4ZFZA

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
277
Chain Sequence
AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
total genus 79
structure length 277
sequence length 277
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zfzA01
1P6FA 2ESVB 3D39A 1U2HA 4U0QB 4PRPE 5F7EH 3QH3B 3U2SA 2DJSA 3NCJH 2MCG1 3VFRA 2GSGB 4GXUN 4NN6B 3QG6A 3PDOA 4LSRH 3GSXB 4HUKB 5JORA 2RBLA 5I1CH 8FABA 2OXGA 2LE9A 5DJ2B 3S4SA 4TQEL 5I16A 5E5MA 3TESA 4M7LH 4I3GA 2A6IB 5I1KL 5F7YC 2Q8AH 1IC1A 3VFSA 4MCZB 4NZUL 4FFVD 1AO7B 5T1MB 3CPLB 3MFFB 1CDJA 3S37X 1IZKA 3VXME 2A9MH 4RBPK 2ZUYA 3PL6C 3GIZL 2DYPA 4O2CA 1QSVA 4YC2B 2DLGA 3PHOB 4GMTL 1CLZH 5HI4C 4MQ7B 4K23H 1NUGA 1XAUA 1K8IA 4RRPG 4KRMB 4NJ9H 4UU9B 4EDWH 4ZD3H 1CS6A 2Y7QA 1UKTA 5KG9A 3H9YA 1CL7H 4D0BA 5BRZB 2JKXA 3LKRB 1LDSA 3KPNB 5INDB 1ZWIB 3V6OA 2MKWA 1FFPA 1V3JA 5DJAB 4AJ0A 3INUH 4I48B 3BVNA 3TBSA 4MCYA 4XBPA 4NWUL 2YD1A 4I5BA 5DUBB 4L4VA 5DC9B 4FZ8H 1KC5L 3QEQB 1CDGA 4OZHA 3FB5A 4MA7H 1BVZA 4DN4L 5HY9B 1HYSC 4EDXB 2P46B 4UT7L 1GGUA 1S8DB 1W0YT 4IBLT 4ODXA 5D7IA 5I73B 2EYSB 5IHZA 2NR6C 3BGMA 4XVJH 2DQTL 2BVOB 1E4WL 3DMMA 5JPMA 4Z0BH 2P7TA 3TH4T 1K85A 1YN6A 4Z5RB 2FJFB 3BRGC 5IK3A 1DSFH 2F5BL 4XNMB 5GGRB 2ZWLT 1W0WB 3DROB 5DRWA 2IBBA 3FQRA 4Y4HC 1P7QB 2KZWA 1FVCA 4PRNB 2YR3A 4HFUL 5AD0A 2BNRE 2ZG2A 2P5EB 2AK4B 4HK0B 4WDIA 1OAYH 1TFHA 2FYYA 4QKXB 1S78C 1AGEB 3RUGA 3L5WB 5CJ5A 3TYFB 3REVB 1HHIB 1JZ5A 1JGUH 3T0VA 4FABH 4YHNB 4YXHH 3MRBB 3AXLB 2HFGH 4AL8L 5EORH 2H6PB 3HRZB 9CGTA 1LO4L 5D6CB 4NYLB 5JXEA 1FLRL 2HG5B 1T22B 2VDPH 3MOBL 1FFOB 1IT9H 3OR7A 5HY9A 3VWKC 1A6VL 4M00A 1INDH 5E2TH 4ZNCD 3VDAA 2YUXA 5CGYC 3O2VL 2W92A 3D0VB 1Q9OA 3WIFB 1UM6H 4ZFZB 2X9XA 1V5JA 3L3IA 5FUZH 5KVEH 3MLYH 1NUFA 1OCWH 1ZT4A 3M17A 5C6TH 2HKHH 1F4XL 4YEFA 3RPKA 4PV9B 4WI3A 4CMHB 1EFXB 2D4FA 1U95B 1A7NH 3DI3B 4QF1A 3KYNB 1I1CA 4TSCH 3PWLB 1JI1A 1IAOB 3B43A 1MIML 4ZXBB 4GG6E 4XPBH 3W2DL 4ZFOB 2ID5A 1BQSA 1B88A 2JELL 3FTGA 3BRDA 1K3ZA 1XR9A 3DMMD 1KB9J 5E99L 1GXEA 1WAAE 1PQZA 4UTAH 4AENA 4ELKA 3V52L 2XY1A 2ZCLH 3WL9A 3WJLC 1CXFA 1FZMB 4ZNEA 5BZDA 1MFCL 4NJAH 2W0KA 4KROC 2IBGA 5EOCJ 1NLDH 3FMGL 5GGVH 4TVPL 3QXVA 2FWOB 5D1ZD 1AC0A 2YWYA 3ZYIA 1R3IH 4K3JL 4PLNC 2G9HB 1SYVA 1BFTA 2B4CL 2D03H 1CGSH 3IDJA 1UENA 1Q9OB 3CMGA 4KTYA 1IM9D 1U8PA 5JDSA 1UVQB 1YC7A 1G6RA 4KQ4H 2OLDA 1OPGL 1H0DB 3CFKA 3KS0H 4KHTL 4LF3A 1OLLA 2K1MA 3B9KB 1HHKB 5HVHB 4GKOA 2XV6B 3QUXC 4MNQA 2CRZA 2YS4A 3O81A 4LAJH 2VAAB 5E8OA 3UPAA 3SE3C 5AZ2L 5K9JL 3DTXB 4S1SL 2CGRH 5D1XB 3HE7B 4HULB 4P49A 4BZ2L 3X11A 3X14B 4BH7A 5T5NG 1U58A 3Q5OA 3QFDB 2DKMA 2VQ1A 1WICA 3ULUF 5SWZD 3CDGA 5D93B 4R7NB 5EOTA 3C09C 1JMXA 5A43C 4PJAF 5HDQH 1MFAL 5BO1L 4QLRA 4UT7H 5C0AD 1PKQA 5L2JA 3AS1A 3CVHB 3HC3H 1EVTC 3PF2A 4HCRH 5JR1L 2VZTA 1YJDL 1OTTD 1ZGLM 4UNTA 4J2XA 2QR0A 3H9SE 3BESR 3B5TA 4FFZH 1G7JB 2A0LC 5ITFB 5TPWL 1J8HE 5BXFB 4FQQB 4H25A 1W0VA 4Z7VE 43C9A 4M4RA 1WV7T 5J13C 1TQBB 1NGPL 1A6WL 1WSST 2XTJD 1S8DA 1NGQL 3EJZD 3HAEB 5TE6H 4LLUA 4OCSL 1KBGL 1BIHA 5EU5B 4M3JA 2O26U 4WY7H 1RZFL 4TRPH 1LILA 3KPMA 1K9TA 4YLQT 1MCBA 3KPNA 3UBXG 4L8BA 3WUZA 5MI0B 1MSPA 1U2CA 3R06A 4MDJA 3RUGE 4D0DB 3QR2A 3WE6A 1PSKH 1KCUH 3FRUB 3MYZA 1JFMA 1CICA 1OGTA 1N64H 1C5BH 2E9WA 3MLYL 4YDIL 3VXPB 3DNKA 4ZO7A 3C5ZD 1U95A 4KK8C 1HSAA 1FC1A 4OGAC 3NIGF 1UGNA 4X4XB 1AR1C 3EYOB 4N90D 5SWZA 3NVQA 4BQ9A 4L9LC 1KTRL 1EO8H 1IAIM 1NDGB 4W4NA 5D2NC 3WFBH 5J12B 1FYTD 3T1FA 1CFNB 2A6IA 3U0WL 1FCCA 3P73B 3TC9A 4L3EE 1I9JH 4YHMH 1XR8B 4N0UA 3VG0H 3EDJA 3DUSB 3F6IA 1S9YB 3DX8A 3V5HB 5EBMA 1ZK9A 1Z9MA 3U46B 5BMFL 3R4DA 4QHUA 1DFBH 5CBEB 5JOEA 2F8VA 3H9HA 3C6LD 4PJAB 4Y4FD 5MI0C 3EYVA 4MNHA 3TYFA 2ESVA 3B83A 3ILQC 1S7SA 4P2OA 4BSVA 5T1LB 1T7XA 4NZTH 5ID1A 1MPAH 4OFYD 4FG6C 2ICEB 4FQ2H 2Z92B 1DL7L 4P2RA 3BUTA 3TBVA 5IW6A 1JIBA 4CDGC 4KKLD 4Z95H 4ZNEE 2W9LA 2ZJSL 3ZTNL 4HUVB 1MCQA 3RWDA 4NQVB 1DBBL 2O93L 1T5WA 4S10A 5CEYA 5T1KA 4OLZL 3JVGA 4KRLB 2MCPH 4QNPE 2A83A 1JF1B 1ZA6B 3OKDA 2K7PA 5IEHA 4L8DB 4PB0L 1KCSL 4Z6AT 4HWEL 3U4BH 4MJIA 1BLNB 3W2DH 1BD2A 4ALAL 4M9PA 2IANE 2Z9TA 4LGSB 2X4PB 5K33A 4JQIL 5L7XH 3HI6L 3T65A 3G6AA 3KLDA 3QI9B 1DE4B 4NQCD 3KXFE 5INDA 2J7LA 5DQ9B 1F4AA 3A0OA 4LPUA 1VGKB 1KLUA 4XAKD 4MD4A 4HZAA 3B9VA 3C09B 2NY7H 2FGWL 3MRFB 2XT1B 3UDWA 3L3GA 4FQCL 4LP4A 1WZKA 4AIZA 2OL3A 2OP4H 2DQIL 5T33L 4TNWK 3GMMB 3QFJB 7FABL 2ENSA 1LD9B 4MSWB 3EYSH 1GYAA 3MV11 4NT6A 3RKPA 5DJZA 5C0CA 4HMEA 3G6AB 4LCUA 2CKBB 3BPOC 4IHOA 4LARL 2FHBA 4UUJB 2C4XA 3ZHKA 3O6FC 1I7RA 2OSLA 1SM3L 5IESH 1MHCA 5LQBL 3QRFM 3EO9L 5JHDE 1JTTA 2WV3A 1KB5L 3G5YA 5SWQA 3IFNH 1HOCA 1RZFH 2VLKE 1UWEH 4WUUD 5D2LF 2DQJH 4R0LC 3TYGL 1ZA3B 2J88L 1XGPB 2ZCHH 3DVGB 1BD2E 4H25B 5ETUB 5MEQA 2XYCA 1A6UH 3L3KB 1KIPB 1QYGH 1AI1L 1OTUC 3G9AB 1T1ZB 2X40A 1BOGA 2BHUA 4OQTA 5EOTB 2OL3H 4U1JA 5DMIL 5GSRA 3P0YH 3C6SA 4ODWB 3LZFL 3TJHD 5EN2B 5GGSB 1KXQE 4MLSA 3BAEL 5FKAA 3WS6A 4XWOD 4OZGA 4BFIB 1G9MH 2JF1A 1NANH 2V5MA 3MRHB 4PJIB 1NCWL 4YBLB 4R90L 4LIQH 2NCMA 4ZSOE 1ZLUH 5ANMA 1IZJA 1KCKA 3ISWA 5LAXB 4MMZC 