4ZFZB

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
total genus 15
structure length 100
sequence length 100
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzB00
1A9BA 4HWBL 3VXME 2DLFH 3FQXB 5FYJD 1YQVL 5D96C 3P9MA 4DQOL 1KIQA 4GAGL 2WUBH 4QRQB 1Q94B 4LPCA 2VOTA 5IIEA 2C1PA 2H8PB 3HZKA 1XGRA 2X9XA 3VXNA 1UWXK 5IB1A 4TYUA 5DLML 4U1LA 5SX5H 4NQVA 3AAZB 4ZFOL 1U3HB 1Y0LB 3IVKB 5CSGA 4J12A 1TPXC 1NFIB 1MAMH 4I8DA 5DMJB 3C2SA 5FDYA 1UB6B 1IGFL 1WC7A 3MLYH 5BXFB 4MQ7A 5LQBL 3GNML 5CEYA 2HKFL 3UCRA 5KN5A 1MJ8L 4KJPD 4PRHB 3VXSE 5E2VL 3ZYJA 1IJ9A 1B0RB 5HGBB 2OBGA 4NO2A 4LLQA 3T4AA 2JELH 1MH5B 4J4PD 4WW1A 3PP3H 1FORL 2EICA 4U1JA 2EIEA 4YXKL 3WLWC 1ACYL 1CBVL 3GBNH 2W0PA 3IFOB 3ES6B 3CVHH 5IFHH 3MRBA 1OF2B 1Q9KB 3FQTA 2C9AA 4OI9A 1FG2A 1YN6A 2C3VA 4MA3B 4ZFGH 3MBED 4RAUB 5I8KH 1RURL 4ZYKB 2P5WA 1B6DA 3PG2A 4P5TB 5L8LB 5L0QC 3EYFA 3RWEA 5JNYA 1A6WL 2GK2A 2NX5D 2G5RA 3RX8A 1NGXB 1YEJH 5F9JB 4OCRL 5GISH 1RZIA 1JWMA 1QFOA 4OCYL 1NCCH 4S0SD 4K7PX 1AP2A 2OMBA 1KCRL 4OSUH 1MQ8A 4HK0B 5DTFA 1MCCA 5LQBH 3OX8A 1SVCP 4UINH 3RZCC 1OD9A 1LEGB 5BCAA 1OSZB 3DXAD 2Y5EA 3QDHA 1IGIL 2AEIT 3P77A 3LH2H 4MNGE 1JGDA 2HTLD 5J13C 4OZFH 4DJMA 3C8KA 4K94L 4Y19D 1IAIM 1VKXA 5DFVD 1ORSA 1F4YH 4BELD 3HZKB 3VXNB 2WUBL 4PJBA 3MV7B 3WFDL 4UDUB 5CCKH 2V9TA 3MQIA 3SO5A 4A2MA 2DQFA 5IM7A 5IMMB 5L2KA 1P7QA 4FZ8L 1KCLA 3QUXD 2YUXA 4EUPH 1I1AB 1MIMH 1F8TH 3ULUD 4XMLL 4FMKA 4WIQA 4JY5L 5HYJD 2VR4A 4HIEB 2OK0H 4R2GD 3OZ9H 1M71A 1OAYL 2ZZUT 3ARDD 4HS8L 3CFIC 3FO9A 4XVTH 1H3UA 4GMSL 1ACZA 2R69H 3VI3E 4YFDB 1MH5A 3ARBA 3RL2B 5JOEA 4ODVH 1DBML 5ABDE 1AGDB 4KKLD 3KYMB 4P5TD 4YHKH 1P7KB 3IDYC 4LLMB 5HHQA 1U8HB 1HEZA 3Q6GL 3HPLA 2DL2A 1XZ0A 1ETZA 1JWSA 5F7WC 2R4SL 3J7HA 4FFWC 4P48A 4F57H 4H1LB 1QOKA 3TBWB 2R8SH 1U8NB 2IEPA 4GW4B 2HN7A 1X5LA 1ZGLB 4PRIE 4LL9A 4Y0GA 1TQBC 3VCLA 1IEBB 4D0DA 3QCTL 1NGXA 1SY6A 2EE9A 4HX1A 1CCZA 4L8BB 3EOYG 3PWPE 5IHZA 1UCBH 2XZCL 3FO2B 1H3PH 3OKLA 1G0YR 1IM9B 1WUNT 1P53A 3TA3D 4RZCB 1QLFB 2VLJE 4PIRF 3M8OH 5KTEL 4FQQB 4KI5D 1DQQA 4PGCB 4FXKA 2VERN 3KG5A 4JDTH 4MJIB 2Z8WC 2O5ZH 4S2SA 5E6IB 1D9KA 1CDJA 2QHRH 5ETUB 4LEXL 1K6QL 5C0JB 4N5UA 3BP6B 1NLDH 2CLZB 5KS9F 3U0WH 4LASH 1F2QA 1F11B 4PP2A 3A6BL 2ARJQ 2QTEA 2CO7B 5A16A 1XF1A 4NJ9H 4W4NA 3WNOA 5F1KC 3NPSC 1AIFB 5FUCE 1T1ZA 1KJ2B 2ZCLL 3BKMH 3GI8H 3Q1SL 3RWDB 3LY6A 3MLSH 3REWB 2VN7A 1SBSH 5GGSA 3NFSL 1I1AA 1I9JH 3QEQE 2F19L 3QEHB 4P0DA 2BVEA 3AAZA 4M1GL 1BZ7A 3OKEB 3BESR 5DRWB 1HHJA 5BVPH 1KEMH 1MIML 1KPUA 3QXWA 4OZFA 4J23A 4WUKH 2F8OA 2FX9H 3NIFF 3M8OL 5KW9L 2ZUQC 1XGRB 4H25A 1OVZA 2DQIL 3QI9C 4PJ8D 5ISZD 1S78D 3KLAA 4JRXE 4D3CL 2EDKA 1EAJA 5SWSE 1EO7A 4S1DD 1FAIH 1GPOH 2PTTB 1MEXL 4N5ED 1UM5H 4M48H 2B20A 4YBQC 3DJ9A 4EIGB 2J3SA 4ZAKD 4TVPL 4MCYA 3RWFA 1EFXD 3AGVA 1WK0A 2MQCA 5AEAA 1DCLA 4KVNL 3N1GC 5D5MB 3L95A 1VFAB 1X4ZA 2IAND 1YN7A 1BBDH 2EO1A 3I50L 5JIIA 2VISB 3WDHA 1RIUL 3MLYL 5HVHB 3GSOB 3OPZL 2BJMH 2J7LA 4N0YL 1R5VA 5K9QG 3HI5L 3OZ9L 