4ZFZA

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
277
Chain Sequence
AGSHSMRYFSTTVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASPKMEPRAPWMEQEGPEYWEEQTRRVKDAAQTFRVSLGNLRGYYNQSEAGSHTLQTMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQWRAYLEGECLESLRRYLENGKETLQRAEPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
molecule keywords Major histocompatibility complex class I
molecule tags Immune system
source organism Macaca mulatta
total genus 79
structure length 277
sequence length 277
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zfzA01
1QKZL 1HHHB 2ID5A 5C8JA 1G9NH 1U8LB 3RL1A 4L4VA 3U9UB 2VLJB 1P1ZA 4H88H 4PJAA 2F53E 4NT6B 1S9YB 4XAKE 2R39A 1EGJL 1K8DB 2DD8H 1Z3GH 3L5WB 1NUDA 1EMTH 4KJWD 2X89A 5I73C 4E5XB 2ERJC 4AJ0A 5HYJA 3TP4A 1KCLA 2F9BT 3OTTA 4R7NA 4RZCA 3TJHA 3Q3GA 4PRPB 3TGXA 2VMFA 3G08B 3EYQD 5IHLB 2RBLA 4Y4FC 1I8LA 1I9EA 3QCVL 2VH5H 5BJTA 3SE9L 2VRAA 4NN5C 4XVJL 1NGPH 4YPGB 4JHAH 4LSQH 1S5HB 2XZAL 2D0HA 4XCNA 5EWIH 2P8PA 3WSQH 3PGCA 5C0FB 2VLKE 2UZXB 3FB5B 1S3KH 2UVEA 1WIOA 4RDQF 1BBDL 3KR3H 3LQZB 3MLTB 1F58H 1Y6MR 2H3NA 3SGJC 4OFPA 2ICES 1T1YB 5SWSD 5IBUB 2EEAA 3VFGL 1KACB 1TVHB 4EUPB 1AY1L 5EZIL 3RNQB 2VOTA 1EDQA 3PWUB 2Y23A 2AEWA 1R5WB 4Y4HA 1W0VA 4BM7A 3HZKB 3ARGD 1RUML 2DKMA 5EORL 3TBWA 4Y5VB 4RFOH 3BT2H 5EO9B 4OF8A 5GGQH 3JVGA 3MRPA 1DP0A 1OQXA 2BOBA 5TF1L 4BSVB 2YZ1A 4P4KB 5L6YH 3GSNB 4JAMA 2F5BL 3IDXL 4X4YB 1H0DB 4LSPH 4N5EA 3QHZH 1SQ2N 3LKQA 4ORGB 4UZGA 1IZKA 3F12B 4OV6F 1WZMA 4OLUH 4QHUB 1I85C 3B3IA 3SDXF 2NY2B 5FGRA 4BFIA 4YEFA 3ARYA 1X3DA 1HZHH 5KSVA 4U6XB 4EDXA 5F7EH 2HT4D 5I66A 2QADC 2R0LH 2CIKB 3V8CA 2X89D 1EBAA 3CNKA 2HG5B 3WIHL 4S2SA 4HT1L 3U0WH 5HYJD 5BZWB 5JHLH 1HH6B 3DSFL 1Z5LB 4XPHH 5MP6L 1CU4H 4JO2H 3CLFH 2OXGA 2XA8L 2XWJB 3D0VB 5TE7L 1A6AB 4HPOH 4NO2A 1UWGL 1HHHA 4G9FE 1U8LA 2JIXB 1N2RA 4LQFL 4HX1A 3U9UA 2VLJA 4MA7L 2YD8A 4M6OH 4P3CL 1S9YA 3QIWB 4U1SB 1K8DA 3OKEB 1FZJB 2VNCA 3L5WA 3UAJC 5IVXF 1JHLH 3D39B 4E5XA 4IDLA 4I0CC 2I24N 3HG1E 1UGNA 5JMOC 4PRPA 2XFXA 5BW7A 2VZVA 3Q5TA 1HWHB 5KVMC 2W9DH 4MB5A 3ZTJG 3WFBL 2CK0L 3S88H 3OGCB 3K81A 1MCOH 3RGHA 2A2QT 3P30L 2OYPA 2VSDA 4YPGA 3VCLB 4YBLC 1S5HA 4OFYA 4R2GB 1Q9LB 1VCAA 1HNGA 3JUYA 2AJUL 3GSUB 4Y4HD 2X1XR 3LS4H 4M48H 1INEH 1G6RB 4Q0XL 2VDKL 3FB5A 4JFXA 2F58L 4JDTL 3T1FB 5H94B 3C6LB 3LQZA 1QLFB 3MLTA 4AM0B 4B50A 4ZFGL 5CP7A 1B9ZA 3P4LA 1N0XH 4R96B 1T7YA 1T1YA 4HF5L 1TVHA 4EUPA 1HSAB 4EUPH 2RFXA 4AIXA 3PWUA 1MIMH 4XMPL 5BQ7A 4TVPE 1CL7I 2WWKT 3HZKA 5D71H 1T89A 4QHNB 1J1OH 3OGOE 3LN5B 4U1MB 5EO9A 5GHWL 3NBNA 4K7FB 1GXEA 3IFLH 4YBHA 5JIKA 1L6ZA 1WITA 3HNVL 4GAGL 5H37G 1JPFB 1J0HA 4BSVA 1HE7A 4P4KA 3GSNA 4IRJC 2BCKB 4EBQH 4X4YA 1G9ML 1H0DA 5ITFA 1DN0B 2EDWA 4ORGA 2MPAL 3F12A 4NNPH 4KDWA 5IJVB 4PY8J 4QHUA 5C09D 5DC9B 1XF4B 3B9KD 5BCAA 4JKMA 3WFDL 3F5WB 2EDHA 2F74B 4PJEF 1IL1B 3FO9A 3L6FB 5HDBF 4LOUC 5IHZB 2VLJD 1RZJL 4U6XA 2EDLA 2GIYA 3JUZA 1OTUC 1S7UB 3PP4H 1FL6B 3WNKA 2K7QA 1ZHBB 1OB1A 2CIKA 1VFBB 3U1SL 4OLEA 3B8SA 4HLZG 4X7CC 2QHRH 2CIIA 3DUUB 5BZWA 5EA0L 1HH6A 1Z5LA 3MC0A 2OTWB 4WHDA 1XR9B 3DURB 2XWJA 3D0VA 4JVPA 5E2UL 1A6AA 3IJYB 2JIXA 5B3NA 1UC6A 4PLOB 3QIWA 4U1SA 3OKEA 1FZJA 1ZANH 5KVFL 1CDCA 3D39A 2HJLB 1J1PL 4JO3L 5GS0H 3GK8H 3PWJB 5GSRB 4FFZH 1SY6L 2APXA 2UUDH 4NGHL 5GISH 4D3CH 1FNGB 2YA0A 2CMRH 4FMFA 3OGCA 4WI2A 2IQAB 2WY3A 5FEBA 4MA1C 2GEEA 4PB9H 1MF2H 3EYVB 3VCLA 3VXSB 1WUNT 1Y6NR 3SGEI 3TNNA 1Q9LA 2E7LA 4N0CC 4XNMA 4MB4A 2D31B 4H8WL 3DBXB 3V7MA 1IM3B 4JG1L 4LVHC 4NSKB 4GJTB 1G6RA 4KWUA 3KNBB 4Z0XA 1G6RH 3L3KB 4RFNC 3T1FA 5H94A 3C6LA 1QLFA 4AM0A 1FN4B 2HTLD 1SYSB 5CIPH 2JJVA 1UJTA 4JPKH 4L8SB 1RFDL 2R0ZH 3WFEH 1K8IB 1RIHH 4M5ZH 3ES6B 4FQHA 3X3FL 1JI2A 1HSAA 4P4KD 5EUOB 5I1LB 2PYEE 1HEZB 4HG4J 4U1HA 2WM0A 1KEGH 1CE1H 4DKFH 4M3JA 4Y5YC 1K5NB 2VITB 5EOQL 3THML 2EYRB 2G60L 3RWGA 4QHNA 2MQ0A 1LP9E 5EULV 3LN5A 5T3ZL 2NY2D 4U1MA 4F8TA 5LQBL 4K7FA 5J11C 3GI8H 5I1EH 3KGRA 4TULL 1QBLH 3UBXB 4XBPB 1RZ7H 5CSGA 2ICCA 1JPFA 5F88B 2MWCA 5JW4R 2BCKA 1E4XI 1J05B 1IC5H 2Q3AA 4YC2C 1DN0A 4OZHE 3L3IA 2GJ6D 3G04B 1FFRA 4GKZB 3MCG1 2XN9B 2ESVB 2X4UB 3MOAL 3VI3E 5IJVA 5CILL 1WZLA 2PTTB 1XF4A 2HRPH 1MVFA 1H3PH 4PRIE 2R0WH 4LDOB 3F5WA 1YNLL 2F74A 4PJ9A 1IL1A 3NH7L 5DJCB 2JIXD 3VFSB 5IHZA 2BY1A 1QHPA 1L7IL 1FL6A 4U1IB 4XNYH 1ZHBA 1BEYH 4FNLH 5D7SH 1VFBA 3C2SA 5DSCB 1I8IB 4RWYH 4LCYA 5BS0B 2I25N 1P4IH 4YBQC 3DUUA 4XVSL 1ZV5A 1T0MB 3KPMB 3ZE0E 5IESL 1XR9A 2YUVA 3DURA 4BK5A 5FKAB 5E99L 3IJYA 1MCKA 4GBXB 3ZDZE 4XBGB 3GHEH 4OCRH 3G6DL 5C2BL 2NLJB 4G80B 2O26U 1JF1A 4KK6D 1T1WB 1BF8A 3ZYOA 4R2GD 2HJLA 1Q0XL 4ACPA 1VADA 2ITDB 3IDYB 4ZUTA 1TZIB 3LV3B 2CUMA 3RZCC 1CLZL 1C5BH 5E94A 3PWJA 1KYOK 1NUNB 2NYYC 5GSRA 4GRLC 5L88H 1OAYH 4GRWE 1LO2H 1FNGA 3TJEL 1YJDH 4XT1C 4HK0A 5D1ZB 2FCBA 2IQAA 3SE3C 3EYVA 3VXSA 3RA7L 1QOKA 1RJCA 5IKCA 4PRNB 2DL2A 3OWEA 4FQCH 2KBGA 2P43B 3MLUL 1FE8H 1PKOA 3DBXA 1IM3A 3B9DA 4NSKA 5DJ6A 2DM7A 4N0UB 3AAZB 3KNBA 3MV11 2VUOA 1PLGH 3L3KA 4JCLA 3Q5YA 3HI6L 1FN4A 1SYSA 4L8SA 5DFWH 5HHPA 1K8IA 4QXGH 3LS5H 4G3YH 3ES6A 4Y4KD 