1NFKA 2Z35A 4PJAA 3PDDA 3O3BB 4MJID 1QR4A 1H3XA 4MQTB 3HZVA 2VTFA 3PDGA 4LLYB 3IF1B 1AXIB 1VFAB 3GO1L 4G3YH 4ONFH 2BK8A 3ULUL 1PEWA 5I71B 4YH6A 1YPZA 5HXMA 1PKOA 4N0UE 1GZQA 2YKLH 4GBXA 4Y8AA 1PQZB 4Y5XA 5A16A 4Z95L 4D0CA 1G7MA 4N5EA 3T0XA 4U6YA 1LDPL 2W07A 1ZHNA 3QDAA 1T6WA 3FN3A 2BSTA 3ARDA 5CHNB 2YPLE 2HJKA 2FJHA 5I17A 4JRYD 4H20H 1DANT 4PJDA 1MI5B 1W72L 2PO6A 3F7VB 3FQTB 4XCYB 4HC1H 2DQFA 4P2QE 1JGVL 4KC3B 1Z9SA 3RHWK 1S3KH 3PGDA 5HVWA 4JM2B 4GH7B 4I9WE 1FP5A 1EJ6A 2B1AL 4GXUM 1JV5A 5CP7A 4OTXH 4Z7QE 3JTSB 1CF8L 4H8WL 4C56D 3MV7E 4L8SA 1YEKH 1II4E 3ZE1F 4QHNB 5D1QD 2GITA 5A2LH 4Y16B 3R8QA 3VXUB 3MCG1 3MV9A 4FQCH 1HCVA 3KPRB 2YMXL 5F7HA 5E2WL 5KAQG 1JF1A 1HCFX 5SX4I 3B2VH 1R5WA 3D48R 2VZVA 3F62A 1KPRB 3RX7A 1MWAA 1B0GB 3RWHA 1F00I 3OL2A 4KTEH 5HHVL 2VUYA 2NY3C 5EU3B 3LIZH 5M94B 4HS8H 4KPHL 2BCKB 3Q6GL 1D5XB 4TVPD 4YHNA 4N1HB 3FFCA 4ODBD 3MROB 3NCMA 4KK6C 4UZGA 5DMKB 4PP8C 3O4OB 3PV6B 3U82B 3HPLB 4KI5C 1YN6B 1IEBA 4Z5RA 32C2A 5C0CE 1ED3A 4L3CA 2Q86B 5FO9A 5GS1B 2X05A 5J6GA 1JZ7A 5D7LE 2BVYA 4IOSD 4L4TB 2Z93A 2CDFA 4HLJA 3K2UL 1A7RH 1N4XL 5ALBH 2NQCA 2O61B 4ELMA 2P49B 5DUMH 2DB8A 1N5AA 2HMID 4MD5B 4XP6L 3KYAA 2IQ9L 3ZE2F 4CUCA 4KKBD 5FYKE 4LF3B 5DD3L 4HSQA 5FEBA 2BY1A 2DQHL 4WCYH 5CZKA 3OKKB 1HSAB 1AXTH 5D93C 4JFYB 2JJWA 4LHUD 3T08A 4LVNC 3BQUA 4N0FB 2VDOH 5JXEC 1NAMB 5EZIH 4DKFL 5DJAA 4X7CC 2PR4H 1UWXK 1YNKH 4EIZC 2XN9D 4K9EH 5E95B 4U1IA 3T0EA 2J5LB 3BPNB 5D7SL 1FVEB 2FWOA 3I6LE 1RHFA 3UJTH 5C0BD 2GQHA 1HI6A 2WBJB 3QUKA 4TOYL 3PP4L 3HUJF 4F2MA 1S9XA 1VFBA 4KKBC 1FG2A 2X9YA 1MI5A 5LJYH 2NY1B 2V9RA 4JFDD 4LBEA 4MNGB 4QEGA 2E9BA 3D85A 3DX6B 3FB8B 1N0XH 2YKLL 1YA5A 3SBWA 4EXKA 3AC0A 5IW1A 3GSWB 3OPZL 3GEWB 5ERWB 4C56E 3I2CL 4I77L 3HRPA 2VITB 3WNMA 1S7TA 2AXFB 3OGCA 3BMVA 2H9GA 4K8RD 1LEGA 2NPLX 5DQJA 4CADB 4FQQA 4P2YA 5IM7B 4X8XA 5CWSA 3VW3H 3ARDC 4YHKL 1EMTH 3VXOB 3AREC 3DO7A 3U2SB 2VSDA 1A3QA 1A1OB 1E4XI 2MPAH 4KK6D 3IJSA 3CFBB 1JGEB 1G84A 2J8UF 2BSSA 3B3IB 1DLFL 1EDQA 1TVBB 4YFLI 5IJVB 3VFNB 3NGBC 2CDEB 2NY3D 1NKRA 1I8IA 4Q9QL 4HAGA 4MS8C 4ZUSB 2Q87A 1G7QA 4GT7A 1OSZB 3CLFH 1D6EB 4NO0B 1K4CB 1U8HA 3T2OA 3MLSL 1FBIL 1NEZG 3UYPA 4QTIH 2X4QA 2OXHA 3TPUA 5HBBA 1EEZA 3IU3A 4GS7B 2APBA 4WI8A 4X7SL 2DQDL 3MV7A 5SWSE 2A6JB 5HHVH 1A0QL 2DJ4A 2PYEE 1E4JA 2EECA 4ZYKA 4V1DE 1I3RA 3TA3C 1FRGH 2B20A 5FYJH 4OB5L 5DUBA 1JGEA 3TO2B 4WUUB 3SE4C 4K94H 2VOTA 4Y4FB 2LFGA 3CIQA 2H32B 5T3ZH 3VH8G 1IGJA 1MQKL 3D5OF 3ZDYF 5KZCB 4JREB 4Q2ZA 4EI6A 4JEGB 5IHZB 4G6FD 1JYVA 4PJCB 4UBDD 3TT3H 4RRPA 2D31B 1IFHH 1OARL 3SDAD 5FB8A 4XX1E 1IM3B 3C9NB 3GIVB 4WJ5A 3JV6B 1EBAA 3VD5A 4XCYA 1RQ5A 4X80H 4K7FB 4LRIC 3TIEA 4GRMB 5F3HB 4EBQH 1CIUA 4ONHB 3JV4A 2WBJA 2XQBL 2X4TB 1WUNT 4PG2A 5FYJD 3BXNA 2K3TA 2LTQC 4YWGL 2ADJA 4XX1G 5A2KH 2Z4QA 3V0VA 1FFNA 1FL5A 1Y0LA 2I26N 4LBEB 1AO7A 5T1MA 5EO9B 1RURH 2VXQL 1HNFA 1QPXA 4WHTB 5I1AA 3GUTB 4Y89A 3NABH 3G6DH 5D7LA 1QSEB 3OJDA 4BUHA 3MLWH 1SEBB 3M8OL 4I2XE 3DVIA 2HTKC 3BKYH 4ZOEA 3M17B 2EH8H 2VDOL 4LLYA 3KNBB 1RI8A 2EICA 3O0RH 4H26A 4KPHH 5JA8B 1DEEB 1FC2D 4X6BA 3RZCC 3OTTA 3ULUE 5HPMA 1BLNA 1I1FB 1K4DA 5I8OH 2HG5A 1FH5L 4Q6IB 3SJVA 2I60H 2V5TA 3EOTH 3IJHA 3RQ3A 2R2EB 5A40E 3U7WH 5KOMC 2HJFA 4FFWD 1AQKL 3RL1B 1XCQB 2E7LA 2CUMA 2I07A 3D39E 3ILPA 1NGZA 3WJJC 1MIEL 4LSRL 1NBYA 2F9BT 4GKSA 1DBJH 4NHCH 4P9HH 5CMAA 3RZCB 3B9DA 2XKNB 1J18A 1KNOB 3CVHH 4ACPA 3KPRD 1CFSA 5JW5B 1CLCA 4AEEA 3CZFA 4HIIA 2LV4A 1BF2A 2F5BH 5CILH 5EU3A 5HDBE 4LLWB 4P4KC 1CK0L 1KJ2L 1CWVA 3L3KA 4X9FA 2WZPD 5GRJH 4PTUB 4XPTL 5I0ZA 5BRZE 3EBAA 3KWWB 2B0SL 3BN3B 4I3SL 5A3IC 1NGYB 1UJ3A 2W0FB 5FHBH 5AUMA 4HH9A 3P4OB 3LQZA 3RVVC 4KMQA 1X5HA 3H7LA 4EKXA 5IWLA 3BP7B 4RGOH 2EYSA 4R26H 4TSAH 2HN7A 1D5IL 4G7VL 4IRJC 2ZZUT 3S37L 2UUDH 1X5GA 5HDOA 5IB4B 1LK3L 1NAML 1AQDB 1X5XA 2R69L 2V5RA 1LO4H 2C7UA 2XWJA 3LV3B 1DN0A 1HHJA 1ORQB 3HE6A 4PRIA 4V1DD 3ULVC 1KJ3L 3OKMB 2ADIA 4PRHD 4PREA 4HUNB 6CGTA 1IQDB 1DQLL 1JHKL 2GK2A 1A21A 4N1EA 4G43A 1UM6L 5EORL 3S96A 2CJUH 4UUJA 5IB5A 2BVUA 1ZVSA 3V8OA 1BVLB 3BH8A 3QCUL 3V9FA 3HS0B 5MEPB 3C6LA 2G60L 2P5WE 2GJ6E 5IVZA 3OAZH 5I15H 3BP4A 4F58L 2YPVH 2GAZA 4Y2OA 3O2VH 4PRIB 4WENB 4YXKL 3QIBA 2FJGA 2AK1L 3S4SG 2N1KA 4P4KB 1I9RH 2ZKHH 4LPCA 1L6XA 2OL3B 1WC7A 4XXDB 4TUOB 2B2XH 1XGTB 2VLJA 3L3GB 4N90E 4MXQA 3LEYL 3WNKA 4N5EC 1H8OA 4KUCD 4K3HA 2N4IA 5CHNA 2H2SC 4PJHE 3P4LA 4HUWA 4V2CB 4OZIE 4UQ2A 5BW7C 3ULVH 3HB3D 3R1GL 4P4RA 1CU4H 1W72A 4NRXB 4POUB 3RBSA 1TLKA 1R3IL 1CICD 1U91B 4LAQH 4YDLC 1YY8B 1FBIH 3P77B 4UTAL 5K93A 3CMOH 1XFPA 3CFJA 4KXZI 5FF6A 1GVIA 1S7SB 2BVPB 2XTJE 3H3BC 3QDMB 5C6TL 3BPCB 1MCPH 5IFHL 1T80A 3WDHA 1F6LL 3CXDH 1XGQA 3FAXA 1NCNA 1CL7I 1OPGH 2O5XH 2OR9H 4MXVE 1RK0B 5FO8A 3P77A 5HYSB 3GRWH 4M1GL 5F88B 5C0BE 2WLZA 1CXKA 1J8HD 5DJYA 1ZVYA 4X98A 5IKCB 1YEJH 3BZDA 4G6AD 2HH0L 2YK1L 2L4OA 1CIDA 3EHBC 5J0BA 1WIPA 3MA7A 4HKJB 5AZ2H 3SN6N 1O5DT 4ZFGH 4KKNA 4OLYL 4X4XA 4YHIA 4Q9BA 1XH3B 1V7ML 1P84K 3BKCH 5BVPH 4PYHA 4RGMB 5FM8A 5JXED 4M6NL 3FFDA 4LU5L 2G2RA 4ORGA 3TCLB 2OI9C 2W0LA 4AEFA 