4ZFXA

Siderocalin-mediated recognition and cellular uptake of actinides
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
b'TSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin-mediated recognition, sensitization, and cellular uptake of actinides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/inhibitor
total genus 40
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4zfxA00
2AT8X 5KHPA 4OMWA 5CE4A 1LFOA 4GRJA 2AH7X 1ZRYA 4YCEA 3ZUIA 2LB6A 1LICA 5F58A 4YGGA 5FENA 1B8EA 3D95A 4QYNA 1BLRA 1ERXA 3FLLA 5D48A 3WJGA 4DQ3A 5HTDA 4ZCBA 1IFBA 1G85A 1YWBA 1GM6A 3WJEA 2A2UA 3P6CA 2R73A 2OZQA 5HA1A 1SXYA 4EXZA 4GNWA 3NADA 1DC9A 1SXWA 1MUPA 1CBQA 3B2IA 1TXLA 5HZ9A 1HQPA 5FFHA 4DQ4A 1EIOA 5EPQA 4A8ZA 5F7GA 2NNQA 3EBWA 1Z24A 4ZFXA 1I04A 1KGLA 3CWKA 2P8GA 4CK4A 3ZUOA 3B2LA 3PECA 3C78X 4NLJA 4I9RA 2WEWA 1IKEA 4A60A 1HMSA 3HWDA 2LFOA 2G7BA 5EDCA 2AL0X 2CZUA 5IO5A 1T0VA 2WUTA 1IIUA 3QKGA 2FTBA 4AYHA 3P6FA 5DPQA 1GXAA 1AB0A 2MM3A 2FLJA 2RA6A 1DZPA 2WWPA 2XSTA 1TW4A 4K19A 4PSQA 5LJHA 1I06A 1GX8A 5H9NA 2HYSA 1FDQA 5L8OA 3SAOA 1QFVA 2POAA 1X8OA 2MJIA 5HZQA 1A57A 2AT6X 3T1DA 1GT3A 1X8QA 5HCCC 3WBGA 2L68A 4HPAA 5F6ZA 4TKBA 3FIQA 4BQUA 2DM5A 4YKOA 3BSZE 4M7MA 4D6AA 2W2FA 3EBKA 3FR2A 5HWZA 2CM4A 1ERBA 3F9DA 3HWEA 4OMXA 3TGAA 1QWDA 1B0OA 2W2BA 1SY3A 1JV4A 4YH0A 3S26A 4KIIA 4AZQA 1KXOA 1EIIA 4ZHHA 5C0NA 4N7CA 3G7XA 4YBUA 3IFBA 1HBPA 4IB8A 4QZTA 2E4JA 5EEDA 4IMNA 1R0UA 5L8NA 1YIVA 4R0BA 4ARHA 4QAEA 2NNDA 5L8IA 3B2HA 1NP1A 3WJDA 3D97A 5B27A 3PEDA 3K3LA 1CBIA 4UU2A 1GGLA 1SY0A 3U9PC 4IB6A 1EPBA 3I0AA 3DTQA 4Y0RA 3HWFA 1N0SA 1YP7A 2FT9A 5LJCA 3FA8A 2WR6A 1SXXA 2L5PA 2NNEA 4MVIA 2X46A 4I3BA 1DFVA 5HCEC 1ZNHA 2F73A 1LIFA 1IFCA 1DZKA 2OVEA 4GH7A 4RUNA 1FTPA 2Q39A 4ZHCA 2G79A 4O9SA 4AW8A 3BU9A 4Y0PA 1ACDA 3OJYC 4WFVA 1GKAA 2X45A 3AKNA 2W2AA 1AELA 1KOIA 1BJ7A 4AZPA 5LJDA 4ORYA 1SA8A 1TOUA 2JU7A 1LF7A 4EEJA 3UEVA 3KFGA 2AT0X 1I4UA 4LZVA 2RCTA 1X8UA 3NQ9A 1PEEA 3PPTA 4AZRA 3JS1A 4ODDA 4ZHDA 4EFGA 1LIBA 1E00A 1KT6A 1QQSA 1X8NA 3PP6A 1ZNEA 1TVQA 5D45A 2Q4NA 2A0AA 3CMPA 4MVLA 1KT3A 2Q2PA 2A3FX 3GAQA 2IFBA 5D4AA 1UZ2X 5LJGA 1BSYA 3BS2A 2OFMX 4TNNA 4M6SA 3FELA 3BLGA 3RZYA 3VG5A 2ALLX 2AT3X 5LKFA 1YUPA 1X8PA 2CZTA 1QFTA 4YFQA 1YP6A 1ICNA 1XCAA 2NP1A 3NR3A 1JJJA 5DG4A 1LIDA 3O19A 5H9LA 5HBSA 4IB9A 4IAXA 1EALA 3EMMA 1D3SA 3FMZA 3KFIA 1JYDA 4TKJA 2Q9SA 1JYJA 1HN2A 5KICA 1KT5A 4WFUA 4QGVA 1BEBA 1YWDA 4ALOA 2MO5A 3CQNA 3AKMA 4TKHA 5LJKA 5D8JA 1CJ5A 4NP1A 4OS3A 4ZJ0A 3WJCA 5EEEA 1T8VA 4D6BA 4ORXA 1U0XA 5BVSA 1JBHA 2FS7A 2EU7X 2AKQA 3HK1A 5B29A 4ORSA 2GTFX 4LKTA 2FR2A 2RCQA 2WEXA 4ZR2A 5LJBA 3FEKA 4ORRA 3CBSA 1LIEA 4I9SA 2YG2A 2RD7C 1KQXA 3WJFA 1OBQA 2WSJA 1OBPA 3RSWA 1S2PA 1DF3A 3JSQA 1U18A 1DV9A 5HZ5A 1H91A 1MDCA 3ELZA 4IAWA 2PY1A 4YGHA 1FEMA 4NLIA 1BBPA 2CBSA 2AT5X 1ICMA 1EW3A 3MBTA 4XMFA 4OS8A 4YFPA 1MX8A 3BX8A 3KFFA 5IO7A 4NYRA 2QO4A 3O22A 1B56A 3TF6A 1BRQA 2WQ9A 3BRNA 1G7NA 2R56A 1OPAA 2K23A 5HZ8A 2QOSC 4GNYA 4QGXA 5IO6A 2BLGA 1RLBE 3P6HA 3TGCA 1JZUA 4RUUA 2JN3A 4XMCA 1KQWA 1GKAB 2FRSA 3UEWA 3NPOA 5HTEA 4BVMA 4TQ2A 1T68X 1OEKA 5K06A 1FE3A 4AZMA 1EQDA 3APVA 4IB7A 4BOEA 1FELA 3NX1A 1ADLA 4NNSA 4YFRA 1NGLA 3C76X 3CR6A 2G78A 3FA6A 4XMHA 1AVGI 4ZGUA 2XKLA 1IKJA 1KT4A 1BRPA 5EDBA 3U0DA 2O62A 1ALBA 2GJ5A 2KTDA 3UEUA 1LKEA 1O1UA 3BX7A 1O1VA 4ORWA 5JR8A 3F8AA 3FA9A 3WJBA 1VYFA 1LNMA 1G5WA 1QY2A 3FW4A 3STKA 3VG2A 1P6PA 4QGWA 2HNXA 1GX9A 1QY0A 1OBUA 3FENA 4YCHA 5EZ2A 4QYPA 1UREA 4XMDA 2CBRA 3Q6LA 3KZAA 1B4MA 1VYGA 3HWGA 3STMX 1BWYA 5H9AA 4ZH9A 1ZNKA 2FR3A 4UU3A 1CBSA 4N7DA 1BSOA 4IMOA 5LKEA 2HMBA 3O2YA 1E5PA 2HZQA 3P6EA 1D2UA 1SXUA 1X89A 1ZNLA 3VG3A 1YWCA 1BM5A 4IBAA 1PBOA 1JJXA 4NYQA 4YGZA 2A2GA 2ACOA 2CM9A 2GC9A 1HBQA 3BY0A 1PMPA 2QM9A 4GETA 4ZHGA 1GT4A 2OVAA 2LKKA 3APWA 1LPJA 3FA7A 1O8VA 3WVMA 3FR4A 2ACPX 4Y0SA 5BVQA 2L67A 4EDEA 1HMTA 2A13A 1NP4A 4LKPA 1ML7A 4YKMA 2K62A 2LBVA 1QABE 4HPDA 1L6MA 1SY2A 4GE1A 4ZHFA 3D96A 3STNA 3TZSA 4I3CA 5HA0A 4YDAA 3UEXA 3FEPA 4TJZA 1DZJA 5F6BA 1U17A 3ZQ3A 5BVTA 4YMYA 1KZWA 3FR5A 2LBAA 3PH6A 1S44A 3DSZA 3FW5A 3NP1A 5H8TA 2OVDA 4QZUA 3WXQA 1I05A 1SY1A 3P6DA 3L4RA 4A1HA 1X71A 1CBRA 4YBPA 2JOZA 4HPBA 1IW2A 3NQ3A 4AZOA 3CBCA 4XMGA 4MVKA 2AMMX 1CRBA 4TLJA 2FWVA 3BDRA 1A2DA 2OFRX 2FS6A 5FAZA 1ZNGA 1FENA 1OEEA 1E02A 1EUOA 1A3YA 1EPAA 3APXA 1S7DA 2QO5A 5HAEA 1EXSA 1E06A 3BU1A 5HCDC 4ES7A 3P6GA 1AQBA 3EYCA 2JU8A 3KQ0A 1KT7A 3NX2A 1GT5A 1TOWA 3C77X 2ASNX 1XKIA 5KIDA 4LZUA 1ZNDA 1HMRA 5HZ6A 3IA8A 4HFOA 4ORUA 5AQ6A 4I3DA 2R74A 1VPRA 3VG7A 1BSQA 3PH5A 5LJEA 3U03A 5H9KA 1DZMA 3KFHA 1G74A 3I17A 4ZH6A 3VG6A 2HZRA 4GKCA 3TGBA 2HLVA 3CQRA 4ALBA 2KT4B 2RQ0A 1QY1A 4WBKA 2WQAE 4HPCA 3ELXA 4XMEA 1MVGA 3MVFA 4YDBA 2Q2MA 2QO6A 1RBPA 1YWAA 1A18A 1QG5A 4NNTA 5F1EA 1GT1A 2L9CA 2JU3A 3B2JA 5D47A 1PM1X 2ANSA 3EM0A 1OEJA 3VG4A 1MX7A 1OPBA 4Y0QA 4OS0A 4AZNA 3APUA 4A1YA 2N93A 1KZXA 3B2KA
chains in the Genus database with same CATH superfamily