5I1LA 1N3NB 1P7HL 2HTKD 4LSUH 3BPLB 1HEZA 1T22B 3S36H 4M7LH 4PRHE 2DLFL 2EKSB 5FKPB 4ZFZB 1K5NA 2VITA 4M03A 5JW4Q 2EYRA 5K9OB 3V6OA 4K07A 1G9NL 1VGKB 1YYLH 1PGRB 3EYUH 3RY6A 4H88L 4OZIA 1HKFA 4XAWH 2RCSL 3V4VH 5DGRA 1HQRB 4PJ9D 3UBXA 2DD8L 4NN7B 4XBPA 5C0JB 1EMTL 3TN0B 5F88A 3ULVE 4JZJC 1J05A 1V8HA 2VN4A 3PABA 3RY5A 1AGCA 4ZYKA 3GGWB 1CFQB 2UVFA 3G04A 4GKZA 1AR2A 1RI8A 1AC6A 2OJZH 4ODXB 2XN9A 2X4UA 3PHSA 1OTTC 5DVMA 4PBVC 2PTTA 4P23C 3S4SB 3VGFA 4MA8L 3FFCE 5DJCA 3VFSA 2CR6A 5J1TC 3OB0H 4LSQL 3WDIA 4U1IA 3GI9H 2C4FU 1FVDB 1I8IA 1KOAA 1NAMB 5BS0A 2X4SB 2NCMA 2BXYA 2WQ8A 2FATL 3GRWH 4GQPH 3U4BH 1T0MA 4AMKL 3KPMA 3G6JB 3E3QC 3K2MC 4LNVA 3SJVB 1UEMA 4HIJB 4GBXA 4XBGA 5HYSB 1DDHB 2BNRB 3CFCH 3QYCA 2NLJA 4G80A 4M7KL 4OGZA 4P5MB 1T1WA 4JQXA 3VXSD 5MI0B 5TDOB 5F97E 1TZIA 3H9SB 3LV3A 3BPOB 3BT2L 1IEHA 2DBLH 4NRZB 2R2EA 2QSQA 2DQFB 5DR5L 3CZJA 5DD5H 5GGQL 3VH8B 1J0ZA 3TA3B 4QWWC 3UPRB 3RBGA 5D1ZA 1QLRB 2QSCL 1ITCA 1J8HE 4WHCA 3TF7A 2W9EL 3SDAC 4Y4FD 3LQAH 3VD9A 1U3ZA 4PRNA 5JQHC 2AP2A 4PJCA 1K4DB 3KYMB 3MUZ1 3MJ8B 8FABA 3GNMH 4PLKD 5ACLA 4N0UA 3AAZA 4GS7B 4P2OB 7FABH 1HZHL 1VFMA 4YHOL 3EOYG 3WIIH 2A77H 3UJTL 1FC1A 4HHAA 1UADC 4OT1L 4X99B 1IKFH 1NDGB 4UV7L 3R8QA 2OL3H 3JV5A 4R26L 4HAFA 4BFGA 1RK1B 1N3NA 5E2JA 1T7XA 4CVZB 4PJFE 1T22A 2BC4B 1A8JH 1Q0YL 1CU4L 1IGYB 4U1NB 2EIEA 2EKSA 5FKPA 4ZFZA 3BGMA 2N1KA 2XN9D 4DFIA 3KJ6L 2KQNA 1VGKA 3TBYB 3VXPB 3UJJL 3WHE1 5JW4M 1HQRA 1NUGA 5C0JA 3FT3A 1A7QL 1CICC 3TN0A 1KCSL 2E8YA 2NY5C 1RZFH 4M62L 2PXYC 1NPUA 4WTWA 5BS0D 5F9OH 3GGWA 1CFQA 1GC1L 4KK5C 2N56A 4ODXA 4MXQC 1FPTL 4KKAD 2YUZA 4ELKA 5DEGB 3S4SA 1SJHA 4GBXD 4YDKL 5EOCJ 5B21A 4ZPVB 1ORSA 5IWLA 5CUSL 3UX9B 3CFEB 3KXFD 1LMKA 4WFED 4ZPTB 1FVDA 4JVUA 2GUOB 1FL5B 2HFGL 3LS4L 1INEL 2X4SA 4YK4B 3QWOB 1NAMH 3DNKA 4CRPA 2DQDL 1R6VA 2OQJB 4KUZL 5ISZB 3G6JA 2Y5TA 2AI0L 4K3GA 1KPRB 3SJVA 4RBPK 3VD7A 5ICXB 4NOBA 5D2NE 2WANA 4HIJA 5HYSA 3ZDYE 2BNRA 3RX8A 2YKLL 5FFLA 1MCNA 3D25B 5T1DL 5DURB 3E6HB 4NM8H 1NEUA 3L7EB 5D72L 1MIML 1I7UB 2X9YA 5T1KB 4JKWA 4X4ME 2Y72A 5TDOA 3RDTC 1J0YA 3H9SA 2IPTL 1HIML 1G7MB 1NGYB 2IGFH 4NRZA 2EDFA 4WIQA 4G8GD 5IVZA 2DQFA 3UAJD 3S37H 4TUKL 5ADOL 1LP9F 2X6MA 1KLGA 2ZUQC 1F11B 1QLRA 4ONOA 1PY9A 3TPUE 4M4RA 1YQ2A 5D7IF 4HXBL 3GSNL 3PL6B 1JZ3A 1K4DA 1U36A 3KYMA 3RIAK 3BWAB 1BIIB 3MJ8A 4OZHF 3RJDA 5KAQF 1NQBA 2YD3A 5KSBB 3GJEB 3KDMB 3PHQB 3U83A 3ARRA 4P2OA 3VI3F 4WI8A 4NWTL 4P59H 3DX6B 4QTIH 1HI6A 1D5MB 3T4YA 2PO6B 4X99A 1KPVB 3Q6GH 1H8SA 1MCSA 2BJMH 2Q76B 3HUJB 3MV9E 4BZ1H 4NCC2 1U9KA 5I8EA 4L8CA 1A7RH 5DRNB 1RK1A 5I71B 1DANT 5IBLD 4TVPH 4CVZA 5IB3B 5TE6H 3WLBB 4DKEH 1HHIB 2OK0H 2BC4A 4WV1B 2MMXA 1IGYA 5L8KB 5FUCC 1MCWW 4X6FB 1JNJA 3PUCA 3HAEH 2DJSA 4P2CG 1I4FB 2IC2A 4Z5RA 3P77B 1ZLWH 5ITBL 3KPLA 3ZE0F 5HGAA 4OZFB 2ZCHH 5DD0H 3TBYA 3VXPA 1S7XB 5GGSA 3BQUB 3CH8A 1NCDL 3VMPA 1A7PH 2P45B 5B39G 4CNIB 3TH2T 3ZDZF 1EPFA 1QFUH 2FJGB 5E9DA 3GBNH 1N7MH 1C08B 5HSFA 3BYTA 2VDPH 2ICWI 4TSAH 5DUBB 2VJXA 3SGKC 3VA6A 2Y36H 5SV4A 4DN4H 4JY5H 1AGBA 3UYPA 4OLVH 4JR9L 2CMRL 4KDVA 4IRJD 2OR7A 4RGOL 3SJVD 4P2QA 4GRWF 1ODAA 5DEGA 1G7HB 4NJ9L 4UDTB 4ZPVA 4G6JH 3BKJL 1UZ8B 3QFDB 2R8SL 3CFEA 4PY7A 4BUGA 4M7LT 4ZPTA 1PJ9A 2ORBH 5EH1A 5E00B 2GUOA 1FL5A 5I1GH 2RR3A 4R7DA 4TUJB 4F7PB 1A6WL 1G6RL 2OQJA 4LOUD 4RMQA 3C8HA 5ISZA 1WCBB 3S7GA 3I6KB 1P2CB 4R9HA 1X6LA 1KPRA 2VL5B 1RK0B 3C60B 3WFEL 4PJBA 4M5ZL 5D1XB 3VXNB 4WI9A 5B4MC 5EBWB 3D25A 1NFKA 3BPCA 3BYYA 4EJ1C 3L7EA 4NC1E 1I7UA 4MDIB 1CE1L 5T1KA 4YO0B 1RUPL 4ODTL 4YXLH 4R4BB 2EXYC 3QSKB 2X1PA 4D0CA 5FGBC 4EOWL 4JGJA 3V4PL 1N5YL 3QNXB 1G7MA 1BD2A 1NGYA 3PGFH 1WZ1H 5HBBA 5HGBB 4OGXH 2YEZB 4HIIB 1EO8L 3CX2A 3HNTH 3RU8L 5FM8A 3O9WC 1FZMB 4RISH 2JJWA 4DJMA 3T65B 3SOBH 1R5VB 2KQMA 3PL6A 3SDDC 2A6DB 4MGXA 3ULVF 2FYYB 1A7OH 3BWAA 1BIIA 1MQKH 1VDGA 4D9QD 5DUMH 3LRSB 2FGWH 4JJ5A 4K9EH 5KSBA 4K8RC 3GJEA 3KDMA 3PHQA 1QUNA 5E7BA 1DEDA 5H35A 3DX6A 5J12C 1D5MA 5I6XB 2PO6A 1KPVA 4J3TA 1MI5B 2Q76A 1TQCB 2W38A 4FNLL 5D7SL 2DDQH 1MFDH 4PRHB 3RI5F 5E9DD 1MJ7H 1P4IL 4ISVA 5IB3A 3WLBA 3P3YA 3QDJA 1HHIA 4F7CA 3O8XB 4WV1A 1I9JH 2J3SA 1UXWB 4X6FA 1MCEA 4PP8C 4Q74A 3DX7B 1I4FA 4ZDHB 4M7ZC 3P77A 4ETYA 1RURL 3MRNB 4OZFA 4P2QD 5HI3C 1S7XA 4YDVB 5IBTL 3BQUA 4OV5B 4OZFH 5D2LE 4WHYG 5GGVY 5CLTA 5EZLB 2FJGA 3M17B 2UZIL 1C08A 2YS4A 3RGVC 3VXMD 3HA0A 1N59B 4JPWH 5LG1A 5L88L 1DEEB 4E0RB 1PG7L 5DUBA 2FSEA 1DLFH 5CCKL 1I9IH 3P0VH 5ISZD 2W92A 4M1CC 4MX7B 1IAKB 1T20B 4GW4B 2IALB 3WMSA 4UDTA 3AS3A 1JNNH 1UZ8A 5DT1L 3QFDA 3MUJA 1QZ1A 1A3LL 4MQ7B 3SKMB 4ONFL 5E00A 5T1MB 1UYWL 5HYEA 3D3VB 4ZO9A 4TUJA 4PD4J 2W07A 4F7PA 1JZ8A 4CADB 5F9DC 3KPRE 1BD2D 1WCBA 1XGYH 2FZ3A 5ADPL 3I6KA 1P2CA 3ZYZA 4Z77B 3C60A 2VL5A 1RK0A 2YWYA 3LS5L 2HFTA 1DVFC 5F7LB 4X6DE 5D1XA 4YHMH 3VXNA 1FC2D 4LCCC 3TV3L 5EBWA 5CINH 1U95B 4L9LB 3S36L 3PL6D 3GSWB 1PY4A 2XZCL 4MDIA 1TJGH 3BP6A 3QIUC 4YO0A 3WN5C 3X3GL 3ILPB 2NY4B 4PJFF 2Z8WC 4R4BA 4LEXH 4GRWH 3TCLB 3QNXA 1HILB 4LKCB 3DO7B 5HGBA 3TYGH 1A3QA 1CXHA 2YEZA 2NXYC 4HIIA 4UOW1 3V4VL 5I16B 1WC7B 5FYJH 1BZ9B 4CMHC 4P99A 1DTUA 2EH7H 5CJOH 