2BNQD 1GHFL 3SE3A 2LAAA 2C4FU 2D03L 4XP1H 1CK0H 1KJ2H 4D9LH 1Q9KB 4HV8B 5I8CA 4FTVD 1MHPL 4JRXB 3SCMA 1TQCB 1FFQA 3GSNH 4I2XB 3QUYB 1H3PL 1MHHB 1QSEA 4K2UH 4QOKD 1U42A 3UP1A 3ZE2E 4UAOC 5ADOL 1OGTB 4HHAB 1YQ2A 4PD4J 4RWHA 2GK0A 1IM3A 1WISA 3C9NA 4BM7A 5C3TA 1E6OL 1PG7L 1R5VB 4WO4B 1AD9A 2OTWA 3H3KA 2EYRA 1U93B 5F3HA 3RKDC 2Z31C 1E28A 1BEYL 5IGXL 2A0LD 4YDJA 5GRVK 3VMNA 4JHZA 4LDOB 4P23C 3KJ6L 4TULL 3KPQB 2Y36H 4HBCL 4KDVA 5HDQL 3PWUB 3SEPA 5DJDB 4JFFB 2F5AL 5F1NA 1WWCA 3MO1B 2ICWJ 4WHYG 1S5IH 4JN1L 1EHAA 3FO1B 4UT9H 3GMRB 3GSOA 2IALB 4LHUA 4R4FH 1UXSA 5KVMC 1RJYA 5IB2A 4CNIA 2VLKA 3KPSD 2VZ1A 4Z18A 2NY6D 2QQKH 4QTHB 1CZ8H 1PX3A 3IFOB 3VFPA 4TPRH 3OKNB 4ZUWA 3ZDXF 3E6HA 3AREB 3RNKB 5IG7B 4MJIB 3WO4B 5HYQB 1A9EB 1WAAF 2NXZD 3CZFB 5C0NC 5IW6B 2EIDA 2Q86A 2EDWA 2A38A 5GS1A 5D1QC 4JDTH 2NY0D 4LFHD 4OD1H 4NQXA 4OZHE 4JR9L 4QXGL 4EVNA 2X42A 4Z7VA 5GXBB 3BPCA 5LGHL 4PGBA 3HR6A 3O4LB 2AV7B 5E94B 5I1EL 1MVUB 4PTTA 1XCQA 3CUPA 1MVFA 4MA3B 1A1OA 3BZEA 1B0RA 2V5YA 4QHUB 1U8NB 4QRUB 2OR8A 5GJTL 4JRYE 4M1DH 3BKJH 5AYUH 2AKRA 5CLWA 3MBXL 2APFA 2YPLA 2FEEI 1T2QH 5L2KB 5I75C 3T8XB 1DL7H 4HXAL 5JDJA 3BKML 1MRCH 1Z0NA 3MXVH 1T1XB 1UM4H 2EDJA 3P11L 4JKMA 1DJSA 2ZSVB 2FLRT 4P57B 1MCPL 1T0NA 5GZOD 1YPZE 3ZKMC 5C09D 3BW9A 5E2UL 5DXWA 5ID0B 3ME0A 1JPGB 3ESVF 3DX7A 4JN2A 4OCYL 3E6FB 4MJ6A 5EZLB 1YEJL 3FTGB 2PW1A 2GAZB 5I19H 5HYJB 4LLVA 5ESAA 4FP8H 3ULVE 1M05B 5KJRH 3JTTA 2Q20A 3PIQA 1RD6A 1RZKH 4ZAKC 3NBNA 1DFBL 3CDCA 3PHOA 4JKWA 4RISH 4Y8DC 5GS1C 3AY4C 4CVWA 3OKLB 1Z5LB 3G5ZA 1UKQA 1FVEA 4FQXD 1NBZA 5F6HI 4XCEA 4PRPB 1G7HB 1QFPA 2C3XA 4F7PB 5DTFB 1HZHL 3L7FB 1AGBB 1INQA 2AJZA 4Q0XH 2E6QA 1J87A 1JF6A 2D7OA 3HC4H 7FABH 2HRPH 1MFEL 1JPFA 1XF4B 4MS8D 2HFEB 3CC5B 4WFHD 4D9QE 2COQA 4P57A 1H3PH 3EYQC 3L6FA 3O3AA 4PRAA 1TZIA 3O2DH 1PY4A 4HAFA 1QG3A 4KK9D 4UINH 3UTPE 5EPMA 3U36A 1P84J 5J56B 5IFHH 5FO9B 5J6GB 5HYIA 3O3BA 3PQYA 1HHIA 1PG7H 2I27N 4YXLL 5MEND 5JHDD 1CDBA 3S9DB 1GH7A 3ELAT 2YA1A 3ARED 4HJGA 5T1DH 3QA3A 3FOLB 1ZV5A 3DRTA 1F4WL 4P48A 4U1MB 1IC7L 2VIRB 4ZUTA 1CDUA 1IARB 1MVUA 4PTTB 1LE9A 5DLML 2ZG3A 1V7NH 1NFDB 3LCYA 2PXYD 1MRFL 5F9OL 1QFOA 4X6CF 2FO1A 5F7UA 4Y5YC 3KPLA 4GMSL 2FNBA 3MLPA 5FGSA 1P9MA 2J6EH 1I8IB 5IFAH 3DRTB 4Z8FL 5D71H 1WBXB 4YX2L 4ORZC 4EI5D 5JW3L 3C60C 5DURD 3RAJL 3DV4A 2VL5B 2XZAL 4MAYD 2GY7B 5JHLL 2FJFA 4KZDH 1UB5B 4DTGH 3SGJC 4JDTL 5E00B 3H7BA 4H26B 3TV3L 3D9AH 1KCRH 1MCCA 3UBXI 4FFEX 5J1AA 5CINH 4R2GB 5DZOA 5M7QA 4OBRA 3EHBD 1EV2E 3IFNL 1P7HL 4MX7B 3MYJA 1D5MB 5ALCL 3ULUH 1CGTA 1OWWA 2G9HA 2NY6B 2V7HB 5KVFL 4FFVC 5ERWA 4DN3H 4WO4A 1NC4B 3ZYOA 3OB0H 5KG9B 4MZ3A 2BC4B 1JGDA 4QNPF 3CPLA 1SJVA 1UM4L 3NZHH 3PHQA 4CN1A 4K7FA 1CVRA 3B5GA 5C2BH 1P4IH 5DC4B 5E9DA 1GAFH 4XWGL 4E41D 3KHQA 1HKLL 3LZFH 2AI0H 3HE6C 5DFVC 1BBDH 4E0RA 4Z0XB 3TJEH 5C7XL 3VWKA 5KSBB 1RV6X 4R96A 3QCTL 4CL7A 3WUWG 1Q9LB 4HC1L 1MCFA 5DWUH 1I1AC 4HEPG 2IH3A 2J2ZA 4ORGB 2W9EL 3I50L 1VADB 4HWNA 4POZD 5EH1A 5HDLA 3C6LC 4WW2F 3VRJA 2MKLC 1NQBA 5EIVA 3U7YH 5C6PB 5DJXA 3RWJB 5IEHB 3IKCB 4HPYH 3WIIH 2OYPA 2ZCLL 2NY5H 3JSSA 4MJ2A 3U30C 1QACA 2C3VB 2P47B 3P0GB 4DZBB 5E94A 5T5NF 4G3YL 4EN3C 2RFXB 1Z9LA 5H37H 5F89A 2D0FA 4PJCF 3TBVB 4FQXC 4QRUA 3FQWA 4YHLH 2JJSC 1QSFB 1CBVH 2V17H 2VLLA 3IDYB 3BX7C 3S36H 3MA9H 4LHJB 5F6IC 3REVA 1R0AL 1U8QB 4KRPD 4QYOB 2YD9A 4FQJH 4NM8H 3I6KB 2IMNA 4QY8A 1N3NA 3GMLA 5KTEH 1T20B 3VH8B 2Z8VC 3MOQA 4OFYA 4AEIL 1D5XA 4OIBA 3UTZB 2CGRL 5F7KC 2LTQB 4OCYH 1LVEA 3ULVD 1JGLL 4KUZL 4YBLC 4DOHE 3O6MH 2IH1A 1OP5H 5GGQH 4HF5L 2IWGA 3ZHLA 3P73A 1S3KL 2HTLC 1EJOH 4U1NA 5JQ6H 3BWAB 4RFNC 1YC8A 2V9TA 1QLEH 4HKBB 1S7WA 5BS0B 2ZUSA 4LHQB 2XTJC 1AD9B 5F9OH 4W6XB 4X99B 1YMMD 1N4XH 1U3HD 5DGRA 3QFJA 4F80A 3QNYA 1IKNC 4JO4H 4Z76A 3PWVA 4U31A 3PGCA 4I0PC 5TE7H 4IEFB 4F7EB 2NW2B 1J8KA 1NMBL 5J1SC 2X1PA 1G7IA 3RGVA 4U1HB 3W11D 3IDNB 4DAGL 4X6FA 1WQVT 4G43B 3TCLA 4PJXF 4OF8A 5HHNB 2Y6SC 3W0WB 1QEWA 3QNXA 3QPXL 1BFOA 4JM2F 4OCSH 3S35X 5E4IA 1XIWC 4MA1B 4L8DA 4DCQB 5BS0A 1G1YA 1RIHL 4LSSL 3VXRB 4U1LB 2O61A 3DURB 1I9EA 1RAMA 2PXYA 3P4NB 3RZCD 1UA6H 2NYYC 1IAIH 4RCAA 3JUYA 3QDJB 1ZGLP 1FSKC 1UADC 1PG7X 1WAAA 1OTUD 2HVKB 2E3VA 3ZYJA 5FYKH 5FM5M 1NCBH 5JMOC 3IS0X 4NUGH 3PWPA 1L0YA 4DN4H 5I2IA 2Y1VA 4UAOB 43CAB 4LPYA 4AEHH 3MJ8A 4DVRL 1PKQB 4Z7QF 3QFJD 2MPAL 2HLAA 2WUBH 1AXTL 5JQHC 1CFSB 3BYTA 1HH9B 2X7LB 5D1ZC 1Q0YH 5IB3B 2HVKA 2ZNWA 4TUKH 3WFCH 4F9PA 2YRZA 1T4KB 5JW4R 4P9ML 1RK1A 4NQCB 3OKNA 3DMMC 1AR2A 4YGAB 4QXTB 1WIUA 4XPHH 5I66A 3W39A 1C16B 3U46A 3IFPB 4NZTL 1ES0B 2FDBP 4UDUA 4JFED 4LSUH 3FB6A 4OLWH 2NZIA 4ZXBC 4MVBA 1KJMA 5HHOB 2R29L 2CR3A 2EDEA 3IRPX 5E08H 2B1HL 2BNQE 1I8KB 3NZHL 4LCUB 3HR5A 4FQJL 1A6ZB 4ZSOA 3W5MA 1T7YA 4OB5H 4HIJA 2R2HA 4B41A 1OQXA 4TSBH 5FGCB 4PJHF 1RZJH 4PB0H 1H3TA 5ENWA 2W59A 2HKHL 5EO0B 4QHMA 3UZVB 3QG7L 2DM3A 1S7RB 5LKNA 4AMKL 1A7NL 1DLFH 1V05A 1TVHA 4JRXA 2P5WA 1G7LA 1A6ZA 3GMMA 5T3XH 2VDRH 1QNZH 1DANU 1F4YL 2UYLA 4XPBL 4OZFH 1A1MA 3G6JE 3L9RB 4KKLC 1NEZB 5FHAL 4IDLA 1CD9B 4RA3A 3K2MC 1T1WB 5D5MF 4JO4L 