2AT8X 3P02A 5KHPA 4OMWA 5B11O 5CE4A 1LFOA 1SWEA 4GRJA 4O3ZA 3EC5A 2MF6A 4GJVA 5IRUA 1ZRYA 2GTLN 4YCEA 2AH7X 4Z27A 4JHQA 3ZUIA 5K67A 2LB6A 1LICA 5F58A 4YGGA 3ZW0B 1B8EA 3D95A 4QYNA 4MIRA 5FENA 1ERXA 1BLRA 3FLLA 5D48A 4CPHB 2OY1O 3WJGA 4U8UM 2RTDB 4DQ3A 5HTDA 2FKGA 4QQ1A 4ZCBA 1IFBA 1N9MA 1G85A 1HXZA 4GJSA 1YWBA 1GM6A 2OFAA 3WJEA 2A2UA 3P6CA 2R73A 2OZQA 5HA1A 1SXYA 3HTYA 4ON1A 4EXZA 4GNWA 2A5BA 2RTKA 3SZJA 1VWOB 1DC9A 3NADA 1SXWA 1MUPA 1CBQA 3B2IA 1TXLA 3VHMA 5HZ9A 2IZDB 1HQPA 4NV7A 5FFHA 4DQ4A 1EIOA 5EPQA 4BGFA 4A8ZA 4Z2OA 5F7GA 3RDMA 2NNQA 3EBWA 1N43A 1SWJA 4JGLA 1Z24A 4ZFXA 1I04A 2UZ2A 3RY1A 3VE2A 3CWKA 2P8GA 2X55A 4CK4A 3ZUOA 1KGLA 3B2LA 3PECA 2BHVA 3C78X 3H3IA 4NLJA 2UYWA 1LUQA 4I9RA 2WEWA 3X00A 1IKEA 4A60A 1HMSA 3HWDA 2LFOA 3OE3A 2G7BA 5EDCA 2AL0X 2CZUA 1OSPO 4QRLA 4BBOA 5IO5A 2A5CA 4I6SA 1T0VA 2FGSA 2GH7A 2WUTA 3RDOA 1IIUA 3QKGA 2FTBA 4AYHA 1N7YA 4Z6JA 3P6FA 2LA7A 1STRB 5DPQA 4OELA 1GXAA 2PI3O 1AB0A 2MM3A 2VFBA 2FLJA 5CYBA 2AVIA 1DZPA 2RA6A 2WWPA 1TW4A 1SRHA 2XSTA 4K19A 1I06A 4PSQA 5LJHA 1GX8A 5H9NA 2HYSA 1FDQA 5L8OA 3SAOA 1Y9TA 1QFVA 2BS5A 2POAA 1X8OA 2MJIA 4U9CA 5HZQA 5K68A 1SWDA 1SLGB 1A57A 2AT6X 3Q34A 4BX6A 3T1DA 1JQPA 1GT3A 1X8QA 5HCCC 2OF9A 2FKJA 3WBGA 2L68A 4HPAA 5F6ZA 2OL8O 3MG5A 4TKBA 3FIQA 4BQUA 2DM5A 1E2TA 4YKOA 3BSZE 4M7MA 4D6AA 1SWPA 2W2FA 2F01A 3EBKA 3FR2A 5HWZA 2CM4A 1ERBA 3F9DA 3HWEA 4OMXA 3TGAA 3S5XA 1QWDA 4EKVA 1B0OA 1VWMB 4CDEA 2W2BA 3OBLA 3T6LA 2RTFB 2FHNX 1SY3A 1JV4A 1VWAB 4YH0A 4KIIA 2RTJA 3S26A 1KXOA 1Y55X 4AZQA 1EIIA 4ZHHA 5C0NA 4N7CA 3G7XA 4YBUA 3IFBA 1HBPA 4IB8A 4QZTA 4B55A 2E4JA 5EEDA 1SWGA 4IMNA 1R0UA 4KC7A 2RTQB 5L8NA 1YIVA 4O3WA 1VWCB 4R0BA 2IZLB 4QAEA 2NNDA 4GGZA 3UAQA 4ARHA 2X8SA 2X8FA 5L8IA 2IZKA 3B2HA 1NP1A 4IABA 4MVEA 3D97A 5B27A 3PEDA 3K3LA 1CBIA 1JMXA 1GGLA 1SY0A 1VWGB 1NQMA 4U46A 3FYFA 4UU2A 3U9PC 4IB6A 1EPBA 3I0AA 3DTQA 4Y0RA 3HWFA 1IJ8A 3PK2A 1N0SA 1YP7A 2DJFA 1STSB 2FT9A 5LJCA 4GUZA 3FA8A 2WR6A 2FHLA 4O4OA 1SXXA 2L5PA 4ID2A 2NNEA 4MVIA 1VWFB 2M4LA 2X46A 4FBRA 2OY7A 4I3BA 4CDCA 1DFVA 3E3CA 1ZNHA 4U3QA 5HCEC 1AVDA 1SWUA 2F73A 4GZVA 1LIFA 3WYQA 1IFCA 1DZKA 2CAMA 3RE5A 2HKDA 2OVEA 1SLDB 3KVNA 1SWKA 4O49A 4GH7A 1LELA 4RUNA 1FTPA 2X56A 1KL5A 1STPA 2Q39A 1W6FA 2F09A 2G79A 3LTWA 4FBOA 4O9SA 3BU9A 3PQUA 4Y0PA 4AW8A 4ZHCA 1ACDA 1LCZA 3OJYC 1GKAA 4WFVA 2RTPB 2X45A 1SWLA 3AKNA 2W2AA 2A8GA 4CSBA 1KOIA 1AELA 1PTSA 1BJ7A 4AZPA 3RDXA 2BSZA 5LJDA 4ORYA 1SA8A 1TOUA 2JU7A 1LF7A 4EEJA 5B2AO 3UEVA 3KFGA 2AT0X 1UYOX 1I4UA 4CV7A 4LZVA 1SWCA 1MK5A 1X8UA 2RCTA 3NQ9A 3PPTA 1PEEA 3WOVA 4AZRA 3JS1A 2KTSA 4ODDA 4ZHDA 4EFGA 2RTLA 4KH8A 1LIBA 2IZEB 1E00A 1KT6A 1NDJA 1NQNA 1QQSA 1X8NA 1TVQA 1ZNEA 2Q4NA 2X34A 3MM0A 4Z2VA 2A0AA 3CMPA 4MVLA 1KT3A 3SLJA 2Q2PA 2A3FX 3GAQA 2GTLO 2IFBA 5D4AA 1UZ2X 1I9HA 5LJGA 1BSYA 3BS2A 2OFMX 4TNNA 4M6SA 2KD2A 3FELA 3GE2A 4PJ2A 2BT9A 3BLGA 3VPJE 3RZYA 3VG5A 2ALLX 2AT3X 4C5PA 5AJBA 5LKFA 1YUPA 1K24A 1SRIA 1X8PA 1SWSA 2CZTA 4WHIA 1QFTA 2YMSA 1N9YA 2RN4A 1JIWI 2DJGA 2JW1A 2OFBA 1YP6A 2IZHB 3NBXX 4YFQA 1ICNA 1XCAA 4GDAA 2NP1A 2VFCA 2OY5O 2X8TA 3NR3A 3VHIA 5DG4A 1LIDA 3WYPA 1JJJA 3SOTA 3O19A 3MX7A 4GGTA 5H9LA 5HBSA 4IB9A 4IAXA 3S60A 1RAVA 4CPFA 1EALA 3EMMA 1D3SA 3FMZA 4BX6B 3KFIA 1JYDA 4TKJA 3ZW1A 2Q9SA 4HWMA 1JYJA 1HN2A 2KW1A 3AUMO 5KICA 4KC8A 2IZAA 4GGRA 1KT5A 4WFUA 4QGVA 1SREA 2QCBA 1BEBA 1YWDA 4ALOA 2MO5A 2GTLM 2X4MA 3CQNA 3AKMA 4TKHA 5LJKA 5D8JA 1CJ5A 4GD9A 2RTMA 4NP1A 5CHKA 4OS3A 1SWRA 4ZJ0A 3WJCA 5EEEA 1T8VA 4D6BA 2C1SA 2MHDA 4ORXA 2VDFA 1U0XA 5BVSA 2ZAIA 2FS7A 5B10O 1JBHA 2EU7X 2AKQA 3HK1A 5B29A 4ORSA 3SLOA 2GTFX 4LKTA 2FR2A 2RCQA 2WEXA 4ZR2A 3WZNA 4BX5A 5LJBA 4KT5A 3FEKA 1RXKA 3CBSA 4ORRA 1LIEA 1MEPA 5FQ8E 4I9SA 4GDZA 2YG2A 3T6FA 2RD7C 1KQXA 3QQ2A 3WJFA 1OBQA 2WSJA 1OBPA 3RSWA 1S2PA 1DF3A 3JSQA 1SRFA 1U18A 2IZFB 2IZIA 1DV9A 5HZ5A 2RTNB 2IZBA 4Z2PA 2AF5A 1H91A 3VHHA 3LHNA 1MDCA 3ELZA 2JGSA 1JMZA 2RTIB 4IAWA 2PY1A 2C4IA 4YGHA 1FEMA 3F6ZB 4NLIA 1BBPA 1NBXA 3RDUA 2CBSA 2AT5X 1ICMA 1EW3A 2QOMA 3MBTA 4XMFA 4OS8A 3JQOA 4YFPA 1MX8A 3BX8A 2RTOB 3CKGA 3KFFA 5IO7A 4NYRA 2QO4A 3RKGA 3O22A 3FDCA 1KFFA 1B56A 1KL3A 3TF6A 1SRGA 1BRQA 2RTGB 2WQ9A 3HOEA 3ZW2A 3BRNA 1G7NA 2R56A 1OPAA 2K23A 3WZPA 4MISA 5HZ8A 2QOSC 1VWLB 4GNYA 4O3YA 5IRAA 4QGXA 4CPIA 3SZHA 2BLGA 1FJ1E 3ZWEA 4BJ8A 1RLBE 3P6HA 5BYPA 5IO6A 3TGCA 4Y5DA 1JZUA 4RUUA 2WPUA 2JN3A 2OVSA 3PP6A 4XMCA 1KQWA 4Y59A 1GKAB 2FRSA 1VWRB 4U8UN 3UEWA 3NPOA 5HTEA 4BVMA 4TQ2A 1HQQA 3LV4A 1T68X 1VWNB 1EI5A 5IRWA 1OEKA 5K06A 2OYBO 1FE3A 4AZMA 1EQDA 1W4TA 5F2BA 1VWQB 3APVA 4IB7A 4BOEA 1FELA 3NX1A 1ADLA 4NNSA 2BS6A 4CDFA 4YFRA 5B5FA 1NGLA 1SMPI 3C76X 2G78A 3CR6A 2OF8A 1AVGI 3FA6A 4XMHA 3VGWA 5CSEA 4ZGUA 2XKLA 4U8UO 4ZGFA 1IKJA 1KT4A 1BRPA 5EDBA 3VE1A 3U0DA 1SWFA 2O62A 1RSUB 4DNEA 1ALBA 1VWPB 2GJ5A 2KTDA 3UEUA 1LKEA 1O1UA 3BX7A 4MEEA 1O1VA 4ORWA 5JR8A 4GK9A 2RTBB 3F8AA 1VWKB 3FA9A 3WJBA 1VYFA 1LNMA 1VYOA 4JNJA 1G5WA 1QY2A 1SWAA 4IRWA 3FW4A 3STKA 3VG2A 1P6PA 1AVEA 2HNXA 1GX9A 4QGWA 1QY0A 4QNIA 4O3XB 1OBUA 3D4RA 3FENA 5B5GA 4YCHA 5EZ2A 3WJDA 4QYPA 1JJUA 1UREA 4JO6A 2OL6O 4XMDA 2CBRA 3EW2A 3OD9A 1HY2A 3Q6LA 3KZAA 4ML7B 1B4MA 1VYGA 3HWGA 3STMX 1BWYA 5H9AA 1Y53X 1ZNKA 4ZH9A 2FR3A 4UU3A 1CBSA 1SWBA 4N7DA 1BSOA 4OKAA 1GX3A 4IMOA 3ZW1B 1Y9LA 4I60A 5LKEA 4YVBA 4NW4A 2X32A 2Z4IA 2HMBA 4EQAC 3O2YA 1E5PA 2HZQA 4COTA 2ZAGA 3P6EA 4O4SA 1D2UA 1MOYA 1SXUA 1X89A 4LQZA 1ZNLA 3V8UA 3VG3A 3N91A 1YWCA 2IZCB 1BM5A 4IBAA 1PBOA 2IZJA 1VWIB 1JJXA 4NYQA 4YGZA 2A2GA 4Z28A 2ACOA 4BX5B 4L1NA 2CM9A 2GC9A 1HBQA 3BY0A 1PMPA 1SLFB 2QM9A 4GETA 4FGIB 3ZW0A 4CPEA 4ZHGA 1GT4A 4O4UA 2OVAA 3CKFA 3PQSA 2LKKA 3APWA 1LPJA 4CPHA 3FA7A 1O8VA 3WVMA 3FR4A 2ACPX 4Y0SA 1Y52X 5BVQA 5IXGA 2L67A 1K3BA 4EDEA 1HMTA 3S5VA 2A13A 1NP4A 4LKPA 1ML7A 4YKMA 3RDQA 2K62A 3HPEA 2I5VO 4BX7B 2LBVA 1QABE 4HPDA 1L6MA 1NC9A 1SY2A 4GE1A 5D45A 4ZHFA 2G8CO 3D96A 3RBYA 3STNA 3VU1A 4DCBA 3TZSA 2Y32A 4I3CA 5HA0A 4YDAA 1WBIA 3T2WA 2C1QA 3UEXA 3FEPA 1KL4A 4TJZA 1DZJA 3P24A 5F6BA 1U17A 1SWOA 3ZZVA 