4ZFZB

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
source organism Macaca mulatta
total genus 15
structure length 100
sequence length 100
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzB00
1U93B 1S9YA 2HT4D 4IHOA 1IILE 4QOKD 1AR1D 1S7RA 5KJRH 5C0CB 4X9HA 1UADC 5AG8A 3OGCA 4M6MH 4P48A 4PGCA 4J6RH 3D0VB 3H9SE 1K8DA 4M5ZH 1FL5B 3SEPA 3OTTA 3BVNB 4JANB 2E7LA 5B3JF 4FP8H 2V9TA 3SE9L 5TDPB 1A6WL 1BIIB 3DTXA 3N1GC 4P4KA 3A67H 1PQZA 3SN6N 2VXUL 3EYSL 4AIOA 6CGTA 3K8LA 1A1OA 4P3CL 4GKZB 1JWMB 4M1DH 1CDUA 5KN5B 4OAWB 4YR6B 4YNYB 3CDFA 3KYOB 4KROC 3ZE1F 1LEKA 1MCOL 15C8L 4D0CB 1NEUA 3HS0A 2A6KB 1KG0A 1MJUL 3VRLF 1I8IB 4DTGH 1QYGH 5DK2B 4QWWC 2QKIA 3K4ZA 2KZWA 1G0YR 4Z95L 5E2WH 2HH0L 4JHWH 4XCYA 5KSAD 3U1SL 2B4CH 1BVLB 3H7BB 2RR3A 2BXZA 3SE8H 5FGCB 1EFQA 3CIQA 4NO2A 4ZSOE 4MMXC 4P5TB 4U0RB 1PLGL 3MA9H 4LIQE 2HFEA 3QFJB 5ESQB 1Y0LA 3MV7B 2JIXA 2NXZC 1FRGH 1PFCA 4UT6H 3TA3D 4YK4B 1NCDH 1T1ZB 5HDOA 2QBWA 3FFCD 5F9WB 3DV4A 2VB5A 3WFEH 2ZJSH 1HZHH 4LHQB 4NM8H 3KYNA 4QRTA 1HQRB 1WGOA 5D93B 2YWYA 5EBLB 3HR5A 4LLWB 4ZPTB 4J4PC 3BX7C 2F53A 1U8HA 4Q97A 4EUPB 1P7KA 1GAFH 3BJ91 4O2CB 3UDWA 3ILPA 1R3KB 2RQ8A 3IXTA 1Q72H 4YE4H 1NCUA 4JFEE 3TJHC 3PQYB 5TFSL 2R0WH 3DSFL 1F90L 3VXMD 4ZUVA 1JN6B 2FB4L 2UWEF 3MV8A 4N0UA 1RZKL 3GO1L 2WZPD 3ZT5A 1I8MB 4Y88A 4G9FD 5JPMA 5JMRA 4LVHC 5C0FA 2X4PB 1JWUB 3NCFB 3C8KA 5INCA 2YD2A 3JWDH 5ALBL 4QHUA 1FYTB 5C0AB 4ODXB 1KCUL 3SCMC 4U6YA 2VL5A 4Y16D 4Y4FC 5GISH 1OWRM 4JFHE 4OJFH 4GMSL 3MLSL 2R4SH 4JJ5B 2PW2A 1WK0A 4HH9A 2Y6SC 1BBDL 4QRRA 1G6RL 1DVFC 1MQ8A 3NCMA 4YFDB 2JF1A 4RGNB 1KXVC 3L5IA 4NQCD 3OKOB 1G9MC 5D2LE 5DQJB 2UUDK 3NFNA 1AIFB 2O26U 1FFPA 1PGRB 4CMHC 4U1JA 3V5HA 2G5RA 1I3UA 4RA0C 3FZUC 1EERB 4BQ8A 3W2DL 3VDBA 4IDJL 4RDQF 4OD2A 4P2QA 4XNZB 4M62L 4EN3A 1RIVH 5ACLA 1Q1JL 5HXMA 1AQDB 3DX8A 4M6OL 4OQ1A 1ED3B 3QWQB 2VN4A 5ALCL 3B5HA 4M5YL 4M7JL 3L3HB 2DQGH 2JJUA 3FB6B 4PJ8B 2EZ0D 3F7PC 5ESVB 1QFWH 4XP4L 3HB3D 3Q6GH 1P4IL 2NY0B 4JPKL 4CKVX 4ZDHA 3ARSA 2C1PA 1WAAE 2VRAA 4W6WB 1YUHB 3WV0A 4PJHA 5IB4B 5D8JL 1A3LL 4J3SA 35C8H 3IS0X 1U95B 1CGTA 4X6EA 1FPTH 1PKQB 4X98B 3K1DA 4MD5B 2OSLA 4UOW1 4HFWB 1IAOA 4YBQC 3U2SB 1FVCB 3P77A 4NOFA 3MCKB 3KPLA 4JN1H 1LEIB 5SWZD 1D9KB 2HYMA 2HMIC 5FOBB 2F8XC 4OKVB 2GTWB 4QTIL 4F7CB 2N1KA 2VERN 4LP4A 2AJUH 4Z5RA 3NACH 3NCJH 4ODWB 4R9HA 5DJCA 3GZKA 4A6YH 2BC4A 1KTRL 5ID0A 1HKFA 3D25B 5D2NB 1BJ8A 1I9JL 2X4OB 4TPRL 3GSQB 1GZQB 3O4LE 1QLRA 1L0QA 2B5IB 4OFPA 5CGMA 2HN7B 3ULUH 1PZ5A 2PXYC 1KXTB 1TMCB 1MCHA 3QDAA 4DKEH 4MJ6A 3HE7B 2I5YL 2XRAL 4L4VA 4LF3A 3TFKC 4PJ9A 1WC7A 2VLJD 4JFOB 4U6VH 1ADQA 4XMLL 3GJEA 5JR1H 4S1SH 5EWIL 4LIQL 3RWGA 1SM3H 5DI8B 1CWVA 1YECH 1KB5H 1N59B 4YHPB 5C09D 1QFUL 1WT5C 2XYCA 4ZFOA 4IMLB 5C2UB 4NZUL 2FX8H 4I4WA 1KN4L 2DLFL 3IDJB 3SDCB 5E6YA 4LLVB 1MQKL 1LDPH 3C2AL 4X80H 2PTTB 4X7TA 1AE6H 4I0KA 3HZMB 4I18C 3KNBB 1KYOJ 1HXMA 4GAFB 5JHDB 2XG5A 5HYJD 3ARBD 3QDME 3MC0A 1T04B 1TVDA 4U1NB 5GJSL 3JVGC 5EU5B 3C9NA 2NY2D 4K23L 5IBLC 3UCRA 3MV9B 2MSPA 4G9FE 1FN4B 2VN7A 1NBZB 4PP1C 4JAMB 1MI5E 1E28A 2DQHL 3NCBB 5DTFA 2BHUA 2X6MA 4L4TD 2IADB 1FZOB 1KPVA 3MRHA 1AO7B 2QR0A 3VE0A 4GW4B 4JM2B 5C0BA 1WCQA 5CP3H 4TVPD 1MHEB 2ATPA 4N9GB 4WWID 2G2RA 2RHEA 3IVKB 3OZ9L 4WY7H 4U6XA 3V52H 4XZUB 3G04B 1T2QH 4X6DA 1IGJA 3HI6L 2EYTB 2ITCB 4RFEA 1GGCH 5MEOA 5IUSA 3VWJA 3RTQD 3U6RB 2VZUA 3LN4B 1V7NL 4DN3H 2E7LC 4UDUB 2IQAB 2NY6C 4LL9A 5T3XD 5K9KA 1RD6A 2DI7A 4RAVB 1A0QH 4TVSa 3B8SA 3TNNA 1ETZA 5I6XB 1HQ4A 2D9QB 3A6CL 5KSBB 4APQB 2V5TA 3BKCH 2E7BA 3X12A 5GRUL 1WBXA 3RDTC 3W11D 4JQVA 4X8XA 3BPNC 3UJTH 2YXFA 1F2XK 3V79C 3LMJH 4WU5B 4BUHA 1V5JA 5CZVH 3T0VA 4TRPH 3MRDB 3RAJH 2AABL 3H3KA 2HRPH 4TTDD 1CICC 3JWOL 3QFDB 5F9DC 5D1ZA 4N0RA 4OLWH 3F7RA 5B3JE 4LQFH 4WI8A 3HLAB 3QIBD 4XWOD 3C6SB 2Q7YB 4LCUA 4YHKL 4H0GA 1HHKB 4CMMA 1NEZA 5GJTH 5GXBB 4QEGA 5TDOB 2R56H 5DFWH 3ROOB 3WKNA 5L2JA 1TPXC 2IC2A 1UENA 4QOKA 4G8GD 2BJML 4RIRB 4YHLH 2D31B 3UTQB 4OLVL 3JUYA 1J05A 5IOPA 1PSKH 5E5RB 3GSRA 3SKJL 4HWUA 1V3JA 1KENH 3LQZB 3JBG7 3PNWB 1CFNB 5FK9A 4UNVA 3QG6A 1P7HL 1M7DB 4YHYC 1N6QH 1ND0A 2OI9C 3LEXA 3FB7B 5IHZA 1MRCH 1HHHB 3LDBB 1WIUA 4QHMB 4OM1H 2IFFH 1G7MA 2FJHA 1L7IH 5DR5L 5BV7C 2PW1B 1QFWM 1FFRA 3NFPB 3B6SA 2DQIL 1DJSA 3C2SA 2APTA 3TIEA 4GKSB 2CJUH 3D69B 3O8XA 2A73B 2GKIA 4NC2B 4U1IA 4KH2A 1FLRH 1MPAL 4YHNB 3O2DL 3PF2A 3P2TA 4OZGE 3HMWH 4DKFH 5KSAA 1ZVYA 1A9EA 4MJIE 5JQ6H 3QAZC 4OZIA 1IEAA 1QACA 2EIZA 4P2RA 1QQDB 5BMFL 5IWLA 1JNLH 3DVNB 1WQVT 4M61B 2BVQB 5HGBB 1K2DB 4KJYA 1KJ3L 1XF4B 5ENWB 3GSVB 5FA3A 4LSUL 3TA3A 5K59E 4XRCB 2AJSH 3VFWA 4HIJB 3FFCA 4AENA 3CK0L 4WUUB 2UWEE 4NJAH 3LIZL 3MYJA 1W0VA 2VITA 4LVOC 3BI9X 3QIUB 3IGAA 1M05A 4OZFB 1JGVH 3O3EA 4XX1E 1AI1H 2OXGA 3HZKB 4ZTOH 5J6HA 4Z7OF 5D7IB 1JPFB 1YJDL 4KRPD 2BNQE 4KV5F 1N8ZA 5C0DA 2FLBT 4HDIB 1UACL 5E8DL 4EN3C 3SKOA 1N7ML 5IT2H 2X5PA 1PEWA 1EMTL 5GGRB 1OAYL 2VLMD 3VJ6B 5CBAA 1V8HA 2XFXB 3VXMA 1I7UB 2VDMH 5GGTL 3QUXD 1RHHA 4OFVA 1CL7H 4HS8H 3VXPB 3MRMB 1CK0H 4BELD 3TPUA 1K4CB 3D39B 1JFQH 3I84A 5GGVH 