3I6GA 3HR5B 3UTZA 3MZGB 3V52H 2BDNL 4FXGA 3UTTA 3UZEA 1F42A 2NY3B 5DFVD 5DGQA 5HGGS 5TE7L 2GJZB 3PHSA 1MCRA 4MHHI 3SKOA 3STBA 1FL6A 3QQ4B 1CGSL 5HYSA 2DQEH 4LRIA 2BMKA 2VLLB 2UZIH 3MR9A 2OK0H 2VJXA 5GS0D 1KN2L 3TN0C 1U6AL 4N1CA 4D2NA 3H8NA 3AMLA 4N8VG 1BQLH 3FONA 2Z8SA 3TNMB 5EFIA 2IBZX 5GGSA 2C3VA 4WFFD 3TYGH 3QIBD 2VXSL 4POYA 1QTYT 4OF3A 4PV8A 3ARFB 3NFNA 3QZWG 3LHPL 5L6YH 4JG0H 2XZQH 1G9NL 1A6UL 1K5NA 4C83A 3UCRA 1H15A 4GQ9L 4KJWC 4HJGB 2CXGA 3KYOB 3GHEH 3LSOB 3DUHA 4GRWF 5C09B 1BF8A 2P5WD 4H1LG 4OCWH 4UOW1 5GGRY 4YWGH 5CIPA 3MV01 1UH3A 2OZ4A 1WZLA 1VHPA 3DGGA 1MWAH 1F11B 4DVBB 1FZKB 1NBVH 5EU4B 3L6FB 1RU9H 1ZLVH 4L1DA 4QXWA 4HIEB 3LQAL 1QSZA 1VCAA 1YJDH 4HXBL 4M8VA 4MXVF 3NZ8A 3VXPA 1LP9B 3WN5C 1JMZA 2IADA 4U2ZA 5J7CC 1IM9A 5FDWA 4BJLA 1TETL 1Q9LA 4J12A 3FAWA 4U1HA 5D1XC 1CR9L 1JRHH 2ZPKH 2E7CA 3G5ZB 4J1UB 1J9CT 5IBTH 4PB9L 4IRJA 2LU3A 1CI5A 5DK2A 3MRQB 4PUBH 1WJ3A 3UPRB 2Y4SA 4PY8I 3EIFA 4ZO6A 2FZ3A 3MODL 1AQKH 5H8DA 2BNUB 2ZOKA 1KLUB 1QBAA 4PREB 4KZEH 1GIGL 3V6ZA 4DEPB 2G60H 1NLBH 1NCBL 2H1PH 3BWAA 3AM8A 4HIEA 4QOKA 1DQLH 3UJJL 5ISZB 3U48A 1MCJA 4YXKH 4U6XA 5CILL 4WO4C 1FGVH 2KH2B 5BV7H 5DRXB 4YAQB 2A9NH 2EXWC 2MTPA 2HT2D 4YDIH 3VXNA 2DLFL 5J9PA 3GHBL 1OY3B 4Z9KB 4B7LA 3ZKXB 4Y4KB 4OI8A 5CEYB 1Q0YL 5T1KB 2ORBL 3I6KA 4QY8B 1AGEA 2YPLB 1ZT1B 2F54D 4TYUA 4ZAKD 2CK0L 5CJ8A 3TP4A 5F70A 2B2XL 1BBJA 4PDCE 4RX4A 1YNTB 3MLXL 3PGFL 4HWUA 3ULSB 4MAUH 3VGHA 1U3HA 1JK8A 3SO3B 3ROLB 1A5FL 1YEIH 1CU4L 5C70A 4GKZA 4UIKL 5ILTL 5AD0B 2NY2D 2LVCA 1YPZF 5HHOE 4XMKH 3RU8L 2CJUL 5E08L 2YD5A 5FUCC 3MV8E 1J1PL 3RVWC 4NC2B 1XCTA 1U58B 2JE8A 3V5HA 5GRUL 4WI2A 2ESVE 3E6HB 3QQ3B 4X4YB 2A2QT 4KRPB 2RGSA 1B0GA 3LN4B 5T5FL 4L5FH 1MWAB 2DOCA 1K2DB 5CP3A 5F1OB 1IEHA 2JJTA 1OB1B 3S6CA 2GJ6A 4RFEA 1TQBC 3VXOA 1FFPB 2O5YH 3RZWA 5M95B 2I9TB 2FHFA 3FN0H 1CGVA 4K7PX 4JFFA 4JY5H 5DUPL 4DZ8B 5CUSL 1UXWA 3TA3D 2QADD 1BZ7A 3RA7H 4YNYA 2UV3A 4LPXA 5JHDB 4N8VA 1PVHA 4PJDB 5DDHA 5E2VL 5D2LE 4A6YH 5I17B 2HFTA 1G7LB 4IRJB 1R5VA 3QWRA 2Y25A 2DM7A 1WEJH 5ALBL 4V1DA 2HT2C 2JJVA 2VZOA 3QDMD 3MRDB 5E6IC 4JGJA 3VXUD 4R97C 3IDUA 4NCC2 2AJUH 5IQ7H 1GGIL 3ARXA 1NBVL 4QRTB 3QNZA 5L0QC 3D3VE 3SGEI 3RTQB 3DGCR 4QO1A 4QXUL 1K3IA 4XVUD 1CFVH 2DIBA 5T3ZE 3L3HA 1A2YB 4MJ5A 5I9QC 4Y5YA 1TETH 3MRLA 4Y2DB 3B9EA 1JF5A 3OV6A 4PJEB 3QEQE 4WW1B 1I7TA 2UWEB 4JFYA 4OSUH 5HPOA 3FB6B 4PJ5D 2CLVA 4GW1A 3NCFB 1HQRA 4NPYB 1YYLL 1FFOA 1DBKL 3OR7B 4J6RH 4M7JH 2Z93B 1REIA 2BFVL 3SE8L 5DD0L 3ARDD 3NN8A 3P0VH 4JRYB 1M71A 2W60A 4JB9L 1WBYB 4PUBL 1AO7E 3SKUD 2ITCB 3HE6D 3L5HA 4BQBA 1OAZL 4RSVA 1R3KA 5F7MC 1A3LH 4M1CD 4X8JA 4CVXB 1H3UA 1E6OH 5EFIB 5D1XD 2IAMA 3O4LA 1VKXB 4Y19D 1T04A 1Q8MA 1U8NA 4TUJA 3SKJH 3RIAK 2MHAA 1B0RB 4FZ8L 3SDDC 5L8LB 1I4FA 3CFIC 5I1IL 1EH9A 3SDCC 3UXFA 32C2B 1EEQA 1W8OA 3NCEB 3MV9E 4E5XB 2D0GA 1ZXQA 4BH7B 4NN6C 1S5HA 1NFDA 2YUWA 5H37G 5IF0B 4HFUH 2DLFH 1KULA 5DR5L 3GNML 1E4KC 1BQHB 4L4VE 1TNMA 3MJ9H 3FO1A 1KIPA 2CK0H 4YIQA 4JDZB 3VCLB 1IGIH 3IDMA 2VYRE 3QEQA 5C9JA 1ZEAL 3K3QA 5ESQB 4G80A 3GK8H 3DMMB 2NY0B 4R9HA 5I18L 3VG9C 5K9QG 4X6CE 3TN0D 5DA4A 3SDDD 3VGEA 2EO1A 2ITDB 5BRZA 4D0BB 4EN3B 5K59F 3VGBA 2PYEA 2QV2A 4HWBL 4URTB 4MQXD 4X7SH 3ARFD 3WFDH 4JRWA 3BKJL 3WFZA 2CDGB 4PRID 1FG2B 4NWTH 5J4MA 2FJHB 1INDL 5F1SA 3V79C 2VLRA 5IROC 2DTMH 2CUHA 2VQTA 5FOJA 3GKZA 3E6FA 4MJ6B 5EU6E 3VD3A 4Z7NE 5D7LD 3HG1B 4NQED 4UIMB 1JCKA 3NACH 5HHOA 5I19L 5GS0L 5J6HB 1GZQB 3DIFA 3SQOL 3ARYA 3HC0B 2VERN 4APQA 3LRSB 2XRAH 1MCNA 2IPTH 3RY5A 4U6YB 5DHVH 3S5LG 2VXVL 3WIFA 3P40A 3PNWA 4HQQH 1MCWW 1UACL 3FMGH 1FIGH 4P23B 1LP9A 1T6VN 2WINA 4PJCE 3OAUH 4JZJC 4P2QA 4KJQD 5AYUL 5EC1B 1T7WA 2R56H 1UFUA 4LKCA 1D5BB 1KTDA 1QLRA 4P3CH 1A5FH 3MRBA 3OG6B 4IOIB 4RISL 4Y1AD 3EOYG 4Q9RL 3OG4B 2X4NA 3BIAX 3MXVL 1R3HA 1W8NA 3QO0A 3O45B 2NY1D 5GGUA 4PGBB 2CRMA 4MZ2A 5F88A 3SE4A 3MROA 4D8PA 4XP4L 2HRPL 5FOBA 3O2WL 5MEOA 1N6UA 2QSQA 2R8SL 3C2SA 3IDXH 3H6JA 1U8OA 3MRNB 5DEFB 2KQNA 4I9WD 4M8QA 2CD0A 2HAZA 3QZWB 5I2IB 3ZKMD 1VB9A 4NRYA 5GZOC 2AP2A 4HZLB 3C6SB 4ODWA 4H88L 4QHLA 4ISVA 1NEUA 2BVOA 3O3DB 4IRZL 3GSUA 3ZDXE 2D4DA 3IJHB 1PX4A 2BMKB 1G1CA 2DDQL 2NTSP 4UQ3B 1D5BA 4FNLH 1FE8H 3WIHL 2NY2C 4HUWB 3G08B 5EC1A 3FHAA 1RVFH 1OAKL 2J6EA 3HZKB 4AM0B 4GJTB 1ZA3A 1NCAL 4ERSL 4KKAC 3KNBA 2VNCA 1RJYB 1G7IB 5GRJL 5I74B 5IQ7L 2AEQL 1X4YA 3AMKA 5IOPB 1L9MA 3K2UH 3CD4A 1KGCD 5TF0A 1GL4B 1NAKL 1K8IB 4NP4L 3LVEA 4WHTA 1DQJA 4MQ7A 2Y5TB 1PFCA 2DQCL 5DD3H 2AQ2A 3WEXB 5I1HH 3QRGL 1B6DA 4K3DH 2E9JA 3PG2A 4FFWC 1NFDE 3MPCA 4I4WA 3VFGH 4L1HA 4KY1H 3L3DA 1NGPH 5KVFH 3MLUH 2OTPA 3VWJD 3HPJA 1IMHC 5DS8A 4ESKA 2R2HB 4S1RL 4CW1A 2SEBB 2A73B 5AWNL 4Z78B 1LP9F 3QDJD 1IQDA 5B21A 4B5EA 5C0AB 4ZPVB 2ZUTA 1RULL 5I1GH 3OKMA 3E8UL 3QUXD 4YHIB 5FO7A 3QI9A 5KVDL 2V2TA 4TRPL 4F3FB 2E6JA 3V0WH 1DTUA 1YECH 2W0FA 3QPQD 4NBZB 3UTSE 3IDGB 5I30L 2AI0L 3T0EC 5I15L 3BQUD 2XNAB 3STLA 2ATKB 2R2BA 5FYJE 1T4KA 2VXUH 5EBGA 5FA3B 1YQVH 5C0EA 4HPOL 4CJ1A 1TJHL 4R97B 5K9KA 5J06A 3UTSD 1PGRB 2FX8H 1G7PB 4KFZC 2VLKD 4WUUE 1N26A 5DVKA 