4LSRH 4PJ8A 4YZFF 1OL0A 3BW9B 3CFJB 2BRRH 2WNGA 5DVKA 3QHFH 4EZMA 3TBVA 1N6VA 4XMLH 5T1DL 43CAA 1U91B 3PV7A 1CT8B 3OX8B 1CLOL 3EJJX 1INDL 1DBAL 2A9NL 1U8QB 1MF2L 5E00A 3QQ9C 3BGMA 4ELKB 4RIRA 2DQUH 4R7DA 3VI4E 3T2QA 3G6AB 3PP4H 4BKLA 2EYTB 2P44B 1ORQB 3L7FB 5DRZB 2NY6D 4J3WA 3IJSA 3BRDA 1T1ZB 4D9LL 4P5MA 2GT9A 5CKAA 4QYOB 1DANU 4MDIB 1LEGA 1OAKH 2DKMA 1AXTH 1KENL 2GAZA 4UDUA 3T77B 2XICA 4MJ5A 5F9AC 3GNMH 1CR9H 5IESL 2A9ML 3K2UL 1J1PH 4A6YB 3KLSA 4ZAKC 4CW1A 4FQXD 1UWGH 1ZVYA 5CAYB 2M1KA 5F1IB 3T8XA 1NBQA 3RPIA 2JJSA 2X9WA 1JF1B 3GSWB 4ZG1A 1TJGL 1VACB 2ZPKH 4FTVE 5TE6H 3O41B 2XRAL 4ZNEE 3ME0A 3H9SD 2X4PB 2UZYB 4EVNA 4OCSL 2NXZC 4BSVA 1EGJL 4DN3H 2BNUA 4JG1L 3CSPA 3HFMH 1V8HA 1KIRA 4ZUTA 5SX4H 3STBA 1JI1A 5IROC 1IAMA 5A3ID 1FE8H 4FQCL 5I71B 4IRSA 4UIKH 3X14A 5FO9B 1AGFA 4Y4FA 2NXYD 2UV3A 2RAMA 1CGXA 1OAUH 1F4WH 1FZJB 3WJJC 2B1HH 4D94A 4NUGL 4O4YH 2IBZX 3ARBD 1UEMA 3PWNA 4G8EB 3DUSB 1OSPH 1NBVL 2LVCA 4JFYB 3N50A 3RVUD 3QFJD 3ARDA 3CX2A 1QFPA 4HS3B 3QDMB 4OUUA 1RJCA 1FFRA 4KKBC 3C5JB 1W72H 4I18C 3SN6N 2VLRD 3QEGH 1JHTA 1T5WA 4LSPL 3UTTD 5JR1H 1TCMA 5J1SC 4JM2B 3BP4A 1FP5A 3FONA 2APXA 3C60D 1RQ5A 2FEDC 3C60A 3DSFH 2EDWA 5EA0H 1WBZB 3LQMA 1MCIA 3HNSH 5EG6C 3JVGC 5GSRB 2CO6B 2HT3D 3D39B 4NGHH 1Y18B 1GGTA 2YBRA 1ADQA 4K3DL 4J3UA 4XBEL 3DXAA 5FM5O 2V2WA 3BIKA 5C1MB 3QEHA 3NCCB 3O6MH 3UTQB 2CLRB 4ZMAT 1HHJB 4N1CA 4MQ7B 1KTRL 4FTVA 3DX7B 5HHOB 3W9EA 3QRFM 1D5BB 3QFJA 1ZHLA 2IADB 4U49A 4TTGA 4OCMC 4ZS6C 1GHFL 1EVTC 4PP1C 3Q6FA 4PJ5E 4PB9L 5C0EB 3WFBH 3FT2B 3VGAC 4G9DA 3F12B 3GBML 1M05B 3MLRL 4DTGH 2AXJA 1DQMH 4Y4FD 5FXCH 5CWSB 3R06A 5EO0A 4CU8A 4KH2A 2FZ3B 1IAKA 3KYAA 5HTSA 2YSSA 2DQTL 1AO7E 5HVFB 3MROB 5C0BB 4JHWH 5CZXC 4D9QE 3LMJH 3MMEA 5DT1L 2WUCH 4UBDD 1CS6A 3BIBX 3C6LD 1A1NA 3EAKA 3V4VL 3VD3A 1ES0A 1K9TA 4E5XB 5DI8A 1PKQB 7FABL 4LDEB 1NL0H 1B4RA 1XF5B 3TNMA 4B53A 2H3NB 4AL8L 1N5YL 1L7TL 1DFBH 5GHWH 4NP4H 4UQ3A 3ORJA 3SDCA 4LSQH 4QRQA 1AXSA 4JDVA 5DYOB 4WO4B 5F1OB 4U6HB 1V3MA 2J8UB 3T0EB 3OAZK 1U92A 4PJ7E 4M00A 1FHGA 3UYRL 2NX5E 3DNKA 3RVWC 2FO4A 4XH2A 3AY4A 1YYML 5DJ2A 1FL6A 2FX8L 4GXVL 3HS0B 4XVUD 1RZJL 3IFPA 3MLZH 4IRJD 4X9FA 2OSLB 3C5ZB 3O4OB 1Q1JH 1NGZB 3G9VA 3ULSB 4EN3C 3NCJH 4OLUL 2BMKB 2WBJC 1WISA 1D5IH 5E2WL 3MZGB 1EO8L 2AAVA 2CKBH 1QRNB 4UI2A 5BOZG 3RVTC 3EO9L 1MLCB 2R0ZL 1PKQE 1KPVB 1IQDB 4Q9RH 1JMZA 5KSBA 4JPKL 5B3JF 3BD3A 1HKLH 4FFYH 3T65A 3PHOA 3KXFD 1A8JH 3RDTA 4Z7WF 3IJYB 4HCRH 4IOIA 4DGYL 2IH3B 3VWJD 2EH8L 4POZC 3D3VE 4L3ED 2NXZD 3ISWA 3F58H 2WZPD 2YRLA 3S35H 1I75A 4IDJL 5LXGL 1HIML 2VAAB 5D1ZB 2J8OA 1XZ0B 1K4CA 5I1LA 5BZWA 4PJGA 4RWHA 5DHVH 5CEYB 4WFGE 1YJDH 2MQ0A 4R0LC 1U8PB 5ERWB 1JGLL 1MCOL 2FWOA 5HYFA 1DQLH 1C08B 2OZ4L 4KTDH 4JQVC 1DZBA 5IR1B 4B0MM 1KFAL 5H37G 1IM9A 3WFHB 4L3EB 1NBYA 5JNYB 4D0BB 3WS3B 1HOCB 4NZDA 3CJJA 1MFEH 4I9WD 4QNPF 1VDGA 1MWAA 2IGFH 5KVMC 5J11C 4MJIA 3EFDH 5J56B 3PHQA 3B2UD 4WHTA 1A47A 3W82A 2OZ4A 4LLUB 4JFFE 5B8CA 1EHLH 1GGIH 3LN5A 2FEDD 