5T1DL 3MJ9H 1LD9B 3QP3A 4LRIA 5DJDB 1Y6NR 3ARDB 5F7MC 4LPWA 4ETQA 5HHMB 3CFKA 5C0JB 4XP9H 2Q6WA 2VLLB 3IFPA 3MOAH 2HA1A 1KNOA 4MX7B 2WBJC 3U46A 3GSNB 4R2GD 5EIVA 1AFVH 9CGTA 4Y16A 2EE3A 1T5XA 1UB6B 3MRJB 3HMXA 4JRXE 5MEPA 4FQ2L 5H8DA 4QHKJ 2QQLH 2DRUA 3BQUB 2MHAA 5ADOL 2FGWL 1MREL 1YN7A 4K8RH 1NFDA 1FL3B 1NAMB 4PJDF 4WW1B 2IPTL 4WUKL 3O4OC 2AJZA 4UDTA 1CU4L 1X4XA 4NQCA 2F54A 5F6IB 2UY6A 4UT7H 4XH2A 4PRID 1YDPA 3OR6A 4OTXH 1D6EB 3DSFH 4MNGB 3H9YA 3VA2C 1MIEH 4LGPB 2WUCH 2GFBA 2UY7A 1E4XH 1LK2B 4XGZA 4JPVL 1B4JL 4Z7UA 5I66A 1ORSB 1GIGL 2BY1A 3A6BL 3VXRB 3X3FL 3MOBH 4YC2B 4E41B 1U8OA 4NKOA 2AV1A 5F21B 4XI5C 2XQBL 1F3JA 3WXWH 3ZKXB 3WDIA 4R96B 5K9OB 1I9EA 4LAQH 2CUIA 4L3EE 5LBSH 3GRWH 1A7QL 1C5CL 4M7KH 2DLEA 1CS6A 2DL2A 2X4SB 5ICXA 1A1MA 2BOCB 4GMSH 1KSRA 1KPRA 5BOZG 5C08B 1K8IB 3CPLB 2NZ9C 4JZOB 1FNEB 4RRPG 4KJPC 1NAML 1R3IL 2X42A 4YDIL 1OW0C 2RGSA 3NA9H 5T5NG 1NANI 2NR6C 3BKJL 2NW2B 2OR9H 4L3CB 1I9IL 5DJXA 5EBWA 3KXFB 3LKSB 4HUVA 4HULB 3ARFD 1NCTA 1ZV5A 2QADD 5HHNA 1TVHA 5SWZA 5ESAB 3S98A 5HHQA 3SDXB 3T4AA 1UWEH 3IKKA 1DQMH 4GXUM 5JW4Q 4H1LH 1MCPL 2NXYD 2AXFB 4FZ8L 2AK1L 3QUMA 1R5IB 5CEYA 1OWWA 3KYMA 3MNZB 5DSCA 1P1ZA 1A4KB 4JFZH 2H8PB 2HVJA 4FXGA 2DQEL 5FYJD 2VISB 3GI8L 4YFLF 5BRZE 3L6FA 4CW1B 4HG4J 1FO0H 1T20B 1KEML 3QZWA 3MBXL 2AJXL 5DVKA 2K7QA 4FQIL 1A7OL 2LU4A 4HMEA 5JORA 2NLJA 4L8BB 3H42H 4F58H 3VXNA 2VLJA 3K8MA 5E9DB 5C9JB 1NDGB 3SGEH 3MRCA 4FFVC 3MRNA 5C09A 4GRLB 4ORGB 4HJ0D 5B38B 4I3RL 3SKMA 1YNKL 4LVNC 1NLDL 4K94L 1F2QA 1BLNB 1NKRA 1Y18A 3BHBA 4JO3H 2DJSA 4LMQI 2Y07H 5C07D 2YA2A 3GJFH 3L9RB 4JQVC 1U8PA 4KK9D 1Z9LA 4QTIH 1CGWA 5CCKH 1YNLH 3BP4A 4CN4A 1VGKA 4XNMB 5HI3C 3VU2A 4BFBD 2DM7A 2IJ0C 1S7UA 1HDMA 5AUMB 1JZ6A 4OV5A 3ARZA 2Z91B 4X4YA 5HYJA 3V5DB 2QV2A 3ARBA 5MP6H 1I9JH 4N0FA 4MD4B 4NIKB 5HD8D 1HHIA 5D1ZC 3ZKND 1OAUH 4L8CB 1EVUA 4TQEH 2GK0B 2ZPKH 2ZUWA 3EKCA 1IAKB 4ZUTA 1LDSA 1OGTA 4LHUG 3MYZA 4L4TA 4NUGL 4X4MA 3ULVH 2E9WA 3PP3K 3THML 3EJZC 4H88H 5IM7A 3ES6A 4LFHG 4J3UA 3IFOB 3VGEA 4KI5F 1TJHL 1HHGA 1AR1C 5D6CA 2R8SH 4UB0H 1OB1B 3WE6A 4NZUH 3T08A 4OZHF 3RGVD 4KDWA 1ULVA 5DFVD 4ZPVA 3TNMA 3AC0A 1XIWD 5T5FH 3RTQA 3BN9D 1A47A 3DMMD 1AGCB 5GS0D 4FNLH 4L1DA 3SGKA 1KJ2B 5EN2B 5E1AA 1U8QB 3STLB 1PJ9A 3SKNA 5C0CD 1FVDA 3GIZH 4U1MA 1ZHKB 4JFFB 5D70L 1S7SA 1IGCL 3SGDH 2Z8RA 1FJ1B 4PLJD 5L8LB 1H8OA 4CJ0A 5D96C 1AHWB 4FN0A 5ETUA 1JGEA 3BYTA 2VC2L 3WIHL 3VXSE 1QLFB 2HAZA 1QOKA 3O8XC 1INDH 5C0IA 3VG9C 1HIML 3VI3F 2VSDA 2NQCA 3FT4A 4HKBB 4F2MA 1FGVH 1N0XL 4RAHA 3RL1B 3VCLA 3JTTA 1UCBH 5F7DB 4NN7C 5F7EH 3P9WB 4YDKL 5E8EB 5JDSA 3PWLB 4F80A 4X4XA 2VDRL 5IWLC 2C5DC 2W92A 1M71B 4J3TA 4UTAL 1CFQB 4AIZB 2R1XA 3CXDH 3QIBA 2A74B 3K80A 1CD1A 2IALA 5DD1H 1R0AL 3OAYH 3PABA 1ZGLM 2QHRH 1WBZA 1KJ2L 5D5MA 4P5TD 3CU1A 4Y5XB 2BCKB 4AZ8A 4DZBA 4G8GA 3QFJD 5I75C 3HZVA 1BP3B 1XAUA 3CFDA 2PCPB 3MV7D 3RIFK 4MAUL 5LAXA 2I27N 1DL7H 4OD1H 1I4FA 5IVZB 1MRDH 3PXJA 4PTTB 1T0NB 1X5ZA 1OQXA 1W72B 3WIFA 2PUQT 2VQ1B 3BIKB 4CU7A 4EIGB 2JJVA 5GGSB 1PG7H 1NUNB 3S35L 1A7RL 5FGBA 1NJ9A 3VGHA 4NUJB 5J6GB 1MVUA 1UH3A 4PD4J 5IFJB 3QEQA 4G5ZL 5F7KC 2ATKB 1NLBL 4ZFFA 1IM3A 3B9AA 1IT9L 2HKFH 2GEEA 2XICA 1RFDH 5ABDE 4U1LA 3PJSB 4M48L 2E3VA 2RBLA 2ILLA 3FO0L 3TV3H 3QJHA 4L9DA 1VFAB 2XQYG 4GAYA 2CRZA 4WEUD 1PEZA 4IJ3B 2I60H 4Y16C 5F7NC 1MNUH 3D85B 4Z7OE 1OAQH 5HYSB 5MERA 1IGFL 1ZLWH 1QEWB 3TJEH 3DUSB 3IAPA 3P4OB 3WFBH 4M6AA 4FQXD 5HY9A 3DNKA 2ZUSA 1FYTD 5C0AD 1OTSC 4LOUC 3OXSA 3T65A 3CDYA 4X9IA 3QO1A 4PY8I 1XF3B 3I9GL 1RURH 3QPXL 1W72L 1N0LA 4TSCL 5DD5H 3V0WH 1J5OL 2ZUQB 4EOWL 2H32A 3G9VA 3FQUB 2FGZA 5I76B 4I2XB 1MFBH 1JNHB 1EV2E 3G6JA 4UQ3B 1N6UA 5ISZE 1UXSB 4RGND 1UJ3B 3GI9H 2VKXA 4GW1B 5F9OL 4FQJH 1UWXH 1OP5K 5I30L 1SMOA 3LD8C 4C58B 2CKBB 2OL3A 4UUJA 4NSKB 2DLIA 2G5BA 5E5UB 3PE9A 4OGZA 5MI0B 3QUXA 4KKCD 1GZPA 3CVHH 4EI5B 3CMOL 4QCIA 3DI2B 4D9LL 5BMFH 1S9WA 5DRWB 4OZ4B 4PJDE 1A21A 3OL2A 4YIQB 3B5TA 5A16A 2V2XA 4ODBD 4LASL 3G08A 4P9MH 2R39A 4PJ8D 5KVDH 4OB5L 1Z5LA 4LSQL 3H2WA 3GMRA 3QHZH 4F57L 3F7YA 1JTOA 4PJIA 1RVFL 2Y4SA 2NY0D 4FQLL 4HZAA 4X6BA 5FIEA 1GJIA 1U3JA 4LLMA 2Y9RT 1P84J 4ZUUB 2R29L 3QG7H 5D6DA 1FGNH 2WQ8A 3BP6A 4JO2L 3EYOA 5FHBH 5E6ZA 5MEQA 5FA4A 4IIQC 2A6JB 3U82B 3G5VA 4PJAB 1LNUA 5GRWA 3TESA 5F72S 2IBZX 4WENB 5DVNA 4PRIA 2E9BA 1LGVA 1D9KD 5GRJL 4PLKC 4BKLB 4S0SD 1NGXB 2Q20A 4XCNB 5IR1A 4WFHD 4Q9RH 1RUPL 4PJXB 1FFQA 1T22B 5T1DH 2R23B 5FKAB 4Y5YC 5BVJA 1BBJA 4PUBH 4BA8A 5BS0B 1KTDB 1C1EL 4K7PX 3DLQR 1GSMA 3VFGL 1BQSA 2L7UA 4H26B 4PLOB 4U1SB 4ZFGL 4ELKB 2VMFA 4EDWH 5MHSE 3MTRA 3HE7D 3MV7E 4R4FL 5KTEH 2VZOA 3BKML 4XHJC 4PRDB 5HGAB 3QUKB 2DS4A 4XVJL 1F42A 4JY5L 1KYOK 4WW2F 4Y4HC 2CMRH 3G5XA 2VABB 1BMGA 1OP3K 3BD5A 3B2UD 4PJEB 1IGIL 1NMAL 3SDCD 5ITFB 1DFBH 2YPLE 2NY2C 4CN6A 4PY7B 1MFEL 4D0BA 4DGVH 4YDJB 2JCCB 1KJMA 2DWEA 3PQYE 3WUWB 1RZFL 5L88L 4KQ4L 1HSAA 2YEZB 4MS8C 4Z7VF 4NRXB 4F7TA 5JHDD 5BXFA 1C7SA 1D5ZB 1E27B 3SOBH 2PR4L 3MV9D 3S97C 4FXKA 2PKDA 3HC0B 3RY4A 1A3QA 5DJ6A 1NCAH 3CX5J 2YKLH 2QEJA 1AO7D 3UROR 2VJXA 4JM2D 