3BDXA 4KROD 5C7XH 3KR3H 3IJYA 8CGTA 4NHUB 4XGZB 3SOBL 3VWJA 2MQ0A 3WIIL 3AB0B 4MA8L 3MRNA 4MB4A 1HH9A 5D2NA 2YD2A 4LPTA 1F3DJ 4UBDC 1KTDB 4PJHB 5CP3H 4U7SA 5IMKB 2QQLH 1ZSDB 5IVXB 3KPPA 3H2WA 2IFFH 2H2PD 3HMXH 1T3FA 3O8XB 1BAFL 1PW3A 2IH3B 2H3NB 4ODTH 1LEIB 1FAIH 5KOVC 4P5KA 3J7HA 1BGXL 4MNQB 3A6CH 1MF2H 1VSCA 3NFPA 1VFMA 3M45A 4KRPC 5I1KH 1P4IL 5J8OA 3L95B 1KOAA 3KYKH 3Q6FB 1BFOB 3DUSA 4UT6L 5FYLL 5J13B 3HNSL 3N06B 4ONOA 1A4JB 2DQUH 1UVQA 1C1EH 2X4RA 2XN9A 3TNNA 4OJFL 3E0GA 4JZNB 4X6DB 1MY5A 4AYFA 2UYLB 1IAMA 5TF1H 3VXRA 4Y5YB 4EN3D 3PJSA 1SEQH 2BNQA 3LS4L 3NA9H 5CJOL 3WFHA 4WFFE 1OAQL 2VLRB 3T77A 2HH0H 4F7EA 4OLZH 1LO0L 3DIFB 2A77L 4GW5A 4X5LA 4M6OH 3AUVA 3P30L 4JY6A 3ZE1E 5JW4Q 2XRAL 4HPYL 3LH2L 5EU6B 4HIXL 5EU5A 2D0HA 4N0CC 2EEDA 1V7MH 2FJGB 1VDGA 3TWCH 4POZC 3V0VB 5DC0A 4FZEH 4DZ8A 1EJOL 1ZT4B 3QHZH 5EZOH 4XMLL 4ERSH 4MA7L 2IEPA 3HS0A 5MEPA 3VD7A 3FCTA 1HXYA 4KHXL 1DUZB 5IB5B 2BVTA 1CLOH 3P4MB 5C07B 1BZ7B 1WFUA 2DM2A 1T2XA 2CIKB 4NNPH 5ACZB 4LLUB 4Q9RH 3P2TA 5FB8B 4PP2A 3VD4A 2FL5A 3CK0H 5KSBF 4NKMA 1NAKH 2E8YA 4NP4H 2VXQH 4JFDE 2AQ1A 2H2SD 2GJ6B 3K81A 4Y1AE 3RVXD 1E6JL 5DJ6A 5DD1H 3T0BA 3TO2A 4UDTA 4EI5B 5C07D 3FHQA 3RJQB 1DDHA 5ADPH 1TJIL 3I6LD 4ZDHA 2FR4B 2XN9E 1AR1D 4L3ED 1GC1L 4P5MA 1U8OB 1YMHA 3WN5A 1CXHA 2DWDB 1A7BA 3BE1L 4KI1A 3C5ZC 2N7BA 4QHKJ 1KPVB 3V6FB 4Y5XC 4FABL 1FH5H 4X5XA 2XWTB 2VMFA 3MOAH 5I1DB 5IVXF 5I9QB 4RQQA 4XNXH 4F37F 5FYKL 4FQLL 4NQXB 4EVNB 3MNZB 2GUOB 3BGFC 4Y5VB 3UC0H 3F58H 3MCLH 4HX1B 2HYMA 1DQDH 1UA6L 4U05A 1TXKA 4V3EB 1RZ7H 3SDCD 1VKXA 1CFQB 1MREL 2VSCA 3RL1A 1T0MA 2PXYC 2YZ8A 1SYVB 4I48A 1B90A 3BSZL 1A64A 3B2UD 1HDMA 4JKPH 5MP6L 5EIQA 1J05A 4HS6A 4ODSL 1KENL 2HFFA 1SVZA 4NN7B 4XH2A 3TZVC 4AENB 4XMPL 4TVPE 3N1GC 3W9EA 1FO0A 3NPZB 5KAQF 2GTZA 2P43B 3QPQC 3WHXB 3O4OC 3R06B 3DWTA 3S37H 1J7VR 4XCCL 4JLRB 5IW1B 1Z6JT 3EDKA 4L8BB 1DVFB 3OF6D 4K7PL 4JVWA 3O11A 3H42L 4M6AA 4FS0A 3FQNB 2HLFD 4XVUC 3JV6A 5ICYA 5K59E 1KTLA 1ZT7B 5IMOB 4BQ6A 2ZSVA 2GTZB 3WHXA 4PY7B 4NBXB 4GRMA 4MCZA 4ZFZA 1UB6A 4KU1A 5SWZE 4N5UA 3MGTB 2BNRB 1LO0H 3BPOB 5C0RH 4QRQA 4ZYKB 4Y19E 4QWWC 2NZ9C 4PV9A 3KYOA 1YPZB 3EUUA 1RFDH 3LN5B 4RFOH 4R8WL 2B5IC 2WUCL 3VFOA 2DI9A 4U6VH 4K71B 4NYLA 4M62H 1VFAA 4H8WH 4IRSA 3TM6A 4CVZB 1RMFH 1EGJL 1MH5A 1UJ3C 25C8L 4XPHL 3GJEB 2YXMA 4KKAD 2YMXH 3FO2A 1S5HB 1XMWA 4JFXA 4OM0H 4PJHA 4GRWH 1MJJB 4RAUB 2YD4A 3NA4A 4HMCA 5D2NB 1Z2KA 3MRKB 4L9LB 4U7KA 5FGCE 1JNLH 2LU4A 1YMHB 4HCRL 3QT2A 2ICWA 2WQRA 3GSRA 3C2AH 4J23A 4J3OC 3X11B 3X14A 1HHGB 3MRGB 5KANG 2JCCE 1I1YA 2CXKA 3D6GA 4Z77A 1K4CA 1U8HB 2AJSH 3RDTB 2XKUA 2R1WA 1F3RB 2WBKA 1A6AB 3PWNA 5LWYH 3G6JB 3VXUE 1BM3L 3OSKA 5AG9A 5SX5K 3MX0A 3TLRA 5MEQB 4XNQB 1MCLA 4OZHB 3AAZA 4U1GB 2A77H 2YUZA 2NMSA 2WBJD 5C2UB 1MFAH 5BO1H 4L4TE 1KB9K 1OQOA 4Y1AA 4CVZA 4GQ9H 4I3RH 2E6PA 3KS0J 5JO5A 3F5WA 2KBGA 1BQLL 2JB5L 3MNWB 3G5YB 4ZFOL 4U6XB 5IM7A 1BP3B 5I6XB 1T0PB 1X4ZA 4Z78A 2M26A 5D1ZB 4ZOAA 4LK4A 5HGDB 4JPVH 4JAMA 1IGCL 4FQHA 5DRZB 4ZPTB 1FV1A 2F19L 3SGDI 3RAJH 2FEEL 1C5BL 3MUGB 4JQVA 2UVEA 4JLRA 4AK1A 3N1FC 3CU1A 5ICYB 4WWID 4G6JH 3QQ9C 3F8UB 4R4NC 3SHSA 1NGQH 3UJTL 3QIUD 5IBTL 5F6HJ 1KN2H 3L1OL 5MERB 1QFHA 4CMMB 5JLZB 3S35L 4F33A 3U0WH 4OGXL 3MLZH 5J1AB 1U92A 3EFFA 1ZLUK 3EDDA 4HGWA 2VE6A 1DUYA 2ERJC 5A16B 4MNQD 5GGTL 1A4JA 4TN9A 2A74B 2APWA 1CL7L 4JVPA 4OAWB 3LN4A 2VH5L 4LSTL 4MQXC 3WHE0 2BOBB 1U8IA 1EHLH 3O6FB 1B2WL 1JJUA 4XPAL 4HG4K 4WGVB 4E41E 2XIDA 3IF1A 4X5WB 1HYSD 1X5ZA 3KPTA 1N8ZB 2Y36L 1FFRA 3F58L 3QH3A 1CQKA 3KYMB 3T4YA 3C87A 3ROLA 1AD0A 3KPOA 1MUJA 3SGKA 3I9GH 3IXAB 1NGWA 5GHWH 3VJ6B 2PCPB 1D5ZA 5DWUL 4Z0BL 4PJIA 1NLBL 2AEWA 3U4AA 1QBLL 4ZTOL 2QQKL 1I85A 1KNOA 1XGYH 3W9DB 3MRMB 4KJWD 3HMXA 4EIGB 4LQFH 5C08A 3TNMA 4BSVB 4KDTC 1DLHB 3DUUA 4MD0A 1CD0A 4HMDA 4RMSA 4FHBD 4GKNA 3STLB 1EO5A 3KYMA 2V7NB 3PL6B 5J89A 4JJ5A 3GHBH 1E4XL 4PB9H 4X83A 4ALAH 3SKNB 4BA8A 3I3EA 4U1JB 3GMPA 2JB6B 3MUJA 3V5KA 3HKFA 3BOVA 2OJEB 3DX8B 1KCVH 2BOBA 4G6KL 4W4OC 1AH1A 1I7RB 3PWUA 3CH1A 3ZL4H 3BZFB 4EUPA 4LSVH 5B3JE 2FIKA 4L8SB 4PJFE 5C0FA 3RWIB 5I74C 4IS6A 5HD8C 5IB2B 4CMHC 2X70A 2YD3A 3CX2A 3D25B 4G9FB 1OGAE 1Z5LA 4PP2B 3T1WA 4KKCC 1V3LA 1MRCL 1FGVL 2UY7A 1ULVA 4BZYA 3GUTA 1NDMA 3RPIB 3CLEH 1A0QH 1F4XH 4JFEB 1QKZH 2KPNA 1YYML 2CIIA 4KTDL 3CZJA 4ZODA 1G9EA 1FYTE 5C0GB 3JWDH 1FNFA 3HMWH 2GIYA 5IB4A 3BT2H 2E7HA 2NY7L 4PJAE 4X6DF 4OZFG 4JPVL 1JBJA 3WFEL 1WCBA 2DQIH 3NABL 2X70B 4WGWB 5T33H 3AU1B 2BJML 1OP3K 4KDWA 1MCWM 4NQSB 4XRCB 5DEGB 1YEDA 4OGAD 1I3RB 3EYSL 4L8CA 3RY6C 3ALXA 4LEXL 5CCKL 3CFEA 2WBJC 2PF6A 1SY6H 4YIQB 2R1XA 5GJSL 1XF2B 3QDGB 1EHXA 4YQXL 3RWCB 4JO2H 3FQWB 1A14H 1QRNE 1RIUH 1LO3L 7CGTA 3L1OH 4QXUH 5LWYL 2VN4A 4YFLF 1J0KA 2RCSH 2Z35B 4Y4KD 4X9BA 2DRUA 1U8QA 4QYOA 4XXCA 1T21A 2VC2L 5DUPH 2YN3A 5HSFA 3ET9F 5GSRB 1JUFB 4OD3H 5K9JH 3RVWD 3FT4B 4WI6A 5CKGA 5HJ3A 4YXLH 1HIMH 5K9KB 1ACYL 4LQ1A 3U9UB 2OS7A 4LVHC 3VWJB 1NGZB 1WLHA 2OCFD 4JREC 4RZCA 4HT1H 1HHHA 4CU6A 5D96B 3H9SD 3S88H 4YHOH 4NO0D 4LCIL 3QWQB 1EAPB 1OT1A 5INCB 3I6GB 