1CYGA 5IK3B 8FABB 3DPBA 3MZTA 1RZGB 1QNZL 2E6QA 4DKDC 3SDAA 3O11B 5DJAB 4IRJB 1LP9A 4CN1A 3IDMA 3MO1A 3BPCB 1ZEAH 3MBXL 4LLVA 3STZA 5E6YA 4GUPB 1HYSD 1MJUL 5CFHA 1CFVL 3B3IA 4ODBD 5A2KH 4R8WH 1R3LA 1NL0L 2AJUL 4FQ1H 2V2WB 5DUBA 4DW2L 1IE5A 1CDCA 3ZKMD 3QNXA 4EI5A 4JPWL 3G5XB 3O8XB 2MSPA 3KGRA 1WBYB 3LZFL 3PABB 4XNYH 4JAMA 1ZANH 5GSRA 4JREC 2IWGA 1KELL 3ULVE 4H0HB 3GM8A 1CF8L 2F5BH 4GKOA 2HKHL 1MI5B 1XAUA 3KYNB 3NIDE 5AG9A 4Q74A 4QOKD 4YAQA 1XF3A 5ID1B 1SM3L 4G7VL 1SMAA 4OGYL 2WP3O 1U8HA 3CCHA 1A7RL 3NZ8B 4LCYB 1YEEL 1WT5A 2E8ZA 4FQ1L 4GO6B 4O2EA 2ICWJ 5JHDA 1BEYL 4Y5XB 3MYZA 4KQ4L 1T83C 2AGJL 4K8RC 2ADJA 3AS3A 4R7NA 1M05A 5E2TH 5DA4A 4YJZL 2DS4A 4QWWD 1JPGA 2ZSWA 2VRAA 2WINA 3IS0X 4JKLA 3AS2A 3D2UD 3D69B 4JZOB 4P2RD 2G5BB 1MCDA 1WCQA 1CI5A 3BJLA 5DSCA 3THML 2AJ3B 5F7KC 4UT6H 1B0GB 3HZMA 3GMQB 4ELMA 1E4WL 2BOCB 2FHFA 2VXVL 3QUXA 3H42H 3GEWB 3MXVL 1QRNE 1WZMA 2XN9B 1IZKA 2KQMA 2YD4A 5J0BA 1BWMA 2DI8A 1Z3GL 3CFCH 3BKYH 1LO3H 4ODXA 3MA9H 4WFGD 5KANI 3ULSA 2CK2A 3IDMB 1IM3A 1KTDA 3UC0H 4UZGA 4JY4B 3LRGA 1AIFA 3KPMA 2J88L 5EZLB 4XCNA 1KFAH 3CK0H 2OMNA 4IDLA 3E2HC 3EHBD 5DJ8A 4QRPB 1NGWA 1V7MH 3OGCA 1BVLB 3BDYH 3IDGA 1MFCH 3BOVA 1PY9A 3RA7H 1I3RB 3QO1B 1KYOK 3O2WH 1RK1B 3MOAH 1LDPL 5CEZL 1PEZA 1QLEL 4N0CD 3S36X 1MCPL 1MHCA 4OT1L 1Y6MR 4W81A 4XPAH 4GRMA 3L1OH 4OLZH 4Y19B 3UYRH 3CDGA 2IH3A 3C9NB 3OR7A 3UBXA 3EJZC 5DS8B 1ADQL 1KPVA 4KUZH 3GSUB 2XACC 4I4WA 4KXZH 3S35L 3X13A 3TJEL 3FB8B 4YDJB 5GHWL 1PSKL 1DTUA 4WCYL 3RY4A 1QZ1A 3L3GB 3KNBA 1I1YA 3KPNA 4ZTOL 4U1NB 2OX5A 4N0UA 4L3AA 1AGEB 5BVJA 4M6NH 2HWZL 4EDWL 2DQCL 5ERWA 4I2XA 3TPKA 4ODSH 3HR5B 3MV8A 4PJ9D 3KPLB 3TESA 1RULH 4O9HL 2VAAA 2WINB 4ZUSB 3L6FA 3UTSA 5L88L 1K4CB 4D9RD 5EB9A 1UZ8A 4L3EA 2J8UF 5IV2B 1FO0H 1A5FH 2FGWH 3LKRB 1D5MB 4RBPK 2B1AL 5E9DD 5AZEH 2VDMH 2X4NA 2JB6B 2R1XA 3OJVC 4I0PB 3DYMA 3JTTB 3L1OL 3UTSE 5IROA 3P4LA 5D93B 2H26B 1GHFH 4R6UA 3SCMC 4AG4L 4MAUL 3LS5H 4BFBD 1VEOA 1JCKA 1RFDL 1LILA 4FZEL 4LPTA 4NWTH 3RBSA 2DKSA 1JP5A 5GGTL 4AENA 3MUY1 1IVLA 1G7JA 1U3HD 3IDNA 3NFPB 3VXMA 2DOCA 3MA9L 4NZJA 4LSSL 3HI5H 4LSRL 4PJ5D 2V17L 1OW0C 4V1DE 5KSVB 4QXTA 2PO6D 1CL7H 2NY7H 4HHAB 4QHUB 1F90L 1YMMD 4PJFF 3W9EB 2BVPB 2E7BA 3FMGH 4X98B 4A2LA 4ORGA 1VGKA 5ELIA 5DMKB 1ZHLB 2IADA 3ILQD 3L3DA 2YPLA 4PJEB 5F1NA 1INQB 4X6DB 1QUNA 1ZLUH 1SYSB 5EORL 4Y4KD 5KOVC 3UTSD 1OAQL 2DL9A 5B39A 3SGDI 2P7TA 3CLEL 1TZHA 1N8ZB 4UB0H 3TGXA 3VXRD 1A4KB 2O5XL 3A6CL 1UM5L 1PVHA 1VADB 5TDOA 1KLGB 5EOTA 2XZZA 5AD0A 2XG4A 4Y4HB 5EZIH 5K9JL 3MMEB 3CFBB 3PQYE 1MFDH 4OGAD 1JL8A 4K3DH 4XBEH 1QSEA 4V1DA 1NGQL 1P9MC 2JKXA 3ARPA 2X4QB 3I84A 5CEXA 5KZCB 3QCUH 1NAMH 1BVZA 1MQKH 5BQ7B 3EDFA 4XNMB 5F7UA 4OD1L 1LD9A 1EGJH 3Q48A 5D2LE 3AUVA 4FTVD 2BVTA 4OCSH 4F7MA 5D1XD 1DBBL 2WWMC 4F80A 1J12A 4H20H 4NQSB 1B0GA 4JM2F 4OZGF 1J0KA 4Y2DD 4O2CA 5AUMB 3SE8L 2BSSB 4BFIB 3BDXA 5GZOD 5ANMA 4X6DF 2DWEA 4LAQH 4LGRB 5FOBA 4MMZC 3VFVA 4X80H 1KEGL 3OAYK 3WIHL 2GCYA 3TVMB 3SDDB 3MCKB 