4LGRB 4BH8B 4YXKL 1AGFA 2CIIB 3ZDYE 2HFFA 5C0AE 3RTQC 1AP2B 3HC4H 1E4KA 1IC7L 2QQQA 1ZWIA 1GVIA 1D6VL 2DQTL 1I8LC 1M4KA 3S37H 4H0IA 5IB3A 5EA0H 1EEZA 3L3GB 2CK2A 5ACZA 5DD3H 4K3EL 4K3GA 3UTTD 4JFXB 3W11C 4DW2L 3NTCH 5C07A 5JNYA 2GYSA 3BH8B 1T83C 1WFTA 2CR6A 2GTZB 2FR4B 1AKJB 3QULA 1MRFH 2B2XH 1TJIL 2A9ML 4KI5E 2ICWI 1C16B 4NRZA 5TDNA 5FXCH 1CZ8L 3QO0B 4OZHE 2LAGB 2PNDA 1I9RH 2JELH 4DGIL 4MB4A 1U2HA 5FM8A 5C2BH 5AAWA 3R8BB 3S36X 1Q38A 2YS4A 1U92A 3MFFB 3AS3A 3ARXA 1QP1A 1R3HB 4OGAC 5BVPL 1GGUA 1EO7A 3TVMC 1KCSH 2B1AH 3TBVB 2EE2A 3CH1A 4PV8B 3PDDA 4HUMB 5C3TA 3PGDA 3VI4F 4TUKH 1CR9L 1ZA3B 4LCWA 1QBML 3MRFA 4PR5B 4N0CC 1RUKL 1UFUA 4X6CB 3RGVA 3V0AC 4D9QD 2LAAA 1XIWA 3PGCA 5I1JL 3DMMA 1JK8A 3O6LL 1EX0A 5E00B 1FZMA 1YEEL 2R0KL 4HC1L 4I48B 1U93A 4Z0BH 4XNQB 2BY0A 2R0LH 5EOCJ 3MNWA 5C0CA 2P8LB 3E6HB 1QFOA 5FGBC 1RJZB 2YPVH 5D7SL 1Z3GL 2E6JA 4FZEL 4GKNA 2D7TL 3D0VA 1EO8H 1FL5A 4POZD 1KB9K 3HUJF 1BOGA 3BVNA 4NFBA 4XP6L 1YN6B 1BIIA 3QWRD 4GG8B 3FQXA 3GBML 2BVPB 3BP5B 1WV7T 5D2NE 2FDBP 4RFNB 2VDQH 1DLFL 4PJFB 4GKZA 3BKYH 3QEHA 1JWMA 1BX2B 4J3WA 3NIGE 4OAWA 4YR6A 4YNYA 4D0CA 4EEEA 3CSPA 1DCLA 2AXHA 4JY6B 1I8IA 3ZTNH 4G80B 1FE8L 4WNQB 4FXLA 4CU8A 5DK2A 4HZLA 3Q5OA 5DHVA 1KT2B 3KR3H 1XGPB 4GG6B 1EH9A 1URLA 1BVLA 3H7BA 5B39G 3CXHJ 2HJFB 2D7OA 3C09B 3ULUC 4WRLA 5JPNB 5FB8B 1JBJA 4P5TA 4PJ5E 4HWNA 1F3DJ 4WCYL 3RIFF 4BSVB 3VGDA 4OLXL 3QFJA 4OFDA 4POYA 1SYSB 1A2YA 5F88A 3LKOB 3QPQD 4NKQB 3NOIA 2WINB 3MZGB 4WUUD 1VA9A 2H1PL 1WZ1H 5FUCC 3BH9A 3C6LB 3GK8H 2DI8A 1BD2D 2ZZUT 1P4LB 3QIUD 3CC5B 4FQCH 5C6TH 5EBLA 4LLWA 4ZPTA 1MCEA 2XY1A 5D9SB 4K9EL 1G6RA 4EUPA 4HPYH 2DD8L 3CFBB 4O2CA 2W59A 1R3KA 4N90E 1T89C 1T7ZA 3KPSB 5J1TC 4GAJL 5J9PB 2C4XA 5I8OH 3MA7A 2AK4D 3H3PL 4LU5H 3GMOB 5L8KB 3I6LE 3DV6B 4J23A 1OT2A 1JN6A 3L5HA 1JPSH 3OJMB 5ICZB 1DE4B 2ARWA 4DOHE 1RK1A 1UT9A 2FYYB 3D39D 3OAZK 2X4PA 1BQLH 2XQYK 2R0ZH 1EHAA 2FBJH 3ARDD 3GIVB 1RV6X 1QSVA 1T3FB 4FQXA 5HHMD 4OCXL 1X5HA 1FYTA 3GKWH 4U1GC 1BGXL 4PB0L 1UM6H 3CZFA 5LGHL 2VE6B 2X1PA 5TF1H 1FNGA 4MB3A 5FOJA 4ODXA 5JUEH 5FECB 4JKWA 3X17A 1F6LL 1EJ6A 5AWNH 4NGHH 3HR6A 2VDKH 1P6FA 5EORH 1OGAE 3QRGL 1BJ1H 4XXDB 3EDDA 5CAYB 5CKGA 3I85A 2A9NH 2DQJL 3D18A 3MLYL 4KROB 1U8NB 4E0RB 4LNRB 2BFVL 3OKOA 1ZT1B 1DQTA 5DQJA 1H3PH 3UYRL 3MLWH 1AIFA 4I77H 2E9JA 2PYFB 3B9EA 1RULH 4LPCA 1X7QB 2J12B 4QRSA 4Y8DC 3MODH 4AJ0A 4Y4KC 5M94B 2XN9E 3T2NH 2JB5H 1QR1A 2GJJA 3VXRD 4L5FL 1NKOA 4H8WL 1AQDA 4E41D 4Z7NF 1HK6A 1VESA 3IU4L 1ED3A 2VZSA 1B3JA 3NABL 4K71C 3QDGB 2RCSL 4ZS6C 4NNXB 3FB6A 4LCCA 2HLAA 2NXZB 4R26L 3WYRA 4M7ZC 4EBQH 4AT6B 4KZEH 5L7XL 1PVHA 5TE6L 4MLSA 3FQWB 2GY7B 4NDMA 4PRBB 5C08D 2CUHA 4MDIB 3U4AA 3EO9L 2QADC 3Q2CA 4NZJA 3H9HB 3FQRB 5F7UA 5IB4A 3QWOB 5I1CL 2IAMC 1U95A 4PJBF 4PJ7F 1PKQA 4X98A 2EICA 4EXKA 4P23C 2MPAL 1I7ZB 3EGSB 3U2SA 2CLRA 3UO1L 3MCKA 1JRHH 1NUGA 1LEIA 4O2FA 1OL0A 4W4NA 1D9KA 3F5WB 3IS1X 4WEMB 2WM0A 2GJ6E 2K1MA 5FOBA 3CMOH 1BWWA 1QFWI 4UV4H 4F7CA 4XCFL 3MLTB 4ODWA 1MCNA 5I74C 2P45B 5JA8B 5CJQH 4LVHB 4N8CL 4XWGH 2IMNA 1J9CT 4WFGD 5CIPB 2X4OA 5EG6C 5GIRB 4A2MA 1AC6A 1E6JL 5JA9A 2ZG3A 5E2TH 2HN7A 3SCMB 3WSQL 4Y4FB 3SE3A 4NNPL 1A6ZA 3HE7A 5J12C 2BHYA 3S34L 4Z7VE 3OAUL 4GQPH 1RZIB 5ITBL 4JFOA 5F3BA 4OD3H 4K2UL 1N5YL 1DVFB 5DI8A 2R1YB 3KWWB 3V6BR 1HYSC 5CS7A 4PTUB 1Q0XL 4IRZL 1N59A 4YO0B 4GRLD 4LARH 3WHE1 4Q9CA 5T5NF 4P46A 4XPTH 1S7WB 3N9GH 2ZWLT 2C7UB 3SDCA 4CMHB 3UJIH 3EJYD 3BXNB 2PTTA 2Y36H 2Z4QB 1NCWH 4JRYE 1CXLA 3BUTA 3HZMA 4X9FA 3KNBA 4L8DB 5DMIL 1EK3A 5TGBA 5IBUB 4KI1A 4JR9H 2APFA 5C3LD 3N85H 5JHDA 3EOTL 3ILQC 1DN0A 4EI6B 4JFQB 1T04A 3LKQA 4U1NA 1DBMH 5EU7E 2ID5A 3VFGH 1KCKA 3MV9A 5EIIB 3BZ4B 4E5XB 1FN4A 1NBZA 2DIJA 5E95B 4JAMA 1HSBA 4NM4H 3MJ7B 3Q0HA 4LSVL 2IADA 2GHWB 1AO7A 4GW4A 4JM2A 4IOSD 4NO3A 3P30L 1XIWC 4N9GA 3L3KB 3IVKA 2XPGB 3LEVL 2JB6B 3F7QA 3BDBA 2VLKE 3H3BC 4XZUA 5KSVA 1FORL 1JZ4A 4PP2B 2EYTA 2ITCA 2PO6D 4Z18A 1B2WH 1BREA 4PLJC 5EOTB 1IC1A 5K9QG 3LN4A 3ROLB 3CFCH 3PHQB 2O93L 3ARWA 2CIKA 4S1QL 3UTTA 5KBNC 4UDUA 4G7VH 2BSRA 2IQAA 3KHOA 3NIFF 3WEXA 3BO8B 4JQIL 4JFFD 1KACB 5FYJH 4B0MM 3P0VL 5KS9F 5C0NC 1VHPA 2BSSA 3WHE0 3VI4E 1DUYB 1EGJA 2MOVA 5KSBA 3SDDC 4K8RC 3DARA 3VFSB 4ZNEA 2V7HB 3ESUF 3EFFA 4I0PD 4JG0H 4X5LA 3PL6A 4LLUB 5KZCD 5DHXB 2PXYB 3F58L 2JE8A 2G60L 4QTHB 1N64L 1QRNA 3WBDA 4DVRL 4POUB 1RU9L 2J5LC 2YSSB 1CXKA 1S7QB 3MRDA 1RZKC 1F13A 5GHWH 5CEZE 5JDJA 2P5EB 4XP5H 3BZFB 4HJJH 4H1LG 5E8OB 4MVBC 3M07A 3UMTA 4KGLA 2ZSVB 3RWIB 1NGYA 1INQB 3HLAA 1I3VA 2Q7YA 3C6SA 3O2DA 4KTDL 1HHKA 3DO7B 4FG6D 5IEKB 3QI9C 4F15C 2PYEB 5TDOA 2YC1A 3V6ZB 4KKBD 3OHXB 4I18B 2I25N 3IDGB 3KXFE 4TN9A 4RIRA 1HILA 2D31A 4WU7A 5A40E 2ADFH 1Q9WB 4XNXL 3GSWA 2X41A 4R0LA 3HC3L 2X9XA 1CLZL 5I8KL 3SDXE 2QQNH 1CE1L 3LEYH 1F4WL 4LMQE 1CFNA 1M7DA 4F7PB 1HH9B 3JV0A 2CH8A 1WICA 4XCCL 2P5WD 1MELA 3AY4C 4QHMA 3RWHB 3ZHKA 5JW3H 4WWKC 1CDBA 3IDUA 1F4XH 3KPNB 2DQUL 3NFPA 2OBGA 3SJVB 3RY6A 4U49A 3HAEA 2EH8H 1CDCA 4IHOB 1S7RB 5GS0H 1QBMH 1SY6L 3D69A 4FQXC 2A73A 2X1OA 5T3ZL 3LZFH 2MNUA 4PGCB 