1FZMA 2PO6D 1T4KB 1PD6A 2CKBB 5CEYB 5IEHB 4AH2A 3BESR 2B7DT 5HXMA 3T65A 3NZ8B 1R5VA 2NYYD 4OLXL 2XKSA 1OSZB 3H7LA 4Z95H 1OT1A 2FYYA 2HJKB 3QDJD 3TEUA 3NGBB 4JHZA 4Z18A 1F3RB 3LRSA 1UH3A 4XNXL 2NY1C 5TPWH 2Q7YB 2R2CA 3LZFH 1M4KA 1SBSL 3BQUD 4WO4C 1MI5A 1U8JA 2KPNA 3GI9L 4DAGH 1KFAL 5DUPL 2NW2B 3SDCC 5E24E 3U4BL 1YJDC 4AG4H 4W4NA 3JZ7A 1NGWB 1MFCH 4NO3B 4Y19D 4ODHH 2DLTA 1N5AB 4N0FB 4V3EB 1LO0H 3DX7A 3AUVA 4ZDHA 2C7UA 1DR9A 2EH8H 3MXWH 1U8IB 3MRNA 3CFCL 2Z93B 4OV5A 4YDVA 4OB5H 3FRUB 3ROLB 5IMOA 1MHPL 1MRFL 5EZLA 1V7NL 4X7SH 2AAVA 1IGCL 4NOFA 4PB0H 4PJDA 4YE4L 4Q6YA 2RAMA 3HC3L 1UZ6F 1N59A 1OARH 4I2XE 4E0RA 1DEEA 4S10A 2WW8A 5DD1L 4BQCA 3VW3L 4RWHA 2EYSB 1L7TL 2IAMB 1CTNA 1F2XK 3C60D 3NOIA 1T20A 4GW4A 2IALA 5I8KL 3O41A 2R69L 2GSGB 2ARJB 3MRGB 4I9WD 4MQ7A 3H3PH 1OTTD 2JLLA 3SKMA 3B2UD 5TDNB 3MOBH 1V3KA 4P23D 3UTPE 5T1MA 4GUPB 2CO6B 1AIFB 3QCUL 2W91A 4JPVL 5D6DA 2BNQD 3QRGH 5D2NB 3EYSH 4MJ2A 3N9GL 3WUWA 4CADA 1HCFX 4HEME 4K3DH 3WV0A 1CICA 3Q2CA 4Z77A 3SBWC 4YAQB 4GOSA 3KPSE 1TQBB 2R2HB 2LFGA 2DQTH 3DHJA 1VEPA 1KIRB 2LTQC 3UEZA 4W4OA 1U95A 4L9LA 1KBGL 5JW5B 2H2SD 1R3KB 3R4DA 3TT3L 4JGUA 4HS3B 1I8MB 3CDGB 3ILPA 4RNRB 3RL2B 3TLRA 3QIBB 2NZ9C 4Q2ZB 4P5KB 2AJYH 3ZT5A 1X5XA 5FO7B 1HILA 1J86A 1U8KB 3DO7A 3KPOA 4J3XA 4P9MH 3U0PB 5I16A 4KJQD 5IQ7H 1WC7A 1BZ9A 4C56E 2XTJC 3BISA 1T4KA 5CEYA 1HSBB 5IEHA 4EIGB 4M6ML 2K7PA 3QDMD 2CKBH 2OI9B 3I85A 4FQIH 1OSZA 4K7PH 2W0LA 2V9QA 2BHYA 3HPLA 3OAZK 2HJKA 4QWWD 2J8OA 4HIHB 3ZHDA 2YPLE 5JXAH 5DD6B 2AQ2A 3T0EE 5INDB 1P6FA 1FLRL 1RU9L 2YD1A 3OV6A 3QHFH 1A02N 2Q7YA 2O5ZH 3CH1B 2ZOKB 2VR9A 3UDWA 2CR3A 5J8OA 3JTTA 4FFYH 5K9JL 4FP8L 2ZUTA 1WEJH 1JE6A 1RMFL 5CBEB 2YHGA 3GIZL 4OZGE 2YK1H 1NGWA 1N5AA 4N0FA 4U1GC 1V7MH 5M94B 3QXTA 1OQOA 3LQAC 1I7ZA 3O3UN 3WD5H 3OBAA 5F9AC 5A2JH 2Z93A 4NQUA 3ALXA 2BDNH 5D93C 4NM8L 5GGRB 3FRUA 2DLIA 2CPCA 3ROLA 4Z7UE 1OD9A 4WFFE 3VFNA 3MRCB 3PE9A 1CWVA 4FG6D 2VDRH 4LCWB 3GMNB 4C4KO 3JV0A 1FO0B 3MV8E 4AL8L 2OP4H 4HMDA 2IGFL 1KTLA 2Q3ZA 2EYSA 1CICD 1LK2A 2ICEB 3IFPB 4O02H 5JTWA 5T1LD 3FKUS 1AQKH 5T3XD 4GLRH 4NJAH 3VXRE 1N6QL 2GSGA 2ARJA 4KK5D 1B88A 4MXQD 3AY4C 5K93A 4M7ZB 4AEHL 3MRQB 2B4CC 1T1XB 4HIXH 1AIFA 3QEQD 4F3FB 3ISWA 4BELD 2OR9H 3FQUA 1NGZA 1ZXQA 1EAJA 1Q94B 1WBZB 2CJUH 2J2ZA 4YAQA 2R2HA 4BZ1L 1H9VA 2HA1A 2RHEA 3BW9A 1MLCB 3I6LE 3SGKA 1UENA 1IQDB 3VWKC 4X83A 1KIRA 5TQ0L 3M45A 1PSKL 2AQ1A 2VR5A 3T0DA 2X1QA 4PJXE 4OF6A 5JW5A 1O7SA 3VFRA 4HJGB 3HC4H 5F1NB 4LSRH 3GMRB 3BDYH 4HS3A 1I8MA 3CDGA 4RNRA 3RL2A 1H8NA 1WCQA 3QIBA 4Q2ZA 4P5KA 1ZLUH 2H32H 1OVZA 5FO7A 3FB6B 1U8KA 3VG9C 1FH5H 5MEPB 4BQ6A 3U0PA 1A7PL 2XG4A 4ZXBB 3CX5K 4LLYB 5ID0B 5LXGL 2A1WH 3C8KB 2ENYA 3K3QA 5D2LF 2OI9A 5J4MA 1CBVH 3HLAB 2A73A 4U6VL 4HIHA 4LCCB 1FQ9C 4OLVL 3K4AA 5DD6A 5INDA 1RZIA 2FEDC 3BAEL 1YPZE 4CN4A 5JQ6L 1RJLB 1EA9C 1NFDE 4TTDC 5B8CB 1JNHB 2FECL 4JZNB 2X1OA 2APVA 4JRYB 4XRCA 4AZ8A 1A7BA 5SWZE 5HHME 4ORZC 3MRHB 2ORBL 3PQYD 4P5TB 5I1GL 3VFMB 4WTZA 3S96B 2FGZA 3J8F7 5CBEA 3Q1SH 15C8L 1AI1H 2X4TB 5HY9B 1WSST 5MEQB 2W59A 1SEQL 4NNXA 1DLHB 1I9RL 1YN7A 3AGVA 4U7MA 1X5HA 3R1GL 2A74A 5LCVH 3OJMB 1T83A 4P46B 5GGRA 2VLRE 4WU7A 4X6DF 1ADQH 1HK6A 3MRCA 3FO0H 2PTUA 4LCWA 4W6WB 4RA3A 2A9MH 2QQLH 2HFFB 1FO0H 4PR5B 4WO4B 4PP1C 1H15B 4KQ4L 3HNTL 3OX8B 3LCYA 4KAQL 1GGYA 3HI1A 1T6VN 3O0RH 1Q8MA 2ICEA 2NX5B 3IFPA 1CTOA 3A6CH 1KJVB 5EOCH 3SOBL 1W72B 1EHLL 4JFEE 4K23H 2VC2H 4XVTL 3KYNB 3KPRB 3MRQA 5HI5D 2Q86B 1T1XA 1NMCB 3FOLA 3RTQC 5TH2B 4F3FA 3QIBD 5IFAH 4PG2A 5ETUB 4KMTL 4NCDA 5GQBA 1URLA 3DXAE 1Q94A 1WBZA 2R0KH 4V2BA 4BA8A 3V7AE 1UT9A 2HLFC 1MFDL 4GO6B 1MLCA 4XNQB 4WEMB 4KI5E 3NABH 2IMNA 4FZ8L 1E4WL 1ZAGA 2JELH 3SGDH 4EI6B 4HJGA 1I9JL 5F1NA 1DUZB 3GMRA 2PETA 3T0VA 4J8RA 5JIHA 1UACL 5I1IH 3T2PA 2YN5A 3X11B 1FBIH 5JHDB 5AYUH 3B6SA 3KLSA 5B4MD 2WBKA 1MHHB 2E8ZA 2BVYA 5JA9A 1R0AL 3GSQB 2GITB 4ZXBA 3VG0H 2DJ4A 4LLYA 1ZTXH 2EXYD 3DI3B 3C8KA 2DLHA 3BPNB 1ZT1B 5IR1B 1W8NA 3K7UA 5JZ7D 4KQ3H 3MRFB 3P0VL 3V52H 1DBBH 3O9WD 4LCCA 4LIQH 4JREB 4R4NC 1KCRH 3VGHA 1RJLA 4Y2DC 5FGCE 4HWZB 5CZKA 4Y0GA 3SO3C 2IBBA 5I9QC 2B5IB 3O2VH 5B8CA 1JNHA 4JZNA 1D5IH 1A2YB 4LMQE 5AYQA 3WN5A 4D0DA 1BMGA 2ILLA 3UJIL 4NM4H 1PW3A 2K9UA 4X0KB 1KCVH 1A64A 4I3RL 1JPSL 4JRYA 5F1IA 5JXEA 5KSAB 2QQNL 2FH8A 2XG5A 5HDQL 3MRHA 3B5HA 1DQML 5IW1B 2CRMA 4P5TA 4K8RD 3DJ9A 5D8JH 3VFMA 2Y1VA 3S96A 5F7HA 2FO1A 4NZDA 1JP5A 1YNTA 5DJYB 2G9HB 5HY9A 3MFFB 3OF6A 5MEQA 2P24B 1W2KT 4WEBL 5EIVA 3HNSH 5DC4B 1FNEB 5BVPL 1DLHA 3RWHB 3DI2B 3LDBC 3GBMH 4F15B 2HVKB 2QKIB 5ESQA 4TUOB 3FO1B 3IDNA 4P46A 3IDUA 4U33A 5HPMB 1DBJH 5K9QI 3K8LA 4K9EC 3S3JA 5DZLA 3GZKA 4S1SH 2HFFA 1KGCD 2F19L 5D5ME 4WO4A 4XCCL 5E5UB 3ERYA 3S98A 4CKVX 1F4XL 1H15A 4RMVA 1YEKH 1EHAA 5C9JA 1YECL 5FYJL 4KROB 2NY6B 1CF8H 1C8PA 2EH7L 5CJOL 3VXTA 3RGVD 3N06B 3CCHB 1L4IA 2NX5A 5TF0A 1KJVA 5H2BB 1FNSH 1W72A 1NLDH 4TVSa 4KRPB 3OZ9H 2AV1B 1W72H 4YHYB 3MV7B 4PGCB 3I3DA 3WKMH 3KYNA 5CD3A 4MJIE 4Z7VE 4ZNEE 4YR6B 5AZEL 4FOMA 4JQIH 4QEGA 2DQHH 3TH4T 3V4UL 3WJJA 1NJ9B 1Q9WB 3FONB 1MFEH 2VXVH 5KW9L 1QRNE 1MRDL 1CE6B 3DETC 