4ZFYB

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with alpha-methyl-d-galactoside
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
261
structure length
261
Chain Sequence
NEQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule keywords rRNA N-glycosidase
molecule tags Hydrolase
total genus 79
structure length 261
sequence length 261
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfyB01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfyB02
3WINC 4OWJA 3PG0A 2KH2A 1IJTA 1MC9A 5BQUC 2FDBM 2K4AB 2KI6B 1FWVA 4G9MA 2ERMA 3FJAA 3BX1C 1AVWB 1IT0A 3CRIA 4KEJA 3TC2A 1BASA 2D22A 5F8WA 2FO1A 4DENA 2M49A 3IAGC 2HW9A 2J3PA 1R8OA 2GO2A 3N0KA 4GP0A 1PC8B 4LO7B 4G1RA 2D7IA 1BARA 1RMLA 4IZXA 1ISXA 3KMVA 4CJMA 2AXMA 2Q9XA 4LO3C 3IM5A 3I29B 4PC4A 5B2HA 1IHKA 3SNVA 1YTOA 4LO2C 4IHZA 5EC5A 4USPA 1RG8A 3LLPA 3PUBA 3AKGA 1S0DA 1HWOB 3CA6A 1I1EA 1SZ6B 2R9KB 5D63A 1JQZA 3WINA 4IQPA 1Q1UA 3ZX7A 3OGFA 1S0CA 5BQUA 5BXRA 4XFSA 1EPWA 3LTQA 9ILBA 41BIA 3AKIA 1ILR1 4EFQA 1K5VA 31BIA 3FUOA 1ISZA 4QBCA 1TWMA 1PZZA 1E0OA 3BAOA 4GAFA 5DVHA 2NVHA 1QXMA 1AF9A 3D7WB 3BRGC 3WA1A 1XHBA 4LO3A 2ET2A 3O4OA 4ISQA 3A07A 3CU1B 4LO2A 4USOA 2MC2A 3V0BA 4IZEA 2D44A 3POKA 3FJCA 3ZC8A 3ILAA 2IHOA 3BRFA 2NM1A 1ISWA 2DRZA 1JY0A 3BAHA 4H04A 5GAQA 2WBCA 1S0LA 3H6SE 3BRDA 4F34A 3B9UA 2NZ9A 4OUJA 1XZZA 3O4BA 2LIEA 1S0EA 5DUYA 2D20A 2DREA 3BA5A 4ZLBB 3BAGA 1J0SA 1EV2A 3R4SA 1DQOA 2IWTB 3HMYA 3F1RA 1NZKA 4QD2C 3AZVA 1W3AA 3O4AA 4LO0C 3NBNA 3AKHA 3BB2A 1W3FA 4HJJA 4J23B 4A7KA 1HWNB 2VSEA 4ZFUB 1TFMB 3FJ8A 3CA3A 4I4VA 4I7IA 3RMXA 5JLVA 3VT2A 3I2AA 2FGFA 2Q3NB 5D62A 2XOAA 3E8LC 2Z48A 2D24A 3K1XA 2VXRA 1YBIA 4I1EA 5F90A 3AZWA 1JT3A 1GGPB 3HN1A 1FQ9A 3N7LA 4GOYA 2QYIB 3H6QA 4Z8SB 1BFGA 3NBCA 4KC3A 4R6UB 5DSSB 1R8NA 1JT7A 5BXSA 1DZCA 1FMZA 1DQGA 3O4DA 5BP5C 2Y9GA 3JRRA 3RTJB 1P63A 2FFUA 1T9FA 3PHZA 4J2KA 2DS0A 3WO3A 3BA7A 2I1BA 3AH1A 1AVUA 3BA4A 3N7MA 3Q7YA 4IONA 4LO0A 2KKIA 3Q7XA 2ZQNA 1ABRB 5F8SA 4ZFYB 4P6AA 3NBEA 4OW4A 4DEPA 4GP3A 1CE7B 3OGGA 3W9TA 2VSAA 3EF2A 4I37A 4X39A 4Q9PA 3P6JA 3A23A 4G9NA 3VWCA 1DFQA 4X38A 4JAWA 1JLXA 2BFHA 3A22A 4ENDA 1AXMA 1OQLB 1DFCA 2MIBA 1BLAA 3AH2A 3N7JA 1S0FA 4AN6A 4OWLA 4QKRA 3CA0A 4I6IA 3F62B 4A7YA 1DJSB 2YUGA 2P23A 4I4PA 3H6RA 4JKQA 3WMVA 4KEKA 4GAIA 5BP5A 1DLLA 4X37A 5FNWA 3ZC9A 4YOLA 1BA7A 3UJ0A 5BXPA 2F2FC 4ZFWB 3C9ZA 4L4HA 4LO8B 5FZYA 3CQAA 4I4UA 4QALA 2ESUA 1PWAA 2HWAA 1JT5A 1G82A 4I96A 4LO7C 3CA1A 2E4MC 1WD3A 1ITBA 1IOBA 1FGAA 2MLLB 1VCLA 2HZ9A 1AVAC 4EB2B 3UJ4A 4ZOTA 4Q9GA 5G00A 4I4QA 4OEFA 4QD2B 1G9BA 5BOWA 1FMMS 3O5WB 4I4OA 3ZXGA 3CA5A 4G6JA 2L5XA 1V6VA 3IM6A 4I4YA 1DIWA 1Q04A 4P0KA 1I1BA 1YYNA 3PMEA 1A8DA 1TTUA 3HOMA 3CAHA 4XKIA 1PUUB 1D0HA 5E24E 21BIA 1TIEA 1II4A 2F2FA 5BXTA 3FUQA 2ZQOA 2F8XC 4IYBA 1JTCA 1BLDA 2E4MA 1ONKB 1XYFA 2RSTA 2BEAA 4II0A 1TOOA 4ZKTB 2X2SA 5HPZA 2Z49A 1FV3A 4X3AA 3ZXDA 3N7KA 1Z2VA 2NTDA 2Y9XE 3T8SA 4Z9WB 2HWMA 4EEEB 1MD6A 2D1ZA 4P0LA 4EKXB 3QYDA 1V6UA 3BAVA 4I2SA 4FVVA 4H9WA 5DZUA 3VSFA 1W3GA 3BAQA 3RMYA 1G9CA 5I1BA 3UD7A 1WBAA 3O49A 4J2SA 2ZR1B 4G6MA 4ISRA 3FJBA 3V0BB 2X2TA 4I3NA 5BVPI 4D0ZA 4D0TA 3WMUA 5JMCA 3FGMA 3A21A 5EG6C 1AFCA 4XFTA 1QQKA 3AJ6A 2UUSA 3OBTA 3MPPG 1TP0A 2D23A 4Q91A 2VXTI 3O4CA 2BEBA 3BAUA 4OEEA 3P53A 8I1BA 1HCEA 1JLYA 3CA4A 5EHAA 3VT1A 4D8HA 4I4RA 1ISYA 1IRPA 4EFPA 1Q03A 3I2XA 2DRYA 2VU9A 3AJ5A 3P6IA 3S8JA 4OEGA 3RTIB 3FJJA 1WBCA 3OJVA 3V0AA 1V6WA 1PUMB 1HCDA 1S0GA 4OWKA 1WD4A 2QN4A 3UD9A 1Z0HA 4I4SA 3FJDA 3UDAA 3FJHA 3CRHA 4J2XA 3RSJA 2KLLA 4ZBVB 2RQ9A 2VLCA 4I1BA 1EVTA 4LO1C 4QKSA 4J2YA 2AFGA 4TLPA 4JRAA 2GZBA 3OBRA 3FJFA 1HKNA 3NJ5A 3VUOA 5FZZA 4JKXB 1S0BA 3VT0A 4XFUA 4A7ZA 1G9AA 5FZUA 3BTAA 1FWUA 1M2TB 4JP0A 3FJKA 3JUTA 1Z4SA 1SR4C 1AVXB 3AH4A 1XG6A 3FFZA 4DCKC 1RZOB 2NP0A 2Y9FA 3UD8A 3VEQA 7I1BA 1FN0A 3MALA 2K43A 3AKFA 3OJ2A 