4YHNA 2VKWA 5E9DE 4I13B 3DHMA 1S5IL 2EYSB 3FAXA 2NY6B 1QQDA 3CVIL 3DVNA 4M61A 2BVQA 4OUOA 5SWQB 4GAGH 3I6KB 3QDJB 1P9MC 1PKOA 2WSKA 3P73A 1XF4A 5ENWA 3GSVA 4PS4H 6FABH 2F8VA 4KMTH 5HJ3B 2CKNA 3UX9B 4MJ5A 4ENEC 1U0QA 1QVOB 4HIJA 3RDTB 4OBSA 3HS0B 1R24A 4WUUA 4XXCC 1J1PL 5CUSH 2BNRB 3BPNB 3O3BB 4H0HB 1BD2A 2Q1EA 4I9WD 4XTRD 3QIUA 3CLEL 1TZGL 3HZKA 4UTBH 2VDPL 4KQ3L 1JPFA 1T7VA 4M1GH 2DQDH 1CICB 4PRHA 3X3GL 4MQ7B 2JJTA 4OCWL 4KZDL 43CAA 2HFEB 5DD0H 5GGRA 5DT1H 1S9KC 3VJ6A 2AK4A 4LCCC 1XT5A 4N8VB 4CVWA 1I7UA 1I8KB 4OLYH 4LRNL 4O9HL 5FKPB 4EI5D 3MRMA 1I3RB 3NZHL 1K4CA 1CBVL 3D39A 4PRPE 1H9VA 1TPXB 3SGJA 1P84K 1ZK9A 1LD9A 2ZCLL 4PJGF 4UIKH 4UI2A 3ARDA 3E6FB 3UP1A 1CVRA 1U8HB 1OTUD 2HJLB 4RGMC 3SY0A 4MX7A 3BEVB 1YEIH 5LJYH 3CDCA 3V9FA 3GSNA 5J1SC 3IXTB 1J8HA 4MA8H 3K2UL 2NY7H 5DWUH 4YHYB 2O5XL 2OI9B 1QBLH 3MRJA 4J7RA 5F89B 5JXEC 5L9DL 1ZEAL 1IBGL 2V6HA 3K4DA 32C2A 4Z7NE 5H35B 3ALXA 4ZUVB 4NQDE 3MRLB 1CF8L 1UKQA 3MV8B 4N0UB 2HT2D 1NAMA 1EEUA 5BV7B 4IBLT 3HKFA 4PB9H 4GAJH 3EFDH 1OF2B 4HBCL 1CQKA 1BPVA 1T7XA 3H3PH 4H20H 1D6EA 4MNGA 3O81A 1HNFA 4Z77A 4PREA 1EAJA 2ORBH 5IQ9B 5I18H 4H25B 4WTXA 1LK2A 3QB7C 4U6YB 1RMFH 2VL5B 3QAZB 4JZNA 1ORSA 3SE3C 1CGSL 2ADJB 3VXRA 3OKDB 4PJ7E 3BGFC 3L7FB 2PW2B 4FTVB 4UINL 4E41A 2EKJA 2YK1H 2EH7L 1H3VA 2Q3AA 5BS0D 5HI5C 1WFUA 4HH9B 4HLZG 4R96A 5K9OA 3UTPE 1NEZG 3V6OE 3B9VA 5I15H 2AEIT 4ZOCA 2X4SA 1WSST 2BOCA 4R4BB 3B2UC 4P46C 3FN3A 4LVOB 4OFYD 2F5BH 5DJ2B 1XGUB 5C08A 1K8IA 3V5HB 3CPLA 1KCVH 1YYLH 1HKLL 3JTSB 5ILTH 1A6UL 1ONQA 2ZG1A 4R3SB 2W38A 3BIAX 2BFVH 1E4XI 2XNAB 1SJEB 5I1HL 4EN3B 5IW6B 5TPWH 2YA1A 5DUMH 2Y5TA 2AEWA 4XPBH 2NW2A 2MCPH 3LKSA 4IRSC 2EEBA 3L3DB 3OKNB 1FFNA 3Q5YA 3GB7A 2DDQH 1RUML 1F97A 2Y06H 5K9QI 2EECA 1D5XA 2IEPA 2AXFA 4WGWB 1MCQA 1R5IA 5E6ID 1MWAB 3MNZA 1HINL 5IHBA 2B0SL 1ZTXH 3WNMA 2OXHA 2WBJB 2WQRA 1Q94B 1DQJB 4YHOH 1T20A 2OSLB 2V5YA 4X7SL 1EAPB 4LSRL 3P77B 5IGXH 3KPLB 1FHGA 3QCUL 2D3VA 4N0YH 1RUQL 4HUUB 4NYLB 5C9JA 1SVZA 5DQDH 2ITDB 4HT1L 3O4OB 5EU4B 4GRLA 4ORGA 2Q3ZA 1MEXL 2QL1A 4UOJA 5DJCB 2P1YA 1KLGB 5B38A 3LHPL 5LWYL 4F8TA 2RAMA 1DBKH 1C12B 3L9RA 3RVUD 3FRPA 3PL6C 4V1DE 1AKJD 1CD9B 4XNMA 2XWJA 3DX9B 5AUMA 2RFXA 3WNPA 2A2QT 2Z91A 3H7LA 3MV11 3CCHA 1TQCC 4L4VB 2IG2H 5DLML 1FL6A 4MD4A 1GH7A 5ANMB 4YDLC 4L8CA 3U4BH 3FOMB 5ECJE 1V3KA 2GK0A 4ZFOB 4JG1H 1IAKA 3NIFE 1EFXB 1N4XH 3GSOB 2WP3T 4IMKC 1YA5A 1I3GL 2Q7NA 3T2OA 2AS5M 1V05A 5KS9E 4BFIB 2AI0L 1K5NA 3MROB 3IFOA 1S7VA 4U3HA 5HYFA 3NMEA 3INUH 4GMTL 3RL2B 2PO6A 4R0LC 5ID1A 4WHDA 1MJJB 1OAXH 2X4QA 4PJAE 5TE7L 4OF3A 1AGCA 3QCVL 1KJ2A 4OQTA 1Q0YH 1TQBC 1U8QA 3OXRB 5DTFB 3U30C 1CE6B 4JFFA 1XF5B 5EZOL 2EIEA 1R3JB 1FJ1A 2CLVA 4O2EB 5D7JC 1AHWA 4KGJA 5JOEA 5GS2D 1R5WB 1LILA 3RY6C 4M6NL 1QLFA 1PZUB 1E6OL 4I0PA 4X9GA 1UQSB 4MA3A 4U7MA 4K7PL 1EEYB 5HYIA 3D9AH 3DRQA 5BS0E 4HKBA 3IT8D 3WFCH 3MLUH 5FYKL 1JF5A 2VXTH 2XT1B 5F7DA 1UA6L 3CXHK 4UBDD 5E8EA 3BIBX 1M1SA 1VPOH 5K9JH 3B5GA 1MLCB 1MCCA 4M3KB 3RA7H 1YMMD 4M93C 1M71A 2E27L 5IK3B 1CFQA 4KDTC 3TYGH 1H3UA 1R5VA 3TNNB 1CLOH 1F4AA 1CXHA 5T1MB 1CI5A 4LVNB 4U0QB 4Z7WF 4Q0XH 2YMXH 1WBXB 1EGJH 5J89A 4MQSB 3T2PA 3HNSH 2ZKHL 1MCIA 4OCRH 4AH2A 4Y5XA 2H26A 4MJ4A 4XP1H 2J6EL 2A6DA 1RUAL 3S6CA 3T3MF 1LP9F 1E4WH 2PCPA 1LO2H 5IG7A 3IRPX 3VH8A 2GQHA 5IVZA 5D1ZB 3C6LD 3S4SB 3ARVA 4KUZH 4PTTA 4D8PB 1W72A 2W9EH 3BIKA 4PJCF 4WEBH 5GGSA 4YZFE 3I3BA 2P5WA 1LHZA 1VGEL 2WUBH 4NUJA 4ACPA 4JHAH 5IFJA 3DVGA 3PV7A 4Y19B 2ATKA 2J8HA 5GZNC 3KPSD 4JVWA 4ALAH 2D7NA 3CSGA 3GMPB 3SGJC 5I2IB 5L2JB 3IU3B 3QZWG 3PJSA 4C57C 1J05B 5IOPB 1VFAA 4TSAL 3QXWA 1PYWA 2VDOL 5EDXA 4XBEL 2VXSH 2XZCH 1DBJH 2DWDB 1X44A 4OM0L 1RZ7H 3FO1B 2OLDA 5FK9B 5DO2C 3LEXB 2CDEB 5HYSA 4C54A 3P4OA 3MLZL 3QEGL 5EUKA 5TQ2L 3O2WL 3PGFL 4NQEB 5DYOB 4AMKH 1OSPH 4OLZH 1Q8MA 3O45A 2VZ3A 3I50L 1XH3B 2WIMA 5D96B 1CDJA 3HE6C 5GGRY 1BZ9A 5HVHC 4LVEA 3OJDB 2P44B 4AY0A 4GW5B 2OR7A 4FOMA 4L9LA 5DUPH 5HHXH 3O8XB 3KJ6H 4BZ2L 2J1KA 3VG9B 1OPGH 3SE4A 4X8JB 4DCQB 4YHML 3FQUA 1ZHBB 5I76A 2JTDA 4PJGE 4I2XA 3SO3C 1F45A 1JNHA 4MHHG 4NN7B 1YY9C 1ZSDA 4KROD 1UXSA 4ZQKB 1UJ3A 4OZIB 4GW1A 4P2RB 5IBTH 4MCZA 2P24B 4NBXB 1SY6H 2GT9B 4QWWD 5I17B 2EE9A 3JV6B 4KKNA 4NSKA 5HI4C 1FC2D 4G42B 1IQWH 3R1GL 3VFWB 3FFCB 4EI5A 4X6CE 4HAGA 4YX2L 4OZ4A 3ZYOA 4YIQA 4XBPA 1RZJH 1IC5H 3QDGD 2W1NA 3FB5B 3HCVA 1BFVH 3O3EB 5I75B 4HCRA 4OZFH 1Y6MR 4MZ2A 2R4RH 4JQXA 3GUTB 1R3LB 5SWSE 3S88H 3GMQA 3VFUB 4G6KL 1NCBL 1WF5A 1QTYT 1MHPH 3UJJH 1U8JB 3FONA 1OARH 4YQXH 2QQKH 4K94C 1MJ8L 4J4PD 4DQOH 1YEKL 1RHHB 4D9RD 2FJFB 4RWYH 4C56B 2A6JA 2EDXA 2X40A 1Q9KB 4KZDH 2LTQC 4QXUH 1UYWL 3MCG1 3WDHA 4KAQH 4D94A 1DR9A 4WI2A 3VFVB 25C8H 2A77H 2Q6WB 4BKLA 4JDTL 1UWGH 1NGXA 3NGBC 3WFDL 4BZ1H 5EU6B 4XCNA 3PXHA 2XA8H 2VDNH 4MDJA 4PJXA 1WEJH 3FRUB 3I3EA 4GRWB 4RWHA 4Y16B 4WI5A 1T22A 3VFPB 3GSNH 3WFHA 2R23A 3H9ZA 5IVXF 1CFVH 5FKAA 5MEPB 3D3VE 1M7IB 2O5YH 3EHBC 3WNOA 3HRZA 4PV9B 5CEXB 2X4UB 2MHAB 2MCG1 4YGVB 1U58A 4G7YL 4XVTH 3SCMD 4XVSL 4XPAH 4H26A 4Y4FD 5E24E 2F54B 8FABB 4HQQH 2CK0H 3OR6B 