4JHAH 2AJUL 1P69B 3LRSA 4HK3N 1T1WA 2KKQA 2DQGL 3GNMH 1OTTC 2AEPH 4P23A 1A47A 1OW0C 4HLZH 4WHDA 3P9MB 5H94A 4RGOL 2VLMD 1A9BA 4WV1A 4G7VH 5CBAA 3IFLL 2NY0C 1FDLH 4K9EC 3ZMRA 2M8XA 2GTWA 4JO1H 5EIIB 5EU7C 3WLBB 5IVZB 3WXVH 2JJUA 3I75B 4GS7C 4XWOC 1UCBH 3HNVH 1WC7B 1S9XB 5CINL 1FNLA 2XPGB 3TJHC 4OTXL 2P5ED 3RGVB 3HFMH 4JHWL 2GFBB 4MAYB 3QWOB 4J4PD 3MNVA 3ZL4L 1AKJD 1CD8A 5EC2A 1DE4A 2A6KB 3C08L 3UJIL 5C92A 3D25A 3PWVB 5EO1A 5I18H 3SDAB 3SCMD 2DM4A 3BQUB 4N0FA 4WUUA 1URLA 4LVEA 43C9B 2HTKD 3E2HC 3OWEA 1ADQH 3CGTA 1WGOA 4KDTA 3QFJE 1H8NA 1QSFE 5EOQH 1Q9WA 4MD4B 4YR6A 2Z31D 3ZKSD 5B39B 4M6ML 5FCSH 1I9RL 2ZKHL 2VB5A 4DFHA 1QSFD 2DMBA 3ESUF 4P2RD 5IROA 1DEDA 2WK2A 4KK5C 4ISVB 4WIQA 1HKLH 3BD5A 3OBAA 4NSKB 4P2OD 4OZ4A 1Q0XH 3GMLB 1NL0H 3CH1B 3R1GH 3H3PL 5T3XL 3VXTB 5C08B 2FB4L 5D6DA 1DBAL 4NOBA 4P3DB 5JIHA 1UACH 5FOBB 4HH9B 3SGJA 4JG1H 4QOKE 4G9FD 4GKNB 4GRLB 5BS0E 3NH7H 2B8OT 5I1JH 1QHPA 5GIRB 1I8MB 3VXMB 4G6KH 5JOPD 2ZUXA 2MSPA 3WN5B 1T89A 5L0QB 5D7JB 1MFBH 5B8CA 2YPKB 3B9KA 4Q6IA 1A6TA 5DJXB 4HS3B 3RWJA 1LNUB 4KV5E 3KPSB 1TCMA 5ICXB 5DSCB 3QIBC 5IJVA 4N0UB 2X6MA 3CXDL 4LMQI 2UZIL 3DYMA 3LEVL 4NQEA 4YHLL 3VXQA 5TE4H 1QZ1A 1R5WB 1CT8A 2R4SL 4K8RL 3LY6A 4NCDA 4JFFD 1ZAGA 1S9VB 1ORSA 5ELIA 3VWKB 4M7KH 5KSBA 3U83A 1QVOA 4GUPA 4DKFH 1H3GA 3ALPA 1OGAB 2H9GB 3SQOH 4BFGA 4IRZH 1DEEA 4OIIH 2XXMB 4DGYH 3IDXL 3FCTB 3O11B 5EUOF 3IDNA 1NDGA 4LMQE 2ADGB 3MV8A 3WXWL 3WE6B 3GSWA 4HFWA 5EZLA 4UU9A 3B6SB 4M61B 4H5SA 3FOMB 4D9LL 4OQ1A 5I1AB 4OZIF 4XBGB 3OX8B 2ICWI 3QEUB 4D3CL 4KJYB 3VMPA 1ZGLA 2GI7A 1I9IL 3ARPA 1C7SA 4KJPC 3DHMA 1P1ZB 4LEXH 1C5DA 4ZFOA 5GS2D 1ORQA 2DN7A 1G7MB 4NJ9L 1TPXC 3QIUA 4RNRB 4ELMB 3OKOB 1SJHB 3Q5TA 2ZPKL 3RWFA 4C55A 2AEQH 4N8CL 2FIKB 2JJSA 3EDFA 5IMMA 4N68A 4WFGD 4M7ZC 1S9WA 3QQ3A 4XAWL 1MCOH 1KJVB 1F3JB 5FGRA 2I9TA 3PDOB 2FECI 4KMTL 4F37K 3NFPB 1KG0A 3AXLA 4JFHE 5IVXE 5CEZH 2UUDK 4B0MM 4LCCB 1KB5H 5MENB 1ACYH 2DBLH 3MRGA 4O00A 1AJ7H 1NBQA 3I2CH 3GMNA 4OCXH 4NN7C 4XPFH 4HIIB 1Q72H 1KC5H 5F9JA 1R3JA 1IL1B 1KT2B 3HZMB 3O9WA 4PJFF 3TT1H 4BSJA 1JWSA 2I24N 4YHKH 3FO2B 2DQDH 4GRLA 4BSWB 5ABDE 3GJEA 1I1RA 4I0PB 3SPVA 4OQTL 1P53A 3EJZC 4OD2A 4ZUSA 1N8ZA 1I8LA 1X7QB 5CZVL 2R0ZH 4PRPD 5DJDA 1I3GH 4E42A 1TJHH 4KVNH 3TT3L 4YXHL 3AS3A 2NX5D 4P59H 4QRPE 1IAKB 3IJSB 1QBMH 3DRQB 2W38A 2WIIA 1NMCC 2FEDC 2IALA 3MLUL 3TO4C 4OV5A 1M7IA 4MQSB 15C8L 4Q97A 1WBZA 4PJ7B 4G9DA 1WTGT 2VISA 1BGXH 1XF4A 3L9RA 1A02N 3K8LA 4K3JH 4J4PC 3NGBB 2OTUB 3BVNB 3TBSB 1JPTH 2ZNXA 5EC2B 3RDTC 3VGDA 3TIDA 3WUWB 2IAMD 1KTKE 2FIRT 3ZE0F 2BNUA 5EOQL 1PG7W 2I9LB 4WV1B 2Q76A 3T4AB 4ELKB 4D9RE 3FB7A 1IM9B 2PO6B 5FDWB 2XN9B 3P11H 2BOCB 2XWBA 3O41A 1J0IA 4LCWA 5DEZA 3FFDB 1LO5A 1Q0XL 5J11C 1HDMB 2VLJE 2W65A 1RZKL 2MNUA 3LH2H 3KJ4B 1NJ9A 4HJ0C 1N2RA 3ZZ1A 5IB1B 1GJIA 1X9QA 4QRRB 5F3BB 5JHDA 1I7ZB 3KLAA 4DGVL 2IC2A 2WBWB 5FECA 5SV3A 5E5UB 4NQDD 3ARSA 1DQQA 2VDRL 3NH7L 1P7QD 3UYOD 3JWOL 1UG9A 3WCYA 4BH8A 3BZ4B 2FH6A 4QGTA 1GSMA 2JCCF 4GO6B 4RMTA 2FBOJ 3TWCL 3VFTA 1JHTA 4F9LC 4FZEL 3T2QA 3UBXA 3UTPD 2EKJA 1L8JA 5ITBL 4O2EB 5HI3D 5JW4M 1S7UB 2NNAA 5FUOL 5JNYA 2WWKO 4HS3A 1RZIB 1QRKA 1QFWI 3Q3GA 4D9QD 4FFZL 3SDAC 2OZ4L 2MQ3A 1MFEH 4N0CA 3KHOA 2DQUL 4F57L 4S1SH 5E7BA 3MJ7A 1UZ6E 4OI7A 3VFUA 3F12B 4KHTH 4KTEL 3M1BB 1ZTXH 5F1IA 5CJOH 3WHE1 2Y07H 1EA9C 3VI4F 3U7WL 4ZFFA 5E6ZA 3ZHDA 5CEZE 1XGPA 1QHOA 3SBWC 1KPVA 4YGVB 5EU7E 4JKLA 2DBLL 5HGAA 2EIZB 1Q1JH 1T1ZA 5JPNB 4N9OB 4F7TA 5EWIL 5E6IA 1MHCB 4MGXA 1IC7H 2XOTA 2SEBA 5J57B 4XXCC 2CR6A 5EG6C 4Z8FH 5IV2B 3JTSA 1YEHH 4ETQA 3NTCL 3GSNA 3HC3L 2OI9B 2YRPA 1NBZB 2PTTB 3LQMA 2ZOKB 2KZ1B 4EOWH 4Z7OF 1N6VA 4NQDB 3D9AL 4L3EB 4MNGA 1T2JA 3DV6B 2DQFB 4TUOA 3FQNA 3BD4A 3EJYD 4ODHH 3X13A 5FAAA 4PRBA 1QSEE 4LVHB 5DD1L 4ODSH 1MI5D 4WFED 1KBGH 5F9WC 1SJXA 3IAPA 3IVKB 1MCOL 3GK8L 2F8OA 2C1OB 4IJ3B 3MLRH 3CVIL 4YHYB 1BJMA 1J1OH 3N1MC 2E9IA 3K80A 3P9WB 3WSQL 3O6FD 3PXJA 4P5TB 3S5LA 4TOYH 3LD8B 1U8JA 5I8CB 2C4FT 4HWBH 4UQ3A 1EXUA 4FXLA 1S7QA 1HNGA 1GAFL 4XWGH 3T3ME 1ND0B 1JPTL 1OLZA 4QRPA 2JCCB 5E8EB 3IB4A 1T0MB 3F7QA 5IIEA 5L9DH 3D39B 2J8UB 1CDCA 3GBNL 4OFVA 5BXFA 2IH1B 3TT1L 1ZHLB 1GIGH 4JANB 3DETD 4G7YL 2X09A 3LKNA 4UTBH 5EU4A 1E4KA 3MRMA 4KV5F 4IM8A 4NBYB 3LKQA 4EUPH 2A83B 1RUPH 2P8LB 1F6AA 4FMKA 4MDIB 2VDNL 2MQCA 4P46D 2N7AA 2FX7L 3TJEL 4CAGA 5FK9B 2Q3ZA 4LASL 5L2JB 5E8DL 3CFCL 1MUJB 4X7EC 3GRWL 3GDBA 4M1GH 5FFLA 3REWA 4MAYC 4JQVC 3BN9C 3V6FA 1RUKL 5E0QA 1XGRB 4FXKB 2BRQA 4CN6A 4P59L 4XMPH 3Q48A 1FL6B 1I1FA 1K4DB 1MPAL 2BZDA 1YY9C 5IG7A 2G75B 3GMOA 5FYKD 3TBTB 3V8CA 4TQEH 1FORL 4NO2B 1CN4A 3MREA 1DZBA 1ND0A 4QRPB 4OZFA 1ADQA 2YEZB 4MAUL 4XC1H 2V2TB 3EYOA 3Q2CA 5SWZB 3U6RA 2OBGA 4ZS7L 3BEWB 2VN7A 4CMMA 1IC5H 1ZHLA 3HC0A 1LE5A 3ZO0A 1PBYA 4PLOB 3P9LA 4Y4HA 5DFWH 3QUZB 4EXPX 1PZ5B 2V17L 1MLBA 4RMUA 4UV4H 5C0GA 3IGAB 4WNQB 4XNUL 3QXAA 4LDLB 4X6EA 1R0AH 1FFNB 1FL5B 2NTFB 4DCQA 1WZMA 1UC6A 2P5WB 3O8XC 4Z0XA 2DD8H 3U9PL 4Z7WF 1T5XB 3GM8A 5I75B 2XZZA 5GQBA 5KZCD 4O58L 1KXTB 4OF6A 1BM3H 4JZJA 1AY1H 3UPCA 3QIBB 4NC0B 4EN3A 