5HDQH 5I8EB 3K8MA 4GJTB 3V5DA 1JHKH 4PV8A 4GSDL 3DIFB 3W0WB 2W65B 4OZIB 4KMTL 5LAXB 3SDCC 4QRPD 2AXGA 5FCUH 4Z18A 4GRLB 3F7QA 5E8NA 2R1WB 2CGRH 2P5EA 2A1WH 3NCYS 4M6ML 3U48A 2FJHA 32C2B 3D2UA 3WNLA 1RZ7H 3BQUB 3FO0L 4X83A 1CGTA 1MFEL 4X7EC 2JK5A 5JW4M 3MSPA 1PAMA 2CIKB 4YDVB 5DHYB 3ULUE 4O5LL 5EU7E 4RRPG 4HD9A 4YDJA 5DK0A 5T1KB 3T2NL 5JHDD 4IBLT 1C5BL 4GH7B 4Z5RA 1BF8A 3T2NH 1LK3L 5TDOB 4FQLH 4LSUH 3RWHA 2CMRH 4M7LL 3C9NA 3OR7B 3UBXB 1K4DA 3JWDL 3AM8A 3KPNB 4I77L 2Y5TA 4QOKA 1E27A 3LSOA 2H45A 2WSKA 3TIEA 4QLRA 4M1CC 4L4TA 3AMLA 5DRNA 3HHRB 5I2IA 1KJMA 1QEWB 4DKAA 5GIRB 1T3FB 2CK0L 1MRFL 1KN2H 5DC4B 1OCWH 1FLRL 4YHPB 4Z7UF 3J8F7 1D6VL 2Z92B 5E56A 3SO3B 3SBWA 4XPGH 5HD8D 4N0RA 2EH8H 4NN6C 4C56A 5MEPA 1INEL 2X89D 3QDJE 4UUJA 4MNQB 3QB7C 3V4UL 4FABH 3ZE2E 2A9NH 5TPWH 5C0RH 3TIDA 1GJIA 5AYQA 3S4SG 4EXPX 4YXHH 3IS1X 3BXNA 4U7KA 4KGLA 3WJLA 2ZOKB 4I18B 2AJVH 3VA2C 4GAJL 1YY8B 3LH2L 3OAYH 5D5MF 5EUKA 3WIHH 4M6OH 1AKJB 3SDAD 3K80A 4XCCH 2JJTA 2J6EL 4RX4D 3DO7A 2GJ6E 2E7LC 5DMIH 4JFEA 5CILH 5HGDA 4NM4H 3FQNA 3PGCB 1TVBB 4OF3A 2MHAA 1WWCA 5IW1B 2BNRB 3MV9A 5ETUA 4PG9A 3GGWA 4OSUL 4Y8AA 3K0WA 5L9DL 4HG4J 1YUHB 1S9VB 3B2VH 4PJCB 4KRPB 4S1SH 2DI9A 1UG9A 4GBXA 3MRQA 4MJID 4XBPB 4ODTL 5HYQA 1NLDL 3CUPB 4U33A 2VLJB 4KRLB 3BQUA 1WZLA 5E9DE 1U3ZA 3O9WC 4YBQD 5DVMA 3RUGE 3V4PH 4YNYB 4P57A 2NX5B 3HI1B 4WEBH 5H35B 2I9TA 2E6PA 3GSVB 3TYFB 4JFQB 4YAQB 1DDHB 1XF3B 3RIAK 4ZFZA 4YXKH 1CLYL 3B6SA 2NMSA 3WJJA 3B5TA 3T4YA 2IALA 3DYOA 4DZ8B 2GJZA 1WCBB 1CXKA 1ZWIA 5HD8C 3CFDA 1RZKC 1T7WA 43CAB 4TNVK 4F7PA 2FWOB 1NGYB 4NQCB 1DLHB 5IVNA 3QZWB 2MQ3A 4HIXH 4PJXA 3VWKB 5C2BH 5GRUH 4OLWL 3ILPA 5BRZD 1KCKA 4F15C 4GKZA 2ZKHL 5CJXC 2J8HA 3SE3C 5HHXL 5T3ZL 3OKDB 5F7MC 4X7TA 2CJUL 3IDXH 5ACLA 3SDAB 3O11A 3MRFB 4NZRL 2FHCA 2W59A 3WXVL 2R69L 3T0BA 3CLFL 4LSVL 5GGSY 4HS8H 4RISH 3WLBA 2XPGA 2AJZA 4M43H 4L8SB 1NBYB 1CFQB 1UH4A 2DLFL 4KRNA 1XF4B 1D5XB 4KDTC 2F8XC 3UPCA 3MFFA 1FDLL 1S7QA 2DQDL 1S7WB 1KG0B 1CQKA 4U1GB 3V8OA 3I75B 3KPQA 1MCRA 4WU5B 2NY1D 3WFDH 1JZ6A 1KV3A 3GKZA 4YK4C 3LKPB 5MENB 2D31A 4L4VA 1F42A 5F1SA 1AGBB 4ALAL 4EI5C 1QRND 1BD2B 3RJDA 2A74B 1T1YB 3JV6B 1EAPB 2HT2D 1T6WA 3IXAB 5DVOA 4M7ZC 3SGKC 3GSNL 5DVNA 3V6OC 3G5YB 3SDCD 5I8EA 3E2HB 3LKNB 4LSDA 3PWVA 2QJDA 3CCHB 5D7JA 3I6GA 5EH1A 4OLWH 1HCVA 2X4RA 5DXWA 4JM2C 2R56H 3GHEL 3FB5A 2PW2A 4OAWA 4TSCH 4YE4L 5GRJH 5MI0B 5C92A 3KYNA 1QFWL 4PRAB 2EXYD 3E6FA 1HSAB 4WFHE 4OBRA 3HA0A 2CR6A 2VABB 1X5HA 4Q9CA 3MGOA 4G80B 1FNGB 1UC6A 3GRWL 2EYRA 4M1DL 2ID5A 4ZFGL 3SDXE 5IHLB 5ACZB 4G3YH 2P5WB 4P5TA 5TE4L 4FZ8H 4JG0H 3GIVB 2Y5TB 2RCSH 4JANB 4KI5F 1TTGA 2KQNA 4FQXC 4XCFL 4PRPE 4XNZB 4XX1E 2HFTA 1HH9B 3RY5A 2W9DH 1LQSR 4LKXA 5CEZH 5ICZB 3WKNA 3ES6A 2KDGA 4NQDB 2GY5A 3DWTA 1CXFA 4HUVA 3PWUB 1JRHI 4RMQA 3B2UC 3FL7A 1GCFA 5B4MC 1A1MB 1O7SA 3KPMB 1ZSDB 4MNQA 4YHZL 2Q8BH 2MPAH 3T3MF 1J9CT 4P23D 4Z95H 2AJXH 4MMXC 3D69A 1C5DA 2VLLB 3LDBC 4JZOA 3CFCL 2EIZB 3MRJB 4F2MB 4U1KA 1OY3B 