1YEDB 1YDPA 4ZOBA 3TO4C 5DWUL 2DQUL 4IMLB 4ZTPL 4ZXBD 3WHXB 1CGVA 5F3HB 3VXUE 1LO4H 1OWRM 5EZOH 4OI9A 4XNQA 3VJ6B 5EPMB 1BOGB 2Q6WB 5I1JH 3MRMB 1DUZA 1Q9KB 5IHUH 1CDJA 1DVFD 3X11A 5JHDA 1JGDB 4G9DA 1JPTH 2EH8L 4OZGF 3MXWL 1MHHA 3ECBB 5HYQB 4X8XA 3P0YH 4YXKH 2OZ4A 3GSQA 2GITA 1HN1A 3QIUD 1EEUA 4TPRH 5DJXA 5BO1L 4JRYD 3QAZC 3EJYC 3H9HB 4TOYH 2FD6H 2IBZX 4Z7UF 1CS6A 1ZT1A 4OQTA 5IR1A 2NXYD 3MRFA 3CFIC 4G8EB 3OF6D 5GGVH 2OSLB 3C5ZB 5CMAA 4HWZA 1GJIA 5HVHC 3QEUB 5GIRA 1B0RB 4M4PA 3WIFB 4ZTOL 1FORH 1U91A 4Z76B 1A47A 1FYTE 2HH0L 4M6NL 4X0KA 3QO1B 3BRFA 5KSAA 4MD4B 3WJLC 3BKCH 5C0CD 3ARVA 1ACYH 5IW1A 2NY1D 5FDYA 2PF6A 4ZNCD 2EDYA 5FDWB 5C3LD 1LDPL 3BKMH 5DJYA 3DTXB 1ZWIA 2G9HA 3DHMA 3F7RA 3MFFA 4WO4D 4LSVH 1WIUA 2P24A 3TBTA 3DYMA 1FNEA 2C4FT 2NY5L 3RWHA 4PGEB 3CVIH 4EUPG 5I75B 1IAIH 2HVKA 2I60H 2NX5D 2QKIA 4LGRB 2D9CA 4TUOA 5T3XL 3FO1A 5HPMA 4NQEB 3G6AB 4N8PA 3LB6C 4O9HH 1OTSC 2Q20A 3W0WD 5HHVL 4PUBH 1QSVA 4PJXF 1MAJA 3HKFA 4PV9A 1NCBL 5IQ7L 1AJ7L 2AABL 1LWRA 2LVCA 3PF2A 1CGSL 4ZSOE 3KLDA 4FXGB 2AV1A 5DJ2B 1YEFH 4MA3B 2GQHA 3MV7A 3A6BL 1QACA 4YR6A 1I3RB 2VZ1A 1NJ9A 4F7TB 1Q9WA 3FONA 4P57B 5ELIA 5DHVB 3HCVB 3ULVC 3LN4B 1A21A 1CE6A 1XAUA 2NQCA 4YHZL 4DTGH 1YEDA 1YPZF 2H41A 5IB1B 4IMLA 1NFDF 3ARWA 4FFYL 1N4XL 5HI4C 5F3HA 1I1CA 3KLHC 1CGTA 1NGQH 3WFCH 3L3GB 3VJ6A 3V9FA 5EPMA 3V2AR 1BOGA 1DZBA 2Q6WA 1E28B 3QDGB 4PRAB 3MCLL 3KJ4B 1XH3B 1Q9KA 5I1KL 3BEVB 1PAMA 1AO7E 2DM2A 1JGDA 5FAAA 2C3HA 1BECA 3AY4A 3ECBA 3WD5L 5HYQA 3L5IA 1ZLVH 4N90D 2FX9L 3GSVB 1K6QL 2UWEF 3E1F1 4NQCB 4FHBD 1R3IH 4NQDB 4Q9RH 4YHKH 1WAAE 3MRIB 2NZ9D 3T4AB 2DMKA 1KJ2B 1RUQH 3IDGB 4F37K 1YMHB 1X5GA 1MCQA 2P7TB 3MBEB 2D0GA 1ETZB 1NSNL 1DBAL 2X5PA 4XGZB 4G8EA 4LSSL 2VDNL 3GMQB 3FRPG 2OSLA 2VTFA 3C5ZA 1IM9D 1E0OB 3AVEA 2UZYB 3UTQA 1S5IL 2AERT 3HN3A 4HV8B 5HHMB 3T8XB 3QEUA 1OSPH 1B0RA 3WIFA 4JANB 4Z76A 1UWXH 3FQRB 4LAJH 1NC4B 3QO1A 3MBXH 4XAKD 4ERSL 4MD4A 2F54A 3QUYC 2K1MA 5HHOE 4QRRB 4DQOL 2FX8L 3PXJA 5K9QG 5CGYC 1I1AB 3T0WA 2YUWA 1P4BH 5HD8C 3DTXA 1YY9C 4UNUA 5IP4A 4Z78B 3TIDB 1YEJH 4L4JA 2NY6D 4WTXA 4PGEA 1A14L 5AZ2L 1PZ5B 4RMTA 1TXKA 4TSCH 4KRPD 1QA9B 4S0SD 1JNLH 4R8WH 3JWOH 3MV7D 4CN1A 4KI5F 3U79A 3TYFB 2VLKD 3LEVH 3FQXB 4XMLH 3TVMB 5IOPB 3LEYL 2PR4H 1YMME 4HC1A 4W68A 4DN3H 2E27L 1OAKL 1KIPB 1TITA 1MCLA 2IFFL 5IFHH 2C3XA 4TSBH 5AWNL 4JM2F 5C70A 3OR7B 4U3HA 3VFPB 5KSUB 4FXGA 5DJ2A 4JPIB 4MA3A 1UB5A 4NFDA 4UUJB 4YDLB 1I3RA 1PBYA 1ZVYA 2BZDA 1QBMH 2ZUSA 3RPIA 1JF6A 4P57A 1DQLH 5DHVA 4Y5XC 5I74B 1B4JL 3LN4A 4HK3J 5KS9E 2AJ3B 1C5CH 4NBXB 5DJZB 5K33A 1CDUA 4WI3A 5IB1A 3UTTE 1N0LA 1T3FB 3BJ91 2L0DA 3DARA 1WFOA 4U49A 1O7VA 3L3GA 5JDSA 1E28A 3QDGA 4PRAA 1KPUB 2BHZA 2VL4A 1XH3A 1MCRA 5F72S 1KTDB 3BEVA 4HH9A 1WJ3A 2L7JA 5ESVA 3PV6B 4WFGE 1AHWB 3X17A 5LCVL 4R0LB 1J8KA 4IDJH 1KCUL 3ULUC 1MPAH 2WWMC 5D7IB 4NQCA 4LVOC 1VGEH 4NQDA 4N9GA 3M1BB 1EZVY 1HXYB 3T4AA 3F6IA 2F54D 1KJ2A 4K8RL 3IDGA 5EU6B 1YMHA 1CFNB 4JFDE 5F7YC 2P7TA 3MBEA 1QSFE 5FYKD 3TZVB 5FGCB 3VD4A 2DI8A 5BOPA 2HRLA 4XGZA 4HWBH 1L0XA 3GMQA 2VXSH 2VQTA 3QISA 2BVQB 4S1DC 3GKWH 5BZDA 4ZO6A 4XPFH 4HV8A 3T8XA 1GGUA 3AREC 5C0BB 4JANA 2JJSA 8CGTA 4XXCA 3FQRA 1NC4A 1JTOA 4JG0H 2XT1B 1Q1JH 4QRRA 2FEDD 4CU7A 1KXVC 2BVOB 2KH2B 4KK8C 5DHXB 1I1AA 4Y16C 3G5ZB 4NBYB 2A0LC 4Z7VF 4P4RB 3MNZA 3O3EB 4HH8A 3KVQA 3OMZA 2NY3C 4Z78A 4UBDC 1C7TA 3TIDA 5C07A 2YD4A 1MRCH 2B2XL 3PDDA 5IG7B 2X4RA 2EICA 4QHMB 1PZ5A 1UFUA 5C6WH 3NABL 1SJXA 4QOKE 4KY1H 5GXBB 1MAML 2MCPH 1QA9A 2D2OA 5D5MB 3WFZA 2YMXL 1FBIL 4G6KL 1MEXH 1BAFL 3TYFA 1UM6H 3WS6A 1UB6B 3OJDB 1MVUB 4HLJA 4UIKH 2IBGA 3TVMA 3QH3A 1RQ5A 4QCIB 3HR5A 4PJIE 1YEHH 3MA9H 4RGNB 1ZTXL 1WBYB 4PBXA 1I1FA 1KIPA 2JJUA 5DQJB 5IVOA 2Z8VC 4PP1D 3O2DA 4X5WB 3OR7A 1KT2A 3VFPA 4UQ2B 1U8PB 4KHTH 2XWBB 4JFHD 4UUJA 4PJGE 5FXCH 3HZVB 4LIQL 5TE4H 2ZUXA 1EHNA 3L95A 4XNZC 4OF0A 1JRHH 3EAKA 3TNMB 4K94H 1D5IL 1EO7A 3PGDA 4ENEC 3HZYB 4JFYA 1AR1D 1KCVL 2BMKB 5JORB 1B2WH 1T3FA 3GO1L 4LHUD 1XR8B 1KTKE 4JO1L 3VGAC 4GMSH 3KPPB 4LAQH 2Y6SC 1KPUA 5IQ9B 3MBED 3HMXA 3NN8B 5GJSH 4OJFH 1B6DA 1QFWH 1MCIA 2HLFD 3HMXH 2J5LB 2P5WE 3RWDB 3ARFC 4OFKA 4WY7H 5CZXC 1ZMYA 2XKUA 1F90H 4HWNA 4R0LA 4XP9H 3NAAH 1ZVSB 4YHLL 1JWMB 1D5ZB 5D7IA 5HGHB 3M1BA 3MRBB 1NMBH 3H3KA 2ED9A 4QRRD 4S1SL 1NBVL 1CFNA 2DMCA 4LCUB 3TZVA 2BHUA 1M7DB 4P0DA 5DJDB 4NC1C 5IVNA 3I84A 4KH2A 4WNQB 2BVQA 3WHE0 5C07D 4BH8A 5I19L 4JQVC 1KIQB 3UYRL 1KUMA 2GAZB 1I8KA 5C0BA 5EU3B 1MFAL 4IMKA 1V3JA 3QXWA 1W72L 3ZYIA 1HYRC 4KGLA 4R4ND 5KOMC 4I5BB 5T3ZE 3B5TA 4Y2DD 3U0TB 5HDOA 1EJOL 1YEEH 1HOCB 5C2UB 2DB8A 3VRLE 1YEIL 3RWJB 3EKCA 2BSTB 4P4RA 5C6PB 3LD8C 3NA4A 3KHOA 4ODUB 4A6YH 5GZOD 2V2XB 3R06B 3QQ9D 4WW2B 4DEPC 5IG7A 1A6UH 3WNNA 1LO4L 5DA0B 2QSTA 4QHMA 3DMMB 3PWLB 5LKNA 4U6HB 3EHBC 3MO1B 4OUOA 3EZ8A 1AD0B 2Y07L 3QUMB 5IHUL 3QEHB 4P2RB 1DUYB 4ODBD 2RB8A 3C2AL 1BREA 1ITBB 1QSEB 1UB6A 3OJDA 3WJLA 1MVUA 1T1ZB 4YXKL 3QO0B 4QCIA 5IJKA 3R0MA 4UIMB 4FQXC 4MNHB 5BV7C 2OZ4L 1GGIH 3D69A 2WNGA 4EQ2A 3ELAT 4U1LA 5DQJA 5GRVL 5D7JC 1LNUB 4X5WA 3L5XL 4UQ2A 2PYED 3BDXA 1U8PA 1WAAF 2XWBA 2AJVH 4OQTL 