3ZQ3A 5BVTA 4YMYA 2G5LA 2RTRB 1SLEB 3PDFA 3FR5A 2LBAA 3PH6A 1KZWA 1S44A 4I95A 3DSZA 3FW5A 3NP1A 2Y3FA 5H8TA 2OVDA 4QZUA 3WXQA 1I05A 1HXLA 1SY1A 3P6DA 1SWTA 3L4RA 1LDOA 2JMBA 5B3MO 3RE6A 4BX7A 2RTCB 4A1HA 1DF8A 4BCSA 1X71A 1CBRA 4YBPA 1SRJA 2JOZA 1IW2A 4HPBA 3NQ3A 3ZI8A 3WZQA 4AZOA 3AEHA 3SZIA 3CBCA 5AJCA 4XMGA 4MVKA 2AMMX 1CRBA 3D9WA 2RTHB 4TLJA 1VWHB 2FWVA 3BDRA 1A2DA 2OFRX 2FS6A 2MWHA 1ZNGA 1FENA 1OEEA 1PBYA 1E02A 1EUOA 4KCAA 5FAZA 1A3YA 1EPAA 1LCWA 3APXA 1S7DA 2QO5A 3EW1A 3NQKA 5HAEA 1EXSA 1SWHA 1E06A 1RSTB 3BU1A 3RWXA 3T2XA 4ES7A 3P6GA 5HCDC 1AQBA 3EYCA 2JU8A 1SWNA 3KQ0A 1KT7A 3NX2A 1GT5A 1TOWA 1N4JA 3HOLA 3C77X 2OY8A 2ASNX 1XKIA 4INNA 5KIDA 2IZGB 2Z4HA 1ZNDA 4FBVA 4LZUA 1HMRA 5HZ6A 3IA8A 4HFOA 4ORUA 4GU8A 5AQ6A 1LDQA 2I5ZO 2R74A 1VPRA 1VWEB 4I3DA 3VG7A 1BSQA 1W5RA 5FQ6E 3PH5A 5LJEA 3U03A 1I78A 5H9KA 4CDDA 3RDSA 1DZMA 3KFHA 1G74A 1MM9A 3I17A 4ZH6A 3VG6A 2HZRA 2OL7A 4GKCA 4L3RA 2HLVA 3CQRA 3TGBA 1Y0GA 4ALBA 4NV8A 2KT4B 2RQ0A 1QY1A 4WBKA 2WQAE 4HPCA 3ELXA 4XMEA 5L3YA 1WUBA 1SWQA 1MVGA 4FQBB 2BC3A 1VWJB 1LCVA 3MVFA 5AEOA 1VWBB 4YDBA 2Q2MA 2QO6A 1RBPA 3RY2A 1YWAA 1A18A 1QG5A 4NNTA 5F1EA 1GT1A 2L9CA 4O4XA 2JU3A 3B2JA 3FIDA 4OEMA 5D47A 1PM1X 3WZOA 2ZSCA 2ANSA 3EM0A 1OEJA 3VG4A 1RXJA 1MX7A 1OPBA 4Y0QA 4OS0A 2RTEB 1UYNX 2Y3EA 3APUA 4A1YA 2N93A 2RTAA 1VWDB 5FQ7E 5JD2A 4AZNA 1KZXA 3SLTA 2QMIA 1RXHA 3B2KA
chains in the Genus database with same CATH topology
2AT8X 3P02A 5KHPA 4OMWA 5CE4A 1LFOA 4O3ZA 4GRJA 2AH7X 1ZRYA 2GTLN 4YCEA 3ZUIA 2LB6A 1LICA 5F58A 4YGGA 3ZW0B 1B8EA 3D95A 4QYNA 4MIRA 5FENA 1ERXA 1BLRA 3FLLA 5D48A 3WJGA 4U8UM 4DQ3A 5HTDA 4QQ1A 4ZCBA 1IFBA 1G85A 1YWBA 1GM6A 3WJEA 2A2UA 3P6CA 2R73A 2OZQA 5HA1A 1SXYA 3HTYA 4ON1A 4EXZA 4GNWA 3NADA 1DC9A 1SXWA 1MUPA 1CBQA 3B2IA 1TXLA 5HZ9A 1HQPA 5FFHA 4DQ4A 1EIOA 5EPQA 4A8ZA 5F7GA 2NNQA 3EBWA 4JGLA 1Z24A 4ZFXA 1I04A 3VE2A 1KGLA 3CWKA 2P8GA 4CK4A 3ZUOA 3B2LA 3PECA 2BHVA 3C78X 3H3IA 4NLJA 4I9RA 2WEWA 1IKEA 4A60A 1HMSA 3HWDA 2LFOA 3OE3A 2G7BA 5EDCA 2AL0X 2CZUA 4QRLA 5IO5A 4I6SA 1T0VA 2WUTA 1IIUA 3QKGA 2FTBA 4AYHA 3P6FA 2LA7A 5DPQA 1GXAA 1AB0A 2MM3A 2FLJA 5CYBA 2RA6A 1DZPA 2WWPA 2XSTA 1TW4A 4K19A 4PSQA 5LJHA 1I06A 1GX8A 5H9NA 2HYSA 1FDQA 5L8OA 3SAOA 1Y9TA 1QFVA 2BS5A 2POAA 1X8OA 2MJIA 4U9CA 5HZQA 1A57A 2AT6X 3T1DA 1GT3A 1X8QA 5HCCC 3WBGA 2L68A 4HPAA 5F6ZA 4TKBA 3FIQA 4BQUA 2DM5A 4YKOA 3BSZE 4M7MA 4D6AA 2W2FA 3EBKA 3FR2A 5HWZA 2CM4A 1ERBA 3F9DA 3HWEA 4OMXA 3TGAA 3S5XA 1QWDA 1B0OA 2W2BA 3OBLA 1SY3A 1JV4A 4YH0A 3S26A 4KIIA 4AZQA 1KXOA 1EIIA 4ZHHA 5C0NA 4N7CA 3G7XA 4YBUA 3IFBA 1HBPA 4IB8A 4QZTA 2E4JA 5EEDA 4IMNA 1R0UA 4KC7A 5L8NA 1YIVA 4O3WA 4R0BA 3UAQA 4ARHA 4QAEA 2NNDA 2X8SA 2X8FA 5L8IA 3B2HA 4IABA 1NP1A 4MVEA 3WJDA 3D97A 5B27A 3PEDA 3K3LA 1CBIA 4UU2A 1GGLA 1SY0A 3U9PC 3FYFA 4IB6A 1EPBA 3I0AA 3DTQA 4Y0RA 3HWFA 1N0SA 1YP7A 2FT9A 5LJCA 3FA8A 2WR6A 4O4OA 1SXXA 2L5PA 4ID2A 2NNEA 4MVIA 2M4LA 2X46A 4FBRA 4I3BA 1DFVA 3E3CA 1ZNHA 4U3QA 5HCEC 2F73A 4GZVA 1LIFA 1IFCA 1DZKA 2OVEA 4O49A 4GH7A 4RUNA 1FTPA 2Q39A 2F09A 4ZHCA 2G79A 4FBOA 4O9SA 3BU9A 3PQUA 4Y0PA 4AW8A 1ACDA 3OJYC 4WFVA 1GKAA 2X45A 3AKNA 2W2AA 4CSBA 1AELA 1KOIA 1BJ7A 4AZPA 5LJDA 4ORYA 1SA8A 1TOUA 2JU7A 1LF7A 4EEJA 3UEVA 3KFGA 2AT0X 1I4UA 4CV7A 4LZVA 2RCTA 1X8UA 3NQ9A 1PEEA 3PPTA 3WOVA 4AZRA 3JS1A 2KTSA 4ODDA 4ZHDA 4EFGA 4KH8A 1LIBA 1E00A 1KT6A 1QQSA 1X8NA 3PP6A 1ZNEA 1TVQA 5D45A 2Q4NA 2A0AA 3CMPA 4MVLA 1KT3A 2Q2PA 2A3FX 3GAQA 2GTLO 2IFBA 5D4AA 1UZ2X 5LJGA 1BSYA 3BS2A 2OFMX 4TNNA 4M6SA 2KD2A 3FELA 3GE2A 4PJ2A 2BT9A 3BLGA 3VPJE 3RZYA 3VG5A 2ALLX 2AT3X 5AJBA 5LKFA 1YUPA 4WHIA 1X8PA 2CZTA 1QFTA 2YMSA 2RN4A 1JIWI 2JW1A 3NBXX 1YP6A 4YFQA 1ICNA 1XCAA 2NP1A 2X8TA 3NR3A 1JJJA 5DG4A 1LIDA 3SOTA 3O19A 3MX7A 5H9LA 5HBSA 4IB9A 4IAXA 3S60A 1EALA 3EMMA 1D3SA 3FMZA 3KFIA 1JYDA 4TKJA 3ZW1A 2Q9SA 4HWMA 1JYJA 1HN2A 2KW1A 5KICA 4KC8A 1KT5A 4WFUA 4QGVA 1BEBA 1YWDA 4ALOA 2MO5A 2GTLM 3CQNA 3AKMA 4TKHA 5LJKA 5D8JA 1CJ5A 4NP1A 4OS3A 4ZJ0A 3WJCA 5EEEA 1T8VA 4D6BA 2MHDA 4ORXA 1U0XA 5BVSA 2ZAIA 2FS7A 1JBHA 2EU7X 2AKQA 3HK1A 5B29A 4ORSA 2GTFX 4LKTA 2FR2A 2RCQA 2WEXA 4ZR2A 5LJBA 4KT5A 3FEKA 4ORRA 3CBSA 1LIEA 5FQ8E 4I9SA 4GDZA 2YG2A 2RD7C 1KQXA 3WJFA 1OBQA 2WSJA 1OBPA 3RSWA 1S2PA 1DF3A 3JSQA 1U18A 1DV9A 5HZ5A 1H91A 3LHNA 1MDCA 3ELZA 4IAWA 2PY1A 4YGHA 1FEMA 3F6ZB 4NLIA 1BBPA 2CBSA 2AT5X 1ICMA 1EW3A 3MBTA 4XMFA 4OS8A 3JQOA 4YFPA 1MX8A 3BX8A 3KFFA 5IO7A 4NYRA 2QO4A 3RKGA 3O22A 3ZW2A 1B56A 3TF6A 1BRQA 2WQ9A 3HOEA 3BRNA 1G7NA 2R56A 1OPAA 2K23A 4MISA 5HZ8A 2QOSC 4GNYA 4O3YA 4QGXA 5IO6A 2BLGA 3ZWEA 5BYPA 1RLBE 3P6HA 3TGCA 1JZUA 4RUUA 2JN3A 2OVSA 4XMCA 1KQWA 1GKAB 2FRSA 4U8UN 3UEWA 3NPOA 5HTEA 4BVMA 4TQ2A 3LV4A 1T68X 1EI5A 1OEKA 5K06A 1FE3A 4AZMA 1EQDA 3APVA 4IB7A 4BOEA 1FELA 3NX1A 1ADLA 4NNSA 2BS6A 4YFRA 1NGLA 1SMPI 3C76X 2G78A 3CR6A 3FA6A 1AVGI 4XMHA 4ZGUA 2XKLA 4U8UO 4ZGFA 1IKJA 1KT4A 1BRPA 5EDBA 3VE1A 3U0DA 2O62A 1ALBA 2GJ5A 2KTDA 3UEUA 1LKEA 1O1UA 3BX7A 1O1VA 4ORWA 5JR8A 4GK9A 3F8AA 3FA9A 3WJBA 1VYFA 1LNMA 1G5WA 1QY2A 3FW4A 3STKA 3VG2A 1P6PA 4QGWA 2HNXA 1GX9A 1QY0A 4QNIA 4O3XB 1OBUA 3D4RA 3FENA 4YCHA 5EZ2A 4QYPA 1UREA 4XMDA 2CBRA 3OD9A 3Q6LA 3KZAA 4ML7B 1B4MA 1VYGA 3HWGA 3STMX 1BWYA 5H9AA 4ZH9A 1ZNKA 2FR3A 4UU3A 1CBSA 4N7DA 1BSOA 4IMOA 3ZW1B 1Y9LA 5LKEA 4NW4A 2Z4IA 2HMBA 4EQAC 3O2YA 1E5PA 2HZQA 4COTA 2ZAGA 3P6EA 4O4SA 1D2UA 1SXUA 1X89A 4LQZA 1ZNLA 3V8UA 3VG3A 3N91A 1YWCA 1BM5A 4IBAA 1PBOA 1JJXA 4NYQA 4YGZA 2A2GA 2ACOA 4L1NA 2CM9A 2GC9A 1HBQA 3BY0A 