3JV4B 1TQCB 1NFDE 2VL4A 3CXDH 3KWWB 4NFBA 1BZ9B 3LHPL 4YR6A 4JFZH 2B7DT 5D7LE 5I18L 1T22B 1X3DA 3IDJA 5MHSE 2BOCA 1OHQA 3PP4L 3EFFB 3KPSA 3MBEC 4KKAC 2VXTH 4XNXL 2X2YA 3GDBA 3Q5YA 4GAGH 4ONGL 1CVRA 2YK1L 12E8H 2YEZA 1YY8A 4LGSB 4JQXA 1D6VH 5LGHL 3ZDZF 5CIPB 1INDH 1DBAH 2P24B 3MLWH 5ITBH 2APTA 3SEPA 4L4JA 3P0YH 4I0PD 5CBAB 3S88L 4M8QB 3WO3B 5BXFA 2AK4D 3UTTB 4POZD 4QY8B 3O6KL 4U6XB 2B5IB 4ZOBA 2X05A 1HSBB 4DKFH 2JELL 3VFOB 3RTQD 2C1OA 1I3RA 3VFUA 4YHZH 2VYRE 3LQZA 1E6OH 3ZDZE 4PJ9B 3MRMB 2PXYC 3VI4F 1N5AA 1M71B 3BO8A 1IZJA 4HQQH 4WHYG 5EZJB 3MNVB 4O51B 4I3RH 3PDOA 4KY1L 1R3HA 3BPNB 1YEJL 3MJ9L 2VB5A 5MI0C 3RL1B 5EO1A 1Q9WA 1MRDL 1YEKL 3MLXL 5H2BA 5CZVL 1QP1A 3OKOB 1FIGH 2Z31C 1XGUA 3QZWA 1NMBL 3O6LL 5DK3A 4XCFH 1DVFB 2EC9T 5HDBF 1EXUB 1QYGH 2DQEL 1PZ5B 4XPHH 1TZGH 4HS6A 4XVSL 1EMTH 3EZ8A 5IVZA 5EN2A 1P2CA 3BKCL 2UY7A 2HJFA 2ARJB 1AJ7L 3BP7B 4QRRE 2XQBH 4M02A 3H9SE 2H6PB 1EHNA 1ZA6B 3B9VA 3EKCA 5ANMB 1MIEH 1JPST 1XIWA 4YGAB 4KI1A 5IW6A 1F4AA 4XBGA 3ILPB 1MLCA 4PV9A 2EIZA 3MRJA 1TJIH 4NHCL 2ZNXA 1EPFA 2AJXL 2Z31D 5FFLA 2I5YL 3SJVD 5D2LA 4YHYB 4OF7A 1KEGH 3VFNA 4LFHG 3ESVF 1I3GH 5J8OA 4OF0A 3D0VB 4L9LC 5L0QB 3ULUH 1M7XA 1FGVH 3CZFB 3TH3T 1S9KC 2OTWB 4DOHB 3SE3A 4YHML 4I2XE 5FGRA 4QRRA 5DJYB 3NVQA 5KVFL 2DLGA 5IHUH 4UAOB 4QHNB 3UROR 4JQVA 4EDXA 5IB5A 4XPTL 1T0NB 4BH7A 2HVJB 2ZCKH 1B90A 3UDWA 3LKQB 1MCLA 1ED3B 4WFFE 1I1CA 3WV0A 4NQTA 1P4BL 1CICD 3O4OC 3MLVL 4XP6H 3PJSB 3MUGB 4XZUA 1X7QB 4YFEA 5HHPA 2V7NA 4XC1H 5BJTA 4KKAD 4POUB 3I85A 1T04A 4E0RB 1L0YA 3UMTA 2R8SL 1UWEH 3CLEH 1UKSA 1QVOB 2P48B 1IL1A 1DUYA 4EXKA 1BECA 1AHWA 2AKRB 2XWJB 2CKBA 3Q6GH 5DEGB 4MDJA 4P2OA 2OS7A 1AC6A 1DP0A 2DYPB 4JRYD 4YIQA 4OV5A 3H9SB 4JFFB 2F54A 1ZT4B 4EQ2A 3TH2T 3BAEH 4ELKA 2VABA 3LN5B 4MCYB 4G6AD 5F3HB 5TH2B 2FIKB 2UY6A 4NQDA 2AEPL 1TJHH 3BD5A 3QXUA 1BIIB 4HCRA 5DRZA 5ACZA 1W8NA 1AD0A 1N4XL 2A6IA 4OD3H 4JKMA 4NO5A 1MCEA 2AABH 5LAXA 1IKFH 3U30C 1PX3A 3DETC 4U0RC 3HE7B 2ESVD 2I9LB 4O58L 1NUNB 2W0FA 3O2DA 4GRWE 1P4LA 2ZUVA 4XNUL 5A40E 3EDDA 4JJHA 5D2LB 3AB0C 5IIEB 4H1LH 4RISL 2A6KB 1YEGH 4HG4K 1X5KA 3KWWA 3FTGA 5JA8B 4QRUB 2GSGB 3N85H 4YUEH 1QKZH 3JSSA 3FN0H 3L3IA 4GG8B 1RJYA 3VU2A 5FOBB 4OZIF 2X4PA 3W39A 3UTTE 3VFGH 5HVGB 4R7DB 4P3DA 4NM8H 1CG9B 4UV7L 5DJ0B 3KR3L 4R96B 2IG2H 2B8OT 5KVDH 4OZIE 1T1XB 4BH7B 5KS9B 2K3TA 2RFXA 4TQEL 5IQ7L 3H7BB 3P0VH 3GHBL 1U95B 1J86A 2P5WE 2HTKD 1A7NH 2ZUWA 2AEPH 3KLDA 4XGZA 2VNCA 4L3CA 3WIIL 1FPTH 2IPTH 1X7QA 3V9FA 4YHIA 5TPWL 3RPIB 4GRWF 4IM8A 5TDNB 1CLYH 5E5UB 4K71C 5GIRA 3T0XA 3BO8B 3P9WB 1G6RH 4BQBA 3SE4A 3B9KC 3O45A 4HS3A 4LARH 2XWJA 4I5BB 1KJ2H 1ZS8A 1N7MH 5TF1L 3GJFB 3C5JA 3GMQA 4ELMB 3WL9B 3PXHA 1JYVA 3FQRB 2FO1A 3ULVH 5IVXB 2XFXA 5D5ME 4WJ5A 3RU8H 2R1YB 5EPMA 4S1SL 1SY6L 3PDOB 5DD1H 1Q0YH 5IQ9A 5C0IA 4G6ML 3C8DA 1RUPH 4X4ZA 1MJ8H 2EO9A 5HYJA 2HFFB 2ARJA 4WW2A 3OXSA 4Y16A 4PGDA 3RDTC 5FEBA 2V5MA 3RJQB 4Z7WB 3L5XL 3HRPA 2VQ1B 1F6AA 4KZEH 3AU1B 1P7QD 4MJ6A 3ARFD 1NCNA 