4UNTA 1AGFB 3HZVA 1FCCA 4EIZC 2M8XA 3CXDL 4LLUB 3I75B 2WP3O 3TNMA 4EI5C 3RBSA 1CFVH 2DTML 1FORL 1A4JB 4QRQB 3HZYA 1H5BB 3ARBB 2WUBL 5JORA 2BOCB 1ACYL 5DZNA 1XR8A 2OTPA 1G0XA 4E41A 4PY8I 3DETD 1UJ3B 5FM5O 3Q0HA 2AJZB 3P9LA 4IJ3B 4OD1L 4UILH 1TMCB 3Q6FB 1AGDB 5SWSE 4F9LA 5CEZH 5TFSL 3NN8A 3QUZC 5DYOB 3RWDA 3RZWA 1P9MA 5HYSG 4I1NB 5FUOH 3S5LB 1YYMH 5LGHL 4PRID 1JWMA 1D5ZA 1MSPA 5HGHA 5GJTH 2CDFB 3MRBA 1RPQA 3L1OH 1KJMB 1NLBL 4BSJA 2VYRE 4FQ1H 3FTGA 5E1HB 4LCUA 1P4LA 3T1WA 4M5YL 4OCSL 3VH8G 5DJDA 1P7KB 1JTTA 2Z0BA 3UTZA 2P5EB 4WNQA 1C12B 3ARDC 3I6GB 1KIQA 2R1WB 5F3BB 2DQEH 4MNQE 4RAHA 1F4WH 2GAZA 5E2TH 5F21B 2QL1A 5EU3A 5C0RL 1VEOA 2YD5A 1P53A 4WWKB 3CFJA 2VABB 1EX0A 1IAIM 4XX1E 5FECB 4YFEA 1XIWB 4L4VE 3U0TA 1HOCA 4PJAE 4WI5A 3RWJA 2IPKA 3F7QA 4YZFE 2BSTA 4XPBL 4YHIB 2VDOH 1A7NL 4ODUA 5C9KA 2V2XA 4X9FA 5HYJE 3R06A 4GMTH 4RX4A 3IU3A 4L4TA 4L1DA 4JHBA 3DMMA 3PWLA 5KJRL 1JHKH 3MRRB 2F15A 5CJQL 5J1SC 3LY6A 3MO1A 5I8OL 1AD0A 4IHOB 3QUMA 3MUY1 4P2RA 1TZHA 3JTCA 3HAEG 3IB4A 1DUYA 1ZT7B 2SEBB 3EO9H 1EK3A 4BSWB 3BXNB 1RJZB 4LHUG 5KTEH 4K55A 5KVEL 1T1ZA 1ZKAA 3QO0A 5DRXB 4CJ0A 1AQDB 5BXFB 2IANA 4UIMA 4XPTL 4MNHA 1OTSD 2B4CL 4KI1A 3RFZC 1GPOL 3P11L 4Q9RL 4J6RH 3HHRB 1KN4L 1D5BA 1LNUA 3EOTH 4ESKA 2NY3B 3V8OA 3ARZA 4E41D 2FL5B 4M93C 5J6HB 2CK2A 2GY7B 5KS9B 1AGFA 1EGJH 3EW3B 3BHBB 1KSRA 1WICA 1RZ8B 1TPXB 4LLUA 2Y06L 5LGJB 2NY0B 5IB5B 3ORJA 3OB8A 1OSPL 1BZQK 1A4JA 4JRXE 4UV4H 1H5BA 2L7UA 1CZ8H 3IXTB 1OCWH 4DVBB 5LAXB 2BOCA 2B1AL 4X6CB 3FZUC 4Q97A 1ZEAH 5FK9B 5GRYA 3C09C 3SCMC 3SE9H 3ULVD 1U41A 4XVJH 1UJ3A 2AJZA 5FYKL 1TMCA 1AGDA 1QTYT 1R5IB 3Q5OA 2XZAH 3WFHB 2CRZA 5A2LH 2R4SL 1KLUB 3TBVB 2HMIC 3KLHD 3CMGA 2NTSP 4U3CA 3S5LA 4APQB 1EH9A 1HDMB 4YH6A 1BBDH 4I0PB 4LLWA 4TSCL 2ZOLB 4J7RA 5SV3A 5C0AB 2CDFA 4AQ1B 4DGIL 4KRMB 3VFGH 4HKBB 1AY1H 3LEVL 1SMOA 1RVFL 5I1HL 4O4YH 1P7KA 4JFQB 5EBLB 3WXWL 2P5EA 4QRPB 1TETL 1C12A 3QQ4B 2ZSVB 4HC1L 1RUMH 4POZC 2DIAA 3I6GA 4PJIF 3QB7C 3U82B 1D6EB 2Z31C 5EORH 2R1WA 5F3BA 2F8OA 4L4TD 1MH5B 3OPZL 2LE9A 3DMMD 4M1GL 1EHXA 3CSPA 1EBPA 4WWKA 3HPJB 3BKYL 1Y18B 1JGLL 3NIGE 5F71A 5FECA 2X10A 1MAKA 1XIWA 2VLJE 5FYLD 1LQVA 1DQLL 3IDXH 3MQIA 4PJGF 4GSDH 4F2MB 3CZFB 2FEEI 1KIUA 3IGAB 4ETQB 2OCFD 3O6FC 1EUUA 4ZUUB 2IAND 3BSZH 5CGYD 3BZEA 4PRPE 5E8PB 2FX7H 1Y6KR 5HD8D 4DK6A 3MRRA 1FZKB 3UTSB 2DQIL 5E6IC 5L0QC 2MNUA 3MMEB 5I17B 4P3DB 4HK3N 4IHOA 2APTA 3CD4A 3C5JB 1BX2B 1ZT7A 2E9JA 3H3BC 4NRXB 2SEBA 4BSWA 4I3SL 4I8DA 3O45A 3BXNA 1RJZA 5DZOA 4OZFG 1UEYA 4HT1H 4X9GA 3RNKB 1GOFA 5DRXA 2GJZB 1AQDA 3DWTA 5BXFA 3DSFH 5MP6H 2ZG1A 2MTPA 5KAQG 4KKBD 3KWWB 4Y16A 2XA8H 3QQ3B 1S9KC 4LEOB 1UWGH 3MROA 5DA4A 1KJ2L 3FJTA 4LQFH 1TNMA 4MA7H 2FL5A 5J6HA 1JYNA 4P3CH 2HVJB 3SY0A 2DQJH 2ZWLT 3UROR 4QRSA 3BHBA 5JPMB 1VFUA 1E6JL 4EZMA 1RZ8A 5AUMB 4UOW0 5L2KB 2DF3A 2OM5A 4HQQL 4XPFL 3N1GC 1T0NA 4ONGL 5EIIA 3TIEA 3HFML 3ARTA 2QSVA 1UH2A 2CD0A 3JWOC 4PS4L 4N0RA 4JG0L 3IXTA 2WP3T 1UQSB 4DVBA 2WLYA 4W81A 3WFBH 1Q1JL 4X6CA 4H0HB 2CK0H 3M07A 5LWYH 1P7QD 5FK9A 3WO3B 2VZSA 5I2IB 3P30H 4DZ8B 4L29B 1YN6A 4X8JB 4QTHB 3BN9D 1R5IA 1WT5C 5F7NC 3WFHA 3C9NB 5KVDH 4GLRI 3VRLF 4MNGB 1KLUA 2LVEA 4HBCH 2P46B 2AJUH 1KJ3H 4APQA 4Q0XH 5F9WB 2VDKH 4H26B 4AENB 1KXTB 5CZVL 2F58H 5DLML 2WZPD 3CU7A 4I0PA 4ZFGH 3CVHA 2ZOLA 2EC8A 5C0AA 4I77L 1FIGL 3IETB 5ICYB 4KKLC 3HE6C 4HKBA 3K80A 1BQUA 3VGBA 1XIWD 4KZEL 2ZCKL 3ULUD 1XCTB 3WO4C 1FNHA 3IU4L 2VZTA 2CRIA 3IRZA 4XMPH 5DMIL 4JFQA 5EBLA 4QRPA 4FQPA 4HFUL 5JOEA 2ZSVA 1K4CB 5E8OB 3T09A 1ZA3B 2P49B 1MH5A 4CDGC 4JKPL 5ESAA 3O2DL 4YUEH 2UY7A 2DQCL 1Y18A 3HNVH 3MODL 4GAGH 3IF1B 4NBZB 2R9HC 5GRJL 1T5WB 4O5LL 5IV2B 3CZFA 1G9MH 2NR6C 5F7FA 2FO4B 4ETQA 3D39E 2MPAH 2HT2C 1ED3B 4ZUUA 1B2WL 1FSKC 2J8UB 2JF1A 4PJ8C 4Y16D 5E8PA 5J06A 5EN2B 2A0LD 2NTFB 3CAFA 3DRQB 3UTSA 3WFDH 1BQSA 4N68A 2NY3D 4UBDD 2X4PB 3MMEA 5I17A 4P3DA 1RZJH 1T7ZA 1GGBL 2CDGB 4YWGL 3C5JA 1BX2A 3HMXL 2QEJA 4DW2L 5I1CH 4NRXA 4NUGL 1U8MB 1AD9B 3U1SH 3WNMA 4IIQC 4XP9L 2E7LE 3D87B 1F3DJ 3RNKA 1SYVB 2GJZA 5EA0H 2DOCA 3U6RB 2IH3B 1BGXL 1NMBL 3U30C 5E2UH 3MV9D 2VZUA 3FMGL 1P69B 3O3DA 5DJAB 2R15A 1I7RB 5GGTA 1U8OB 2HVJA 4KZDL 5E2VL 5JA8B 3O2WL 3VDBA 5KVFH 5JPMA 5D96B 3BD5A 1IT9H 4IRSC 3HR6A 3WL9B 3ZSTA 5L2KA 1J1PH 4WUUB 4JO3H 4QNPE 1MIEL 3BP7B 5EBMB 4HGWB 4NGHH 3CDFA 1UQSA 3GMMB 2P48B 1F6LL 1R3HB 1K2DB 5C0AD 2CUIA 2W60B 5I2IA 2I5YL 4DZ8A 4L29A 3HMWH 2OR8A 4QTHA 2GTWA 1JL8A 5E5MB 4PJAF 1U8NA 4GAFB 4MNGA 1JGEA 4H8WH 4YZFF 1E4KA 1FNLA 4JG1H 1CDYA 4QRPD 3AMKA 3BDBA 4LARL 3WLWC 4AENA 4H26A 2Y6SD 3IFNL 3BEWB 1BJMA 2W9LA 3L3DB 1GZPB 3MLRL 3P4OB 3EDFA 2X4OB 5HHXL 3ARFD 3IETA 5CZXD 5ICYA 3WNOA 1CGYA 1X9QA 1UKTA 4QHKJ 2VWEE 5DD3L 1HINL 4CW1B 2VIRB 1XCTA 1CD8A 1FRGL 4KI5C 1BWWA 5EOQH 3I9GL 1K4CA 1NEZG 3THMH 5E8OA 2G60H 1ZA3A 2DJUA 3QRFM 5SX4H 4XC3L 3L3OB 3GM0A 4HG4K 2DWEA 3MGAA 4QYOB 4MD0B 4JM2C 4WUKL 5BMFL 3NCBB 2EDEA 1T5WA 1NCTA 2HN7A 5HYJB 4R7NB 5IV2A 3ARUA 1Z9OA 2FO4A 5ACZA 4NIKB 2XZZA 4BUHA 2CLRA 4OCXH 1ED3A 3ZKXB 5B38B 4JY4B 5I0ZA 5CILH 2J8UA 5CD5C 2NTFA 2PYFB 3DRQA 1YNLH 4B41A 2AXFB 3NH7H 2EDBA 