1PMPA 2QM9A 4GETA 4FGIB 3ZW0A 4ZHGA 1GT4A 4O4UA 2OVAA 3PQSA 2LKKA 3APWA 1LPJA 3FA7A 1O8VA 3WVMA 3FR4A 2ACPX 4Y0SA 5BVQA 2L67A 4EDEA 1HMTA 3S5VA 2A13A 1NP4A 4LKPA 1ML7A 4YKMA 2K62A 2LBVA 1QABE 4HPDA 1L6MA 1SY2A 4GE1A 4ZHFA 3D96A 3RBYA 3STNA 3TZSA 3VU1A 4I3CA 5HA0A 4YDAA 3UEXA 3FEPA 4TJZA 1DZJA 3P24A 5F6BA 1U17A 3ZZVA 3ZQ3A 5BVTA 4YMYA 1KZWA 3FR5A 2LBAA 3PH6A 1S44A 4I95A 3DSZA 3FW5A 3NP1A 5H8TA 2OVDA 4QZUA 3WXQA 1I05A 1SY1A 3P6DA 3L4RA 2JMBA 4A1HA 1X71A 1CBRA 4YBPA 2JOZA 4HPBA 1IW2A 3NQ3A 3ZI8A 4AZOA 3CBCA 5AJCA 4XMGA 4MVKA 2AMMX 1CRBA 4TLJA 2FWVA 3BDRA 1A2DA 2OFRX 2FS6A 2MWHA 1ZNGA 1FENA 1OEEA 4KCAA 1E02A 1EUOA 5FAZA 1A3YA 1EPAA 3APXA 3NQKA 1S7DA 2QO5A 5HAEA 1EXSA 1E06A 3BU1A 5HCDC 3RWXA 4ES7A 3P6GA 1AQBA 3EYCA 2JU8A 3KQ0A 1KT7A 3NX2A 1GT5A 1TOWA 3HOLA 3C77X 2ASNX 1XKIA 4INNA 5KIDA 4LZUA 2Z4HA 1ZNDA 4FBVA 1HMRA 5HZ6A 3IA8A 4HFOA 4ORUA 4GU8A 5AQ6A 4I3DA 2R74A 1VPRA 3VG7A 1BSQA 5FQ6E 3PH5A 5LJEA 3U03A 5H9KA 1DZMA 3KFHA 1G74A 3I17A 4ZH6A 3VG6A 2HZRA 4GKCA 4L3RA 3TGBA 2HLVA 3CQRA 4ALBA 2KT4B 2RQ0A 1QY1A 4WBKA 2WQAE 4HPCA 3ELXA 4XMEA 1MVGA 4FQBB 3MVFA 5AEOA 4YDBA 2Q2MA 2QO6A 1RBPA 1YWAA 1A18A 1QG5A 4NNTA 5F1EA 1GT1A 2L9CA 4O4XA 2JU3A 3B2JA 5D47A 1PM1X 2ANSA 3EM0A 1OEJA 3VG4A 1MX7A 1OPBA 4Y0QA 4OS0A 4AZNA 3APUA 4A1YA 2N93A 5FQ7E 1KZXA 2QMIA 3B2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AT8 X;  5KHP A;  4OMW A;  5CE4 A;  1LFO A;  4GRJ A;  2AH7 X;  1ZRY A;  4YCE A;  3ZUI A;  2LB6 A;  1LIC A;  5F58 A;  4YGG A;  5FEN A;  1B8E A;  3D95 A;  4QYN A;  1BLR A;  1ERX A;  3FLL A;  5D48 A;  3WJG A;  4DQ3 A;  5HTD A;  4ZCB A;  1IFB A;  1G85 A;  1YWB A;  1GM6 A;  3WJE A;  2A2U A;  3P6C A;  2R73 A;  2OZQ A;  5HA1 A;  1SXY A;  4EXZ A;  4GNW A;  3NAD A;  1DC9 A;  1SXW A;  1MUP A;  1CBQ A;  3B2I A;  1TXL A;  5HZ9 A;  1HQP A;  5FFH A;  4DQ4 A;  1EIO A;  5EPQ A;  4A8Z A;  5F7G A;  2NNQ A;  3EBW A;  1Z24 A;  4ZFX A;  1I04 A;  1KGL A;  3CWK A;  2P8G A;  4CK4 A;  3ZUO A;  3B2L A;  3PEC A;  3C78 X;  4NLJ A;  4I9R A;  2WEW A;  1IKE A;  4A60 A;  1HMS A;  3HWD A;  2LFO A;  2G7B A;  5EDC A;  2AL0 X;  2CZU A;  5IO5 A;  1T0V A;  2WUT A;  1IIU A;  3QKG A;  2FTB A;  4AYH A;  3P6F A;  5DPQ A;  1GXA A;  1AB0 A;  2MM3 A;  2FLJ A;  2RA6 A;  1DZP A;  2WWP A;  2XST A;  1TW4 A;  4K19 A;  4PSQ A;  5LJH A;  1I06 A;  1GX8 A;  5H9N A;  2HYS A;  1FDQ A;  5L8O A;  3SAO A;  1QFV A;  2POA A;  1X8O A;  2MJI A;  5HZQ A;  1A57 A;  2AT6 X;  3T1D A;  1GT3 A;  1X8Q A;  5HCC C;  3WBG A;  2L68 A;  4HPA A;  5F6Z A;  4TKB A;  3FIQ A;  4BQU A;  2DM5 A;  4YKO A;  3BSZ E;  4M7M A;  4D6A A;  2W2F A;  3EBK A;  3FR2 A;  5HWZ A;  2CM4 A;  1ERB A;  3F9D A;  3HWE A;  4OMX A;  3TGA A;  1QWD A;  1B0O A;  2W2B A;  1SY3 A;  1JV4 A;  4YH0 A;  3S26 A;  4KII A;  4AZQ A;  1KXO A;  1EII A;  4ZHH A;  5C0N A;  4N7C A;  3G7X A;  4YBU A;  3IFB A;  1HBP A;  4IB8 A;  4QZT A;  2E4J A;  5EED A;  4IMN A;  1R0U A;  5L8N A;  1YIV A;  4R0B A;  4ARH A;  4QAE A;  2NND A;  5L8I A;  3B2H A;  1NP1 A;  3WJD A;  3D97 A;  5B27 A;  3PED A;  3K3L A;  1CBI A;  4UU2 A;  1GGL A;  1SY0 A;  3U9P C;  4IB6 A;  1EPB A;  3I0A A;  3DTQ A;  4Y0R A;  3HWF A;  1N0S A;  1YP7 A;  2FT9 A;  5LJC A;  3FA8 A;  2WR6 A;  1SXX A;  2L5P A;  2NNE A;  4MVI A;  2X46 A;  4I3B A;  1DFV A;  5HCE C;  1ZNH A;  2F73 A;  1LIF A;  1IFC A;  1DZK A;  2OVE A;  4GH7 A;  4RUN A;  1FTP A;  2Q39 A;  4ZHC A;  2G79 A;  4O9S A;  4AW8 A;  3BU9 A;  4Y0P A;  1ACD A;  3OJY C;  4WFV A;  1GKA A;  2X45 A;  3AKN A;  2W2A A;  1AEL A;  1KOI A;  1BJ7 A;  4AZP A;  5LJD A;  4ORY A;  1SA8 A;  1TOU A;  2JU7 A;  1LF7 A;  4EEJ A;  3UEV A;  3KFG A;  2AT0 X;  1I4U A;  4LZV A;  2RCT A;  1X8U A;  3NQ9 A;  1PEE A;  3PPT A;  4AZR A;  3JS1 A;  4ODD A;  4ZHD A;  4EFG A;  1LIB A;  1E00 A;  1KT6 A;  1QQS A;  1X8N A;  3PP6 A;  1ZNE A;  1TVQ A;  5D45 A;  2Q4N A;  2A0A A;  3CMP A;  4MVL A;  1KT3 A;  2Q2P A;  2A3F X;  3GAQ A;  2IFB A;  5D4A A;  1UZ2 X;  5LJG A;  1BSY A;  3BS2 A;  2OFM X;  4TNN A;  4M6S A;  3FEL A;  3BLG A;  3RZY A;  3VG5 A;  2ALL X;  2AT3 X;  5LKF A;  1YUP A;  1X8P A;  2CZT A;  1QFT A;  4YFQ A;  1YP6 A;  1ICN A;  1XCA A;  2NP1 A;  3NR3 A;  1JJJ A;  5DG4 A;  1LID A;  3O19 A;  5H9L A;  5HBS A;  4IB9 A;  4IAX A;  1EAL A;  3EMM A;  1D3S A;  3FMZ A;  3KFI A;  1JYD A;  4TKJ A;  2Q9S A;  1JYJ A;  1HN2 A;  5KIC A;  1KT5 A;  4WFU A;  4QGV A;  1BEB A;  1YWD A;  4ALO A;  2MO5 A;  3CQN A;  3AKM A;  4TKH A;  5LJK A;  5D8J A;  1CJ5 A;  4NP1 A;  4OS3 A;  4ZJ0 A;  3WJC A;  5EEE A;  1T8V A;  4D6B A;  4ORX A;  1U0X A;  5BVS A;  1JBH A;  2FS7 A;  2EU7 X;  2AKQ A;  3HK1 A;  5B29 A;  4ORS A;  2GTF X;  4LKT A;  2FR2 A;  2RCQ A;  2WEX A;  4ZR2 A;  5LJB A;  3FEK A;  4ORR A;  3CBS A;  1LIE A;  4I9S A;  2YG2 A;  2RD7 C;  1KQX A;  3WJF A;  1OBQ A;  2WSJ A;  1OBP A;  3RSW A;  1S2P A;  1DF3 A;  3JSQ A;  1U18 A;  1DV9 A;  5HZ5 A;  1H91 A;  1MDC A;  3ELZ A;  4IAW A;  2PY1 A;  4YGH A;  1FEM A;  4NLI A;  1BBP A;  2CBS A;  2AT5 X;  1ICM A;  1EW3 A;  3MBT A;  4XMF A;  4OS8 A;  4YFP A;  1MX8 A;  3BX8 A;  3KFF A;  5IO7 A;  4NYR A;  2QO4 A;  3O22 A;  1B56 A;  3TF6 A;  1BRQ A;  2WQ9 A;  3BRN A;  1G7N A;  2R56 A;  1OPA A;  2K23 A;  5HZ8 A;  2QOS C;  4GNY A;  4QGX A;  5IO6 A;  2BLG A;  1RLB E;  3P6H A;  3TGC A;  1JZU A;  4RUU A;  2JN3 A;  4XMC A;  1KQW A;  1GKA B;  2FRS A;  3UEW A;  3NPO A;  5HTE A;  4BVM A;  4TQ2 A;  1T68 X;  1OEK A;  5K06 A;  1FE3 A;  4AZM A;  1EQD A;  3APV A;  4IB7 A;  