO5A 2DTSA 2M26A 4JKMA 4O51B 2UY7A 3KPRA 3QH3A 3E6HA 3VXUA 5C08D 1KIRB 3GB7B 3MZTA 3PDDA 4LQ1A 4WDIA 4X7CC 1LEKA 5FHBH 2ICCA 1KTLB 2CLVA 2AABL 2MNUA 3WNKA 4AIZA 1SVCP 3GIVB 4I3RL 4IDLA 1EFQA 1WITA 1Z6JT 3BOVA 3UC0H 4OD3L 4PJ7F 4K7PL 4U1NB 5DWUL 4QT5B 3GMRB 5E6YA 4OLUH 4NM4H 1IQDA 2D9CA 5IJVB 2D4DA 4WHCA 4JVPA 3RDTA 2P5EA 4U05A 1X4ZA 2AP2A 4YXKH 1QVOA 1JZ8A 2XWBA 3F7PC 4M7LH 4F9LA 5H35A 1NGWA 3CFBB 4JKKA 4KI5C 3BIKB 1LP9A 5DRNB 2D7MA 1NFIB 1I7RB 4UT9L 3H7BB 3JV5A 1VADA 1IGIH 1UYWH 1LO5A 4NNYB 1CFTA 1W0WB 4M1CC 2ADFL 1BQHB 1CXKA 4L9LA 3QUMB 3SHSA 3N85H 2CUIA 1XR8B 4PGEB 5CSGA 4YPGA 3OJDB 2GW5A 4NC1E 1DBKH 5C70A 1PG7X 1DLHA 4LMQI 5F7WC 1F90H 5EZJA 5DD5L 2A6DA 4KDVA 4F37F 4EN3C 1JZ7A 1YJDH 5FYLD 1Q9LB 1VKXA 1KCUH 2NZ9C 3QUYB 5LVEA 3CLEL 3BZ4B 3BO8B 1CT8A 2VZUA 4IRSB 4FFZL 5E4IA 3ROOA 1NMBL 2R1WB 2YBRA 4UT6H 1QP1A 3ALWA 4CU7A 1YNLH 4H26B 3U0TA 4BSWA 5HY9B 1QSEB 2UWEE 1F4YL 2P8MB 3CSYA 3I3DA 3VCLA 2C26A 3HUJF 4K23L 3BW9B 4OGYH 2LTQC 4RGNB 3ZLQC 2AJUL 2XTJE 3UZVB 3FB5B 3X3GL 5E4EC 1YPZB 1BREA 2Q20A 3P4OA 4PRPE 1Q0XH 3U7WH 4OT1L 5IHUL 1DDHB 3RNQA 1MI5A 4POZC 4PRAA 5C07E 4GAYA 2ZOLB 4XPAL 3V5KB 3CMOL 2XPGA 3FO9B 4UNUA 4M5YL 5IQ9A 4JQXA 2HT3C 5D5ME 1JVKA 2HG5B 3OKNA 5GQBA 4NKIH 3QHTC 3KG5A 1BVKA 2FJFB 2Y9RT 4R4BB 2O26U 3JWDC 4WI7A 4HBQA 4ODWA 3WIFB 1FL3B 1LQSR 2AJXL 3DECA 2VH5L 4QO1A 2AI0H 2NQCA 4G6FD 4UDUB 4EOWL