4FGFA 3FJEA 5D61A 2LIQA 4HR6C 3OJMA 1YXWA 4ZA3B 1M16A 5F8YA 3S8KA 3WO4A 1G9DA 4IY8A 2AQZA 1HIBA 3R4UA 4KEIA 4P0JA 3O3QA 4LO1A 1HWMB 4F83A 3WO2A 1TWEA 4GOVA 4I0YA 3VSZA 6I1BA 3H6RB 3V0AB 1RY7A 1L2HA 4KBBA 3HBWA 1FV2A 1CVSA 1QQLA 3Q7WA 4QC4A 4WBCA 3V79C 1NUNA 1T4QA 4I8MA 2WRYA 2NYYA 3FJ9A 2D7RA 2FFVA 1EYLA 3NBDA 3CRGA 2RG9B 1BFCA 1SR4A 2KI4A 2Y9WC 1HWPB 5FNXA 2K8RA 4EFRA 3O44A 3BADA 4QBVA 3IM7A 4AN7B 1YF8B 1K5UA 3HSMA 1F31A 3QR5A 1BFFA 1KNMA 4QO3A 3IIRA 3HALA 1JT4A 1UPSA 1BFBA 4JPZA 4ZGRB 2AAIB 2P39A 4JQ0A 1IILA 4I4XA 4IY9A 1DZDA 2VUAA 1IRAX 1ISVA 1V6XA 1N4KA 2D43A 4L4IA 3FJIA 4HA2A
chains in the Genus database with same CATH superfamily
3WINC 4OWJA 3PG0A 2KH2A 1IJTA 1MC9A 5BQUC 2FDBM 2K4AB 2KI6B 1FWVA 4G9MA 2ERMA 3FJAA 3BX1C 1AVWB 1IT0A 3CRIA 4KEJA 3TC2A 1BASA 2D22A 5F8WA 2FO1A 4DENA 2M49A 3IAGC 2HW9A 2J3PA 1R8OA 2GO2A 3N0KA 4GP0A 1PC8B 4LO7B 4G1RA 2D7IA 1BARA 1RMLA 4IZXA 1ISXA 3KMVA 4CJMA 2AXMA 2Q9XA 4LO3C 3IM5A 3I29B 4PC4A 5B2HA 1IHKA 3SNVA 1YTOA 4LO2C 4IHZA 5EC5A 4USPA 1RG8A 3LLPA 3PUBA 3AKGA 4UY4A 1S0DA 1HWOB 3CA6A 1I1EA 1SZ6B 2R9KB 5D63A 1JQZA 3WINA 4IQPA 1Q1UA 3ZX7A 3OGFA 1S0CA 5BQUA 5BXRA 4XFSA 1EPWA 3LTQA 9ILBA 41BIA 3AKIA 1ILR1 4EFQA 1K5VA 31BIA 3FUOA 1ISZA 4QBCA 1TWMA 1PZZA 1E0OA 3BAOA 4GAFA 5DVHA 2NVHA 1QXMA 1AF9A 3D7WB 3BRGC 3WA1A 1XHBA 4LO3A 2ET2A 3O4OA 4ISQA 3A07A 3CU1B 4LO2A 4USOA 2MC2A 3V0BA 4IZEA 2D44A 3POKA 3FJCA 3ZC8A 3ILAA 2IHOA 3BRFA 2NM1A 1ISWA 2DRZA 1JY0A 3BAHA 4H04A 5GAQA 2WBCA 1S0LA 3H6SE 3BRDA 4F34A 3B9UA 2NZ9A 4OUJA 1XZZA 3O4BA 2LIEA 1S0EA 5DUYA 2D20A 2DREA 3BA5A 4ZLBB 3BAGA 1J0SA 1EV2A 3R4SA 1DQOA 2IWTB 3HMYA 3F1RA 1NZKA 4QD2C 3AZVA 1W3AA 3O4AA 4LO0C 3NBNA 3AKHA 3BB2A 1W3FA 4HJJA 4J23B 4A7KA 1HWNB 2VSEA 4ZFUB 1TFMB 3FJ8A 3CA3A 4I4VA 4I7IA 3RMXA 5JLVA 3VT2A 3I2AA 2FGFA 2Q3NB 5D62A 2XOAA 3E8LC 2Z48A 2D24A 3K1XA 2VXRA 1YBIA 4I1EA 5F90A 3AZWA 1JT3A 1GGPB 3HN1A 1FQ9A 3N7LA 4GOYA 2QYIB 3H6QA 4Z8SB 1BFGA 3NBCA 4KC3A 4R6UB 5DSSB 1R8NA 1JT7A 5BXSA 1DZCA 1FMZA 1DQGA 3O4DA 5BP5C 2Y9GA 3JRRA 3RTJB 1P63A 2FFUA 1T9FA 3PHZA 4J2KA 2DS0A 3WO3A 3BA7A 2I1BA 3AH1A 1AVUA 3BA4A 3N7MA 3Q7YA 4IONA 4LO0A 2KKIA 3Q7XA 2ZQNA 1ABRB 5F8SA 4ZFYB 4P6AA 3NBEA 4OW4A 4DEPA 4GP3A 1CE7B 3OGGA 3W9TA 2VSAA 4MZFB 3EF2A 4I37A 4X39A 4Q9PA 3P6JA 3A23A 4G9NA 3VWCA 1DFQA 4X38A 4JAWA 1JLXA 2BFHA 3A22A 4ENDA 1AXMA 1OQLB 1DFCA 2MIBA 1BLAA 3AH2A 3N7JA 1S0FA 4AN6A 4OWLA 4QKRA 3CA0A 4I6IA 3F62B 4A7YA 1DJSB 2YUGA 2P23A 4I4PA 3H6RA 4JKQA 3WMVA 4KEKA 4GAIA 5BP5A 1DLLA 4X37A 5FNWA 3ZC9A 4YOLA 1BA7A 3UJ0A 5BXPA 2F2FC 4ZFWB 3C9ZA 4L4HA 4LO8B 5FZYA 3CQAA 4I4UA 4QALA 2ESUA 1PWAA 2HWAA 1JT5A 1G82A 4I96A 4LO7C 3CA1A 2E4MC 1WD3A 1ITBA 1IOBA 1FGAA 2MLLB 1VCLA 2HZ9A 1AVAC 4EB2B 3UJ4A 4ZOTA 4Q9GA 5G00A 4I4QA 4OEFA 4QD2B 1G9BA 5BOWA 1FMMS 3O5WB 4I4OA 3ZXGA 3CA5A 4G6JA 2L5XA 1V6VA 3IM6A 4I4YA 1DIWA 1Q04A 4P0KA 1I1BA 1YYNA 3PMEA 1A8DA 1TTUA 3HOMA 3CAHA 4XKIA 1PUUB 1D0HA 5E24E 21BIA 1TIEA 1II4A 2F2FA 5BXTA 3FUQA 2ZQOA 2F8XC 4IYBA 1JTCA 1BLDA 2E4MA 1ONKB 1XYFA 2RSTA 2BEAA 4II0A 1TOOA 4ZKTB 2X2SA 5HPZA 2Z49A 1FV3A 4X3AA 3ZXDA 3N7KA 1Z2VA 2NTDA 2Y9XE 3T8SA 4MZHA 4Z9WB 2HWMA 4EEEB 1MD6A 2D1ZA 4P0LA 4EKXB 3QYDA 1V6UA 3BAVA 4I2SA 4FVVA 4H9WA 5DZUA 3VSFA 1W3GA 3BAQA 3RMYA 1G9CA 5I1BA 3UD7A 1WBAA 3O49A 4J2SA 2ZR1B 4G6MA 4ISRA 3FJBA 3V0BB 2X2TA 4I3NA 5BVPI 4D0ZA 4D0TA 3WMUA 5JMCA 3FGMA 3A21A 5EG6C 1AFCA 4XFTA 1QQKA 3AJ6A 2UUSA 3OBTA 3MPPG 1TP0A 2D23A 4Q91A 2VXTI 3O4CA 2BEBA 3BAUA 4OEEA 3P53A 8I1BA 1HCEA 1JLYA 3CA4A 5EHAA 3VT1A 4D8HA 4I4RA 1ISYA 1IRPA 4EFPA 1Q03A 3I2XA 2DRYA 2VU9A 3AJ5A 3P6IA 3S8JA 4OEGA 3RTIB 3FJJA 1WBCA 3OJVA 3V0AA 1V6WA 1PUMB 1HCDA 1S0GA 4OWKA 1WD4A 2QN4A 3UD9A 1Z0HA 4I4SA 3FJDA 3UDAA 3FJHA 3CRHA 4J2XA 3RSJA 2KLLA 4ZBVB 2RQ9A 2VLCA 4I1BA 1EVTA 4LO1C 4QKSA 4J2YA 2AFGA 4TLPA 4JRAA 2GZBA 3OBRA 3FJFA 1HKNA 3NJ5A 3VUOA 5FZZA 