3ISWA 3G5ZA 5CINH 1ZEAH 5FCUL 5HGDA 1JGUL 4F7MB 3DUHA 1OOAA 1JJUA 3TWCL 2Y6SD 4XPHL 5F8QC 3U7YH 1JZ8A 3SO5A 5IMLB 2OZ4L 2GFBB 4XGZB 5HGAA 3QUKA 4KK8C 1NANH 2VABA 5DVOA 1BIHA 1O7VA 3LD8B 1U8OB 1YC7A 2AV1B 1NBYA 4NKOB 4PJEA 1OAZL 1LE5B 5ITFA 3MRQB 1LVEA 2BY2A 4PY7A 3FZUD 1LQSR 4OSUH 3UXFA 3KYKH 2JCCA 1PG7X 4XPFH 5FUZH 5I0DA 2FEDC 4TULL 3WUWA 2KBGA 2Q8AL 2DLHA 1A1MB 3TLRA 1GPOH 5C70A 5CEZH 5C0EA 5E6IA 1D5ZA 4UQ2A 3CH8A 3U83A 2BZDA 4PGZA 2BXYA 5FGRA 3V7AE 2QSVA 3L1OL 2C26A 5FYLD 5I8EA 4RMUA 3T8XB 4ONGH 5JIPA 3QUYC 4JB9L 4FFWC 1VFOA 3OV6A 4UMGA 3NH7L 2PO6C 3PWUA 2CIIA 3LCYA 5DJXB 5GS1C 1GYAA 1I75A 4LGSB 3VFOB 5GGQH 4JLRA 1UWXK 1AP2A 4ELMF 2R15A 3FHAA 3DRTB 1MCWM 3GBNH 2J8UF 2F58L 1HI6B 3T4AB 4IIQB 5JXAL 1JPGB 3NFSL 1MCJA 3RUGB 4FMKA 2OJZL 2YA0A 2LFGA 4HWBA 4YBQD 3KYMB 3HNVH 2DKSA 2W0FB 2HVJB 1A22B 3SPVB 4JFXA 1OD7A 4I0PC 3BH8A 3C5ZC 2HMID 2UZIL 1VADA 3HI5H 4HC1A 3RPIA 2GTZA 3L6FB 5KVEL 1AKJA 4YWGH 3UTSB 1DANU 1MHCA 5E8PB 3PWNB 1C16A 5FGSA 4O51A 4JRWA 2BVOB 4EIZC 3O41B 4Y5YB 3DIFA 1RIHL 3PWVA 2D0GA 1BQHG 5EFIB 2H45A 3MRCB 3MRNB 1R3HA 4RCAA 1H8NA 4LSRH 3GDBA 3TFKD 3BHBB 1JZ3A 2NY5H 1NGPH 2P5ED 3D5OF 3TBVA 4C4KO 4PV8A 5CILH 1OCWH 2BVEA 4U2ZA 5E2JA 1VGKB 4NWUH 4Y4HB 1S7UB 4PR5A 4M6ML 3NPSC 4J6RL 2IQ9H 2A6IA 4N0FB 4M5ZL 2PYED 2NY2B 4GFTB 1ZOXA 5E00A 5DZNA 2C4FU 4FP8L 2AERT 2BSTA 3HG1E 4XNQA 3A67L 4LSTH 1OGTB 2P8LA 3E6HA 4L4TB 1RJZA 4LNVA 4QT5A 3EZJB 5IM7B 4X99B 4M1DL 1N3NA 5IBLD 1IFHH 1FIGH 3IYLW 4IOIA 4PP1D 1YN6A 4MGXA 2IBGA 4DTGL 1QYGL 2BVPA 1N26A 3WE6B 4NQXB 1YEDB 5E2WL 4PJFA 4PG9B 3TF7C 4YHZH 4JHWL 3RTQB 3T3ME 2B4CL 4KY1H 1G7PB 4WI3A 3E8UH 2EYRB 4RGOH 3MLVH 3SE8L 4QRPE 2O61B 1QSFB 1QA9A 2GITB 1FIEA 4JY6A 1A5FH 1FVDB 4MHHI 1YMMA 4WNQA 2J7LA 1S7SB 3MA9L 1VEPA 3IETA 4HIEB 4OQTH 2XWBB 1SBSH 2BVUA 1KT2A 4QXTA 4R8WH 4GG6A 1FNFA 4XCEB 1FRGL 5ETUB 1JGEB 3OKKB 5GGSY 2NY6D 3WFEL 1T66C 5JPNA 2ZJSL 5FB8A 1HZHL 4L9LC 4PJHF 3RY5A 3FQTB 3LS4H 1MUJA 3E0GA 4NM8L 3QDJD 4BSVA 1YEGH 5JOPE 2CD0A 1HYRC 3W5NA 5B3NA 5JDSB 1HNGA 1GAFL 2E8YA 3DOSA 1MCWW 1MAKA 3RDTD 3LKOA 2WINA 1NFKA 1Q72L 3M8OH 2AEQH 3C6LA 4YE4L 2BNRD 4WI6A 1P4LA 2OJEB 2P49B 3CC5A 3ZKMD 1P2CB 2R0WL 4OGXH 1CD1B 3EYQC 2IALB 1JYVA 5FYLE 3PABB 4I5BA 3CLFH 3CFBA 3TVMB 3JV4A 4C55A 1CICD 1XCQA 3KPSA 5L2KE 2EE6A 2DTML 4HUNB 3BMVA 4GSDH 4DZBB 3IFLH 3T04D 4YAQB 3B3IB 3GMOA 1M7XA 3JWDL 4KTYA 4WIQA 4Z9KB 3BZEB 5LAXB 4JQXC 3DECA 4HBQA 1U8KB 1DE4A 3BUYB 1U3ZA 2DIBA 2FYYA 4OLUH 3M1BB 4OJFL 3WIFB 3HNTH 2R4SL 2X7LB 3GIVA 2FX7H 1T3FA 3AS2A 1JPTH 3ULVF 5IROA 4HX1B 1MVUB 1RIUH 3QEQB 3S37X 2XACC 4ZFFB 3MRRB 5FECA 1IM3B 3TC9A 3D6GA 3SQBA 4KK5C 2UYLB 4OBRA 3CNKA 4CBPA 1O5DT 1LO3H 2AKRB 1BM3H 2IH3B 3IJYB 4XXDA 4D2NA 2FCBA 4XMPL 5J11C 2WLYA 1NL0H 2A1WL 1YPZB 1F6AB 4LNRA 5JOFA 1PD6A 1QRKA 1RIVL 1ZT1A 2GUOA 1F4HA 4OT1H 4HMDA 5HY9B 3L3OA 4TNVK 4UILH 3OXSB 3T65B 4K3HA 1QFWL 3QO1B 3Q6GL 2YXMA 3C60C 1H5BC 1DZBA 2N7AA 5E8NA 3GMMB 4FTVD 3QXVA 8CGTA 3O2WH 4X6DF 5CD5C 3QDGA 3TN0C 4RAUA 4NNXA 4X9BA 2KPNA 3G6JB 4ZAKC 35C8L 4FQQB 4LBEB 3MRIB 4O00A 3Q1SL 1FPTL 4TTGA 1GL4B 4JJHA 4P3DA 4MDIA 3S36H 4JN1L 2CKBH 3PHSA 4J4PA 4O02L 4U31A 1GZPB 5IB2A 1J1OH 5D7LD 1IEBA 5DS8B 4ONOA 4P57A 2AJUL 3NACL 3NCJL 4HK3N 3GHEH 5E6IC 5A16B 5CHNA 4A6YL 3EGSA 4LCIH 2V2XB 4JKPH 4AYFA 2ZUXA 3SJVE 3GMRB 3F7YB 1UM5L 1F02I 4HCRH 5DUBB 1K3ZA 4X6BB 3ULUL 1D3CA 3EDKA 3OR7B 3MACH 4LLMB 4DKEL 1KLUB 1IGYB 5D72L 3MXWH 5CIPA 4ZS7H 3BP6B 4U6VL 4U1GB 5JR1L 4S1SL 2F74B 2WBJD 1SM3L 3V7MA 3G5VB 1YECL 1KB5L 4I3GA 3SCMA 2EDLA 3CUPB 4Y4FA 4IRJC 3W9DA 2LVEA 2HTKC 2FX8L 2KH2B 3PWPB 1U36A 4ZFZB 1MJ7H 1RZIA 2GW5A 5HPOA 1JRHI 4X80L 3T0DA 2IGFH 1AE6L 2H6PB 2R1YA 3KWWA 4YO0A 5KG9B 1WAAF 2YN3A 3OKMA 4KHTH 3GSUB 1DQQB 4QRUB 3BD3A 4Z78B 4XVUC 5DHYB 3BXNA 4EUPG 2CQVA 2Z4QA 4Y4KB 3LPFA 5HGGS 3RVXC 1EZVX 3O2VH 3B9KA 4U6HB 4ERSH 1AGDB 4ONFH 1O0VA 2ZUUA 4C59B 4GO6B 4XI5D 3MRBB 3QEUB 5FO8A 1CFTB 4JFQA 4K71B 3VD7A 2MJWA 5EIIA 3BZ4A 4E5XA 4WY7L 5FF6B 3V52L 2BK8A 4NQUA 4YDVB 1IGTB 1T2QL 4M7ZB 3W0WD 3VWKA 3G5XB 4JPIA 1EFXD 2F53E 5FYKD 1GGCL 2NCMA 2XN9A 2X89D 3G6DH 3FN0H 2IWGA 2VTFA 3L3KA 3ETBF 2QADB 2NZ9D 2KZ1B 4KJPD 1H3TA 1KJMB 2IAMB 2YD4A 4KRNA 1A0QL 2WAHA 2NR6D 4P23B 5EOTA 3MV8E 4N0UE 1NMBH 3BKCL 4HS6A 1VKXA 1YNTB 1KC5H 3QUZC 2C3GA 3BO8A 3UJTL 4YFEA 3DYMA 5D1XC 5I74B 3LMJL 1AGFB 2HFFB 3IJSA 1DUYA 4OI9A 2KQNA 5CZVL 4K9EC 4TRPL 3RQ3A 4HKZB 3RAJL 3VFSA 4OF5A 2V7HA 2HRPL 2Z31C 1ZWIB 4OIIH 4OLWL 1ZANH 1QZ1A 2QSCH 4GBXD 3VXUA 5IB3B 4QRRE 5J12B 1S7QA 2YSSA 1RZGB 4NT6A 3WHXB 4CVUA 4WFFD 4KJWC 5GJTL 2P5EA 3ARTA 3WS3A 4YJZL 4WW2A 5E8OA 3BZFA 4L1HA 2R56L 2VZTA 5HHVH 3WJLC 1WWWX 4FFVD 2CRIA 3IAGC 4YHLL 4QRQB 3RWIA 5TDNB 1INQA 3W5MA 1PSKL 3RIAK 5EZJB 5IESH 3MXVH 4JFDB 4P2QE 3DO7A 5IEKA 2NZIA 2PYEA 1KENL 1IC4H 3KLAB 1DN2A 1N6QL 2YD9A 2BX5A 3OHXA 2NYYC 4I18A 3IDGA 3DXAB 1NFDF 2X10A 5HI3D 1MRCL 3KPMA 2IFFL 3TCLA 1L7IL 3IKCA 5GRVK 3F7VA 3EO0A 3JVGA 2VWEC 4KI5C 5D1ZD 2IBBA 1CGYA 1RI8A 1HH9A 3AGVA 4LCWB 4M4RA 4Z7UF 4PJHE 3T0EA 1FLRL 4JRYA 5BZWB 4DKFL 2OS7A 3HMWL 