3MJ9A 3FOLB 5JIPA 1CLCA 3N9GL 4C58B 4QOKE 2ZOKA 4IHOB 3WEXA 1WF5A 4EQ3A 1T2XA 5AAMA 1YECL 1AD9B 3ZLQC 1NUGA 4HUXA 4PGEB 1BREA 2DQFB 3HPJA 1JRHL 2NW3A 4YNYA 3FQNB 3HLAA 2DI7A 3EO1B 1FNEA 3HR6A 1AE6H 4HWZA 1JN6A 3QIBC 1DBKH 4UT6L 3DVNB 4BH8A 3QQNA 1RZKH 3WKMH 4TTDC 5FCSH 2CSPA 5EC1A 4NC0B 3TBWA 5IW1A 4HZLB 3MLVH 4XP6L 3TO4D 4BUGA 5JOFB 4N90E 4PRHA 5TQ0H 4F7CB 1A1OA 4Z7VB 3KJ4B 4UIKL 2DF3A 2P5WD 3BKCH 4P46C 3VWKD 4PJEF 3OWEA 3CIQA 2VR5A 5E4EC 4OFYD 3RVWD 4G80A 4HFUL 4ZUTB 2CUMA 3FFCB 1RK0B 2VDLL 5IB5B 3O45B 3L3JA 4PR5A 2ORBH 3SCMA 4OCNC 3X13B 4P3WA 2EE3A 5C0AB 2VN4A 1BD2D 4ZFZB 4J4PA 2ZPKL 1CE6B 1A22B 4I3RL 4ZS7L 4A6YH 5FUOL 4DWHA 2BCKB 1FLTX 5CMAA 1JWUA 1PY4A 5C0DB 4GLRI 4XTRD 4FQPA 4WI8A 4TRPH 5MHSD 1PLGH 5GZNC 4AEIL 4FRWA 3WKML 2BXYA 4RDQF 4WHDA 5D2LF 1UJ3A 2KH2B 5MENA 1HDMA 4KDTA 5I30L 2D9CA 1MY5A 4F2MA 5IGXL 5F70A 1OM3L 5HHMD 4X80L 4N0UE 4LCUA 4QHUA 1BQHG 2XTJD 5IB3A 4R97C 2FLBT 3KPPB 3PL6C 3F7YA 1AQKL 3IRZA 1II4E 4P9HL 3U4AA 4NO0B 2ZUXA 4KTEH 2AJZB 2Y6SD 4F58L 2XA8L 3UTZB 5IHBA 4JM4L 2P8PB 2I9LA 4K8RL 2BRRL 2E27H 4KUCF 5E6ID 3U83A 5DEFB 4NQEA 5D4QA 1KB5B 3QO0B 5MP6H 4G8FB 1RZ8A 4PRNA 4HZLA 1DANT 4K94C 5HYSA 4PBWD 2XTJC 5CD5D 1FFOA 1S7UB 3AM8C 5DD0L 1C7TA 3FAXA 2BNQE 3NCFB 4XVJL 4HWBA 2O5XH 1XR9A 3LPFA 1JTPA 4TPRH 4AQ1B 1LEIB 2BERA 1BX2B 1ETZB 3L7EA 4IIQC 1CICC 4P4KA 3MNZB 1I3UA 5IJVB 4HGWB 4G3YL 4U6VL 5EU6D 3OF6D 3SGJC 3DUUA 1NKOA 5ICYB 3ROOA 4XNXH 4MAYD 4UILH 1HHIB 1EV2E 2DQIH 4PJBF 3V7AE 3WXWL 5D1ZA 2N7AA 2CKNA 5IK3A 4NOBA 1XH3A 1Z5LB 2DJSA 1FGNL 2W38A 2R23A 4ZPTB 4GMTH 4L8DA 1AO7A 2HVKA 3P11L 3MCKA 1BZ9A 5MEQA 5HGHA 5HXMA 1OARH 2LTQB 2E7LA 4MXQC 2J8UA 5GGTH 3PGDA 4TVPD 3MJ6A 3QNZB 1EO8H 3B3IB 3KPRD 1X5AA 1UVQA 4NFCA 1X5XA 3JZ7A 2CIIB 1RZGA 5CLTA 1X4XA 3NTCL 5L6YH 4CVZB 1OP3K 1NCWH 5GGVH 1HK6A 3RWJA 3GJEB 4XWOD 4IRZH 1R5WB 5IW3A 1YNKH 2DM4A 1NH6A 2YD6A 1MELA 4X7CC 2BVOB 5HDOA 1VB9A 3C09B 3HC4H 3RNKA 3WHE0 4Z7VE 5KSBB 4OI8A 3B5HA 1KC5L 4L29A 1UCBL 2XZCH 4O51A 3EOAB 7FABH 1EGJA 4TUOA 3HAEH 2Y25A 3T4AB 4CMMB 3N1MC 1YPZB 3PWPB 2BNUB 3GHEH 2KKQA 4U1SA 5DZOA 1HSBA 5D1XC 4F57L 3MXVH 4L9LA 3BN9C 3OHXA 5IMLB 1XGUB 2DQTH 3NMEA 3PQYA 2YD5A 3D3VB 4WI7A 5C0BE 3QDAA 3MRBB 4UDTA 4XB7A 2L0DA 5EZJA 5F89A 5EO9A 5EOCH 4X6CA 1I9RH 3DMMA 3V0VA 2FJFA 4PJAF 3MV11 5I74C 3Q5TA 3O4LE 3MTRA 3WN5B 4R7NB 4YDVA 3VFOA 2D7TL 1V3JA 1YC7A 3M17A 5BV7C 4TUKL 4FQJL 5IR1A 1V7NL 3LD8C 3S5LA 1B2WH 3WD5L 4X6CE 4JFYA 3RA7L 3ET9F 5DUMH 2P49B 3G04B 2R29H 4OIIH 1RUML 3LN4A 3G08A 2ZJSH 1I4FA 4WTZA 4RCAA 4TSBH 3VJ6B 3P4NA 1AD0B 1MNUH 5MEQB 4JCLA 3HUJF 4HC1A 4G42B 2AK1H 3ZKXC 4OGYH 5C0AA 1GZPB 1ND0B 4NYLA 2HJKB 1J7VR 3ARYA 4YPGA 1OTSC 4OZ4A 3EJYC 5DRNB 5I2IB 5HI4C 2RJMA 1MCJA 1R3JA 1T3FA 1F45A 4HS6B 4RIRB 1AGCA 1KGCD 3RAJH 4X99A 5CJ8A 3DX8A 1UYWH 3DRTA 1YDPA 4HT1L 2AW2A 2EXWC 2KPNA 2N7BA 3DI3B 4Z8FL 5BS0A 4M61B 4ODHL 4KAQH 1NEZB 4RMSA 4U6YA 4K23H 1CDIA 2BY3A 2BZDA 2K7QA 3QUYC 4APQA 1XCQA 3MRHB 5ENWA 1I9IL 2CLRA 