3IVKA 4N5ED 2HJKB 2J88H 3KJ6H 4TULH 3BXNB 4YBHA 2FSEA 4M02A 4QHMB 2MWCA 4FQHB 3S3JA 2F19H 4U1SA 3BDYH 5DO2D 1SMOA 5KN5A 2JB5H 4YE4H 5E1AB 3B9KC 3G5XB 4XVJL 1MHPH 3W0WE 3FQXB 5DVLA 2AXHA 1F58L 4EQ3A 2GYSA 2ZCKH 2DTSA 3BP7A 2AS5M 4ZSOB 4DK3A 3TEUA 4LPVA 1X3DA 4WI9A 5I66B 4QHLB 3M8OH 4PRDB 3D3VA 3QJHA 1G7JA 4YC2C 3K4DA 3G08A 4LSSH 1SQ2N 4LGRB 4BFBD 1RUQL 2CK2A 3IFPA 4P2QD 1UWXH 4HEME 3TFKA 5AWNH 1YY9D 3L3OA 4H0IA 2X4QB 3DI2B 3REWB 4JFXB 3BPNC 2J5LC 2Z31B 4ZFFB 1QA9A 4JFOA 1I3UA 3E8UH 5GJTH 4MD0B 2EDQA 3BJLA 3EOTL 3GI9L 2DI8A 4PGEA 1HXMB 2PTVA 1BFVL 2J4WH 1HQ4B 5I30H 3BP6A 4LLDA 5GSVB 4XC3L 1KEML 5FA4B 3OB0K 2B39A 5AAMA 4LSDA 3VFVB 4L29A 4J3UA 4HXAH 4G8EA 2XKNA 2ICEA 4X7DC 1EHLL 4N0RA 4NHCL 3IXAA 4X9GA 3EYUH 2VXTH 2VDML 1AD0B 3CFEB 3MGAA 1VACB 2R0LL 5DMIH 2XNAA 4JM4L 2X1QA 5LXGL 4EJ1C 4TUKL 4H20L 3BGMB 5F96H 1AKJB 4M5ZH 4DVRH 3EAKA 2A6DB 1KJVA 4XZUB 5I0DA 4Y5VC 3SDCB 3ZKND 4AT6A 4I3SH 5SWQB 2EXWD 4Z7WB 5BQ7A 4HK3J 5DR5H 2CLVB 3AGVA 1RUKH 2Q7YB 1IGTB 3CSYB 4J7RA 2XWBB 4R2GC 3ARBD 4I0KA 1EVUA 2FHCA 3C5ZB 2CKBA 2HLFC 1CF8H 2Z4QB 4PRPA 3OJ2C 3FT2A 4GAGH 3T0EE 3OXRA 1FAIL 5GGVL 5CKAA 4YHZH 4WI5A 4HUUA 1U3JA 2HT4D 4K07A 4HDIB 1MCSA 3PWJA 3WNLA 4TSBL 3I84A 1BQHG 4OJFH 3QEHB 3QHFL 4P46B 2IPKB 4FFYL 1D5MA 1MCEA 1QKZL 3R0MA 3MJGX 3PABB 4PJ7F 3KPRE 1QBLH 4KGLA 5KS9E 2RR3A 4FQIH 3VE0B 1CVSC 4R7DB 3SDCA 5KSAA 4RIRA 4O2FB 4X99A 3QUZD 3QUMH 3D39D 4X0KA 2BSRB 2QR0B 2Y06H 2GSGA 5T1DL 3V2AR 1JGVH 1OP5K 1IRAY 2VDQL 4ZS6C 5AUMB 4C58B 1D9KB 2ERJB 4YHPB 5C9KA 3K8KA 5DHVB 3WKNA 1XZ0A 5J1TC 1DN2A 3S3SA 1FGNL 4WV1C 3W0WD 3HC4L 3O6LH 3ULUD 1TPXB 5MHSE 3FO9B 4YE4L 3WMSA 1SY6A 1FIGL 1NCDL 3C5SA 3ZKQD 1A7RL 1ED3B 4L3CB 3RDTA 1NGWB 1KGCE 2AJYH 4WUKH 2J6EL 3MUY1 4TTGA 1U36A 4XAKE 1QA9B 3GI8L 4UINL 5D1XA 4U3CA 5E2WH 4KI5F 5EOCL 5CEXA 1TZGL 5H35A 1U3HB 3KXFD 1JZ6A 3UTOA 1KV3A 2ATPA 1JNNL 1R3KB 5HHQB 3UYRH 5F9JB 2AVGA 5GISH 1U6AH 5ICZA 4X5WA 4UV4L 5KANI 5SWSA 3RL2B 4XNMA 5GGRA 1RUQH 1LGVA 3D87B 5I6XC 1UKSA 1X4XA 2BNRA 3N1QC 3MRJB 5GPRA 5KSUB 4WW1A 2VAAA 5E8OB 1UB6B 3MUHL 4QRRA 1LO3H 1Y6MR 4YDVB 4MCYB 4XBPB 2FH8A 1S78D 4I13B 4GG8A 1G7HA 3NN8B 3VFOB 2P8MA 3LS5H 5KW9L 1KTLB 4XC3H 5F97E 1DCLA 3LHPH 4ZO8A 2M1KA 3NMEA 3F7VA 5DD5L 3MRQA 1SJHA 3LPGA 3OKOA 2GSIB 1ZLWH 5A2IH 5F6IB 4YX2H 5EO9A 1JV5B 1MCHA 3GHEL 3OXRB 1UYWH 1TJGL 4DTGL 3VD9A 2IPUK 2PYED 4LEOA 1F58H 3HB3C 1ZHNB 3JTCA 5SWSD 5LVEA 1JPST 4PJ5A 3VFSB 4JZNA 3SDXB 4YQXH 5FV1L 1FDLL 3S8WA 3B9AA 2IAMC 4Z7OE 1KEGH 4GW5B 4NOFA 2AABL 1T0NB 3GSNL 4IRSD 2R15A 3GSQB 4JFQB 3GSXA 3X12B 5FIEA 4YHML 1P9MC 1O7VA 4W6YB 4GG6A 3GSVB 3EYFB 1D9KD 3PWLA 1Y6KR 1JRHL 2DQCH 4O9HL 3W9EB 4LLMA 2GHWB 3KYNA 5D7SH 1NC2A 1X5FA 3BHBA 1RUAH 3CH8A 1HKFA 3TO4D 3HCVA 1QQDB 3VFGL 5ANMB 3KPSA 2HJLA 5F9WB 1BEYH 4PGZA 5HI4D 1S7XB 2H2PC 2ZSWB 4KAQL 5F9DC 1UEYA 1CT8B 3IKKA 4G6ML 2F5AH 4Y2DC 2RJMA 3MBEA 2FBJL 4HJJH 2HMIC 3N9GH 3RUGB 1BECA 1H5BA 2JIXA 3MA9L 4X5XB 4LLQA 1FNSL 1KIRA 3KLSA 1JK8B 5ACMA 4JPKL 2AJ3A 1CZ8L 4TPRL 3HI1A 5HGHA 3JUZA 4GKZB 4RAUA 3KPLB 4R8WH 3AM8C 3IFLH 2YN5A 3O3EA 3BDBA 1QSED 3OKEB 4S0TD 4HWEH 3OHXA 4Z7WE 5E6YA 3ULVF 2DWDA 3SKMB 4RMQA 5HTSA 3RVUD 2EDKA 3KPRA 1YY8A 5FA3A 4NNYB 1OM3L 2HJLB 5FV2A 1FG9C 3AREA 3RNKA 2N56A 1E27A 1A3RH 2AXGA 3K1DA 3NPSC 3PXHA 4PLJC 4PRDA 4JGMA 1L9NA 3OGCB 2JCCA 5C1MB 3C2AL 2EYRB 4NCC1 3VWJC 4ZPVA 5IR1A 3UZQA 5E2TL 1U8MA 4IIQA 3LEVH 4QHNA 3ZLQC 1AFVL 1BJ1J 1A1NA 1A4KA 5HHMA 1BX2A 4K94L 1V8HA 4K3EL 4X6FB 3OX8A 4H0GA 5I71C 4H5SB 1MFBL 3SDXF 1G6RL 4IHOB 4KJPD 3QHFH 1JFQL 4LARH 4R0LA 5DJZB 1T7ZA 1ZLSL 1BOYA 4O2CB 3QJFB 1Z3GL 4MXWL 5DQ9A 1S7RA 1NCTA 2GFBA 2BRRL 3MLVH 1RUMH 1BFSA 4LGPB 4MAYA 2DI7A 1ZHBB 4BYHA 1ZHKB 5TF1L 2XPGA 3MV8B 5TDPB 2FECL 4Y16C 1UWEL 4JFPB 2FLBT 1AO7D 2GKIA 1J5OH 2J12B 1GZPB 5EA0L 4L9DA 1A7PH 5C3LD 2J8HA 2DKUA 4X80L 4M03A 3MXWL 1CLYH 4CGTA 3O3DA 1KN4H 3LV3A 3T65B 1S7WB 3IAGC 2X89A 3MLWL 5F8QC 2H3NA 2EZ0C 1SHMA 5L8JB 1I9IH 1TZHB 2GT9B 2C3GA 4NUGL 5C09A 3H9SB 5T3ZD 5DD6B 3VA6A 4HUVA 1XH3A 1J12A 4GUPB 5DYOB 4ZUUA 4XP9L 4LSQH 4YFEA 5D6CA 3D0LB 4DKDC 5EOCH 5D72H 3G6DL 2UWEE 5MEOB 4N8CH 4KVCL 3GKWL 3O2DA 1G9MC 2WUBL 3QPXH 1G6VK 2VLJD 4P2OB 3FKUS 2EDXA 3MRRA 2GCYA 3FT4A 3MV7D 4PV8B 1BBJB 1A7QH 3OZ9L 3VJ6A 4XAWH 1F97A 1Y18B 1AGFA 3GM0A 1S9YA 2MJWA 1MY7A 4PPTA 2OM5A 5L88L 1UCTA 3CVHL 3UDWC 2Y9RT 4CBPA 3SKJL 4KAQH 5FF6B 3P4NA 5E70A 1AC6A 1KJ2B 4JO3H 2PW2A 3D69A 4U0RC 4UDTB 4EI5A 4U1LA 3H9HB 4KGJA 4ZO9A 1A6PA 4G6MH 5JPMB 4BH8B 4NNXB 3B4NA 3MR9B 4PJIF 3T2NL 2ZUQB 2C5DC 3HI5H 4NFBA 5BCAA 1SYSA 4LVNB 3CXHK 1FNSH 3LB6D 5CD5D 5DD6A 2XICA 5FGBA 1OTSD 3UTTE 5ETUA 4YZFF 2Z0BA 4Z7UE 1MAML 4CDHA 1ODAA 4BK4A 3THML 5GZND 1N2RB 3NIDE 4QRPD 2EEAA 3OJVC 1W72H 5GRWA 5CD3A 4Y4HD 2D3VA 1ZEAH 1FO0H 3T2PA 4DKAA 1NGXA 4BZ1L 1A1MB 3HPJB 3ULVL 2BNRD 3FB7B 2B1AH 4AIZB 3NOIA 5DK2B 2ZUQC 1P7KB 5EO1B 4C4KT 4JKPL 5MP6H 3WO3B 1JHKH 4NT6B 2F54E 2ITDA 3ROOA 4U0RB 1Q9KA 4PYGA 3ZT6A 4GXVL 3MFFA 1CXEA 3PJSB 5JIIA 1DQJB 3RWIA 4OZIB 1MRDH 2QSCL 4J3SA 4PP1C 3RBGA 1NGXB 1X5AA 2XY2A 3FZUC 3FL7A 