4BOE A;  1FEL A;  3NX1 A;  1ADL A;  4NNS A;  4YFR A;  1NGL A;  3C76 X;  3CR6 A;  2G78 A;  3FA6 A;  4XMH A;  1AVG I;  4ZGU A;  2XKL A;  1IKJ A;  1KT4 A;  1BRP A;  5EDB A;  3U0D A;  2O62 A;  1ALB A;  2GJ5 A;  2KTD A;  3UEU A;  1LKE A;  1O1U A;  3BX7 A;  1O1V A;  4ORW A;  5JR8 A;  3F8A A;  3FA9 A;  3WJB A;  1VYF A;  1LNM A;  1G5W A;  1QY2 A;  3FW4 A;  3STK A;  3VG2 A;  1P6P A;  4QGW A;  2HNX A;  1GX9 A;  1QY0 A;  1OBU A;  3FEN A;  4YCH A;  5EZ2 A;  4QYP A;  1URE A;  4XMD A;  2CBR A;  3Q6L A;  3KZA A;  1B4M A;  1VYG A;  3HWG A;  3STM X;  1BWY A;  5H9A A;  4ZH9 A;  1ZNK A;  2FR3 A;  4UU3 A;  1CBS A;  4N7D A;  1BSO A;  4IMO A;  5LKE A;  2HMB A;  3O2Y A;  1E5P A;  2HZQ A;  3P6E A;  1D2U A;  1SXU A;  1X89 A;  1ZNL A;  3VG3 A;  1YWC A;  1BM5 A;  4IBA A;  1PBO A;  1JJX A;  4NYQ A;  4YGZ A;  2A2G A;  2ACO A;  2CM9 A;  2GC9 A;  1HBQ A;  3BY0 A;  1PMP A;  2QM9 A;  4GET A;  4ZHG A;  1GT4 A;  2OVA A;  2LKK A;  3APW A;  1LPJ A;  3FA7 A;  1O8V A;  3WVM A;  3FR4 A;  2ACP X;  4Y0S A;  5BVQ A;  2L67 A;  4EDE A;  1HMT A;  2A13 A;  1NP4 A;  4LKP A;  1ML7 A;  4YKM A;  2K62 A;  2LBV A;  1QAB E;  4HPD A;  1L6M A;  1SY2 A;  4GE1 A;  4ZHF A;  3D96 A;  3STN A;  3TZS A;  4I3C A;  5HA0 A;  4YDA A;  3UEX A;  3FEP A;  4TJZ A;  1DZJ A;  5F6B A;  1U17 A;  3ZQ3 A;  5BVT A;  4YMY A;  1KZW A;  3FR5 A;  2LBA A;  3PH6 A;  1S44 A;  3DSZ A;  3FW5 A;  3NP1 A;  5H8T A;  2OVD A;  4QZU A;  3WXQ A;  1I05 A;  1SY1 A;  3P6D A;  3L4R A;  4A1H A;  1X71 A;  1CBR A;  4YBP A;  2JOZ A;  4HPB A;  1IW2 A;  3NQ3 A;  4AZO A;  3CBC A;  4XMG A;  4MVK A;  2AMM X;  1CRB A;  4TLJ A;  2FWV A;  3BDR A;  1A2D A;  2OFR X;  2FS6 A;  5FAZ A;  1ZNG A;  1FEN A;  1OEE A;  1E02 A;  1EUO A;  1A3Y A;  1EPA A;  3APX A;  1S7D A;  2QO5 A;  5HAE A;  1EXS A;  1E06 A;  3BU1 A;  5HCD C;  4ES7 A;  3P6G A;  1AQB A;  3EYC A;  2JU8 A;  3KQ0 A;  1KT7 A;  3NX2 A;  1GT5 A;  1TOW A;  3C77 X;  2ASN X;  1XKI A;  5KID A;  4LZU A;  1ZND A;  1HMR A;  5HZ6 A;  3IA8 A;  4HFO A;  4ORU A;  5AQ6 A;  4I3D A;  2R74 A;  1VPR A;  3VG7 A;  1BSQ A;  3PH5 A;  5LJE A;  3U03 A;  5H9K A;  1DZM A;  3KFH A;  1G74 A;  3I17 A;  4ZH6 A;  3VG6 A;  2HZR A;  4GKC A;  3TGB A;  2HLV A;  3CQR A;  4ALB A;  2KT4 B;  2RQ0 A;  1QY1 A;  4WBK A;  2WQA E;  4HPC A;  3ELX A;  4XME A;  1MVG A;  3MVF A;  4YDB A;  2Q2M A;  2QO6 A;  1RBP A;  1YWA A;  1A18 A;  1QG5 A;  4NNT A;  5F1E A;  1GT1 A;  2L9C A;  2JU3 A;  3B2J A;  5D47 A;  1PM1 X;  2ANS A;  3EM0 A;  1OEJ A;  3VG4 A;  1MX7 A;  1OPB A;  4Y0Q A;  4OS0 A;  4AZN A;  3APU A;  4A1Y A;  2N93 A;  1KZX A;  3B2K A; 
#chains in the Genus database with same CATH topology
 2AT8 X;  3P02 A;  5KHP A;  4OMW A;  5B11 O;  5CE4 A;  1LFO A;  1SWE A;  4GRJ A;  4O3Z A;  3EC5 A;  2MF6 A;  4GJV A;  5IRU A;  1ZRY A;  2GTL N;  4YCE A;  2AH7 X;  4Z27 A;  4JHQ A;  3ZUI A;  5K67 A;  2LB6 A;  1LIC A;  5F58 A;  4YGG A;  3ZW0 B;  1B8E A;  3D95 A;  4QYN A;  4MIR A;  5FEN A;  1ERX A;  1BLR A;  3FLL A;  5D48 A;  4CPH B;  2OY1 O;  3WJG A;  4U8U M;  2RTD B;  4DQ3 A;  5HTD A;  2FKG A;  4QQ1 A;  4ZCB A;  1IFB A;  1N9M A;  1G85 A;  1HXZ A;  4GJS A;  1YWB A;  1GM6 A;  2OFA A;  3WJE A;  2A2U A;  3P6C A;  2R73 A;  2OZQ A;  5HA1 A;  1SXY A;  3HTY A;  4ON1 A;  4EXZ A;  4GNW A;  2A5B A;  2RTK A;  3SZJ A;  1VWO B;  1DC9 A;  3NAD A;  1SXW A;  1MUP A;  1CBQ A;  3B2I A;  1TXL A;  3VHM A;  5HZ9 A;  2IZD B;  1HQP A;  4NV7 A;  5FFH A;  4DQ4 A;  1EIO A;  5EPQ A;  4BGF A;  4A8Z A;  4Z2O A;  5F7G A;  3RDM A;  2NNQ A;  3EBW A;  1N43 A;  1SWJ A;  4JGL A;  1Z24 A;  4ZFX A;  1I04 A;  2UZ2 A;  3RY1 A;  3VE2 A;  3CWK A;  2P8G A;  2X55 A;  4CK4 A;  3ZUO A;  1KGL A;  3B2L A;  3PEC A;  2BHV A;  3C78 X;  3H3I A;  4NLJ A;  2UYW A;  1LUQ A;  4I9R A;  2WEW A;  3X00 A;  1IKE A;  4A60 A;  1HMS A;  3HWD A;  2LFO A;  3OE3 A;  2G7B A;  5EDC A;  2AL0 X;  2CZU A;  1OSP O;  4QRL A;  4BBO A;  5IO5 A;  2A5C A;  4I6S A;  1T0V A;  2FGS A;  2GH7 A;  2WUT A;  3RDO A;  1IIU A;  3QKG A;  2FTB A;  4AYH A;  1N7Y A;  4Z6J A;  3P6F A;  2LA7 A;  1STR B;  5DPQ A;  4OEL A;  1GXA A;  2PI3 O;  1AB0 A;  2MM3 A;  2VFB A;  2FLJ A;  5CYB A;  2AVI A;  1DZP A;  2RA6 A;  2WWP A;  1TW4 A;  1SRH A;  2XST A;  4K19 A;  1I06 A;  4PSQ A;  5LJH A;  1GX8 A;  5H9N A;  2HYS A;  1FDQ A;  5L8O A;  3SAO A;  1Y9T A;  1QFV A;  2BS5 A;  2POA A;  1X8O A;  2MJI A;  4U9C A;  5HZQ A;  5K68 A;  1SWD A;  1SLG B;  1A57 A;  2AT6 X;  3Q34 A;  4BX6 A;  3T1D A;  1JQP A;  1GT3 A;  1X8Q A;  5HCC C;  2OF9 A;  2FKJ A;  3WBG A;  2L68 A;  4HPA A;  5F6Z A;  2OL8 O;  3MG5 A;  4TKB A;  3FIQ A;  4BQU A;  2DM5 A;  1E2T A;  4YKO A;  3BSZ E;  4M7M A;  4D6A A;  1SWP A;  2W2F A;  2F01 A;  3EBK A;  3FR2 A;  5HWZ A;  2CM4 A;  1ERB A;  3F9D A;  3HWE A;  4OMX A;  3TGA A;  3S5X A;  1QWD A;  4EKV A;  1B0O A;  1VWM B;  4CDE A;  2W2B A;  3OBL A;  3T6L A;  2RTF B;  2FHN X;  1SY3 A;  1JV4 A;  1VWA B;  4YH0 A;  4KII A;  2RTJ A;  3S26 A;  1KXO A;  1Y55 X;  4AZQ A;  1EII A;  4ZHH A;  5C0N A;  4N7C A;  3G7X A;  4YBU A;  3IFB A;  1HBP A;  4IB8 A;  4QZT A;  4B55 A;  2E4J A;  5EED A;  1SWG A;  4IMN A;  1R0U A;  4KC7 A;  2RTQ B;  5L8N A;  1YIV A;  4O3W A;  1VWC B;  4R0B A;  2IZL B;  4QAE A;  2NND A;  4GGZ A;  3UAQ A;  4ARH A;  2X8S A;  2X8F A;  5L8I A;  2IZK A;  3B2H A;  1NP1 A;  4IAB A;  4MVE A;  3D97 A;  5B27 A;  3PED A;  3K3L A;  1CBI A;  1JMX A;  1GGL A;  1SY0 A;  1VWG B;  1NQM A;  4U46 A;  3FYF A;  4UU2 A;  3U9P C;  4IB6 A;  