2EE6A 4PJ7A 1MJUH 4TSAL 2ATKB 2AQ3A 2MWCA 1T20B 3IDUA 1TZIA 2IAMA 1H0DB 4S1RH 4P2QD 1AR1C 1UJ3C 4HEPG 1GIGH 3JWOC 3VG0L 4DVRH 4B50A 1MJ7H 1DL7L 5DJ8B 4M7JL 4L3CB 3W11C 3VXOA 3EOBB 1FLRH 2WIMA 1YEHH 3F65A 4XP4L 3DSNA 4NQEB 2J12B 4GW1B 5CD5C 5GGRB 3LQAL 4U1NA 3GZKA 4JO3L 5T5FL 1FNHA 5IWLA 4OM1H 1RJLA 4NFDA 1S5HA 2JLLA 1IKNA 2A77L 2F53A 4HZAA 4ZPVB 3HNTH 1M7DB 1QPXA 3GSQB 2E9WA 5DEGA 2ZNWA 4AQOA 1A7QL 3FOMB 5CILL 5FOJA 4JO4H 4NKQB 5IQ9B 3IAGC 4QGYA 2EDHA 2ZSVB 3SDYH 4DGIL 4ETQB 1O5DT 2YPLE 4N0UB 3BI9X 1OGTB 4QO1A 3C2AH 1T1WA 4YWGL 4L4TE 5D7KE 3QDMA 4FG6C 4OUUB 3DARA 3FO0H 4QHKI 1I7UA 3MR9A 1T89A 3SE4C 2DQJH 4YIQB 1NJ9B 4APQD 4CUCA 4QNPE 5C0RL 1E4XH 4LVNB 1WWWX 1MVUA 4OLXH 1MHHB 4IDJH 1U0QA 4F33B 4ZD3H 2X4TB 2Q7YA 5BS0D 3MA7B 3BP4B 5KJRH 1OPGH 1O7VA 1KIPB 1PYWA 1HYRC 1UKTA 1NCBH 2DQUL 4N8VG 3HPJB 1RMFH 1JRHH 4M61A 1I7RB 1U8MA 4TVSa 3EHBC 5T3XL 5ADOL 4PLNC 5D8JL 4P59L 4P2CG 3KPSE 3V0WL 1MCFA 4I77H 2W92A 3QPXH 5IT2L 5EBWB 2V7HB 1VKXB 5INCA 2GITB 2I07A 4G8GE 1CGSL 2G9HB 4K71B 1INQA 5KG9A 5F88B 4PY7B 3FB6B 1FZMB 3L3IB 2VMFA 4GG8A 1RUPL 4P5KA 2Y4SA 3ECBB 4W4OA 1PQZB 1IEHA 2BNQD 5GQBA 3QH3B 4LMQI 1A4KA 3QJHA 1A14L 2Y72A 1U8KA 4H1LG 5AYUL 5IMLA 5KSUB 3QUMB 4JRXA 5E5MA 2YXFA 3MRLB 5SWZB 2MKWA 5I1HH 1ULVA 3WYRA 1PEWA 5ITFB 3QEUA 4M1DH 4CMMA 3Q0HA 4KPHL 2BSTB 1QBLH 1BPVA 2HFFA 3IJHA 2CH8A 5C0CB 2H1PL 5FUCC 5E6ZA 1UM4H 1A6UL 3BT2L 4NQUA 1A21A 4FFYL 4XI5D 5IEKB 1AC0A 1NC2A 1UWXH 3FOLA 3QIWC 5E8PB 3EDJA 4AIZA 3QQ3A 2W0LA 4M5ZL 1ZGLP 3WN5A 5TFSH 5D2NC 4ZTPL 4M7KL 4PPTA 3M17B 2HRPH 4LAQL 2V5RA 3HMWH 2Z8RA 4WFEE 2BDNL 2VQTA 4DK6A 1DBBH 2XZAH 5IP4A 3HS0A 5C0IB 4BKLB 4HT1H 1ZT1A 1HQ4B 1KIPA 3S3JA 3VFPB 2A73A 3O9WB 4MCZB 1LP9B 4JVWA 1LE9B 4LQ1A 5GS0C 3FN9A 4MD0B 1FDLH 2DQDH 4LASL 5HI3D 3O2VL 4P2RB 5GS3A 2H2SC 2WMPA 3UTZA 3O4LD 4KRMB 4R4ND 3O6ML 4RWYH 4JFOB 3IKCA 3V6OE 1XT5A 2X1QA 4UNUA 1I7ZB 3UDWC 4LVEA 1IC7H 3BEWB 4HF5L 1F3JA 3BN9D 4MAYB 4OLVH 1J1OL 1CFNB 4K7PY 4JFDB 4HJGA 4XAWH 3V4VH 1AD9A 3QQ4B 3U7YL 3FZUD 1H3PL 4PBXA 5CUSL 1L6XA 4ZFFA 3RWDA 4ZO6A 3FFDA 3S34L 1AR2A 2EH7H 4K9EL 3VFTA 4GS7C 2YA0A 3MUZ1 4QOKB 5I1EH 4U1MA 4AIOA 4U1JB 3QUZC 2NCMA 3QUMA 1MI5D 3BMWA 5A2LH 3WE6B 3GMPA 1WTLA 2IAMB 4FXGB 1U6AL 4P4KD 3L5HA 2FJHB 4AM0A 4MA1C 5I17B 4ZFOA 1OTUD 4X7FC 5SWZE 1NFDB 1ERNA 1UWEL 5J57B 4K2UH 4B5EA 4Y4HC 2IFGA 2P43B 3W2DH 1NDMB 4KJQD 1VGEH 1FYTD 3VXOB 3U7YH 4PJDA 4NUGH 4O4YL 5SWQA 3HUJA 2L7UA 2NZ9D 1ZLWK 4D0CA 5FGCE 4PREA 1D9KC 1FFNB 2PW1A 1F02I 2ZG2A 1OAZH 1TIUA 2R23B 2C3WA 5D7SH 4GAFB 1KCSL 2AVGA 4LVNC 1C1EH 3CSYA 2IH1B 3N1PC 3K4AA 5IB2A 3SY0A 4CDHA 1BM3L 4ZD3L 2HFEB 5J12C 4KZDH 5ILTH 3AB0B 3BN3B 4J7RA 2J5LC 4MZ2A 3QO1A 1NFIA 2BDNH 3S6CA 4HUKB 5D7LD 1CDBA 3TC9A 3D18A 3DI2B 4XCNB 1RU9H 5MEND 3GSNA 1AR1D 1J0JA 1HHHB 1EHXA 4QXUH 4OCLC 3AS1A 1YY9D 3SGEI 1FGNH 3S37X 2YPVH 2J4WL 2A77H 3ARVA 3LKOB 5KVEH 4NT6B 3QUYD 1VERA 3FFCD 3PABA 1I1YB 3HC0B 4WCYH 1OLLA 3V6ZA 4LPWA 1XGTA 3TJEH 5I6XC 3T08A 1B0RA 1T7ZA 