4JKXB 1S0BA 3VT0A 4XFUA 4A7ZA 1G9AA 5FZUA 3BTAA 1FWUA 1M2TB 4JP0A 3FJKA 3JUTA 1Z4SA 1SR4C 1AVXB 4H75A 3AH4A 1XG6A 3FFZA 4DCKC 1RZOB 2NP0A 2Y9FA 3UD8A 3VEQA 7I1BA 1FN0A 3MALA 2K43A 3AKFA 3OJ2A 4FGFA 3FJEA 4MZGB 5D61A 2LIQA 4HR6C 3OJMA 1YXWA 4ZA3B 1M16A 5F8YA 3S8KA 3WO4A 1G9DA 4IY8A 2AQZA 1HIBA 3R4UA 4KEIA 4P0JA 3O3QA 4LO1A 1HWMB 4F83A 3WO2A 1TWEA 4GOVA 4I0YA 3VSZA 6I1BA 3H6RB 3V0AB 1RY7A 1L2HA 4KBBA 3HBWA 1FV2A 1CVSA 1QQLA 3Q7WA 4QC4A 4WBCA 3V79C 1NUNA 1T4QA 4I8MA 2WRYA 2NYYA 3FJ9A 2D7RA 2FFVA 1EYLA 3NBDA 3CRGA 2RG9B 1BFCA 1SR4A 2KI4A 2Y9WC 1HWPB 5FNXA 2K8RA 4EFRA 3O44A 3BADA 4QBVA 3IM7A 4AN7B 1YF8B 1K5UA 3HSMA 1F31A 3QR5A 1BFFA 1KNMA 4QO3A 3IIRA 3HALA 1JT4A 1UPSA 1BFBA 4JPZA 4ZGRB 2AAIB 2P39A 4JQ0A 1IILA 4I4XA 4IY9A 1DZDA 2VUAA 1IRAX 1ISVA 1V6XA 1N4KA 2NS2A 2D43A 4L4IA 3FJIA 4HA2A
chains in the Genus database with same CATH topology
3WINC 4OWJA 3PG0A 2KH2A 1IJTA 1MC9A 5BQUC 2FDBM 2K4AB 2KI6B 1FWVA 4G9MA 2ERMA 3FJAA 3BX1C 1AVWB 1IT0A 3CRIA 4KEJA 3TC2A 1BASA 2D22A 5F8WA 2FO1A 4DENA 2M49A 3IAGC 2HW9A 2J3PA 1R8OA 2GO2A 3N0KA 4GP0A 1PC8B 4LO7B 4G1RA 2D7IA 1BARA 1RMLA 4IZXA 1ISXA 3KMVA 4CJMA 2AXMA 2Q9XA 4LO3C 3IM5A 3I29B 4PC4A 5B2HA 1IHKA 3SNVA 1YTOA 4LO2C 4IHZA 5EC5A 4USPA 1RG8A 3LLPA 3PUBA 3AKGA 4UY4A 1S0DA 1HWOB 3CA6A 1I1EA 1SZ6B 2R9KB 5D63A 1JQZA 3WINA 4IQPA 1Q1UA 3ZX7A 3OGFA 1S0CA 5BQUA 5BXRA 4XFSA 1EPWA 3LTQA 9ILBA 41BIA 3AKIA 1ILR1 4EFQA 1K5VA 31BIA 3FUOA 1ISZA 4QBCA 1TWMA 1PZZA 1E0OA 3BAOA 4GAFA 5DVHA 2NVHA 1QXMA 1AF9A 3D7WB 3BRGC 3WA1A 1XHBA 4LO3A 2ET2A 3O4OA 4ISQA 3A07A 3CU1B 4LO2A 4USOA 2MC2A 3V0BA 4IZEA 2D44A 3POKA 3FJCA 3ZC8A 3ILAA 2IHOA 3BRFA 2NM1A 1ISWA 2DRZA 1JY0A 3BAHA 4H04A 5GAQA 2WBCA 1S0LA 3H6SE 3BRDA 4F34A 3B9UA 2NZ9A 4OUJA 1XZZA 3O4BA 2LIEA 1S0EA 5DUYA 2D20A 2DREA 3BA5A 4ZLBB 3BAGA 1J0SA 1EV2A 3R4SA 1DQOA 2IWTB 3HMYA 3F1RA 1NZKA 4QD2C 3AZVA 1W3AA 3O4AA 4LO0C 3NBNA 3AKHA 3BB2A 1W3FA 4HJJA 4J23B 4A7KA 1HWNB 2VSEA 4ZFUB 1TFMB 3FJ8A 3CA3A 4I4VA 4I7IA 3RMXA 5JLVA 3VT2A 3I2AA 2FGFA 2Q3NB 5D62A 2XOAA 3E8LC 2Z48A 2D24A 3K1XA 2VXRA 1YBIA 4I1EA 5F90A 3AZWA 1JT3A 1GGPB 3HN1A 1FQ9A 3N7LA 4GOYA 2QYIB 3H6QA 4Z8SB 1BFGA 3NBCA 4KC3A 4R6UB 5DSSB 1R8NA 1JT7A 5BXSA 1DZCA 1FMZA 1DQGA 3O4DA 5BP5C 2Y9GA 3JRRA 3RTJB 1P63A 2FFUA 1T9FA 3PHZA 4J2KA 2DS0A 3WO3A 3BA7A 2I1BA 3AH1A 1AVUA 3BA4A 3N7MA 3Q7YA 4IONA 4LO0A 2KKIA 3Q7XA 2ZQNA 1ABRB 5F8SA 4ZFYB 4P6AA 3NBEA 4OW4A 4DEPA 4GP3A 1CE7B 3OGGA 3W9TA 2VSAA 4MZFB 3EF2A 4I37A 4X39A 4Q9PA 3P6JA 3A23A 4G9NA 3VWCA 1DFQA 4X38A 4JAWA 1JLXA 2BFHA 3A22A 4ENDA 1AXMA 1OQLB 1DFCA 2MIBA 1BLAA 3AH2A 3N7JA 1S0FA 4AN6A 4OWLA 4QKRA 3CA0A 4I6IA 3F62B 4A7YA 1DJSB 2YUGA 2P23A 4I4PA 3H6RA 4JKQA 3WMVA 4KEKA 4GAIA 5BP5A 1DLLA 4X37A 5FNWA 3ZC9A 4YOLA 1BA7A 3UJ0A 5BXPA 2F2FC 4ZFWB 3C9ZA 4L4HA 4LO8B 5FZYA 3CQAA 4I4UA 4QALA 2ESUA 1PWAA 2HWAA 1JT5A 1G82A 4I96A 4LO7C 3CA1A 2E4MC 1WD3A 1ITBA 1IOBA 1FGAA 2MLLB 1VCLA 2HZ9A 1AVAC 4EB2B 3UJ4A 4ZOTA 4Q9GA 5G00A 4I4QA 4OEFA 4QD2B 1G9BA 5BOWA 1FMMS 3O5WB 4I4OA 3ZXGA 3CA5A 4G6JA 2L5XA 1V6VA 3IM6A 4I4YA 1DIWA 1Q04A 4P0KA 1I1BA 1YYNA 3PMEA 1A8DA 1TTUA 3HOMA 3CAHA 4XKIA 1PUUB 1D0HA 5E24E 21BIA 1TIEA 1II4A 2F2FA 5BXTA 3FUQA 2ZQOA 2F8XC 4IYBA 1JTCA 1BLDA 2E4MA 1ONKB 1XYFA 2RSTA 2BEAA 4II0A 1TOOA 4ZKTB 2X2SA 5HPZA 2Z49A 1FV3A 4X3AA 3ZXDA 3N7KA 1Z2VA 2NTDA 2Y9XE 3T8SA 4MZHA 4Z9WB 2HWMA 4EEEB 1MD6A 2D1ZA 4P0LA 4EKXB 3QYDA 1V6UA 3BAVA 4I2SA 4FVVA 4H9WA 5DZUA 3VSFA 1W3GA 3BAQA 3RMYA 1G9CA 5I1BA 3UD7A 1WBAA 3O49A 4J2SA 2ZR1B 4G6MA 4ISRA 3FJBA 3V0BB 2X2TA 4I3NA 5BVPI 4D0ZA 4D0TA 3WMUA 5JMCA 3FGMA 3A21A 5EG6C 1AFCA 4XFTA 1QQKA 3AJ6A 2UUSA 3OBTA 3MPPG 1TP0A 2D23A 4Q91A 2VXTI 3O4CA 2BEBA 3BAUA 4OEEA 3P53A 8I1BA 1HCEA 1JLYA 3CA4A 5EHAA 3VT1A 4D8HA 4I4RA 1ISYA 1IRPA 4EFPA 1Q03A 3I2XA 2DRYA 2VU9A 3AJ5A 3P6IA 3S8JA 4OEGA 3RTIB 3FJJA 1WBCA 3OJVA 3V0AA 1V6WA 