1EPB A;  3I0A A;  3DTQ A;  4Y0R A;  3HWF A;  1IJ8 A;  3PK2 A;  1N0S A;  1YP7 A;  2DJF A;  1STS B;  2FT9 A;  5LJC A;  4GUZ A;  3FA8 A;  2WR6 A;  2FHL A;  4O4O A;  1SXX A;  2L5P A;  4ID2 A;  2NNE A;  4MVI A;  1VWF B;  2M4L A;  2X46 A;  4FBR A;  2OY7 A;  4I3B A;  4CDC A;  1DFV A;  3E3C A;  1ZNH A;  4U3Q A;  5HCE C;  1AVD A;  1SWU A;  2F73 A;  4GZV A;  1LIF A;  3WYQ A;  1IFC A;  1DZK A;  2CAM A;  3RE5 A;  2HKD A;  2OVE A;  1SLD B;  3KVN A;  1SWK A;  4O49 A;  4GH7 A;  1LEL A;  4RUN A;  1FTP A;  2X56 A;  1KL5 A;  1STP A;  2Q39 A;  1W6F A;  2F09 A;  2G79 A;  3LTW A;  4FBO A;  4O9S A;  3BU9 A;  3PQU A;  4Y0P A;  4AW8 A;  4ZHC A;  1ACD A;  1LCZ A;  3OJY C;  1GKA A;  4WFV A;  2RTP B;  2X45 A;  1SWL A;  3AKN A;  2W2A A;  2A8G A;  4CSB A;  1KOI A;  1AEL A;  1PTS A;  1BJ7 A;  4AZP A;  3RDX A;  2BSZ A;  5LJD A;  4ORY A;  1SA8 A;  1TOU A;  2JU7 A;  1LF7 A;  4EEJ A;  5B2A O;  3UEV A;  3KFG A;  2AT0 X;  1UYO X;  1I4U A;  4CV7 A;  4LZV A;  1SWC A;  1MK5 A;  1X8U A;  2RCT A;  3NQ9 A;  3PPT A;  1PEE A;  3WOV A;  4AZR A;  3JS1 A;  2KTS A;  4ODD A;  4ZHD A;  4EFG A;  2RTL A;  4KH8 A;  1LIB A;  2IZE B;  1E00 A;  1KT6 A;  1NDJ A;  1NQN A;  1QQS A;  1X8N A;  1TVQ A;  1ZNE A;  2Q4N A;  2X34 A;  3MM0 A;  4Z2V A;  2A0A A;  3CMP A;  4MVL A;  1KT3 A;  3SLJ A;  2Q2P A;  2A3F X;  3GAQ A;  2GTL O;  2IFB A;  5D4A A;  1UZ2 X;  1I9H A;  5LJG A;  1BSY A;  3BS2 A;  2OFM X;  4TNN A;  4M6S A;  2KD2 A;  3FEL A;  3GE2 A;  4PJ2 A;  2BT9 A;  3BLG A;  3VPJ E;  3RZY A;  3VG5 A;  2ALL X;  2AT3 X;  4C5P A;  5AJB A;  5LKF A;  1YUP A;  1K24 A;  1SRI A;  1X8P A;  1SWS A;  2CZT A;  4WHI A;  1QFT A;  2YMS A;  1N9Y A;  2RN4 A;  1JIW I;  2DJG A;  2JW1 A;  2OFB A;  1YP6 A;  2IZH B;  3NBX X;  4YFQ A;  1ICN A;  1XCA A;  4GDA A;  2NP1 A;  2VFC A;  2OY5 O;  2X8T A;  3NR3 A;  3VHI A;  5DG4 A;  1LID A;  3WYP A;  1JJJ A;  3SOT A;  3O19 A;  3MX7 A;  4GGT A;  5H9L A;  5HBS A;  4IB9 A;  4IAX A;  3S60 A;  1RAV A;  4CPF A;  1EAL A;  3EMM A;  1D3S A;  3FMZ A;  4BX6 B;  3KFI A;  1JYD A;  4TKJ A;  3ZW1 A;  2Q9S A;  4HWM A;  1JYJ A;  1HN2 A;  2KW1 A;  3AUM O;  5KIC A;  4KC8 A;  2IZA A;  4GGR A;  1KT5 A;  4WFU A;  4QGV A;  1SRE A;  2QCB A;  1BEB A;  1YWD A;  4ALO A;  2MO5 A;  2GTL M;  2X4M A;  3CQN A;  3AKM A;  4TKH A;  5LJK A;  5D8J A;  1CJ5 A;  4GD9 A;  2RTM A;  4NP1 A;  5CHK A;  4OS3 A;  1SWR A;  4ZJ0 A;  3WJC A;  5EEE A;  1T8V A;  4D6B A;  2C1S A;  2MHD A;  4ORX A;  2VDF A;  1U0X A;  5BVS A;  2ZAI A;  2FS7 A;  5B10 O;  1JBH A;  2EU7 X;  2AKQ A;  3HK1 A;  5B29 A;  4ORS A;  3SLO A;  2GTF X;  4LKT A;  2FR2 A;  2RCQ A;  2WEX A;  4ZR2 A;  3WZN A;  4BX5 A;  5LJB A;  4KT5 A;  3FEK A;  1RXK A;  3CBS A;  4ORR A;  1LIE A;  1MEP A;  5FQ8 E;  4I9S A;  4GDZ A;  2YG2 A;  3T6F A;  2RD7 C;  1KQX A;  3QQ2 A;  3WJF A;  1OBQ A;  2WSJ A;  1OBP A;  3RSW A;  1S2P A;  1DF3 A;  3JSQ A;  1SRF A;  1U18 A;  2IZF B;  2IZI A;  1DV9 A;  5HZ5 A;  2RTN B;  2IZB A;  4Z2P A;  2AF5 A;  1H91 A;  3VHH A;  3LHN A;  1MDC A;  3ELZ A;  2JGS A;  1JMZ A;  2RTI B;  4IAW A;  2PY1 A;  2C4I A;  4YGH A;  1FEM A;  3F6Z B;  4NLI A;  1BBP A;  1NBX A;  3RDU A;  2CBS A;  2AT5 X;  1ICM A;  1EW3 A;  2QOM A;  3MBT A;  4XMF A;  4OS8 A;  3JQO A;  4YFP A;  1MX8 A;  3BX8 A;  2RTO B;  3CKG A;  3KFF A;  5IO7 A;  4NYR A;  2QO4 A;  3RKG A;  3O22 A;  3FDC A;  1KFF A;  1B56 A;  1KL3 A;  3TF6 A;  1SRG A;  1BRQ A;  2RTG B;  2WQ9 A;  3HOE A;  3ZW2 A;  3BRN A;  1G7N A;  2R56 A;  1OPA A;  2K23 A;  3WZP A;  4MIS A;  5HZ8 A;  2QOS C;  1VWL B;  4GNY A;  4O3Y A;  5IRA A;  4QGX A;  4CPI A;  3SZH A;  2BLG A;  1FJ1 E;  3ZWE A;  4BJ8 A;  1RLB E;  3P6H A;  5BYP A;  5IO6 A;  3TGC A;  4Y5D A;  1JZU A;  4RUU A;  2WPU A;  2JN3 A;  2OVS A;  3PP6 A;  4XMC A;  1KQW A;  4Y59 A;  1GKA B;  2FRS A;  1VWR B;  4U8U N;  3UEW A;  3NPO A;  5HTE A;  4BVM A;  4TQ2 A;  1HQQ A;  3LV4 A;  1T68 X;  1VWN B;  1EI5 A;  5IRW A;  1OEK A;  5K06 A;  2OYB O;  1FE3 A;  4AZM A;  1EQD A;  1W4T A;  5F2B A;  1VWQ B;  3APV A;  4IB7 A;  4BOE A;  1FEL A;  3NX1 A;  1ADL A;  4NNS A;  2BS6 A;  4CDF A;  4YFR A;  5B5F A;  1NGL A;  1SMP I;  3C76 X;  2G78 A;  3CR6 A;  2OF8 A;  1AVG I;  3FA6 A;  4XMH A;  3VGW A;  5CSE A;  4ZGU A;  2XKL A;  4U8U O;  4ZGF A;  1IKJ A;  1KT4 A;  1BRP A;  5EDB A;  3VE1 A;  3U0D A;  1SWF A;  2O62 A;  1RSU B;  4DNE A;  1ALB A;  1VWP B;  2GJ5 A;  2KTD A;  3UEU A;  1LKE A;  1O1U A;  3BX7 A;  4MEE A;  1O1V A;  4ORW A;  5JR8 A;  4GK9 A;  2RTB B;  3F8A A;  1VWK B;  3FA9 A;  3WJB A;  1VYF A;  1LNM A;  1VYO A;  4JNJ A;  1G5W A;  1QY2 A;  1SWA A;  4IRW A;  3FW4 A;  3STK A;  3VG2 A;  1P6P A;  1AVE A;  2HNX A;  1GX9 A;  4QGW A;  1QY0 A;  4QNI A;  4O3X B;  1OBU A;  3D4R A;  3FEN A;  5B5G A;  4YCH A;  5EZ2 A;  3WJD A;  4QYP A;  1JJU A;  1URE A;  4JO6 A;  2OL6 O;  4XMD A;  2CBR A;  3EW2 A;  3OD9 A;  1HY2 A;  3Q6L A;  3KZA A;  4ML7 B;  1B4M A;  1VYG A;  3HWG A;  3STM X;  1BWY A;  5H9A A;  1Y53 X;  1ZNK A;  4ZH9 A;  2FR3 A;  4UU3 A;  1CBS A;  1SWB A;  4N7D A;  1BSO A;  4OKA A;  1GX3 A;  4IMO A;  3ZW1 B;  1Y9L A;  4I60 A;  5LKE A;  4YVB A;  4NW4 A;  2X32 A;  2Z4I A;  2HMB A;  4EQA C;  3O2Y A;  1E5P A;  2HZQ A;  4COT A;  2ZAG A;  3P6E A;  4O4S A;  1D2U A;  1MOY A;  1SXU A;  1X89 A;  4LQZ A;  1ZNL A;  3V8U A;  3VG3 A;  3N91 A;  1YWC A;  2IZC B;  1BM5 A;  4IBA A;  1PBO A;  2IZJ A;  1VWI B;  1JJX A;  4NYQ A;  4YGZ A;  2A2G A;  4Z28 A;  2ACO A;  4BX5 B;  4L1N A;  2CM9 A;  2GC9 A;  