2IH1B 3FHAA 3WXVL 2CDGA 1L7IH 1REIA 1FAIL 3VD5A 5MENB 5FM4A 2QHLA 2RQ8A 1OGAB 3VXSE 1U8MA 4J4PC 5EUKB 5L2KD 3EHBD 1RHHB 4XVSH 4NP4L 3U6RA 1XGPB 3WUZA 4M00A 5GJTL 4HCRA 4R90L 5IESH 3I02B 3GJFB 3SKUD 5E99H 5FOBB 2MCG1 2MQCA 2BXZA 5GGUB 1IGFH 3G6DH 4NZRL 3GSRB 1AXTH 2LV4A 3X12B 5DJAA 3MLSL 1I7RA 1U8OA 1JZ2A 4Y4HB 2V7NA 1YQVL 4LLDB 2IPUG 4G7VL 5TDPB 1Q0XH 4FZEL 3WL9A 3K8KA 5D7JD 1GYAA 4WUUA 2CQVA 3KHQA 3BP7A 4HWUA 5EBMA 2FHBA 1CLZH 1F4WL 1Z2KA 3EO0B 4MMZC 2DI7A 3CGTA 2ATPA 4HGWA 4Z7WB 3LKNB 3TJEH 3V6OE 4D9RE 3NPSC 4R97B 1R3HA 4RMWA 1K2DA 2A9NL 2W60A 5C08B 4OZIE 4JAMB 3T0AA 4ELMB 1MCWM 3QP3A 4DZBB 5T5FH 4BZ2L 3B83A 2J88L 5D7LB 3NIGF 3RA7H 4MB3A 2VDOL 3LKQB 1AC0A 5E5MA 3MLUH 4FQLL 5T5NG 5CS7A 2H6PB 4CGTA 1OPGL 1WWAX 3MLXH 2BP3A 4BFIB 3BEWA 3L3DA 1GZPA 2XN9E 4OUUB 3OKMB 3HI6H 4WI6A 3P4OA 1XGUA 1TVBB 2X4OA 5I66B 3QUML 3PV7A 3OJVC 4OAWA 5FYLL 4DVRL 4NQVB 4HUMB 5ECJE 4OFIA 5F70A 3EYFA 1I3GL 4UAOB 3RJQB 2FJHB 2VIRA 4BK4A 4I13B 4S2SB 4CW1A 4H1LH 4J3UA 3U7AA 5C09B 2DLFH 5BS0E 3B9KB 3KYAA 1JBJA 4ZD3L 3ZKMD 4NO2B 3L3OA 3QQNA 3V6FA 3EOTL 1FG2B 1N2RB 4HX1B 2EDOA 4IRZL 2J6EA 2RCSH 4QYOA 4MD0A 2J6EH 2WV3A 3UPAA 3MJ9A 5B22A 4RCAA 2EYTB 2R1XB 3ZO0A 5IF0B 3W11C 5D4QA 4AEEA 4PTTB 2XFXB 4UV4L 2NPLX 5I30L 3HZMA 1CZ8L 1CN4A 1OCWL 2D7NA 5B38A 4JY4A 2C3GA 1X4ZA 3UC0L 1ZEAL 4BFBD 5FOJA 2PYFA 3BD3A 2X70B 4OLZL 3FN0H 3B9EA 1MFBL 1UM4L 4MA8H 1TJHL 2AXFA 2IH1A 2GFBB 2BFVH 3D5OF 5MENA 4FQJL 1OGAA 1BQLL 4MXVE 3NMEA 5EUKA 2IPUK 4WUUD 1SJVA 1XGTB 4JFXB 1LGVA 1NCWL 1RHHA 2FATH 4AMKH 4X6EB 1MNUH 1XGPA 1T0PB 5CP7B 1GZQB 3I02A 3GJFA 4N0UE 5LBSL 3V5DB 3PDOA 5FOBA 3QXDB 5GGUA 2FHCA 3AB0C 3GSRA 3U46B 3PWPA 3X12A 4O4YL 2ZCLL 4M7KH 2RFXB 1B90A 3H7BB 1F8TL 1IAII 2WUCL 3SO5A 5BQ7B 4OLYH 4LLDA 5TDPA 1KV3A 4CVXB 1BVLB 1L9MA 4ZODA 3EO0A 4BQ9A 1CDGA 1BFOB 2AK1L 5DR5H 5ACMA 4Z7WA 3LKNA 2X42A 4MQXC 3BRGC 4XPGL 2QSCH 5C08A 4ELMA 4DZBA 4M7JH 4GSDL 3ULUL 2W9EH 4H0IA 4OM1H 5D7LA 5ITFB 2XKNA 4LSDA 3U30B 5HVGB 3KS0H 3FZUD 4OCYL 3SCMD 3CSYB 5EO1B 4XNUL 2H6PA 3BSZL 3I3EA 2FX7L 3QPQC 3RX7A 4B7LA 1R24A 4OUUA 2DYPB 3OKMA 4ALAL 3FO9B 4YHOH 1RZKL 4JKLA 3UJTH 3A6OA 4OT1H 1TVBA 3K0WA 1OB1B 4UV7H 4JFFB 4R26H 4NQVA 2Q8AL 2R2BB 4HUWB 3OG4B 1HH9B 2FJHA 2CIIB 2GJ6B 3QG6A 5IW6B 3CX5J 1T80A 4ZOEA 3LMJL 1Q0YH 4LPYA 5C09A 3GSXA 3B9KA 4M8VA 1KEML 2Z92B 3KJ6H 1WT5A 2JCCB 3PP3K 3G6JE 1FG2A 1ZLSL 5J7CC 5DRZB 3UJJH 3SJVE 1B0GB 2DQJL 1QBBA 3X14B 3BOVA 2BNRE 1A7QH 3D85A 3HTLX 1IILE 3QUXB 1KCSH 4AYFA 2EYTA 2R1XA 4M62H 5DF0A 5MEND 5ILTL 1OGAD 5E6YA 1HQ4B 1NC2B 5IF0A 3P73B 1QBAA 4KPHH 4S1QL 4PTTA 1G84A 3U7WL 1GC1H 1J0KA 3KAAA 3GSOA 4QNPF 1BLNB 4C56D 5IT2H 3H9SE 4JB9H 3QHTC 1FPTH 3BGFB 5LWYL 3SKJL 2X70A 2FB4L 5HVFB 4PJXA 4YDKH 1EUTA 1HXMA 5CUSH 2GFBA 3PWPD 4F57L 1AH1A 2QR0A 3TNNB 5KVDL 4XNMB 5F6HJ 4HBCL 3VRIA 3ULSB 2YPLD 2HFGH 2AW2A 1KJ3L 2BVTA 4OFDA 1CGWA 5C6TH 4AEIL 4Z0XB 1XGTA 2P8MB 2DQDH 4KUZH 1DN2A 4X6EA 4Q6IC 1MWAB 1GZQA 1CFSB 2AI0H 2FJFB 4E9LA 3CVHL 3V5DA 3LHPH 4MWFA 5BOZG 3QXDA 3BH9B 5E7FA 1MCPL 4FQHB 3U46A 2YKLH 4ZOAA 5C08D 5T1DH 3CDCA 2W0PA 2VN7A 3H7BA 1ORQB 4U1HB 4PJ8A 5D72H 5D7LD 3EJZC 1JZ7A 2OS7A 3VFVB 3RWGB 1YNKL 4CVXA 1BVLA 1UWEL 2IPTH 1HIMH 1DL7L 5CEXB 4D9QE 1BFOA 1S8DB 1QFOA 1UVQB 4YUEL 4MLIA 5IROA 4TUKH 5JR1L 3SGEH 5ADOH 4X7TB 4Y4KB 2HJFB 1ZOXA 2AQ3A 3LKSA 2A83B 4HXBH 2NNAB 3GSNH 4DOHB 2EE6A 3L3IB 2R23B 2BSED 5E4EB 4RGMB 1LILA 4MD5A 1IQWL 3EBAA 2UWEA 3CSYA 5EO1A 4XWGL 4LLMA 4NKQB 4MAYC 2EC9U 4N1HB 4UOJA 2VLRA 4XCFL 2DYPA 3VXRD 4PJ9B 4NN6B 4NWTH 3P4MA 1AKJB 4P2QE 2M1KA 3U36A 5FYJU 5IGXL 5I1CL 1NL0L 4PJ5B 2DM3A 4JFFA 3D85D 3QEGL 3T3PE 4LCYB 2R2BA 4HUWA 3EZJB 4OF3A 1HH9A 1QHOA 5IW6A 2GJ6A 5GS1C 3PNWB 5DFTA 1WTLA 2NXZB 1WWWX 5ITBH 2Z92A 2JCCA 3OR6B 1U8HB 1D3CA 5JPNB 5ISZE 3VWJC 1MHEA 3VFOB 1DBKL 1T7WA 1E4XH 3SQOH 5DRZA 1NCDH 2AVGA 1B0GA 5IK3A 1JF1B 4YQXL 4PJBE 5GGTL 1IC1A 3X14A 5M95B 1IT9L 3QUXA 4I18B 1VADB 4JN2A 1KB5B 2X4QB 4ZUTB 4NZUL 4Y1AB 2GT9A 1SHMA 1HQ4A 4HUNB 1NC2A 3P73A 4BFEA 2AK4B 5E94B 3S9DB 3MTRA 4KGJA 2VLLB 3V6ZA 2DLGA 5EUOF 4CL7A 4XXDB 1BLNA 3K2UL 1MCCA 4JR9H 1H3UA 1BD2E 1VKXA 3JWDL 4HK0B 4RGOH 4B53A 2NR6D 4DUXA 3AM8A 4NJ9H 4YDJA 3B4NA 1EIBA 3BKJH 3HMWL 2APWA 2HT2D 4KVCL 5IKCB 2R8SH 4PJ8D 1NCNA 3ULSA 1EZVX 3S97C 4EN3C 5DJ6B 5IHBA 2P8MA 3MCKB 1A6WH 3AU1B 1D9KC 5GPRA 3BZDA 4W6XB 5I1DB 1MCBA 5I73B 1W0WA 2ERJB 1MWAA 1CFSA 4A2MA 1NAKL 2FJFA 4G5ZL 3BZFB 5HHPB 5F96L 5KSBE 1CFBA 3BH9A 4BZYA 4Y4FB 4LF3B 3OKYA 4LFHG 5EB9A 4NFCA 3HUJE 1ORQA 4NN5B 1J87A 4O00A 1RUPH 4ODTH 3LKRB 3VFVA 4ODVL 1NBQA 2AEQL 3BE1L 3QDJE 4EOWH 3V4PH 1N5YH 1RUKL 1RZJC 4C57C 5CEXA 4OZIB 2IEPA 1S8DA 1DQDL 1EO8H 1UVQA 2VLRD 2DYPD 4LBEB 2FLRT 5D7KE 3RU8H 2EE9A 4X7TA 4ODSL 4Z7NE 4Y4KA 2HJFA 4MAUL 3IAPA 4O51A 3G9AB 2A83A 3PABB 2NNAA 4JFFD 1AGCB 2R23A 4J2XA 4LRIC 3MJ6A 4ZYKB 1XF2B 4OCXL 4FFVC 4XHQA 3N1PC 4PLJD 4P9HC 2IFGA 1VSCA 2N7AA 2JJTC 1O5DT 4JFED 1JRHI 3B2VL 4X80L 1AKJA 3BP5B 1TJIL 1JFQL 4PIRF 1LE5B 4H5SB 4PJ5A 3WLWD 1AE6L 2V5TA 2ZP0T 3QUXD 3F58L 3T0XA 2YXMA 5EZJB 3TFKA 3AS0A 2CUHA 3PNWA 1NC2D 3CSGA 4TQEL 5M7QA 4Z8FL 