1PUMB 1HCDA 1S0GA 4OWKA 1WD4A 2QN4A 3UD9A 1Z0HA 4I4SA 3FJDA 3UDAA 3FJHA 3CRHA 4J2XA 3RSJA 2KLLA 4ZBVB 2RQ9A 2VLCA 4I1BA 1EVTA 4LO1C 4QKSA 4J2YA 2AFGA 4TLPA 4JRAA 2GZBA 3OBRA 3FJFA 1HKNA 3NJ5A 3VUOA 5FZZA 4JKXB 1S0BA 3VT0A 4XFUA 4A7ZA 1G9AA 5FZUA 3BTAA 1FWUA 1M2TB 4JP0A 3FJKA 3JUTA 1Z4SA 1SR4C 1AVXB 4H75A 3AH4A 1XG6A 3FFZA 4DCKC 1RZOB 2NP0A 2Y9FA 3UD8A 3VEQA 7I1BA 1FN0A 3MALA 2K43A 3AKFA 3OJ2A 4FGFA 3FJEA 4MZGB 5D61A 2LIQA 4HR6C 3OJMA 1YXWA 4ZA3B 1M16A 5F8YA 3S8KA 3WO4A 1G9DA 4IY8A 2AQZA 1HIBA 3R4UA 4KEIA 4P0JA 3O3QA 4LO1A 1HWMB 4F83A 3WO2A 1TWEA 4GOVA 4I0YA 3VSZA 6I1BA 3H6RB 3V0AB 1RY7A 1L2HA 4KBBA 3HBWA 1FV2A 1CVSA 1QQLA 3Q7WA 4QC4A 4WBCA 3V79C 1NUNA 1T4QA 4I8MA 2WRYA 2NYYA 3FJ9A 2D7RA 2FFVA 1EYLA 3NBDA 3CRGA 2RG9B 1BFCA 1SR4A 2KI4A 2Y9WC 1HWPB 5FNXA 2K8RA 4EFRA 3O44A 3BADA 4QBVA 3IM7A 4AN7B 1YF8B 1K5UA 3HSMA 1F31A 3QR5A 1BFFA 1KNMA 4QO3A 3IIRA 3HALA 1JT4A 1UPSA 1BFBA 4JPZA 4ZGRB 2AAIB 2P39A 4JQ0A 1IILA 4I4XA 4IY9A 1DZDA 2VUAA 1IRAX 1ISVA 1V6XA 1N4KA 2NS2A 2D43A 4L4IA 3FJIA 4HA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WIN C;  4OWJ A;  3PG0 A;  2KH2 A;  1IJT A;  1MC9 A;  5BQU C;  2FDB M;  2K4A B;  2KI6 B;  1FWV A;  4G9M A;  2ERM A;  3FJA A;  3BX1 C;  1AVW B;  1IT0 A;  3CRI A;  4KEJ A;  3TC2 A;  1BAS A;  2D22 A;  5F8W A;  2FO1 A;  4DEN A;  2M49 A;  3IAG C;  2HW9 A;  2J3P A;  1R8O A;  2GO2 A;  3N0K A;  4GP0 A;  1PC8 B;  4LO7 B;  4G1R A;  2D7I A;  1BAR A;  1RML A;  4IZX A;  1ISX A;  3KMV A;  4CJM A;  2AXM A;  2Q9X A;  4LO3 C;  3IM5 A;  3I29 B;  4PC4 A;  5B2H A;  1IHK A;  3SNV A;  1YTO A;  4LO2 C;  4IHZ A;  5EC5 A;  4USP A;  1RG8 A;  3LLP A;  3PUB A;  3AKG A;  1S0D A;  1HWO B;  3CA6 A;  1I1E A;  1SZ6 B;  2R9K B;  5D63 A;  1JQZ A;  3WIN A;  4IQP A;  1Q1U A;  3ZX7 A;  3OGF A;  1S0C A;  5BQU A;  5BXR A;  4XFS A;  1EPW A;  3LTQ A;  9ILB A;  41BI A;  3AKI A;  1ILR 1;  4EFQ A;  1K5V A;  31BI A;  3FUO A;  1ISZ A;  4QBC A;  1TWM A;  1PZZ A;  1E0O A;  3BAO A;  4GAF A;  5DVH A;  2NVH A;  1QXM A;  1AF9 A;  3D7W B;  3BRG C;  3WA1 A;  1XHB A;  4LO3 A;  2ET2 A;  3O4O A;  4ISQ A;  3A07 A;  3CU1 B;  4LO2 A;  4USO A;  2MC2 A;  3V0B A;  4IZE A;  2D44 A;  3POK A;  3FJC A;  3ZC8 A;  3ILA A;  2IHO A;  3BRF A;  2NM1 A;  1ISW A;  2DRZ A;  1JY0 A;  3BAH A;  4H04 A;  5GAQ A;  2WBC A;  1S0L A;  3H6S E;  3BRD A;  4F34 A;  3B9U A;  2NZ9 A;  4OUJ A;  1XZZ A;  3O4B A;  2LIE A;  1S0E A;  5DUY A;  2D20 A;  2DRE A;  3BA5 A;  4ZLB B;  3BAG A;  1J0S A;  1EV2 A;  3R4S A;  1DQO A;  2IWT B;  3HMY A;  3F1R A;  1NZK A;  4QD2 C;  3AZV A;  1W3A A;  3O4A A;  4LO0 C;  3NBN A;  3AKH A;  3BB2 A;  1W3F A;  4HJJ A;  4J23 B;  4A7K A;  1HWN B;  2VSE A;  4ZFU B;  1TFM B;  3FJ8 A;  3CA3 A;  4I4V A;  4I7I A;  3RMX A;  5JLV A;  3VT2 A;  3I2A A;  2FGF A;  2Q3N B;  5D62 A;  2XOA A;  3E8L C;  2Z48 A;  2D24 A;  3K1X A;  2VXR A;  1YBI A;  4I1E A;  5F90 A;  3AZW A;  1JT3 A;  1GGP B;  3HN1 A;  1FQ9 A;  3N7L A;  4GOY A;  2QYI B;  3H6Q A;  4Z8S B;  1BFG A;  3NBC A;  4KC3 A;  4R6U B;  5DSS B;  1R8N A;  1JT7 A;  5BXS A;  1DZC A;  1FMZ A;  1DQG A;  3O4D A;  5BP5 C;  2Y9G A;  3JRR A;  3RTJ B;  1P63 A;  2FFU A;  1T9F A;  3PHZ A;  4J2K A;  2DS0 A;  3WO3 A;  3BA7 A;  2I1B A;  3AH1 A;  1AVU A;  3BA4 A;  3N7M A;  3Q7Y A;  4ION A;  4LO0 A;  2KKI A;  3Q7X A;  2ZQN A;  1ABR B;  5F8S A;  4ZFY B;  4P6A A;  3NBE A;  4OW4 A;  4DEP A;  4GP3 A;  1CE7 B;  3OGG A;  3W9T A;  2VSA A;  3EF2 A;  4I37 A;  4X39 A;  4Q9P A;  3P6J A;  3A23 A;  4G9N A;  3VWC A;  1DFQ A;  4X38 A;  4JAW A;  1JLX A;  2BFH A;  3A22 A;  4END A;  1AXM A;  1OQL B;  1DFC A;  2MIB A;  1BLA A;  3AH2 A;  3N7J A;  1S0F A;  4AN6 A;  4OWL A;  4QKR A;  3CA0 A;  4I6I A;  3F62 B;  4A7Y A;  1DJS B;  2YUG A;  2P23 A;  4I4P A;  3H6R A;  4JKQ A;  3WMV A;  4KEK A;  4GAI A;  5BP5 A;  1DLL A;  4X37 A;  5FNW A;  