3LS5H 1XIWB 3WL9B 3EBAA 4Y19D 5HDQH 4F3FB 5JQ6L 3TH3T 1JK8B 3KPNA 1FZMB 4OKDA 3PUCA 4H8WC 3RNQB 1JNLL 3MNWB 4JM4H 3MJ8B 5IROC 5IFAH 4GKNB 5F9JB 2AJSL 2AGJH 3AREC 1BOGB 2EYSA 1MFCH 1IAMA 4NJAL 3ESVF 4FFYH 3FQXB 3N0PB 4OUUA 5SWQA 3I6KA 4NQED 3QDJA 3KG5A 1JGVL 4QGTA 1AI1L 3QEHB 3U7WH 3WKMH 2M8XA 5HJ3A 3SDDB 4ZTOL 2NMSA 2R9HC 1CCZA 2EDKA 1QVOA 3RDTA 2D4DA 1TZHA 4Q6IC 2DF3A 1A6PA 2BNRA 3O8XD 1VERA 3O3BA 4L4VE 4MNQB 4WHCA 1U8LB 5IT2L 4HZLB 4I3SH 3O6KH 5DHVB 4MSWA 2EDDA 3S5LB 5F6HJ 1X4ZA 2VDML 4NQTA 2J5LB 3UPRB 3ULVE 1CL7L 2ICCA 4HS8L 3AM8C 4P2RD 4XC3L 1CK0L 1CICA 5HHOA 1JFQL 1X5FA 4MQ7A 5BOPA 5GGVL 2CO6B 4O4YH 3MJ9L 4P59H 4N8VA 3IDYC 1A2YB 4XAWH 4XP9L 3MOAL 1I8KA 5EUOB 5F88B 5FKPA 5DDHA 5D7KE 5H94B 3QI9B 5DRZB 4F15B 1MY7A 4RNRA 1I3RA 1AFVL 3BH9B 2C3VB 4ESKA 5AG9A 5KANG 4OZGF 3MLXH 2WBWB 4YHIA 2NTFB 1G9NH 3E6FA 2QQLL 5DEFB 1RQ5A 3F6IA 4AQ1B 1G6RB 2HJLA 3E1F1 1EIBA 3HUJA 4K8RL 4XAKD 2XTJE 3BEVA 3WNKA 5C0BE 5HDLA 1AJ7H 4N5UA 4UT7L 3MA7B 4PYHA 5F89A 3DURB 4OTXL 2VR5A 5K59F 5H35A 4WWKB 1MIEL 3MRLA 4X6DE 2WUCL 1B9ZA 2AJ3B 4C56D 1E4XL 1AQKH 3MJ6A 4WFED 1RK1B 2DTMH 1OF2A 3RWFA 3UAJC 1REIA 4TNVF 3MOBL 2J2ZA 5CSGA 4FQXB 4PPTA 3WXWL 1MCSA 2KDGA 1FZJB 1CXFA 4LLQB 5IQ9A 4NZRL 4LAQL 3CZFB 5EU6D 4H25A 1FNGB 5LBSL 4BQ6A 3GRWL 4M7KL 2O5ZH 1L4IA 2ADJA 3T0BA 3KLHC 3TZVC 3I2CH 3OKDA 3I02B 3L7FA 4FTVA 5DK3A 2P7TB 1NC4A 4PGDA 4JHBA 3G9AB 4KMLB 2H2PC 1WLHA 4JKLA 2KKQA 1OTSD 4LOUD 1V3LA 3D18B 3DETC 4HFUH 1CIDA 3HI1B 4FFZL 3QHFH 4PIRF 2ZCKH 2F54D 3T77B 3NA9L 2DM3A 5J4MA 2OQJB 3H9SB 4R4BA 3GNMH 2OR9L 2UV3A 5DEZA 1YYMH 5DJ2A 1XGUA 1C5BH 1BF8A 4M43H 4ZUSA 4QRSB 3HPJB 4PRAB 4XMPH 5DURB 2XKNB 3GJFB 3JTSA 2A1WH 4LSSH 4R3SA 3B9KC 5D7LA 1QR1B 2XNAA 1SJEA 1UWEL 3SBWC 5IW6A 1DQML 2I9LB 2GY5A 3L5WB 2RB8A 1YEJH 1YQVH 3L3DA 4JFZL 3OKNA 2E7HA 4LCCB 2HLAB 3B4NA 4QOKE 3RNKB 3VWKC 2F19H 2NX5D 3LRSB 1FO0L 2FWOB 4NDMB 4LHJB 4J8RA 1MWAA 2ZUVA 1NCCH 1QNZH 2IH1B 1CXEA 1H8SA 4ZSOB 2VIRA 4KK6D 4OFIA 3H42L 4F58L 1K85A 4RGMB 3OX8B 2WBJA 3QQ3B 4TSBH 3Q1SH 1KELH 1Q94A 5LCVH 1DQJA 3IJHA 1LO0H 5HBBA 2AP2A 3BYYA 5D5MF 1EAPA 2CLRB 4O2FB 4O02H 4JO3L 2VH5H 1KFAH 2Y07L 1TCRB 1FYHB 4HUUA 4NYLA 3S96A 5INDA 4HIIA 2ITDA 1YNLL 4YBLC 5CCKL 1PX4A 5EU4A 3G6AB 1MLBB 1OM3H 1KLGA 3W82A 3P0YH 3U0WL 1CTNA 1MFDH 4OZFG 3STBA 3X13A 4OZIE 5MP6L 2GK2A 4P2RE 2BSED 4PLKD 1UM5H 1C12A 4JFEB 3IDXH 1J87A 4NCDA 1OAUL 1QSZA 5CMAB 4TQEL 1XR9A 2ZPKL 3UTSD 2AQ1A 3DX9A 1A6ZB 3ULVL 3BGFB 2DICA 5D72H 1K3IA 1UZ6F 4H88L 3FFCE 5F3BB 4WW2C 5ANMA 3FOMA 3GEWB 4J3VA 3O9WC 3ZE2E 5F7WC 3W0WA 2CR3A 1A6AB 2R8SL 4UB0L 2FO1A 1EFXA 5KW9H 3GSOA 3ZHDA 4OCSH 1FQ9C 5EC1A 4P46B 3RVVC 2X89A 1G7IB 1G9MH 4XAKE 4XHJD 5T5FL 4BFIA 2Y1VA 5GZOC 4XNYL 1JUFB 3MROA 3WO4C 4FNLL 4PJBA 3WJJC 4LKCB 1CQYA 1QHOA 3V8CA 5TGBB 1OW0A 3C08H 4Y4HD 2C1OA 3GIZL 4UOW0 1P7QA 3VXME 4R7DB 3RL2A 4XNUH 1MJJA 1DN0B 3KVQA 2Y72A 2LQRA 3LKQB 4IRSB 2AXGB 2HVKA 4U3XA 4NPYB 5D2LB 3GHBH 1HSBB 3OXRA 2J6EA 4JO4H 1INDL 1CE6A 1XF5A 5FYLH 1XGYH 3OKEA 4MS8D 4F8QA 3T0EC 1JZ2A 1FGVL 4NO3B 1R3JA 4O2EA 4MXQC 1UCBL 5F7EL 1FCGA 1WISA 1J86A 1R5WA 3PHOA 4F33B 1KXQE 4NN5C 1UQSA 5HYQA 5KSVB 1BFSA 1EEYA 43C9A 5EU7C 2OX5A 3FJTA 4GBXA 3CXDL 1JF6A 3B43A 3SDAA 4P2OC 1NFDE 5DD1L 3OPZH 3F6LA 2CIKB 1DBAH 2QHRL 3UTTB 2M26A 2BSRB 4NQCE 4JE4B 3CU7A 2F54E 1BJMA 1EUTA 4NZDA 1QSFD 1MLCA 3M17A 3WEXB 1IVLA 4G6FB 1ZXQA 2ICES 1JYWA 5IK3A 4YPGA 3RIAF 5L6YH 3EAKA 1RK0B 4PJIF 4NO0B 2BSSB 3FQNA 2OK0H 1L7TH 5ADPH 5E99H 2F5AH 1OQOA 4Q7DA 5T1MA 4Z7UE 5HGHB 1KCRH 1DL7L 1CDYA 3I75B 4OD1L 2FEEL 3EFFB 2XKSA 2EC9U 1MRDL 2FX9H 3R8QA 3PL6B 3ZKMC 4TNWK 1J0HA 1PG7L 1QRNB 4JZJC 2P8MA 4ZD3H 1LO4H 1TQCB 2GCYA 5KANI 1IGML 5IW1B 3BP7B 3GBLA 3VW3L 4YDLB 3UEZA 3S4SA 2HKFL 1FAIH 1RFDL 4D8PA 3PP4H 4OGAD 4R97C 1NGYB 4HHAB 1C08A 3TV3L 1XF2B 3O4LB 3MRKA 1KIQB 3FB8B 3A6OA 3TVMD 4Y1AD 4ODUB 4Y19A 2ENSA 2I60L 3KPRA 1OT1A 2VXQH 1MNUL 2YC1B 2W9DL 1OAQL 3GMPA 4LKXA 5I2IA 3IU3A 3TJEL 3WFBL 1HILB 4WU7B 5DC0A 4LEOB 1KLFA 2NY3C 4N0CD 1XMWA 3BSZH 1CFBA 3GSWB 1YC8A 5SWZE 5J1AB 4R0LB 2CRYA 1KEGH 1EHNA 4YXLL 4RA3A 2DWDA 1MFAH 3KAAA 4FRWA 4DAGH 3FO1A 4RBPH 5D71H 2CPCA 2CDEA 3VG0H 1RURL 2R2EA 1TQBB 3U30B 1LK3H 5DD5L 4X6FA 3V0WL 5B38G 4NQEA 1Z9OA 5DYOA 1AXTL 1EHLH 3QEQD 1MFBL 4LEXH 3O3AA 1XH3A 5D7JB 2Z8WC 3GI9L 1U3HD 1X5XA 3OJDA 3HAEB 1VFBB 1SQ2N 4GW5A 4FQJL 3QDMB 3VDAA 1FV1A 2IPUK 4KVCH 3VFMB 4CDHA 1ZLSL 1FZKB 2VLJE 1HEZB 1J18A 4X8JA 4DCQA 1ZHBA 1MI5B 2BOBB 1EBPA 4XC1H 4ZQKA 5C09E 4NRYB 3CVHL 2CDFB 2J88H 4KDVA 2ESVD 2P24A 1BQUA 4M93B 3V5KB 4P5MB 1EPFA 2GT9A 1H3WM 3BEWB 4IEFB 4XBGB 3RP1A 5I17A 1T5WB 3RZCD 3P73B 4W4OC 3RWJA 3JV6A 4P9ML 5JW5A 2A38A 5KVMC 1TETH 1I85C 5KVDL 4G42A 4MJ5B 3QHZL 2D9CA 1I1AC 1QD0A 1YQ2A 1JP5A 1CGVA 3DUUB 3WMSA 1MY5A 4X5XA 1R24B 2VXVH 5BW7A 3DGCR 4LLYB 1ZLVH 3ULUD 5CGYC 4QXGL 3FKUS 5HYJE 3BDYH 3EOYG 1BD2B 4HGKC 2EXWC 1A14H 1PX3A 3FB5A 3QG7L 2NY5C 2Z93A 4PBWD 5C71A 1MFNA 1FGNL 3O0RH 1U3YA 2AVGA 5FHBL 5SV4A 3GUTA 1R3LA 5I1LB 4L4TE 4JCMA 3VFUA 4X4ME 2N4IA 2IANA 2VLRA 5AYQA 1OAKH 4PRHB 4G3YH 