1T21B 4MXVF 3DXAD 1OHQA 5ALCL 4L3CB 4HCRL 2X41A 3OR6A 4ZQKA 1RURH 1U8HA 1IGFL 1QFWI 5JPNA 3VFOA 1AXTL 5IBTH 1KB9J 2KUTA 3KXFB 2VE6B 4H8WC 3VMNA 4Z7VA 2R56L 1IKNC 4I18A 2UZIH 1KB5A 1OWWA 2ITCB 2X4QA 4I9WE 5B39A 4Y1AA 3DVFA 1KB5H 5GS2H 3BD4A 2AK4A 4BQBA 4FA8A 2QADB 2R2EB 1F4YH 1PG7H 2VLLA 4RFEB 3RAJL 5FF6B 3SE4C 4JM2D 2D7OA 1XEDA 2GCYB 2VKXA 5CCKH 4XXDA 1RUAL 3BUYB 4IOIB 1LDSA 5A40E 4XP5L 5FYJE 3EOBA 5T5FL 1GAFL 4LPCA 1JI1A 4LMQI 4LPVA 3E2HC 2X1WL 4S1RH 5DT1H 1A3LH 1TENA 4PJCB 1JGUL 5CD5D 4ONFH 8FABB 1UYWH 1J10A 3MLXL 3QXUA 4G8GB 1F3DH 4XMKL 2VXUH 3AU1A 1B6UA 3MCKA 5I1DA 5IMMA 2CKNA 1S7SB 4X4XB 5ADPH 1KN2L 4AT6B 3NVQA 4HHAB 4XBEL 3BZFA 1FG9C 2YD2A 4J4PD 1FHGA 4MQSB 4XVUD 4RMUA 4Y4FA 3I50L 4LF3A 3TV3H 5MERB 4IOFC 5J13C 4JDZA 1IBGH 1MI5E 5AAMA 5C7XL 2XZCH 5F6IC 4JZOB 3LKRA 3BGMB 4U3XA 3X3GH 1FV1A 4GG6B 3MRLB 3ABZA 4YBLB 4JGMA 3CDYA 4K7PY 3ZSSA 1K3IA 3F8UB 1JV5B 1T6WA 4R6UA 4KJWC 4RIRB 1SJEB 1JCKA 4LBEA 3FT3B 2J6EL 4HS8L 1CYGA 3G6JF 1AKJD 4XHJC 4PJ5D 4MCYB 3EYQC 3MJ9L 4N8CL 4OLXH 4I0KA 3SGJA 5E2WH 3GJFK 4J3VA 2YD9A 2EIZB 1XF2A 3UPCA 5D1QC 4H20L 5DMGC 1S7WB 3TFKD 4PJDE 4ZFOA 1A4KB 2NXZD 4ZUVA 5CP3A 4XNXH 1ACZA 3FN0L 4ELKB 1U42A 4IS6B 1SJHB 4ZS6C 1X5KA 3QFJB 1ORSB 4UDUA 1SBSH 2BFVL 3BP5A 4KTYA 4MJID 5EG6C 3RY4A 1LE5A 4JY6B 4H5SA 1L9NA 1KFAH 5DUPH 1G9EA 4Y1AD 1QRND 4LCIL 5EZJA 1A6PA 4OIAA 1MNUL 2AK4D 2Y5TB 1T21A 4QT5B 3D3VE 4IRJB 1W8OA 4L3CA 4F7MB 1QD0A 2ICWB 5EDXA 5JIIA 2G5RA 3MXVL 3KXFA 4U1KA 2VE6A 4OSUH 2AXGB 3ARGC 1I85A 5CJBA 5T3XE 1MHPH 1MRFH 4OLYL 1V7NH 1IGCH 3V95A 1P5VA 2ITCA 4YE4H 1GL4B 2R4RL 3HC3H 5ERWB 3ARSA 3QI9C 3LVEA 3OKOA 1JGVL 3U4AA 5IVZB 4RFEA 5DD1H 4MQTB 5FF6A 3VW3H 2GCYA 1CI5A 1L7TH 3K1KC 1EFQA 2APBA 3BUYA 4JE4B 4IOIA 3GHBL 5EC1B 1KLGB 1VFAB 4WFHE 5DVOA 4M7JL 5I8KH 2R69H 4OM1L 2ATKB 5BVJA 2CLVB 5EBGA 1Q72L 1G9NC 1INDL 4WGWB 3QCUH 4JPVH 4Z9KB 2CSPA 1ROWA 4O58L 4G8GA 3VFUB 4AIOA 3VXOB 3N9GH 2OTUB 2MKWA 1S7SA 4X4XA 2IG2L 2B0SL 4AT6A 1F2QA 1HI6B 2NW3B 3T4YB 3JSSA 2Z91B 3DYPA 1CL7L 3UZEA 5I8EB 5D6CA 1HWGB 3TJHC 4L8CB 1EEZA 1CDIA 5MERA 1FDLH 1KBGH 1I8LC 3MRDA 2J7LA 3T3PF 4M8QB 4JZOA 3TT3H 5CFHA 1MQ8A 4MA1B 1IC7L 5DO2C 5EU5B 4GG6A 3MRLA 4NQSB 4Z5RB 3KPLB 5HGAB 3BZ4A 3GDBA 1JV5A 5GGSB 3H9YA 1FGVL 1S7RA 2JB6B 1SJEA 4RIRA 5DVLA 4LVHB 3L5HA 2CDEB 4PFEA 5E9DB 2BVUA 4RFNB 2VXQL 2ZG3A 4LNRB 4M6MH 1KULA 3V7AG 2D7QA 4MCYA 4KPHL 2YPVL 2EIZA 3N1FC 5KG9B 1EEQA 1PX3A 1S7WA 3IDJB 3O3BA 4NPYB 4MQXD 5GRXG 2E7MA 1AGBB 5IT2L 4JB9L 2ADFL 1A4KA 2VLMD 43C9B 1FLRH 1RU9H 4P2QB 4XH2B 4IS6A 2YC1B 1CLYL 3QFJA 1J5OL 4Y5YB 2UYLB 1AP2B 3M8OL 2WIIB 4GXUM 4S0UC 4PY7B 3G5YB 4KMQA 4JY6A 3VXMB 4UNVA 1Q9OB 5K9JH 4FP8H 5J11B 3WEXB 5F1SA 4R7DB 4PJHB 2Q8BH 5C6TL 4TNWF 3D2UD 1RMFH 4TN9A 5DK2B 3GIZH 1CCZA 5I15L 2QADD 3JVGC 3MUGA 3NCCB 4QT5A 4IRJA 4U6TA 2XXMB 4F7MA 3LHPL 4YC2B 2YUXA 4PJBB 3OAZH 4XP1L 2ICWA 5AD0B 4N5EC 4EDWH 3BPCB 5C3TA 5KSBF 3W82A 2AJXL 3T2NH 2AXGA 3WNPA 4F7EB 5SX5K 4L3EA 2WQRA 4IM8A 3V0WL 3HUJF 2F5AL 4AL8H 4D0CB 5ERWA 4JN1L 1DBML 1BD2B 1D6VL 3REVA 1QFHA 4Q9QH 4UT7H 3KG5A 3E6FA 3W9DB 4RMRA 2A6JB 4NKIL 1P6AB 5EC1A 1VFAA 3EIFA 3MRJB 4ZAKC 4FRWA 1N6QH 2ATKA 2WBJC 1BFVL 2CLVA 4Z7NF 1IEBB 3ZL4L 1AXSB 4AEHH 1CXIA 5KVGH 1ZSDB 3RUGB 4JJ5B 3VFUA 4G6ML 4NHUB 3VXOA 1BP3B 3LH2L 4YHPB 2OTUA 1NCCL 4MXWL 3WDJA 1U2HA 4KXZH 4MSWA 5H35B 4LGSB 2NW3A 5JW3L 2CGRL 4PJ7B 4XP4L 2Z91A 3BVNB 4BH7B 3RZCB 3OKKB 3RWEB 3NA9L 5CBAA 4GRLB 4UB0H 5TQ0H 1PSKH 4ISVB 3QDJB 5BW7C 4F7CB 5HYIA 2DLEA 4M8QA 3T2QA 1KELH 2J4WH 1FFNB 5EU5A 1PKQB 3DECA 3O6LL 4NQSA 1GIGL 4L8DB 3ZE2E 1T2QL 4N0CA 1E4XL 3SQOL 3QULA 4J12A 5A1AA 2JB6A 3EJZD 4EN3A 3QFJD 4GFTB 3QZWG 5DQDL 2CDEA 1FNAA 3GMLA 5LXGH 2EDQA 3OKLB 4PGBB 4LNRA 3QBTB 1QFPA 5IB2B 2V17L 4P49A 3RX5A 4Y19B 4LCWE 2FSEB 5KG9A 1ZGLP 1CK0L 2FDBP 2XICA 3IDJA 4NPYA 4QRTB 4U6VH 4UINL 1VHPA 5DGQA 5DRWB 3ME0A 3BAEH 5JQ6H 43C9A 3P4NA 1CIDA 2EECA 4XH2A 4RQQB 1IGMH 5DS8B 2YC1A 1UG9A 3ZT6A 4Y5YA 2UYLA 1AP2A 1PFCA 1QQDB 5DHYB 2WIIA 3W9EA 1T89C 3G5YA 3RP1A 3VXMA 5EO0A 1JWSB 1Q9OA 4L3ED 2AXJA 4UT6L 1S9VB 3TT1L 3WEXA 4PJHA 4Y5VC 3D1MC 3VI4E 2VDLL 2DQGL 5DK2A 2V7HA 15C8H 1G7IB 1OTUD 3U9PH 3JWNC 2FZ3B 5H8DA 4JZJB 4HZLB 1SEQH 3UTTD 1MWAL 4P4KC 2HWZL 1I9RH 4LRIA 5FCUL 2Y5EA 3R1GH 5D1QB 5AD0A 2H1PL 1IGTB 4F7EA 4P23B 2P1YA 4LQ1A 3BP6B 4OI8A 2JJTA 4X4ZA 1BQHG 2BNQB 3ZTNL 4QO1A 2NY2C 4LLVA 2BSRB 3G9VA 1T66C 3W9DA 4KQ4H 1RULL 1JYVA 4PGDB 3RQ3A 2A6JA 3FB7B 5HJ3B 4KAQH 4XZUB 4EXPX 3MRJA 4AH2B 1JIBA 4XC1H 2KDGA 1EHLH 4HKXB 1JK8B 2VDML 1QSFD 1UM5H 1IEBA 4XVTH 2FBJL 2BY0A 4U6YA 1AXSA 1Q38A 3BI9X 3Q48A 1ZSDA 3RUGA 4FTVA 2M2DA 3ZLQC 4LIQE 3LPWA 4NHUA 4KHXH 4YHPA 2DS4A 1JYXA 3O4LB 3QIWC 4N0CD 3RWFB 4KMTH 1M71B 3DLQR 1A5FL 1BPVA 1F42A 4PJ7A 4EN3D 3MX0A 4BH7A 1U8JB 3BVNA 5GS0C 3RZCA 3OKKA 1BF2A 3RWEA 1F6FB 3QDMB 5FHBL 4GRLA 4K3HA 3SE4A 4EQ3A 1J1XL 4PTUB 3STZB 1N8ZB 4JRYE 4FZ8H 1E4WH 5IB4A 5AG8A 1FFNA 1WLHA 3SE3A 1PKQA 1UACH 2D7TL 3SDAB 1JZ4A 5MHSE 2C7UB 4NDMA 3SDYL 4L8DA 3U4EA 2NZIA 3UO1L 4R2GC 1R0AH 1GGTA 3O6ML 5IMOB 3L3JB 1A6ZA 4B5EA 5IUSA 1MREL 3OKLA 4PGBA 4PJDB 1LEGA 3JXAA 