3ZC9 A;  4YOL A;  1BA7 A;  3UJ0 A;  5BXP A;  2F2F C;  4ZFW B;  3C9Z A;  4L4H A;  4LO8 B;  5FZY A;  3CQA A;  4I4U A;  4QAL A;  2ESU A;  1PWA A;  2HWA A;  1JT5 A;  1G82 A;  4I96 A;  4LO7 C;  3CA1 A;  2E4M C;  1WD3 A;  1ITB A;  1IOB A;  1FGA A;  2MLL B;  1VCL A;  2HZ9 A;  1AVA C;  4EB2 B;  3UJ4 A;  4ZOT A;  4Q9G A;  5G00 A;  4I4Q A;  4OEF A;  4QD2 B;  1G9B A;  5BOW A;  1FMM S;  3O5W B;  4I4O A;  3ZXG A;  3CA5 A;  4G6J A;  2L5X A;  1V6V A;  3IM6 A;  4I4Y A;  1DIW A;  1Q04 A;  4P0K A;  1I1B A;  1YYN A;  3PME A;  1A8D A;  1TTU A;  3HOM A;  3CAH A;  4XKI A;  1PUU B;  1D0H A;  5E24 E;  21BI A;  1TIE A;  1II4 A;  2F2F A;  5BXT A;  3FUQ A;  2ZQO A;  2F8X C;  4IYB A;  1JTC A;  1BLD A;  2E4M A;  1ONK B;  1XYF A;  2RST A;  2BEA A;  4II0 A;  1TOO A;  4ZKT B;  2X2S A;  5HPZ A;  2Z49 A;  1FV3 A;  4X3A A;  3ZXD A;  3N7K A;  1Z2V A;  2NTD A;  2Y9X E;  3T8S A;  4Z9W B;  2HWM A;  4EEE B;  1MD6 A;  2D1Z A;  4P0L A;  4EKX B;  3QYD A;  1V6U A;  3BAV A;  4I2S A;  4FVV A;  4H9W A;  5DZU A;  3VSF A;  1W3G A;  3BAQ A;  3RMY A;  1G9C A;  5I1B A;  3UD7 A;  1WBA A;  3O49 A;  4J2S A;  2ZR1 B;  4G6M A;  4ISR A;  3FJB A;  3V0B B;  2X2T A;  4I3N A;  5BVP I;  4D0Z A;  4D0T A;  3WMU A;  5JMC A;  3FGM A;  3A21 A;  5EG6 C;  1AFC A;  4XFT A;  1QQK A;  3AJ6 A;  2UUS A;  3OBT A;  3MPP G;  1TP0 A;  2D23 A;  4Q91 A;  2VXT I;  3O4C A;  2BEB A;  3BAU A;  4OEE A;  3P53 A;  8I1B A;  1HCE A;  1JLY A;  3CA4 A;  5EHA A;  3VT1 A;  4D8H A;  4I4R A;  1ISY A;  1IRP A;  4EFP A;  1Q03 A;  3I2X A;  2DRY A;  2VU9 A;  3AJ5 A;  3P6I A;  3S8J A;  4OEG A;  3RTI B;  3FJJ A;  1WBC A;  3OJV A;  3V0A A;  1V6W A;  1PUM B;  1HCD A;  1S0G A;  4OWK A;  1WD4 A;  2QN4 A;  3UD9 A;  1Z0H A;  4I4S A;  3FJD A;  3UDA A;  3FJH A;  3CRH A;  4J2X A;  3RSJ A;  2KLL A;  4ZBV B;  2RQ9 A;  2VLC A;  4I1B A;  1EVT A;  4LO1 C;  4QKS A;  4J2Y A;  2AFG A;  4TLP A;  4JRA A;  2GZB A;  3OBR A;  3FJF A;  1HKN A;  3NJ5 A;  3VUO A;  5FZZ A;  4JKX B;  1S0B A;  3VT0 A;  4XFU A;  4A7Z A;  1G9A A;  5FZU A;  3BTA A;  1FWU A;  1M2T B;  4JP0 A;  3FJK A;  3JUT A;  1Z4S A;  1SR4 C;  1AVX B;  3AH4 A;  1XG6 A;  3FFZ A;  4DCK C;  1RZO B;  2NP0 A;  2Y9F A;  3UD8 A;  3VEQ A;  7I1B A;  1FN0 A;  3MAL A;  2K43 A;  3AKF A;  3OJ2 A;  4FGF A;  3FJE A;  5D61 A;  2LIQ A;  4HR6 C;  3OJM A;  1YXW A;  4ZA3 B;  1M16 A;  5F8Y A;  3S8K A;  3WO4 A;  1G9D A;  4IY8 A;  2AQZ A;  1HIB A;  3R4U A;  4KEI A;  4P0J A;  3O3Q A;  4LO1 A;  1HWM B;  4F83 A;  3WO2 A;  1TWE A;  4GOV A;  4I0Y A;  3VSZ A;  6I1B A;  3H6R B;  3V0A B;  1RY7 A;  1L2H A;  4KBB A;  3HBW A;  1FV2 A;  1CVS A;  1QQL A;  3Q7W A;  4QC4 A;  4WBC A;  3V79 C;  1NUN A;  1T4Q A;  4I8M A;  2WRY A;  2NYY A;  3FJ9 A;  2D7R A;  2FFV A;  1EYL A;  3NBD A;  3CRG A;  2RG9 B;  1BFC A;  1SR4 A;  2KI4 A;  2Y9W C;  1HWP B;  5FNX A;  2K8R A;  4EFR A;  3O44 A;  3BAD A;  4QBV A;  3IM7 A;  4AN7 B;  1YF8 B;  1K5U A;  3HSM A;  1F31 A;  3QR5 A;  1BFF A;  1KNM A;  4QO3 A;  3IIR A;  3HAL A;  1JT4 A;  1UPS A;  1BFB A;  4JPZ A;  4ZGR B;  2AAI B;  2P39 A;  4JQ0 A;  1IIL A;  4I4X A;  4IY9 A;  1DZD A;  2VUA A;  1IRA X;  1ISV A;  1V6X A;  1N4K A;  2D43 A;  4L4I A;  3FJI A;  4HA2 A; 
#chains in the Genus database with same CATH topology
 3WIN C;  4OWJ A;  3PG0 A;  2KH2 A;  1IJT A;  1MC9 A;  5BQU C;  2FDB M;  2K4A B;  2KI6 B;  1FWV A;  4G9M A;  2ERM A;  3FJA A;  3BX1 C;  1AVW B;  1IT0 A;  3CRI A;  4KEJ A;  3TC2 A;  1BAS A;  2D22 A;  5F8W A;  2FO1 A;  4DEN A;  2M49 A;  3IAG C;  2HW9 A;  2J3P A;  1R8O A;  2GO2 A;  3N0K A;  4GP0 A;  1PC8 B;  4LO7 B;  4G1R A;  2D7I A;  1BAR A;  1RML A;  4IZX A;  1ISX A;  3KMV A;  4CJM A;  2AXM A;  2Q9X A;  4LO3 C;  3IM5 A;  3I29 B;  4PC4 A;  5B2H A;  1IHK A;  3SNV A;  1YTO A;  4LO2 C;  4IHZ A;  5EC5 A;  4USP A;  1RG8 A;  3LLP A;  3PUB A;  3AKG A;  4UY4 A;  