1HBQ A;  3BY0 A;  1PMP A;  1SLF B;  2QM9 A;  4GET A;  4FGI B;  3ZW0 A;  4CPE A;  4ZHG A;  1GT4 A;  4O4U A;  2OVA A;  3CKF A;  3PQS A;  2LKK A;  3APW A;  1LPJ A;  4CPH A;  3FA7 A;  1O8V A;  3WVM A;  3FR4 A;  2ACP X;  4Y0S A;  1Y52 X;  5BVQ A;  5IXG A;  2L67 A;  1K3B A;  4EDE A;  1HMT A;  3S5V A;  2A13 A;  1NP4 A;  4LKP A;  1ML7 A;  4YKM A;  3RDQ A;  2K62 A;  3HPE A;  2I5V O;  4BX7 B;  2LBV A;  1QAB E;  4HPD A;  1L6M A;  1NC9 A;  1SY2 A;  4GE1 A;  5D45 A;  4ZHF A;  2G8C O;  3D96 A;  3RBY A;  3STN A;  3VU1 A;  4DCB A;  3TZS A;  2Y32 A;  4I3C A;  5HA0 A;  4YDA A;  1WBI A;  3T2W A;  2C1Q A;  3UEX A;  3FEP A;  1KL4 A;  4TJZ A;  1DZJ A;  3P24 A;  5F6B A;  1U17 A;  1SWO A;  3ZZV A;  3ZQ3 A;  5BVT A;  4YMY A;  2G5L A;  2RTR B;  1SLE B;  3PDF A;  3FR5 A;  2LBA A;  3PH6 A;  1KZW A;  1S44 A;  4I95 A;  3DSZ A;  3FW5 A;  3NP1 A;  2Y3F A;  5H8T A;  2OVD A;  4QZU A;  3WXQ A;  1I05 A;  1HXL A;  1SY1 A;  3P6D A;  1SWT A;  3L4R A;  1LDO A;  2JMB A;  5B3M O;  3RE6 A;  4BX7 A;  2RTC B;  4A1H A;  1DF8 A;  4BCS A;  1X71 A;  1CBR A;  4YBP A;  1SRJ A;  2JOZ A;  1IW2 A;  4HPB A;  3NQ3 A;  3ZI8 A;  3WZQ A;  4AZO A;  3AEH A;  3SZI A;  3CBC A;  5AJC A;  4XMG A;  4MVK A;  2AMM X;  1CRB A;  3D9W A;  2RTH B;  4TLJ A;  1VWH B;  2FWV A;  3BDR A;  1A2D A;  2OFR X;  2FS6 A;  2MWH A;  1ZNG A;  1FEN A;  1OEE A;  1PBY A;  1E02 A;  1EUO A;  4KCA A;  5FAZ A;  1A3Y A;  1EPA A;  1LCW A;  3APX A;  1S7D A;  2QO5 A;  3EW1 A;  3NQK A;  5HAE A;  1EXS A;  1SWH A;  1E06 A;  1RST B;  3BU1 A;  3RWX A;  3T2X A;  4ES7 A;  3P6G A;  5HCD C;  1AQB A;  3EYC A;  2JU8 A;  1SWN A;  3KQ0 A;  1KT7 A;  3NX2 A;  1GT5 A;  1TOW A;  1N4J A;  3HOL A;  3C77 X;  2OY8 A;  2ASN X;  1XKI A;  4INN A;  5KID A;  2IZG B;  2Z4H A;  1ZND A;  4FBV A;  4LZU A;  1HMR A;  5HZ6 A;  3IA8 A;  4HFO A;  4ORU A;  4GU8 A;  5AQ6 A;  1LDQ A;  2I5Z O;  2R74 A;  1VPR A;  1VWE B;  4I3D A;  3VG7 A;  1BSQ A;  1W5R A;  5FQ6 E;  3PH5 A;  5LJE A;  3U03 A;  1I78 A;  5H9K A;  4CDD A;  3RDS A;  1DZM A;  3KFH A;  1G74 A;  1MM9 A;  3I17 A;  4ZH6 A;  3VG6 A;  2HZR A;  2OL7 A;  4GKC A;  4L3R A;  2HLV A;  3CQR A;  3TGB A;  1Y0G A;  4ALB A;  4NV8 A;  2KT4 B;  2RQ0 A;  1QY1 A;  4WBK A;  2WQA E;  4HPC A;  3ELX A;  4XME A;  5L3Y A;  1WUB A;  1SWQ A;  1MVG A;  4FQB B;  2BC3 A;  1VWJ B;  1LCV A;  3MVF A;  5AEO A;  1VWB B;  4YDB A;  2Q2M A;  2QO6 A;  1RBP A;  3RY2 A;  1YWA A;  1A18 A;  1QG5 A;  4NNT A;  5F1E A;  1GT1 A;  2L9C A;  4O4X A;  2JU3 A;  3B2J A;  3FID A;  4OEM A;  5D47 A;  1PM1 X;  3WZO A;  2ZSC A;  2ANS A;  3EM0 A;  1OEJ A;  3VG4 A;  1RXJ A;  1MX7 A;  1OPB A;  4Y0Q A;  4OS0 A;  2RTE B;  1UYN X;  2Y3E A;  3APU A;  4A1Y A;  2N93 A;  2RTA A;  1VWD B;  5FQ7 E;  5JD2 A;  4AZN A;  1KZX A;  3SLT A;  2QMI A;  1RXH A;  3B2K A; 
#chains in the Genus database with same CATH homology
 2AT8 X;  3P02 A;  5KHP A;  4OMW A;  5CE4 A;  1LFO A;  4O3Z A;  4GRJ A;  2AH7 X;  1ZRY A;  2GTL N;  4YCE A;  3ZUI A;  2LB6 A;  1LIC A;  5F58 A;  4YGG A;  3ZW0 B;  1B8E A;  3D95 A;  4QYN A;  4MIR A;  5FEN A;  1ERX A;  1BLR A;  3FLL A;  5D48 A;  3WJG A;  4U8U M;  4DQ3 A;  5HTD A;  4QQ1 A;  4ZCB A;  1IFB A;  1G85 A;  1YWB A;  1GM6 A;  3WJE A;  2A2U A;  3P6C A;  2R73 A;  2OZQ A;  5HA1 A;  1SXY A;  3HTY A;  4ON1 A;  4EXZ A;  4GNW A;  3NAD A;  1DC9 A;  1SXW A;  1MUP A;  1CBQ A;  3B2I A;  1TXL A;  5HZ9 A;  1HQP A;  5FFH A;  4DQ4 A;  1EIO A;  5EPQ A;  4A8Z A;  5F7G A;  2NNQ A;  3EBW A;  4JGL A;  1Z24 A;  4ZFX A;  1I04 A;  3VE2 A;  1KGL A;  3CWK A;  2P8G A;  4CK4 A;  3ZUO A;  3B2L A;  3PEC A;  2BHV A;  3C78 X;  3H3I A;  4NLJ A;  4I9R A;  2WEW A;  1IKE A;  4A60 A;  1HMS A;  3HWD A;  2LFO A;  3OE3 A;  2G7B A;  5EDC A;  2AL0 X;  2CZU A;  4QRL A;  5IO5 A;  4I6S A;  1T0V A;  2WUT A;  1IIU A;  3QKG A;  2FTB A;  4AYH A;  3P6F A;  2LA7 A;  5DPQ A;  1GXA A;  1AB0 A;  2MM3 A;  2FLJ A;  5CYB A;  2RA6 A;  1DZP A;  2WWP A;  2XST A;  1TW4 A;  4K19 A;  4PSQ A;  5LJH A;  1I06 A;  1GX8 A;  5H9N A;  2HYS A;  1FDQ A;  5L8O A;  3SAO A;  1Y9T A;  1QFV A;  2BS5 A;  2POA A;  1X8O A;  2MJI A;  4U9C A;  5HZQ A;  1A57 A;  2AT6 X;  3T1D A;  1GT3 A;  1X8Q A;  5HCC C;  3WBG A;  2L68 A;  4HPA A;  5F6Z A;  4TKB A;  3FIQ A;  4BQU A;  2DM5 A;  4YKO A;  3BSZ E;  4M7M A;  4D6A A;  2W2F A;  3EBK A;  3FR2 A;  5HWZ A;  2CM4 A;  1ERB A;  3F9D A;  3HWE A;  4OMX A;  3TGA A;  3S5X A;  1QWD A;  1B0O A;  2W2B A;  3OBL A;  1SY3 A;  1JV4 A;  4YH0 A;  3S26 A;  4KII A;  4AZQ A;  1KXO A;  1EII A;  4ZHH A;  5C0N A;  4N7C A;  3G7X A;  4YBU A;  3IFB A;  1HBP A;  4IB8 A;  4QZT A;  2E4J A;  5EED A;  4IMN A;  1R0U A;  4KC7 A;  5L8N A;  1YIV A;  4O3W A;  4R0B A;  3UAQ A;  4ARH A;  4QAE A;  2NND A;  2X8S A;  2X8F A;  5L8I A;  3B2H A;  4IAB A;  1NP1 A;  4MVE A;  3WJD A;  3D97 A;  5B27 A;  3PED A;  3K3L A;  1CBI A;  4UU2 A;  1GGL A;  1SY0 A;  3U9P C;  3FYF A;  4IB6 A;  1EPB A;  3I0A A;  3DTQ A;  4Y0R A;  3HWF A;  1N0S A;  1YP7 A;  2FT9 A;  5LJC A;  3FA8 A;  2WR6 A;  4O4O A;  1SXX A;  2L5P A;  4ID2 A;  2NNE A;  4MVI A;  2M4L A;  2X46 A;  4FBR A;  4I3B A;  1DFV A;  3E3C A;  1ZNH A;  4U3Q A;  5HCE C;  2F73 A;  4GZV A;  1LIF A;  1IFC A;  1DZK A;  2OVE A;  4O49 A;  4GH7 A;  4RUN A;  1FTP A;  2Q39 A;  2F09 A;  4ZHC A;  2G79 A;  4FBO A;  4O9S A;  3BU9 A;  3PQU A;  4Y0P A;  4AW8 A;  1ACD A;  3OJY C;  4WFV A;  1GKA A;  2X45 A;  3AKN A;  2W2A A;  4CSB A;  1AEL A;  1KOI A;  1BJ7 A;  4AZP A;  5LJD A;  4ORY A;  1SA8 