1KB5L 5IB2A 3C6LC 1F4YL 4Y19A 3K4DA 5CJ5A 1YEGL 5CJXC 2P8LB 3NTCL 4QRTA 3SQBA 1IGIH 2XACC 5DRWA 5HHQB 5IMKB 4DCQB 4KUCD 1IMHC 1D7FA 5L2JB 5DMJB 3T77A 2IQ9L 4PLNC 4LU5L 4RQQA 4HPYL 5DS8A 1JZ5A 3O41B 4M1DH 4S1RL 1UKQA 1QQDA 3UJIH 1J11A 5DHYA 4I4WA 4I3RH 1JPSH 1QNZL 2NX5E 2QQNH 5HDQH 3EFDH 1ZA6A 1DQMH 1JWSA 4V1DB 1EAPB 1S9VA 2XIDA 2VZOA 3E8UL 2VXUL 4WU5B 3WUWB 3S34L 2Z9TA 5DMKB 1A1OB 1CICB 1G7IA 5I76B 3EO1A 3F7PC 4JZJA 4WEBH 1AGEB 4HZLA 5BVPH 2PXYB 4X6BB 5T1LB 4PYGA 5C0NC 4YBQD 5D1QA 4KMLB 1IGTA 1NCAL 1IBGL 3D48R 4M61A 1ZK9A 3MYJB 2FNBA 4P23A 2N7BA 2OLDA 4U0RC 2BNQA 5JW4N 2P5WD 2Z8RA 4XTRC 3QEQB 4UMGA 1QP1A 3MLWL 2F19H 2BSRA 3FAWA 4FTVD 4XCCH 3KPOB 1ZHLB 2VWEC 1F4XH 3QG7H 2AJSL 4JCMA 1YECH 5FYKU 5JHDE 2C1PB 4PGDA 3FB7A 5HJ3A 4EEEA 4WI4A 2BERA 4HWEL 4XZUA 3RZCD 4CBPA 3E3QA 4GRLD 1Z0MA 4O2EB 4HKXA 1JK8A 5E2WL 4L3AA 2XYCA 4N8VB 1DCLA 3HPLB 3D0LA 5AZEH 3V4UH 1H3VA 4ZFOL 5KW9H 1MRDH 3L5JA 3QJFB 3O4LA 4FABL 4C83B 3RWFA 3KYKH 3MLVL 1M71A 3RDTB 2XZQL 5JUEH 5DWUH 2DQUH 4N90E 4ZTPH 1NDMA 4NWUL 3JTTB 4HXAL 4YDIL 3ZHLA 5T3ZD 4OIIL 3QDMA 3VDAA 3DGGA 4PTUA 3STZA 1N8ZA 2VUYA 2ZUQB 4ZAKB 4LRNL 5FO9B 1SMAA 3SDAA 4IOFD 1I7ZB 2EIDA 4NO0D 3HB3C 4OSUL 5F1OB 4R4FH 5E8DH 3L3JA 3PQYB 3VFNB 3ZDYF 5BO1H 3MUHL 1S7TB 1WV7T 5T5NF 1OY3B 1KTLB 5SWQB 4QXUH 2P8LA 4L8SC 5LVEA 5HHQA 1LK2B 2XY1A 3D9AL 5IMKA 4DCQA 2K3TA 4LDEB 5L2JA 4DUWA 3ZZ1A 5FUZL 4XHJD 2ZUWA 4KK9C 5HVWA 4ZTOH 5D1QD 5DMGD 2HH0H 4A2LA 4M6NH 1OM3L 4OLWH 1EO5A 4PLKC 1MY7A 3V0AC 4PP2B 4V1DA 3V6OC 1EAPA 3KYOB 4ZS6D 3QXAB 2E9WA 7CGTA 1J0IA 3RY6C 4XB8A 3MV7E 1LDPH 2YN3A 4WU5A 1MFNA 5DMKA 1A1OA 1NANI 4JO4L 1TTGA 3FQUB 5I76A 1NGZB 1RAMA 3U48A 1AGEA 3H42H 2PXYA 1YZZA 3VGGA 2NY5H 5IEKB 4X6BA 2D4DA 4F9PC 5T1LA 1ZS8B 3BW9B 5BRZA 3CU1A 2LAGB 5T3XH 4Q9CA 4MXQA 1FDLL 3MLZH 4K3JL 3MYJA 1NMAL 3VFRB 2HFEB 5HGGS 5FHAL 5ANMB 3RVUC 5IM7A 4HIEB 5HHVH 4RRPG 3QEQA 2DICA 4RSVA 5GRWA 3I3BA 4JRXA 2NY7L 1ZHLA 1NCBH 2H9GA 4NO5B 2C1PA 3O4LD 5JLZB 1AJ7H 4GG8B 2AABH 3ZE2F 3QI9D 4G6FB 3G5XB 1CGSH 2XNAB 4O2EA 4N8VA 25C8L 3F7VB 2A73B 3A6BH 5KZCD 4KKAC 2QV2A 1RZIB 4GBXC 1CDHA 4YX2L 3SDAD 2OXHA 4MNQD 3H6JA 4YHZH 1V3MA 3QJFA 5TQ2L 4C83A 3OL2A 4JQXC 3MRKB 4YHNB 1M6OB 3JTSA 3RDTA 1FVCA 4D8PB 4XRCB 5E08L 1N4XH 3OKDB 3MZTA 3IDYC 4L4VD 5ALBL 5KANI 2Q8BL 5C0EB 4G8FB 3VRJB 4OM0H 2DM4A 2F54E 3MCLH 3O9WB 4X7EC 3ESUF 5I1KH 4ZAKA 4HD9A 1G0DA 5FO9A 1VPOL 5FYKE 3OXRB 3VI4F 4NNXB 3TJHD 5D1ZC 3SDDB 1YN7B 2WBJA 3FQNA 3TF7C 2A74B 2FX9H 4EDWL 1K6QH 5CWSB 3T2NL 4WU7B 3PQYA 5DO2D 4FQ2L 4NT6A 1U6AL 1S7TA 4V1DD 5J12B 5SWQA 4NQEE 4Q9QL 3SDXB 4UT7L 1NSNH 1DBAH 2VSCA 4LSSH 2VDNH 3G5VB 3FOMB 1C5DB 3HI1B 3G08A 1G1CA 2PXYD 1TTFA 3TCXA 1S5IH 4QXWA 1CQKA 1J7VR 3BPLC 5BRZD 3EJJX 1OAZL 4U2ZA 3VU2A 2DBJA 2UV3A 1CLOL 4ZO8A 3WNLA 5L7XL 4ERSH 3VA2C 4DQOH 5KVGL 4PP2A 3FOLB 2FX8H 3KYOA 2VAAB 3LN9A 3QXAA 2EDTA 1IARB 1GGCH 4KJYB 1S7QB 1F6AB 4JRXD 4NN7C 3MFGB 3S37X 5C0FA 3RGVB 3TN0C 2R1YB 5IEKA 5CIPB 2VQ1B 5IBLC 1ZS8A 1A14H 5IVXB 4UB0L 2ZJSL 3K1DA 5AZ2H 2MKLC 2HFEA 4KKNA 4PV8B 1KELL 2J4WL 5ANMA 4J8RB 2YRPA 3RNQA 4HIEA 4JFHE 3B6SB 3U7YL 2E7HA 3QDGE 4N5ED 1R5WA 2YXFA 5IWLC 5I18L 5D70L 4PG9B 4NUJB 3LEYH 3L9RB 4NO5A 5JLZA 4NRYB 4Y5VA 4GG8A 2E27H 3RDTD 1OAKH 1JPST 2IFFH 3H0TB 5AWNH 3G5XA 3ARPA 5DMYA 1A9EB 2XNAA 4NQCE 4TRPL 4NQDE 1LEKB 1DVFB 3F7VA 2HLAB 3A67L 4ZAKD 43CAB 1IGML 1B4JH 3FCTB 2WBJD 3OKNB 4JM4L 4U0RB 3QIUB 3WN5B 2ADGB 4D0DB 3WYRA 4OD3H 3MRKA 4YHNA 1M6OA 1BM3L 4D8PA 5F1IB 2P44B 3NACH 5FGBA 5MI0C 2Q87A 3OKDA 4OGYL 2ED7A 5ICZB 2NXYB 3BPOC 2BK8A 2GJJA 4NCC1 5C0EA 5L8JB 3BJLA 2EC9T 2LQRA 4G8FA 3VRJA 1YNTB 3ZHKA 4AY0A 4CMHB 3O9WA 4QRRE 3U9PL 2B39A 3LAFA 3JV6B 3TA3C 3CLEL 2HG5A 2P42B 4PRDB 1WBXB 4GQ9L 3RPKA 4DKDC 1UCBL 3OXRA 4HUVB 4JHWL 1MCHA 3SDDA 1HKLL 4PRPD 2HT3C 1CR9L 1E6OL 3PHOB 4QGYA 4CVUA 5ESQB 1KCUH 5C07E 3IDNB 5CSZB 4BKLB 3LPFA 5C0CB 5CWSA 3CXHJ 2ZKHL 2NY1B 4H25B 4P9HL 4KV5E 5E0QA 3MV01 1HHJB 4K8RH 4GS7C 3H2WA 4P2OC 4OFYD 3SDXA 2M26A 5KOVC 5C9JB 4TNVK 2XQBL 2Y9RT 4PJEB 3SDCB 3G5VA 3FOMA 5T33L 1C5DA 3VXTB 2PW2B 1TZGH 1KC5H 3NCJL 4XC1L 4HEPG 3FRPA 5GS3A 2JK5B 1UM5L 3KPQB 3W0WB 5CD3B 3MGTB 1OAXL 1XCQB 4CDHA 2W0FB 4OTXL 4WHTB 4PDCE 1X4XA 2VAAA 4HGMA 1W0YT 4KJYA 1S7QA 1NKOA 1F6AA 4KHXL 3GSUA 1YDPB 6FABL 4M43L 3RGVA 1MJUL 2W0KA 1BOYA 2R1YA 2YRZA 4HJJL 1DQTA 2B2XH 3HRZB 2VQ1A 5CIPA 2H45A 3NIDE 4L5FH 3ILQC 5IVXA 4JVWA 4H1LG 5CJXA 2EDRA 4R96A 2X7LB 4G6FD 1I3UA 2MHAB 1RY7B 4ZS7H 1BFTA 1MAMH 1IFHL 4PV8A 1SM3H 2O5XL 1A6VH 2YMXH 4G6KH 3PWNB 4FFWC 3FT4B 4G9DB 4XX1G 1BAFH 1XGRB 2KZWA 4XWOC 4DGYL 2ZUUA 4Y8DC 1FGNL 1DSFL 4PG9A 2E9BA 2IJ0C 4NUJA 2B1HL 3L9RA 5DVKA 1RSFA 4NRYA 5DJXB 4Y89A 3H0TA 4YK4C 4YEEA 3RHWF 1HHKB 5D7IE 1A9EA 3QCTL 1T66D 2V2TB 2JB5L 1LEKA 1DVFA 5KANG 2LABA 3TWCL 5B38G 1IGIL 5EU6E 1T03H 2HLAA 5CAYB 4JKKA 2LTQB 5CMAB 43CAA 1GHFL 3SDDD 3FCTA 3OKNA 5GIRB 4M1DL 3QIUA 1U91B 2ADGA 2AGJL 2ZSWB 2IBZY 4G59A 4LK4A 5DEFB 3EFDL 3NZHL 3GO1H 4TYUA 3L6FA 1J18A 2VXTL 3K46A 5C0BE 5ICZA 1P84J 4JO1H 1S7UA 2F8VA 4B0MM 3NIFE 3QIWD 2XTJB 1ZWIB 4KTDL 4WJ5B 3JV6A 3D39D 5GS0D 4PRDA 2DIJA