1S0D A;  1HWO B;  3CA6 A;  1I1E A;  1SZ6 B;  2R9K B;  5D63 A;  1JQZ A;  3WIN A;  4IQP A;  1Q1U A;  3ZX7 A;  3OGF A;  1S0C A;  5BQU A;  5BXR A;  4XFS A;  1EPW A;  3LTQ A;  9ILB A;  41BI A;  3AKI A;  1ILR 1;  4EFQ A;  1K5V A;  31BI A;  3FUO A;  1ISZ A;  4QBC A;  1TWM A;  1PZZ A;  1E0O A;  3BAO A;  4GAF A;  5DVH A;  2NVH A;  1QXM A;  1AF9 A;  3D7W B;  3BRG C;  3WA1 A;  1XHB A;  4LO3 A;  2ET2 A;  3O4O A;  4ISQ A;  3A07 A;  3CU1 B;  4LO2 A;  4USO A;  2MC2 A;  3V0B A;  4IZE A;  2D44 A;  3POK A;  3FJC A;  3ZC8 A;  3ILA A;  2IHO A;  3BRF A;  2NM1 A;  1ISW A;  2DRZ A;  1JY0 A;  3BAH A;  4H04 A;  5GAQ A;  2WBC A;  1S0L A;  3H6S E;  3BRD A;  4F34 A;  3B9U A;  2NZ9 A;  4OUJ A;  1XZZ A;  3O4B A;  2LIE A;  1S0E A;  5DUY A;  2D20 A;  2DRE A;  3BA5 A;  4ZLB B;  3BAG A;  1J0S A;  1EV2 A;  3R4S A;  1DQO A;  2IWT B;  3HMY A;  3F1R A;  1NZK A;  4QD2 C;  3AZV A;  1W3A A;  3O4A A;  4LO0 C;  3NBN A;  3AKH A;  3BB2 A;  1W3F A;  4HJJ A;  4J23 B;  4A7K A;  1HWN B;  2VSE A;  4ZFU B;  1TFM B;  3FJ8 A;  3CA3 A;  4I4V A;  4I7I A;  3RMX A;  5JLV A;  3VT2 A;  3I2A A;  2FGF A;  2Q3N B;  5D62 A;  2XOA A;  3E8L C;  2Z48 A;  2D24 A;  3K1X A;  2VXR A;  1YBI A;  4I1E A;  5F90 A;  3AZW A;  1JT3 A;  1GGP B;  3HN1 A;  1FQ9 A;  3N7L A;  4GOY A;  2QYI B;  3H6Q A;  4Z8S B;  1BFG A;  3NBC A;  4KC3 A;  4R6U B;  5DSS B;  1R8N A;  1JT7 A;  5BXS A;  1DZC A;  1FMZ A;  1DQG A;  3O4D A;  5BP5 C;  2Y9G A;  3JRR A;  3RTJ B;  1P63 A;  2FFU A;  1T9F A;  3PHZ A;  4J2K A;  2DS0 A;  3WO3 A;  3BA7 A;  2I1B A;  3AH1 A;  1AVU A;  3BA4 A;  3N7M A;  3Q7Y A;  4ION A;  4LO0 A;  2KKI A;  3Q7X A;  2ZQN A;  1ABR B;  5F8S A;  4ZFY B;  4P6A A;  3NBE A;  4OW4 A;  4DEP A;  4GP3 A;  1CE7 B;  3OGG A;  3W9T A;  2VSA A;  4MZF B;  3EF2 A;  4I37 A;  4X39 A;  4Q9P A;  3P6J A;  3A23 A;  4G9N A;  3VWC A;  1DFQ A;  4X38 A;  4JAW A;  1JLX A;  2BFH A;  3A22 A;  4END A;  1AXM A;  1OQL B;  1DFC A;  2MIB A;  1BLA A;  3AH2 A;  3N7J A;  1S0F A;  4AN6 A;  4OWL A;  4QKR A;  3CA0 A;  4I6I A;  3F62 B;  4A7Y A;  1DJS B;  2YUG A;  2P23 A;  4I4P A;  3H6R A;  4JKQ A;  3WMV A;  4KEK A;  4GAI A;  5BP5 A;  1DLL A;  4X37 A;  5FNW A;  3ZC9 A;  4YOL A;  1BA7 A;  3UJ0 A;  5BXP A;  2F2F C;  4ZFW B;  3C9Z A;  4L4H A;  4LO8 B;  5FZY A;  3CQA A;  4I4U A;  4QAL A;  2ESU A;  1PWA A;  2HWA A;  1JT5 A;  1G82 A;  4I96 A;  4LO7 C;  3CA1 A;  2E4M C;  1WD3 A;  1ITB A;  1IOB A;  1FGA A;  2MLL B;  1VCL A;  2HZ9 A;  1AVA C;  4EB2 B;  3UJ4 A;  4ZOT A;  4Q9G A;  5G00 A;  4I4Q A;  4OEF A;  4QD2 B;  1G9B A;  5BOW A;  1FMM S;  3O5W B;  4I4O A;  3ZXG A;  3CA5 A;  4G6J A;  2L5X A;  1V6V A;  3IM6 A;  4I4Y A;  1DIW A;  1Q04 A;  4P0K A;  1I1B A;  1YYN A;  3PME A;  1A8D A;  1TTU A;  3HOM A;  3CAH A;  4XKI A;  1PUU B;  1D0H A;  5E24 E;  21BI A;  1TIE A;  1II4 A;  2F2F A;  5BXT A;  3FUQ A;  2ZQO A;  2F8X C;  4IYB A;  1JTC A;  1BLD A;  2E4M A;  1ONK B;  1XYF A;  2RST A;  2BEA A;  4II0 A;  1TOO A;  4ZKT B;  2X2S A;  5HPZ A;  2Z49 A;  1FV3 A;  4X3A A;  3ZXD A;  3N7K A;  1Z2V A;  2NTD A;  2Y9X E;  3T8S A;  4MZH A;  4Z9W B;  2HWM A;  4EEE B;  1MD6 A;  2D1Z A;  4P0L A;  4EKX B;  3QYD A;  1V6U A;  3BAV A;  4I2S A;  4FVV A;  4H9W A;  5DZU A;  3VSF A;  1W3G A;  3BAQ A;  3RMY A;  1G9C A;  5I1B A;  3UD7 A;  1WBA A;  3O49 A;  4J2S A;  2ZR1 B;  4G6M A;  4ISR A;  3FJB A;  3V0B B;  2X2T A;  4I3N A;  5BVP I;  4D0Z A;  4D0T A;  3WMU A;  5JMC A;  3FGM A;  3A21 A;  5EG6 C;  1AFC A;  4XFT A;  1QQK A;  3AJ6 A;  2UUS A;  3OBT A;  3MPP G;  1TP0 A;  2D23 A;  4Q91 A;  2VXT I;  3O4C A;  2BEB A;  3BAU A;  4OEE A;  3P53 A;  8I1B A;  1HCE A;  1JLY A;  3CA4 A;  5EHA A;  3VT1 A;  4D8H A;  4I4R A;  1ISY A;  1IRP A;  4EFP A;  1Q03 A;  3I2X A;  2DRY A;  2VU9 A;  3AJ5 A;  3P6I A;  3S8J A;  4OEG A;  3RTI B;  3FJJ A;  1WBC A;  3OJV A;  3V0A A;  1V6W