8FABB 3TZVA 3V4VH 3UEZA 2WIIB 3DARA 3PP3H 1PDKA 1I85C 1IAKA 1IKFH 1EEYB 1M7DB 5TH2A 3LKPA 4J3VA 4KTDH 3QBTB 3ZDZE 4Z7UA 2WWKT 5CZVH 1RK1B 1WFNA 5IBUB 1A7OL 4KQ3H 4YUEL 5E6IB 1PKQE 4WFGE 4F7MB 1EO8L 1C16A 5IJKA 4OZFB 2LU7A 4BKLB 3EO0B 3CCHA 2H26A 2PCPA 4BUGA 4W4OA 5L6YL 5SV4A 5FKAB 4F15C 5CJXC 1QUNA 1BJ8A 2X4UB 3HAEG 1U0QA 2H8PA 1G7PA 3OB8A 4FXKA 2R0WH 4R3SA 4M1CC 4JRYA 2R56L 3NCJL 5JNYB 3QEGH 1MWAL 4OLVH 3RY4A 3TBYA 3V5DA 4XP4H 4FTVB 1NC2B 2IMMA 1PAMA 2XZCL 3BH9B 5A2FA 3IETB 3WKML 5IB1A 1CLZL 2F74B 1AGDB 2ZJSH 1CE6A 3ILQD 4NM4L 3D1MC 3QDGA 2B7DT 4N0YH 4OGYL 2YK1H 4NKIL 3R0NA 3OGOE 2HKFH 2Z8WC 5TQ0H 4E0RB 2QKIA 4QRQB 3S7GA 3NAAL 4RGND 4NQCE 4OF7A 4CW1B 3RVTD 4JFFE 1M1SA 2AAVA 4U1SB 5KN5B 1Q1JL 5E4EC 5E8PB 4F7CB 1LEKA 3S88L 4DGVH 2X4TA 5JQ6L 5EA0H 1GZPA 4KJYA 1K8DB 5BZDB 5EO0A 4Q7DA 1P7KA 4XBGA 4RGNC 5GGTA 4PGDA 3O8XD 1EFXA 5JXAL 1RVFL 2WW8A 5CJBA 4NDMA 4U1IB 3LPWA 1TMCB 3UJJH 5AAWA 5ADOH 4G9FE 2QADC 4MVBD 2OP4L 5GRYA 2OQJB 5FUOH 4ETYA 4PJGB 2GSIA 1D6VL 3RTQD 3DSFL 5BV7L 4GBXC 3BIBX 4L3AA 3U1SL 1N59A 4MMXC 1BIIB 1OAYL 4G42A 2X2YA 4HKXA 1UCBL 2FGZA 1GOFA 1XCTB 1KPUA 1RZ8B 2Y07L 1AHWB 5E56A 2QSVA 1T66C 1H3WM 2R2CA 2WIMA 5DI8A 3VH8A 4KZEL 4M7ZB 3BPLB 4KH2A 4PGJA 3UJIH 5CGTA 5ITFA 5KVDH 1FLRH 2YPKA 4OUUB 1IGMH 4WWKA 5BJTB 2JB6A 1KT2A 1MJ7L 1I4FB 3V5KB 3O4LE 3MBED 3QHTC 1O0VA 4I0PA 3SPVB 3BUYB 4XPAH 3VXSE 5DJCB 2OJZL 5F1IB 1VERA 2P5EE 1WT5A 3V0WL 1HYRC 1YECL 3W9DA 2NXYC 3CDGB 1KSRA 1NL0L 4ZUVA 4M5YH 4OUUA 3SJVB 4GOSA 5IHUL 1MIMH 4LLQB 2ED8A 2O5YL 3KXFA 2NXZC 4JFEE 5FCUL 3QDGD 4NSKA 3ARBB 2I07B 3MLXH 2VLME 1FNHA 1EK3A 3CFBA 4M1DL 1CGXA 5F1KC 1EX0A 4WI7A 1HILB 3WFCL 3V6ZB 1NJ9B 4RFNB 3GJFK 4P9MH 3DXAD 1BHGA 5C08E 1Q9WB 3QNXB 3FB5B 3KLAB 3BKMH 4P9HC 4XHJD 1T7VA 3NIGE 4X6BB 4QRTA 5LGKA 1OAXL 3SDXA 1VEPA 1E0OB 2VDPL 3MOBH 4F15B 1PJ9A 3SGDH 4GRLC 5JIPA 4KQ4L 2CKBH 1NLDL 4K8RH 1NUDA 4ZXBA 3OJDB 1FO0B 1SEQL 5DDHB 3DX9A 1RZKC 4HUUB 2VLRE 4LOUC 4MX7A 4WWKC 5HGDA 3QUYA 4ZTPH 3JXAA 4P3WA 1TNNA 4QRRD 2BSTB 3WLBA 1H9VA 5KJRL 3OR6A 3T77B 1RZGB 5D6DC 4LHUG 3BWUC 1ORSB 1NH6A 1IGJB 1KIUA 4ZPTA 3SE8H 4RFEB 5LGJA 1DQMH 4LCWD 4M43L 2R4RL 2GEEA 4E42B 1UXWB 3G9VA 1LNUA 3ARGB 1R5IB 35C8H 4PJCA 4DVBA 1OD7A 2PO6C 4WEMB 4KHXH 1N0LA 1F4YH 5DLMH 5JPNA 5FYLE 1AGDA 3MA7B 4HKJA 3IU3B 1EEZB 1R3LB 5F44A 4RX4D 2FRGP 4OM1L 1OSPH 2VABA 1I1YB 3DV4B 2P4AB 5I1DA 4JHBA 2B4CH 3M1BA 2XA8H 3DJ9A 3KLHD 1RJCA 2IQAA 3BDYL 2DJUA 2L7UA 4RBPH 2XZAH 1OD9A 2B0SH 5FA4A 4NNPL 2XZCH 2J8OA 3AY4A 1V3MA 5D70H 3QQ4A 2EDDA 1FPTL 4RGNE 3QFDA 2CUIA 1W0WA 3DROA 2NX5A 1H5BB 2JIXB 4NHUA 2DQEL 5I1LB 4Q58C 4GRWB 5CEZL 2DIAA 4EZMA 3NAAH 3PQYB 2X89D 2AK4A 2XXCB 4CNIB 4WW2B 2E5EA 4I18C 3X3FL 4JFDB 3FOLA 3G5VA 2VC2H 1UM5L 2QHRH 4Y16D 3QUYC 3MACH 4QOKB 3RWHB 4LCCA 3MCKA 2CIKA 3IFOA 4HJ0D 1KEMH 4OLXL 3VFPB 3BE1H 1HH6A 4OD3L 5BVJB 5C0JB 2VITA 5B3NA 5F3BA 1WZ1H 4PJDE 4RNRA 3QDHA 4YAQA 3MOAL 4QRSB 4U33A 1I3VA 5B4MC 3K4ZA 2G5RA 2ARWA 3LN5A 1JN6A 3VE0A 4NGHH 1GPOH 2NR6D 2CMRH 4HGMA 2Q8BH 3ZT5A 1WT5C 5KBNC 3GFUA 4C59B 4WTXA 4X7TB 4PJGA 1F6FB 4Y0GA 2QEJA 2UY6A 5DTFA 3RDTD 1MCDA 2D2OA 4KZDL 1Z9OA 3LAFA 4LNRA 2AW2A 1FVDB 2FX9H 3V7AE 4GFTB 3SGEH 4JZJB 3C5ZA 5EZIL 3LDBB 3QYCA 1NAMA 3QCVL 4XT1C 3MQIA 4KK8D 5KSBE 3FT3B 5C8JA 2IPTL 4XCCH 15C8H 4YNYB 5JTWA 1H8SA 1F90L 2P8MB 2MMXA 3IDYC 4MD5A 1M7IB 4AQOA 3HE7C 1OAXH 5D5MA 3HZYA 4D0CB 3O9WC 1AQDA 2NY5C 3VRIA 3IS1X 2X9WA 2Y72A 2VL5A 4P5TD 1TTFA 4HS6B 4O5LH 3NCBB 2P48B 4NRZB 5HHPA 3EYUL 5ESVA 1K5NB 4C83B 2AV1A 1I8LC 3LQZB 3DHJA 5C2BL 4C4KO 3VFRB 4ZTPL 4JM4H 4NO5A 2MCPL 2D7NA 3MRCB 2WUCH 4FTVA 5H35B 5CEXB 4ZOCA 1WTLA 5IHUH 3VXSB 1CFQA 4XGZA 3KAAA 1JWSB 1L7IL 2Z31A 4RA0C 4U6HA 3ZTNH 3DO3A 3PWPB 4PD4K 4ZUVB 5JW5A 3BO8B 1R24B 1VFUA 3UO1H 2F15A 3BP6B 1CXIA 5GSVA 4CVUA 1FGNH 3FQRB 3E2HB 2X4SA 4FRWA 3FQUA 3H3PH 4U1MA 2YWZA 5DK3A 3U7YL 3UTTD 3GMNB 3SJVE 5EUOE 3HI6H 3WD5H 1KCLA 4N9GB 4OT1L 5D2NE 4AQ1B 4P3CL 3QSKB 2XWTA 43CAA 1GGYA 4ENED 5LG1A 1TCRA 4FN0A 3BKCL 3BUYA 5DVMA 2UZXB 4JG1L 2NYYD 2P7TB 2C1PB 4E9LA 3TH2T 3VXNB 4IRSC 2K7QA 1OSPL 2FO4A 4WUKL 2D7TH 1A9EA 3GBLA 4P5MB 5KTEL 3TJHA 2VKXA 1YEIL 2APTA 4R7DA 5KSAB 3RWEB 3RVXC 4UIKH 5ILTH 3FO0H 1PEZA 1XIWD 3DVGA 1OL0A 1BVKA 2DWEB 5CJXA 1YEDB 3RU8H 3P4MA 5C07A 1KFAH 1IAII 1C12A 2Y6SD 1J1XL 2C1OA 3O6ML 1LK2B 1OAUH 4NFCA 3GSOB 4APQB 1EEUA 4NKOA 4FQIL 4G5ZH 4G8GB 4A6YA 2X4OA 2YXFA 2OSLB 1N6QH 1EO7A 2VWEC 2DDQH 1F4HA 5B8CC 4OZIA 2ICES 3S96B 4NQDA 1FVDA 2OTWB 3B6SA 3SY0B 3UAJC 5K9QI 4HV8A 1NCAH 5D96C 4ONHA 5MENE 4AZ8A 4OIIL 1LK2A 1WZ1L 3WS3A 1O7SA 1NDMB 3RPIA 5CD5C 1RULH 2J1KA 5I1GL 5EUOA 3BGFB 1JE6A 3QIWB 1TJGH 2NY4D 4PJ9C 3BZFA 4EUPB 2A1WL 1D7FA 3P0YL 3HZKA 1JVKA 2CMRL 2Q8BL 5FKPB 4WFHE 3LOWA 5DD5H 1GGIH 1I8KA 1JPSL 3OAYK 1A8JH 5FYLD 4NRYB 2V7NA 4GBXB 1CFVL 4AY0A 3QZWA 4F8QA 5FDYA 1N5YH 2QKIB 3L5XH 4R90H 2DICA 2AK4D 4Q6IC 3CU7A 2QADB 5LGHH 4E41B 2F53D 4XVSL 4LCWE 2PO6D 4NO3A 4GRWE 4S1RH 4MA8H 4KRNA 3BZEB 3E3QA 2WQ8A 2Y5EA 1HQ4A 3D69B 1YYLH 4RGNB 5TQ2H 2BVPA 4J3XA 4W68A 4QRRE 4I1NB 3VFTB 2IFF