2CXKA 3TT3H 4TVPE 43CAB 1U8JA 3B9DA 2DBLH 3Q6FB 2AK4B 2EDHA 5FAAA 2FJFA 2OZ4A 4YEEA 1JPST 3QCTH 4C56A 4Q9RL 1DQDH 4XC3H 4MMZC 1MCFA 4JN2B 3RVWC 4DK3A 1Q9KA 3KPOA 1I1FA 3QNYB 2X1XR 4EQ3A 4NKMB 4M3JA 2A83A 4PUBL 3S3PA 3VFVA 3U9UA 1IRAY 5T3XE 3SY0B 4HPOL 3WXVH 3OWEA 5EU6A 3RBGA 4K7FB 1J8HB 3FRUA 3GMNB 2ICWA 4Y5VC 3CMGA 4EDWL 3UC0H 1ES0B 3VFPA 1J0YA 1F5WA 4X5WA 4U33A 1NBVH 1M7IA 2IMMA 3UBXB 5KTEL 2EKSB 4PV9A 1S3KH 32C2B 5CEXA 2X4UA 1NAKH 4RMWA 1Z9MA 2W60A 5TJWK 4GH7B 4YGVA 3CD4A 4EZMA 1YEFL 2Z0BA 3HE6B 4P49A 1T03H 5HVHB 2CMRL 4XPGH 3L3IB 3NIDE 8FABA 5BV7H 3OGOE 4Y8AA 2HFTA 1XGRA 3PWPD 4AEHH 5A1AA 5C7XH 4Z77B 4F7MA 5BJTB 4PREB 4N5EC 1DFBL 3DGGB 5IMLA 4NHUB 4DGVL 3SO3B 1BHGA 5J13C 1TJGH 1JMZA 4JZNB 5DF0A 5IVOA 2K3TA 3QH3A 3KPTA 3AMLA 4K3JH 4Q9QH 3VFTA 1LE5A 3PWJA 3MRQA 3SOBL 4L29A 5D5ME 4NZRH 5FDYA 2F9BT 1R6VA 4Y4KD 2X70A 4PFEA 4Q74A 1NCAL 4G8GE 1U42A 4RISH 2NX5A 2YKLL 4KKLD 3DVIA 4OZGB 2PTUA 1L6XA 2K7PA 1DP0A 3D0LB 1JHKH 2DYPB 3HC4L 4ZS6D 1JNNH 1ONQB 1ACYH 3ARUA 3T8XA 4FFZH 5SX5K 3MUZ1 5HYSG 3S37L 1T1YB 2Y5TB 3V6OC 5EA0L 3QEQE 4NNYB 3VFOA 1UKTA 5DD3L 2UWEB 1FFNB 1IM9B 2ZNWA 3GB7B 3DRTA 3EYUH 1F3DH 3NTCL 1UZ6E 2IAMD 1HI6A 3P11H 4EDXB 5B8CC 2ZSWA 3BZDA 4IIQA 1D5XB 1JPGA 5JQHC 4MYWB 4FHBD 1MRFL 1MSPA 3RUGA 4P23D 3RGHA 2B2XL 2LTQB 3MLRH 3WUZA 5LXGL 4UT9H 2BNQB 3RKDC 1U91B 4HF5H 3LKRB 4DGYH 3V4UH 4K7PY 2W0FA 3SPVA 5I1GH 1MWAH 3MGOB 4NQVA 1I9RL 2JELL 4P2YA 1N2RB 5DGQA 3H0TA 3NGBB 5C2BL 3BT2H 2W65A 3MUHL 3UTSA 4GBXC 4MLIA 4S2SA 5E8PA 1ITBB 1U41A 5F6HI 3PWNA 3SDAC 2BVOA 3O41A 3CFJB 4Y5YA 3EOBA 1KCSL 1CYGA 2B1AL 2EC8A 5EFIA 1QKZH 4Q2ZA 4KHXH 4TUKL 3IXAB 1D5MA 3TBSA 2NY1C 3PV6A 4PBXA 4X7FC 3G6JE 3ZKSD 5DK0A 2J4WH 1QFPA 5I1DA 3Q3GA 5A3IC 4QKXB 4JRXB 2OP4H 3ARGC 1HYSD 3ZDYF 3KPQA 4Z0BL 4BQ9A 2HWZH 4L8SC 2BNUB 2R0LL 5DJYB 4CGTA 2VLME 2XWJB 4Y4HA 4S1DC 5EH1A 2AV7A 2RFXB 1WTLA 4X7DC 2YPVL 3U0WH 3CCHB 2FL5B 4JFDD 4M7LH 1FL6B 4JVPA 2QTEA 4MXWH 1EO8L 4R6UA 4MA7H 3HTLX 3VMOA 3LQAH 5E5MB 3V4PL 2WWMC 1ADQH 2CO7B 3DHJA 3DXAD 5I19H 2D2OA 5KVFH 3EIFA 5CJ5A 3VRIB 1A6TB 3KPPB 2VDQL 2X44D 3ILQD 4PJIE 3BKYL 4X99A 5BO1L 3T0WA 1K5NB 5EU3B 3MZTA 5C6PB 1S7VB 4CL7A 4JDVB 4HUKB 4LCWD 3ZTNL 4WTWA 3QUYB 1JTTA 3PDOB 7CGTA 4NQXA 4L3EB 2PO6B 5ID1B 1YEDA 3KR3L 4PG9A 5GS1B 5IJKC 2C9AA 2X4QB 2XOTA 4XNYH 4JFPA 1G7PA 3ARYA 1TFHA 2EYRA 2V9RA 2O61A 1QSFA 4ONHB 2GITA 4PRIE 4HIEA 4JFYB 2XZQH 2XWBA 1I8LA 2HG5B 1NFIA 2CLVB 3L3JB 1INEH 2OR8A 4XCEA 2ARJQ 1SJVA 3QNXA 4AL8H 5JLZA 5C0RH 3OKKA 1T2JA 4HWZB 4RQQB 4TNWF 4HKJB 2C3HA 1WZ1L 3C5ZB 1T83A 4I0PB 4MA3B 5ERWA 5ICYA 4HJGB 3GK8L 3FQTA 1AGBB 1DBBH 3DRQB 4ODSH 3SDYH 5C0GB 5IMOB 5KZCB 1TNMA 4W68A 4NZTH 3MCLH 3TBTB 4FQCL 1V7MH 5F1OB 5C0ND 5C6TL 3SDDD 1KBGH 4K8RD 4HPYL 3MSPA 1WUNT 5FV1L 3AROA 3WUWG 3X11A 5IHLB 4MNQD 4CUCA 5I8OL 2OJEA 5E08H 1R5VB 1X5GA 1P2CA 1F11B 1GCFA 4LU5L 5CWSB 4FQPA 2ZCHH 5BRZB 3ARQA 3K7UA 4J3XA 2FECI 1JPSL 1QPXA 3O6FC 3TVMA 4Y1AA 4UIMA 5BW7C 2MWCA 1X5KA 4AH2B 1KPUA 1JWSA 2H26B 4MVBD 1HOCA 4AEIH 2A6DB 4BYHA 1BQLL 2LVCA 2R0ZL 2FBJL 4YAQA 3NIGF 2I07B 3B3IA 5IKCA 5E2UH 3ZKQD 4D0DA 2W91A 3NPSB 1QSED 3BZEA 3GKWL 1D5IH 2BDNH 1UM6L 5IG7B 5JUEL 5TF1L 3QI9D 2AJVH 3RWEB 3VH8B 2DI9A 3IFNH 1U8KA 3BUYA 3EDEA 2DQCH 3ZDXE 3M1BA 4R4NC 3WD5H 2H9GA 5AWNL 4NGHL 2VDKL 4NCC2 5EORL 2AEPH 5K33A 2YOCA 2X7LA 2P5WB 5FYJE 4ZOEA 4HWEH 1DEDA 5IJVB 4HX1A 3DVGB 2QHLA 1IGMH 4HLZH 2A9NL 3MRRA 1A1NB 3VW3H 1U3HA 2UYLA 2WIIB 3NPZB 2XA3A 3ZT7A 4G6JH 1H3PL 3IDNB 2AKRA 3MLWL 4I77L 2IH3A 3IJYA 1RULL 2W07A 1QLEH 1PYWB 1X4YA 4WWKD 3MODL 1G6VK 3WN5C 1JGDB 1CFSA 3T2NL 1YPZA 5KVGH 1F6AA 5CJOH 4YGAB 2JB5L 4MAYC 5F1IA 3WS6A 2W9DH 3D2UD 3TGXA 2ESVA 1V3MA 3HZYA 3TP4A 5AZ2H 5EUKB 4A6YA 3HPLB 1WIPA 5C07E 1ZVSB 4DKAA 3RZCA 3O45B 4Z7WA 2VAAB 5DXWA 4YXLH 2XWTB 2FSEA 1NGZA 4DJMA 1BZ9B 3BOVA 4EBQL 1NQBA 3RJDA 4KZEL 1J0KA 1FDLH 3GMMA 4L9LB 2P46B 1LP9A 3ZE0E 1OVZA 1YEHH 1AXTH 1CD0A 1AD0B 4ENED 1ZSDB 5E2VH 4FQQA 2FIKB 4LBEA 3TT1H 3MRIA 5CZXC 3U4EB 1KB5A 5IQ7H 4YXHL 2X09A 4U7KA 4MCZB 3H9SD 1MCLA 5FCSH 4PJCA 4YLQT 4ZO6A 3NAAH 1ZLSH 2FATH 4W6XB 1IAIH 3VXTB 1JRHL 3H6JA 2W9LA 5DURD 3VXSB 2X4NA 1OP9A 1NCNA 5JIHA 4LCWE 4NHCH 5KSBF 4OF8A 3C5SB 5DS8A 4UV4L 3LH2H 1T89A 3K3QA 2Z8SA 3WLWC 5CJQL 4XBPB 3V6FA 4XWGL 1CGXA 5T33H 5JHLH 3HCVB 3D1MC 4KK6C 1H3XA 5J0BA 3LKNB 4KPHH 5C0CE 4I8DA 3GMQB 1C5DA 5E2TL 1J7VR 5DUBA 4QXGH 1A6VH 4ODVH 3OR7A 3FONB 3F12A 1KLUA 5CP3A 1IGYA 2CGRH 2HT3C 2H3NA 4NO5A 1XR8B 1TVBB 4V2CB 4OD3L 4M00A 5HDBE 3BWAA 2F74A 5F3HB 1NC2D 3TPKA 2ARJA 3TO4C 1GGIH 3CUPA 2MFNA 3MGTA 4LARL 3RVTC 5JXED 3PWPA 4XPTL 5GSRB 3N9GL 4ZFZA 3EZ8A 2R69H 3UJIL 2YR3A 1LE9A 2Y36L 2H6PA 3BAEH 4GQ9H 3V4VH 1NCWL 5J11B 4MDJB 1RJYB 5D4QA 2DB8A 5KG9A 4JR9L 3WFHB 3S35X 3D87B 3N85L 3GSUA 2FD6H 1DQQA 4QRUA 1X6LA 3QJFB 3HRZB 3HMXH 1G9EA 5FGCE 2YUZA 4Z78A 3HA0A 4RFOH 5DHYA 4JFED 1DBML 4HPOH 1U58B 4Y4KA 2ZOLA 5JTWA 5CJXC 1UM4H 4NM4L 4U6HA 3QFJE 1AGDA 3C60B 4Q9BA 1IKFH 1H5BB 3CAFA 1MHHB 5FUOH 3TBYB 1ITCA 3G5ZB 2B4CC 4QYOB 3MRBA 3QEUA 4Y0GA 5HGDB 1CFTA 5HI5D 2YUWA 