A;  1PUM B;  1HCD A;  1S0G A;  4OWK A;  1WD4 A;  2QN4 A;  3UD9 A;  1Z0H A;  4I4S A;  3FJD A;  3UDA A;  3FJH A;  3CRH A;  4J2X A;  3RSJ A;  2KLL A;  4ZBV B;  2RQ9 A;  2VLC A;  4I1B A;  1EVT A;  4LO1 C;  4QKS A;  4J2Y A;  2AFG A;  4TLP A;  4JRA A;  2GZB A;  3OBR A;  3FJF A;  1HKN A;  3NJ5 A;  3VUO A;  5FZZ A;  4JKX B;  1S0B A;  3VT0 A;  4XFU A;  4A7Z A;  1G9A A;  5FZU A;  3BTA A;  1FWU A;  1M2T B;  4JP0 A;  3FJK A;  3JUT A;  1Z4S A;  1SR4 C;  1AVX B;  4H75 A;  3AH4 A;  1XG6 A;  3FFZ A;  4DCK C;  1RZO B;  2NP0 A;  2Y9F A;  3UD8 A;  3VEQ A;  7I1B A;  1FN0 A;  3MAL A;  2K43 A;  3AKF A;  3OJ2 A;  4FGF A;  3FJE A;  4MZG B;  5D61 A;  2LIQ A;  4HR6 C;  3OJM A;  1YXW A;  4ZA3 B;  1M16 A;  5F8Y A;  3S8K A;  3WO4 A;  1G9D A;  4IY8 A;  2AQZ A;  1HIB A;  3R4U A;  4KEI A;  4P0J A;  3O3Q A;  4LO1 A;  1HWM B;  4F83 A;  3WO2 A;  1TWE A;  4GOV A;  4I0Y A;  3VSZ A;  6I1B A;  3H6R B;  3V0A B;  1RY7 A;  1L2H A;  4KBB A;  3HBW A;  1FV2 A;  1CVS A;  1QQL A;  3Q7W A;  4QC4 A;  4WBC A;  3V79 C;  1NUN A;  1T4Q A;  4I8M A;  2WRY A;  2NYY A;  3FJ9 A;  2D7R A;  2FFV A;  1EYL A;  3NBD A;  3CRG A;  2RG9 B;  1BFC A;  1SR4 A;  2KI4 A;  2Y9W C;  1HWP B;  5FNX A;  2K8R A;  4EFR A;  3O44 A;  3BAD A;  4QBV A;  3IM7 A;  4AN7 B;  1YF8 B;  1K5U A;  3HSM A;  1F31 A;  3QR5 A;  1BFF A;  1KNM A;  4QO3 A;  3IIR A;  3HAL A;  1JT4 A;  1UPS A;  1BFB A;  4JPZ A;  4ZGR B;  2AAI B;  2P39 A;  4JQ0 A;  1IIL A;  4I4X A;  4IY9 A;  1DZD A;  2VUA A;  1IRA X;  1ISV A;  1V6X A;  1N4K A;  2NS2 A;  2D43 A;  4L4I A;  3FJI A;  4HA2 A; 
#chains in the Genus database with same CATH homology
 3WIN C;  4OWJ A;  3PG0 A;  2KH2 A;  1IJT A;  1MC9 A;  5BQU C;  2FDB M;  2K4A B;  2KI6 B;  1FWV A;  4G9M A;  2ERM A;  3FJA A;  3BX1 C;  1AVW B;  1IT0 A;  3CRI A;  4KEJ A;  3TC2 A;  1BAS A;  2D22 A;  5F8W A;  2FO1 A;  4DEN A;  2M49 A;  3IAG C;  2HW9 A;  2J3P A;  1R8O A;  2GO2 A;  3N0K A;  4GP0 A;  1PC8 B;  4LO7 B;  4G1R A;  2D7I A;  1BAR A;  1RML A;  4IZX A;  1ISX A;  3KMV A;  4CJM A;  2AXM A;  2Q9X A;  4LO3 C;  3IM5 A;  3I29 B;  4PC4 A;  5B2H A;  1IHK A;  3SNV A;  1YTO A;  4LO2 C;  4IHZ A;  5EC5 A;  4USP A;  1RG8 A;  3LLP A;  3PUB A;  3AKG A;  4UY4 A;  1S0D A;  1HWO B;  3CA6 A;  1I1E A;  1SZ6 B;  2R9K B;  5D63 A;  1JQZ A;  3WIN A;  4IQP A;  1Q1U A;  3ZX7 A;  3OGF A;  1S0C A;  5BQU A;  5BXR A;  4XFS A;  1EPW A;  3LTQ A;  9ILB A;  41BI A;  3AKI A;  1ILR 1;  4EFQ A;  1K5V A;  31BI A;  3FUO A;  1ISZ A;  4QBC A;  1TWM A;  1PZZ A;  1E0O A;  3BAO A;  4GAF A;  5DVH A;  2NVH A;  1QXM A;  1AF9 A;  3D7W B;  3BRG C;  3WA1 A;  1XHB A;  4LO3 A;  2ET2 A;  3O4O A;  4ISQ A;  3A07 A;  3CU1 B;  4LO2 A;  4USO A;  2MC2 A;  3V0B A;  4IZE A;  2D44 A;  3POK A;  3FJC A;  3ZC8 A;  3ILA A;  2IHO A;  3BRF A;  2NM1 A;  1ISW A;  2DRZ A;  1JY0 A;  3BAH A;  4H04 A;  5GAQ A;  2WBC A;  1S0L A;  3H6S E;  3BRD A;  4F34 A;  3B9U A;  2NZ9 A;  4OUJ A;  1XZZ A;  3O4B A;  2LIE A;  1S0E A;  5DUY A;  2D20 A;  2DRE A;  3BA5 A;  4ZLB B;  3BAG A;  1J0S A;  1EV2 A;  3R4S A;  1DQO A;  2IWT B;  3HMY A;  3F1R A;  1NZK A;  4QD2 C;  3AZV A;  1W3A A;  3O4A A;  4LO0 C;  3NBN A;  3AKH A;  3BB2 A;  1W3F A;  4HJJ A;  4J23 B;  4A7K A;  1HWN B;  2VSE A;  4ZFU B;  1TFM B;  3FJ8 A;  3CA3 A;  4I4V A;  4I7I A;  3RMX A;  5JLV A;  3VT2 A;  3I2A A;  2FGF A;  2Q3N B;  5D62 A;  2XOA A;  3E8L C;  2Z48 A;  2D24 A;  3K1X A;  2VXR A;  1YBI A;  4I1E A;  5F90 A;  3AZW A;  1JT3 A;  1GGP B;  3HN1 A;  1FQ9 A;  3N7L A;  4GOY A;  2QYI B;  3H6Q A;  4Z8S B;  1BFG A;  3NBC A;  4KC3 A;  4R6U B;  5DSS B;  1R8N A;  1JT7 A;  5BXS A;  1DZC A;  1FMZ A;  1DQG A;  3O4D A;  5BP5 C;  2Y9G A;  3JRR A;  3RTJ B;  1P63 A;  2FFU A;  1T9F A;  3PHZ A;  4J2K A;  2DS0 A;  3WO3 A;  3BA7 A;  2I1B A;  3AH1 A;  1AVU A;  3BA4 A;  3N7M A;  3Q7Y A;  4ION A;  4LO0 A;  2KKI