A;  1TOU A;  2JU7 A;  1LF7 A;  4EEJ A;  3UEV A;  3KFG A;  2AT0 X;  1I4U A;  4CV7 A;  4LZV A;  2RCT A;  1X8U A;  3NQ9 A;  1PEE A;  3PPT A;  3WOV A;  4AZR A;  3JS1 A;  2KTS A;  4ODD A;  4ZHD A;  4EFG A;  4KH8 A;  1LIB A;  1E00 A;  1KT6 A;  1QQS A;  1X8N A;  3PP6 A;  1ZNE A;  1TVQ A;  5D45 A;  2Q4N A;  2A0A A;  3CMP A;  4MVL A;  1KT3 A;  2Q2P A;  2A3F X;  3GAQ A;  2GTL O;  2IFB A;  5D4A A;  1UZ2 X;  5LJG A;  1BSY A;  3BS2 A;  2OFM X;  4TNN A;  4M6S A;  2KD2 A;  3FEL A;  3GE2 A;  4PJ2 A;  2BT9 A;  3BLG A;  3VPJ E;  3RZY A;  3VG5 A;  2ALL X;  2AT3 X;  5AJB A;  5LKF A;  1YUP A;  4WHI A;  1X8P A;  2CZT A;  1QFT A;  2YMS A;  2RN4 A;  1JIW I;  2JW1 A;  3NBX X;  1YP6 A;  4YFQ A;  1ICN A;  1XCA A;  2NP1 A;  2X8T A;  3NR3 A;  1JJJ A;  5DG4 A;  1LID A;  3SOT A;  3O19 A;  3MX7 A;  5H9L A;  5HBS A;  4IB9 A;  4IAX A;  3S60 A;  1EAL A;  3EMM A;  1D3S A;  3FMZ A;  3KFI A;  1JYD A;  4TKJ A;  3ZW1 A;  2Q9S A;  4HWM A;  1JYJ A;  1HN2 A;  2KW1 A;  5KIC A;  4KC8 A;  1KT5 A;  4WFU A;  4QGV A;  1BEB A;  1YWD A;  4ALO A;  2MO5 A;  2GTL M;  3CQN A;  3AKM A;  4TKH A;  5LJK A;  5D8J A;  1CJ5 A;  4NP1 A;  4OS3 A;  4ZJ0 A;  3WJC A;  5EEE A;  1T8V A;  4D6B A;  2MHD A;  4ORX A;  1U0X A;  5BVS A;  2ZAI A;  2FS7 A;  1JBH A;  2EU7 X;  2AKQ A;  3HK1 A;  5B29 A;  4ORS A;  2GTF X;  4LKT A;  2FR2 A;  2RCQ A;  2WEX A;  4ZR2 A;  5LJB A;  4KT5 A;  3FEK A;  4ORR A;  3CBS A;  1LIE A;  5FQ8 E;  4I9S A;  4GDZ A;  2YG2 A;  2RD7 C;  1KQX A;  3WJF A;  1OBQ A;  2WSJ A;  1OBP A;  3RSW A;  1S2P A;  1DF3 A;  3JSQ A;  1U18 A;  1DV9 A;  5HZ5 A;  1H91 A;  3LHN A;  1MDC A;  3ELZ A;  4IAW A;  2PY1 A;  4YGH A;  1FEM A;  3F6Z B;  4NLI A;  1BBP A;  2CBS A;  2AT5 X;  1ICM A;  1EW3 A;  3MBT A;  4XMF A;  4OS8 A;  3JQO A;  4YFP A;  1MX8 A;  3BX8 A;  3KFF A;  5IO7 A;  4NYR A;  2QO4 A;  3RKG A;  3O22 A;  3ZW2 A;  1B56 A;  3TF6 A;  1BRQ A;  2WQ9 A;  3HOE A;  3BRN A;  1G7N A;  2R56 A;  1OPA A;  2K23 A;  4MIS A;  5HZ8 A;  2QOS C;  4GNY A;  4O3Y A;  4QGX A;  5IO6 A;  2BLG A;  3ZWE A;  5BYP A;  1RLB E;  3P6H A;  3TGC A;  1JZU A;  4RUU A;  2JN3 A;  2OVS A;  4XMC A;  1KQW A;  1GKA B;  2FRS A;  4U8U N;  3UEW A;  3NPO A;  5HTE A;  4BVM A;  4TQ2 A;  3LV4 A;  1T68 X;  1EI5 A;  1OEK A;  5K06 A;  1FE3 A;  4AZM A;  1EQD A;  3APV A;  4IB7 A;  4BOE A;  1FEL A;  3NX1 A;  1ADL A;  4NNS A;  2BS6 A;  4YFR A;  1NGL A;  1SMP I;  3C76 X;  2G78 A;  3CR6 A;  3FA6 A;  1AVG I;  4XMH A;  4ZGU A;  2XKL A;  4U8U O;  4ZGF A;  1IKJ A;  1KT4 A;  1BRP A;  5EDB A;  3VE1 A;  3U0D A;  2O62 A;  1ALB A;  2GJ5 A;  2KTD A;  3UEU A;  1LKE A;  1O1U A;  3BX7 A;  1O1V A;  4ORW A;  5JR8 A;  4GK9 A;  3F8A A;  3FA9 A;  3WJB A;  1VYF A;  1LNM A;  1G5W A;  1QY2 A;  3FW4 A;  3STK A;  3VG2 A;  1P6P A;  4QGW A;  2HNX A;  1GX9 A;  1QY0 A;  4QNI A;  4O3X B;  1OBU A;  3D4R A;  3FEN A;  4YCH A;  5EZ2 A;  4QYP A;  1URE A;  4XMD A;  2CBR A;  3OD9 A;  3Q6L A;  3KZA A;  4ML7 B;  1B4M A;  1VYG A;  3HWG A;  3STM X;  1BWY A;  5H9A A;  4ZH9 A;  1ZNK A;  2FR3 A;  4UU3 A;  1CBS A;  4N7D A;  1BSO A;  4IMO A;  3ZW1 B;  1Y9L A;  5LKE A;  4NW4 A;  2Z4I A;  2HMB A;  4EQA C;  3O2Y A;  1E5P A;  2HZQ A;  4COT A;  2ZAG A;  3P6E A;  4O4S A;  1D2U A;  1SXU A;  1X89 A;  4LQZ A;  1ZNL A;  3V8U A;  3VG3 A;  3N91 A;  1YWC A;  1BM5 A;  4IBA A;  1PBO A;  1JJX A;  4NYQ A;  4YGZ A;  2A2G A;  2ACO A;  4L1N A;  2CM9 A;  2GC9 A;  1HBQ A;  3BY0 A;  1PMP A;  2QM9 A;  4GET A;  4FGI B;  3ZW0 A;  4ZHG A;  1GT4 A;  4O4U A;  2OVA A;  3PQS A;  2LKK A;  3APW A;  1LPJ A;  3FA7 A;  1O8V A;  3WVM A;  3FR4 A;  2ACP X;  4Y0S A;  5BVQ A;  2L67 A;  4EDE A;  1HMT A;  3S5V A;  2A13 A;  1NP4 A;  4LKP A;  1ML7 A;  4YKM A;  2K62 A;  2LBV A;  1QAB E;  4HPD A;  1L6M A;  1SY2 A;  4GE1 A;  4ZHF A;  3D96 A;  3RBY A;  3STN A;  3TZS A;  3VU1 A;  4I3C A;  5HA0 A;  4YDA A;  3UEX A;  3FEP A;  4TJZ A;  1DZJ A;  3P24 A;  5F6B A;  1U17 A;  3ZZV A;  3ZQ3 A;  5BVT A;  4YMY A;  1KZW A;  3FR5 A;  2LBA A;  3PH6 A;  1S44 A;  4I95 A;  3DSZ A;  3FW5 A;  3NP1 A;  5H8T A;  2OVD A;  4QZU A;  3WXQ A;  1I05 A;  1SY1 A;  3P6D A;  3L4R A;  2JMB A;  4A1H A;  1X71 A;  1CBR A;  4YBP A;  2JOZ A;  4HPB A;  1IW2 A;  3NQ3 A;  3ZI8 A;  4AZO A;  3CBC A;  5AJC A;  4XMG A;  4MVK A;  2AMM X;  1CRB A;  4TLJ A;  2FWV A;  3BDR A;  1A2D A;  2OFR X;  2FS6 A;  2MWH A;  1ZNG A;  1FEN A;  1OEE A;  4KCA A;  1E02 A;  1EUO A;  5FAZ A;  1A3Y A;  1EPA A;  3APX A;  3NQK A;  1S7D A;  2QO5 A;  5HAE A;  1EXS A;  1E06 A;  3BU1 A;  5HCD C;  3RWX A;  4ES7 A;  3P6G A;  1AQB A;  3EYC A;  2JU8 A;  3KQ0 A;  1KT7 A;  3NX2 A;  1GT5 A;  1TOW A;  3HOL A;  3C77 X;  2ASN X;  1XKI A;  4INN A;  5KID A;  4LZU A;  2Z4H A;  1ZND A;  4FBV A;  1HMR A;  5HZ6 A;  3IA8 A;  4HFO A;  4ORU A;  4GU8 A;  5AQ6 A;  4I3D A;  2R74 A;  1VPR A;  3VG7 A;  1BSQ A;  5FQ6 E;  3PH5 A;  5LJE A;  3U03 A;  5H9K A;  1DZM A;  3KFH A;  1G74 A;  3I17 A;  4ZH6 A;  3VG6 A;  2HZR A;  4GKC A;  4L3R A;  3TGB A;  2HLV A;  3CQR A;  4ALB A;  2KT4 B;  2RQ0 A;  1QY1 A;  4WBK A;  2WQA E;  4HPC A;  3ELX A;  4XME A;  1MVG A;  4FQB B;  3MVF A;  5AEO A;  4YDB A;  2Q2M A;  2QO6 A;  1RBP A;  1YWA A;  1A18 A;  1QG5 A;  4NNT A;  5F1E A;  1GT1 A;  2L9C A;  4O4X A;  2JU3 A;  3B2J A;  5D47 A;  1PM1 X;  2ANS A;  3EM0 A;  1OEJ A;  3VG4 A;  1MX7 A;  1OPB A;  4Y0Q A;  4OS0 A;  4AZN A;  3APU A;  4A1Y A;  2N93 A;  5FQ7 E;  1KZX A;  2QMI A;  3B2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...