3TN0B 3GKZA 1J0IA 5F1NB 4XB8A 3OG4B 4WTZA 4HH8A 5FF6A 1YEFH 4ZAKB 4MB5A 5F7FA 4NC1E 3WNLA 2XTLA 4YDVA 1IGTA 3V7AG 2VZ1A 2QLVB 4H5SB 7FABH 3T0AA 4P5KA 1NBYB 1B2WL 4P46D 1VDGA 3RJQB 1GHFH 3CFCL 1BZ7A 4OCLC 2FHBA 1W0WA 4G7VL 3U7AA 2IAMA 4JHZA 3OQ3B 4O5LH 5AZEL 5FYJL 2X4RB 4N1CA 5FDWB 4CADB 4P23A 5ISZB 1P4BH 5C0EB 5E6IB 4BSJA 4UQ2B 1IMHC 4IRSD 5F93C 1YNTA 4M02A 1A7NH 4OF7A 5I8EB 4JG0L 2R2BB 4JKMA 5D7IF 3DO3A 4OCYH 5IVXA 3PWUB 1FYTE 4JLRB 2X1WL 4K3DH 4XMKH 4HKZA 4NC0B 3LKPB 4HW6A 5GHWL 1MVFA 4HXAH 1VCAA 3KS0J 4NJ9H 4PJDB 5DMJB 4KTEH 4HJJL 4XP5L 5GQBA 1G84A 3U9PH 1IZKA 4JO1H 3AU1B 4IRJB 4S1RH 2XZAH 5IHUH 2OTUA 3JWDC 4WV1A 5DVMA 1WWCA 3VXQA 2GJZB 1RZGA 2V9QA 4QHLB 4RGNE 3WHXA 3QUMH 1RZ8B 3RWDB 4G6FD 1VADB 5FHAL 3RPIB 3LN9A 1KULA 1UXWB 5TF0A 4P3WA 1MHCB 4NO0D 4QRQA 1KIRA 4O51B 3OJVC 5LXGH 4HEME 2ADFL 2W0LA 4RSVA 5EZJA 5I1IH 3DIFB 4JFDA 3PWVB 1HCFX 2XY2A 2QQNL 3K2MC 3LEYL 3KLAA 4WI7A 3PL6D 5IFHH 2A0LC 3DXAA 4DFIA 1QRND 3ZL4H 5A43C 3S3JA 4Z76B 5JW3L 1FNSH 1F4YL 3FL7A 2D03H 4EQ2A 1F4XL 1F58H 1IE5A 2EH8L 5GS0L 4MCYB 3O4LD 3LZFL 4ZOAA 1G1YA 3T4YB 1ZKAA 5BZWA 4ELMA 4HAFA 2A6IB 2JJSC 3MBEC 4FQ1H 3WL9A 1PKQE 4F3FA 1L6ZA 2J8UA 1XCTA 4JPWH 1Z9SA 2ZUYA 2BSTB 3RNQA 1ZA6A 3FTGB 4QHKI 3MJ9A 1UKSA 3MJ8A 1MCDA 4GAGL 3BFOA 4QT5B 1IAIM 1UB5B 2HLFC 4PS4L 6FABL 3WIIH 1NGQH 4G6MH 4KMTL 4WFHE 1KN2H 1N3NB 1BOYA 5FEBA 5F9JA 4TVPH 1U3HC 3V4PH 4IOIB 3QUZB 5CUSL 2YPLB 1VEOA 3U0TB 4DFHA 3CZJA 5D1XB 1ZGLA 5BO1H 5D7JD 3SDDA 4UTBL 1F6FB 2OMBA 2BRRH 3WS6C 2YRLA 4M1GL 2DQDL 4EVNB 3QDMD 1AH1A 1QA9B 2Z31B 1HXYA 1YMMB 4MNQA 5IBUG 3IETB 1U8LA 5T3XH 5DD0L 1PW3A 3RZCC 5TQ0H 1I1RA 3SDXF 3V2AR 5DT1L 4QXTB 3UPAA 1MI5D 3F8UB 3S5LA 2FZ3B 5JIKA 2BHZA 2OTPA 3UPRA 4OLYL 4ZO9A 4HIXH 1CXIA 3L5JA 2P43B 5HVWA 4AG4H 2EDRA 3BRFA 4GXVH 1MUJB 1MAJA 1FBIH 2YPKB 4OF0A 3MRPB 4UIKL 4YFLI 4KUCD 2APXA 3ARRA 3N1PC 2GAZA 4MNHB 1QSEA 5EUOA 2G75A 1EJOL 5AEAA 3GRWA 1YEIL 5H94A 3QI9A 5DRZA 5JHDE 4MA8L 5EO0B 2C3VA 4U1KA 5DWUL 2NY7L 5E4EC 5F96H 1QBLL 4ZXBC 2YUVA 1JV5B 4HEPG 2AXJA 4ODHH 3MV9E 3OBAA 2NTFA 5IP4A 1TZIB 4IOFC 5DEFA 4I5BB 3N1FC 5DJZB 3JV4B 4RMRA 4YEFA 1XCQB 1AO7E 4Z8FH 4PRHD 4PB9L 4F9LC 3EFDL 4YPJA 1HH6B 2NW3B 3LV3B 4OZHB 2KL6A 3DURA 4H20L 3AY4A 2ORBL 3UZVB 5I18L 4WWKA 1IKNA 2AJ3A 5GZND 1RMFL 1D5BA 4TUJB 4DUXA 1ZHLB 3D2UA 2CUMA 4H1LA 5DJAB 2YK1L 4M03A 3UTTE 3V0VB 1KIPB 4HMCA 1FZJA 4LLQA 1NSNH 2MQ3A 1AGEB 1FFOA 2Q8BH 4DN4H 1J8HD 5I15L 3JUZA 3AREB 4MD0B 4LP5A 5I9QC 5DO2D 1FO0A 4YBHA 5MENA 3T0XA 3DPBA 5KSBE 1FP5A 1U8MB 3I02A 4ZNEE 2P7TA 3GGWB 4RX4D 2WMPA 2F5BL 1P9MA 1KCVL 4O58H 1YYLL 5H2BB 5ILTL 5IF0A 3HE6D 1DSFH 3HI1A 3GM0A 5IV2B 1H15B 5JOFB 1QRNE 1U6AH 3T77A 1H0DB 5E0QA 2OQJA 3H9SA 2GUOB 4Q6IB 4XXCA 5DUML 5TPWL 2WANA 5EZIH 4XPBL 2MCPL 3R0NA 3L3OB 1J88A 3HPJA 4PRAA 2XKNA 3GJFA 2EIDA 1YY9D 4Y2DC 3VGBA 2DDQL 5KAQG 4G8EB 2Y06L 4KKLC 5E8NB 1CDGA 4MZ3A 2I9LA 1RJLB 3L5XH 1CLYH 4D9QE 5I73C 3L5WA 1N6VA 3QSKB 1KV3A 2LABA 4RAUB 1CGUA 3BE1H 4X4ZA 5DC4B 5HI4D 3IDYB 3ALPA 2H32H 1X5AA 1ZTXL 2D0HA 5DC9B 3RNKA 3MNVA 3LRSA 4YHOL 4B41A 2P48B 2FWOA 1ORQB 1OY3B 4P3DB 3ZDZF 3MPCA 3QDHA 3DSNA 3AS0A 4MJID 1J10A 2OMNA 5D1QD 2DYPD 2IH1A 5IGXL 4PY8J 4ZSOA 5I8CA 2OL3H 4PJ5B 4N0YL 3ULSB 5ACMA 5IB2B 4ZYKB 1OSZA 3OX8A 3QQ3A 1IEBB 1NC2A 3QXTA 4YXHH 5DQDL 4P57B 1RHFA 3O6ML 5CHNB 5JXEA 1IM9D 3ME0A 2VOTA 1DBKL 1TCRA 3RX5A 4KVNH 2J3SA 5TE4H 1G7HA 4KXZI 1BZQK 4HG4K 5IB5A 2YUXA 2AJYH 3G6AA 2DLTA 1MLBA 1AY1H 4LDEB 4WO4C 4RMVA 2BNQD 3CDGB 1NDMB 2XKUA 2IG2L 1A64A 4JFEA 4LSPH 3U4BL 3MOQA 3ZMRA 1A3RH 5CMAA 2VR4A 4JG1L 1K6QH 4AM0B 4WV1C 3W9DB 1XZ0B 4P0DA 2VAJA 3TZVB 1N4XL 3EHBD 4DOHB 2DJUA 4N8VG 4WUUE 1A7PH 2DQFA 12E8H 1BD2E 3OB8A 1IL1A 5EO1B 2OCFD 3INUL 3FO2B 1A6AA 4P4KC 2Y5EA 3OKMB 1AXSA 4NP4H 1FH5H 5J8OA 5D7IE 5DRNB 1OAXL 1G7IA 3BESR 2YWZA 3ZT6A 2GI7A 1JUFA 4PRHE 3AAZA 4JRXD 3RU8H 4LKCA 1OGAB 3OG6B 3QQ4B 1BVKA 4HV8B 1Q0YL 4KK8D 4LDOB 3B9KB 5C8JA 4HUXB 2AK4E 4R7DA 2H2SD 4U3CA 5FO8B 1DANT 3IB4A 1TTFA 3MFGB 3W9EA 4IRSA 2AXGA 3D39E 4NPYA 1OTTC 5D2LA 2P4AB 2Q87A 2BERA 4MWFB 4J3OC 2FEDD 3N1MC 4WGVB 3VWKB 4JPIB 2HKHH 5E56A 3D9AL 2X1QA 5HHME 4PGEA 3HRPA 3WFCL 2XN9B 3MLUL 5A2JH 3FT2B 3OKLB 2VXTL 4WDIA 3ZTJG 1J8HE 5AD0B 5I1EH 1IEHA 1FVEB 4LDLB 1VPOL 4F33A 5K9JL 2MQ0A 3RA7L 3QUYD 4YH6A 1XGTB 3SHSA 4FFWD 1GGBH 1A02N 4L3ED 3TYGL 1DTUA 1MF2H 3SQOH 2ED9A 3ZE1E 1CLOL 4PRNA 3K46A 1GC1H 4HS6B 4Q0XL 3QIWD 1VKXB 2YMXL 3VRLE 1EGJL 3AFLA 3HNSL 2HFGH 1RJCA 3UDWC 2NY4C 4OCRL 2B39A 1WAAA 5AZEH 1MIMH 4XP1L 4MNGE 2C4FT 1X5JA 3B8YA 1YY8A 1RK0A 5CJ8A 4YBLB 4NO0A 5CJBA 3IJSB 1G1CA 1E4WL 5HGHA 4G8IB 1LO2L 3WLBB 3I75A 3VXRE 3C5ZD 5CBEA 4E41E 4KUZL 1Y6KR 1KB9J 2VSCA 4Z0XA 3VXUB 2W9EL 4WEBL 4PJAF 4EKXA 2GJ6B 2WUBL 5A2LH 3VGFA 4NT6B 4JHAL 1WIOA 5GGVY 1W8OA 5IW1A 3BP7A 3WS3B 4WW2B 3RRQA 5JW4M 4ALAL 3L95A 1H3GA 1JTPA 5C08E 3O9WB 4QXWA 5F44A 5EPMA 4HHAA 4PJXF 1XF2A 3O4LA 1FLTX 5BRZD 4IMKA 1KIQA 4KWUA 2HJKB 3FB8A 1UZ8A 2EO1A 4K07A 2VXSL 2XZCL 1DBJL 4ODUA 1RZ7L 5FYJU 2DJ4A 5FHAH 3CVHA 3WO4B 4Z7VB 2C3XA 1S78C 3SE9H 5HHPA 5DGRA