A;  3Q7X A;  2ZQN A;  1ABR B;  5F8S A;  4ZFY B;  4P6A A;  3NBE A;  4OW4 A;  4DEP A;  4GP3 A;  1CE7 B;  3OGG A;  3W9T A;  2VSA A;  4MZF B;  3EF2 A;  4I37 A;  4X39 A;  4Q9P A;  3P6J A;  3A23 A;  4G9N A;  3VWC A;  1DFQ A;  4X38 A;  4JAW A;  1JLX A;  2BFH A;  3A22 A;  4END A;  1AXM A;  1OQL B;  1DFC A;  2MIB A;  1BLA A;  3AH2 A;  3N7J A;  1S0F A;  4AN6 A;  4OWL A;  4QKR A;  3CA0 A;  4I6I A;  3F62 B;  4A7Y A;  1DJS B;  2YUG A;  2P23 A;  4I4P A;  3H6R A;  4JKQ A;  3WMV A;  4KEK A;  4GAI A;  5BP5 A;  1DLL A;  4X37 A;  5FNW A;  3ZC9 A;  4YOL A;  1BA7 A;  3UJ0 A;  5BXP A;  2F2F C;  4ZFW B;  3C9Z A;  4L4H A;  4LO8 B;  5FZY A;  3CQA A;  4I4U A;  4QAL A;  2ESU A;  1PWA A;  2HWA A;  1JT5 A;  1G82 A;  4I96 A;  4LO7 C;  3CA1 A;  2E4M C;  1WD3 A;  1ITB A;  1IOB A;  1FGA A;  2MLL B;  1VCL A;  2HZ9 A;  1AVA C;  4EB2 B;  3UJ4 A;  4ZOT A;  4Q9G A;  5G00 A;  4I4Q A;  4OEF A;  4QD2 B;  1G9B A;  5BOW A;  1FMM S;  3O5W B;  4I4O A;  3ZXG A;  3CA5 A;  4G6J A;  2L5X A;  1V6V A;  3IM6 A;  4I4Y A;  1DIW A;  1Q04 A;  4P0K A;  1I1B A;  1YYN A;  3PME A;  1A8D A;  1TTU A;  3HOM A;  3CAH A;  4XKI A;  1PUU B;  1D0H A;  5E24 E;  21BI A;  1TIE A;  1II4 A;  2F2F A;  5BXT A;  3FUQ A;  2ZQO A;  2F8X C;  4IYB A;  1JTC A;  1BLD A;  2E4M A;  1ONK B;  1XYF A;  2RST A;  2BEA A;  4II0 A;  1TOO A;  4ZKT B;  2X2S A;  5HPZ A;  2Z49 A;  1FV3 A;  4X3A A;  3ZXD A;  3N7K A;  1Z2V A;  2NTD A;  2Y9X E;  3T8S A;  4MZH A;  4Z9W B;  2HWM A;  4EEE B;  1MD6 A;  2D1Z A;  4P0L A;  4EKX B;  3QYD A;  1V6U A;  3BAV A;  4I2S A;  4FVV A;  4H9W A;  5DZU A;  3VSF A;  1W3G A;  3BAQ A;  3RMY A;  1G9C A;  5I1B A;  3UD7 A;  1WBA A;  3O49 A;  4J2S A;  2ZR1 B;  4G6M A;  4ISR A;  3FJB A;  3V0B B;  2X2T A;  4I3N A;  5BVP I;  4D0Z A;  4D0T A;  3WMU A;  5JMC A;  3FGM A;  3A21 A;  5EG6 C;  1AFC A;  4XFT A;  1QQK A;  3AJ6 A;  2UUS A;  3OBT A;  3MPP G;  1TP0 A;  2D23 A;  4Q91 A;  2VXT I;  3O4C A;  2BEB A;  3BAU A;  4OEE A;  3P53 A;  8I1B A;  1HCE A;  1JLY A;  3CA4 A;  5EHA A;  3VT1 A;  4D8H A;  4I4R A;  1ISY A;  1IRP A;  4EFP A;  1Q03 A;  3I2X A;  2DRY A;  2VU9 A;  3AJ5 A;  3P6I A;  3S8J A;  4OEG A;  3RTI B;  3FJJ A;  1WBC A;  3OJV A;  3V0A A;  1V6W A;  1PUM B;  1HCD A;  1S0G A;  4OWK A;  1WD4 A;  2QN4 A;  3UD9 A;  1Z0H A;  4I4S A;  3FJD A;  3UDA A;  3FJH A;  3CRH A;  4J2X A;  3RSJ A;  2KLL A;  4ZBV B;  2RQ9 A;  2VLC A;  4I1B A;  1EVT A;  4LO1 C;  4QKS A;  4J2Y A;  2AFG A;  4TLP A;  4JRA A;  2GZB A;  3OBR A;  3FJF A;  1HKN A;  3NJ5 A;  3VUO A;  5FZZ A;  4JKX B;  1S0B A;  3VT0 A;  4XFU A;  4A7Z A;  1G9A A;  5FZU A;  3BTA A;  1FWU A;  1M2T B;  4JP0 A;  3FJK A;  3JUT A;  1Z4S A;  1SR4 C;  1AVX B;  4H75 A;  3AH4 A;  1XG6 A;  3FFZ A;  4DCK C;  1RZO B;  2NP0 A;  2Y9F A;  3UD8 A;  3VEQ A;  7I1B A;  1FN0 A;  3MAL A;  2K43 A;  3AKF A;  3OJ2 A;  4FGF A;  3FJE A;  4MZG B;  5D61 A;  2LIQ A;  4HR6 C;  3OJM A;  1YXW A;  4ZA3 B;  1M16 A;  5F8Y A;  3S8K A;  3WO4 A;  1G9D A;  4IY8 A;  2AQZ A;  1HIB A;  3R4U A;  4KEI A;  4P0J A;  3O3Q A;  4LO1 A;  1HWM B;  4F83 A;  3WO2 A;  1TWE A;  4GOV A;  4I0Y A;  3VSZ A;  6I1B A;  3H6R B;  3V0A B;  1RY7 A;  1L2H A;  4KBB A;  3HBW A;  1FV2 A;  1CVS A;  1QQL A;  3Q7W A;  4QC4 A;  4WBC A;  3V79 C;  1NUN A;  1T4Q A;  4I8M A;  2WRY A;  2NYY A;  3FJ9 A;  2D7R A;  2FFV A;  1EYL A;  3NBD A;  3CRG A;  2RG9 B;  1BFC A;  1SR4 A;  2KI4 A;  2Y9W C;  1HWP B;  5FNX A;  2K8R A;  4EFR A;  3O44 A;  3BAD A;  4QBV A;  3IM7 A;  4AN7 B;  1YF8 B;  1K5U A;  3HSM A;  1F31 A;  3QR5 A;  1BFF A;  1KNM A;  4QO3 A;  3IIR A;  3HAL A;  1JT4 A;  1UPS A;  1BFB A;  4JPZ A;  4ZGR B;  2AAI B;  2P39 A;  4JQ0 A;  1IIL A;  4I4X A;  4IY9 A;  1DZD A;  2VUA A;  1IRA X;  1ISV A;  1V6X A;  1N4K A;  2NS2 A;  2D43 A;  4L4I A;  3FJI A;  4HA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...