1DUZA 4QF1B 2DWDB 2YR3A 5JW4N 3I3EA 1J5OH 1B0WA 2F53D 1A0QL 5AYUH 1RUAL 3D87B 4LLWB 1JWSB 4RMRA 2FSEA 4GKZB 3WFCH 5I17A 2XOTA 3I02A 3QR2A 1EERB 4FG6D 2P4AB 4GRWH 1JPSH 1RUKL 3OAZH 1DQDL 2XY2A 5EBLA 2FX7L 2PYED 5BRZB 4YHNA 4OFYA 4K2UL 4KK6C 3VWKA 1NSNL 3RX7A 3QI9B 1KB9K 3X12B 5CZXD 1QFUL 1RIUH 4YHYC 5F3BB 4J3SA 5C0BD 1N64H 4K23L 4GKSB 3FCTB 3LKRA 1MAML 4BUHA 2EZ0D 1AI1H 4PGCA 2EDFA 3MACH 2Q86B 4K8RH 4U6TA 5C07E 1KG0A 1EH9A 1FVCB 3GBLA 1SEBA 4KU1A 1CFQA 3WHXA 3AREC 5E08H 2DLEA 5L2KB 1JWMB 4DUVA 2LVEA 2ITDA 2Z4QA 2DBLL 3KHQA 1R6VA 1U8LA 4EEEA 3SJVE 4AIZB 1HHGA 2BMKA 2VDQL 4FP8L 43C9B 4G9FB 5DF0A 2NXYC 1ZGLM 3MRFA 2YWYA 4JFHD 4XNQA 3I9GH 3EW3B 3JUZA 4YLQT 5CLWA 2BY2A 2CRYA 2RFXB 2ESVB 4NNYB 1FNSL 5H8DA 5C6WH 4X5WB 3MGTA 4FQJH 4P4RA 2P45B 4BZ2L 2D7TH 1Q0XH 2IC2A 4G8GD 4H20L 2VXSH 4NWUL 4YHLH 2NLJA 1VFBA 5E0QA 3LKPA 1RJYB 3JWOH 2M26A 3BPLB 4D8PA 1F13A 1RV6X 3Q6FB 5CBEB 2F5BL 3NIFE 1BGXH 2Y23A 5BRZE 2HG5A 4G6FD 3ZKSD 2BHZA 4WJ5B 1IGMH 3HE6A 5HHOA 2O5ZL 2DTSA 1QLFA 3U4EB 2GW5A 4JG0L 1OAXL 1J8HD 3EYQC 5EZIL 4AMKH 2CRZA 4XHQA 5HHOD 1YEFL 3L95B 4MB5A 1NANI 4AT6A 4HIJA 4QEGA 1ITBB 3PV6A 3FT2A 1PFCA 2WQRA 2B0SH 2XNAB 5D2NE 2YUWA 1FN4A 4OZ4B 3LRHA 5DWUH 3U4BL 3HUJB 4XCEB 4NKIH 3VFVB 1S7XA 4M5YL 1MFBH 3JBG7 4HKZA 2FZ3A 3QAZC 3OG6B 4UV4H 2D9QB 1Q9LB 5FF6B 3G04A 1O0VA 1S9WB 4UIMB 5FHBH 1NCAH 4M3JA 3OXRB 4LVOC 1WJ3A 3NPZB 1F90H 1JGEB 1MOEA 2ARWA 2FECI 3JVGA 4HCRL 5IVOA 3TLRA 5A43C 5LKNA 4HWZB 5I1GH 4YDLC 2JJWA 4YR6B 2SEBA 1QLRB 3DGGB 4G42A 2BFVH 1CGVA 4FQXB 3MXWL 1G6RA 3SJVB 3DVIA 3FFCE 1S7WA 2QBWA 2AXGB 3MOQA 3KPRA 4UNTA 5DJDA 5T3XH 3RGVD 3F6LA 4NWTL 2F74B 5EBMB 4OD2A 3ELAT 4NSKA 3DUHA 3MYJA 3U6RA 1ZA3A 5B3JE 2X1PA 2IQ9H 4Z0BL 1KPUB 4GW1A 5C86A 3DX6B 4BQCA 3IDJB 3L3KA 2VDML 3B8SA 2B1AH 5AZEL 1K4DB 3V52L 4QXWA 4D8PB 5J11B 4XXCC 3ZO0A 3MNWB 4JKWA 1WZ1H 4IOSD 4PJIF 4U1HB 3V8CA 1H3XA 1DN0B 3F7PC 1ZK9A 5EU6A 2YZ1A 3VDAA 1K5NB 2UYLB 5T1LB 1MCBA 5I76A 4AT6B 4JFHE 1OB1B 3LMJL 5DT1H 1A6AA 4GG6A 4YK4B 3VGEA 4J3OC 5C6PB 3EOBA 4G6KH 5F72S 4OZHB 3BZEB 3EO9H 1OP9A 4V1DB 1PDKA 1F00I 4XCEA 2VAJA 4LIQH 3SPVA 4HKXB 5D6DC 2PKDA 5FKPB 3H2WA 2DTMH 1P2CB 3FFCA 2YRZA 4PD4K 4TN9A 3LKSA 3QRGL 4PB9H 5EU4B 5INDA 3PWJA 5C3LD 4PJIB 3UJJH 1HILA 3I6KB 2I24N 1JYXA 2VR9A 2CUHA 2VZSA 1F4YL 5B8CB 5IGXH 4MSWA 2ED7A 4S1RL 3BFOA 1K8IB 2AQ1A 2ZSVA 3GIZL 2JIXD 5HYJE 2EDOA 3CK0L 2J88H 1OWRM 4XP1L 3NA4A 4P46D 3VWKC 2RIKA 3D0VA 1ZA6A 5DJAA 3QFDB 2JIXA 1H8SA 1ODAA 4KAQL 4MAYC 3BSZL 5E00B 4PTTA 1Z3GH 3S3SA 3U6RB 4M6OL 5D1QC 2ADIA 4BSVB 4WWKA 2EYSA 3R4DA 3P9MB 1KIQB 4H0GA 3B9DA 4LCIH 5IJKC 1NQBA 4Q0XH 1CDHA 1DQML 4DTGL 4XCYB 5EWIL 3TBTB 1OM3H 3WFBL 2QQKH 5K59F 2K7PA 1TTFA 4D2NA 5I30H 5EBWA 2EDTA 5LWYL 3IAPA 5F1IA 3CVIH 3SCMD 3LQZB 5E9DB 1HI6A 2AGJH 4JN2A 4AEIH 1U8KB 4FS0A 5ID1A 1QSVA 3UYPA 2ERJB 4DZ8A 5DD5L 3HZYB 2AEQL 4K3EH 2X9YA 1G7IA 3MV8B 5T33H 4WVRA 4EKXA 5FO9A 3INUL 3TN0B 5J6HA 4B7LA 3QDGA 1XCTB 4FQLL 3JTSA 3MLTB 4NUJB 4FFVC 2OR9H 3G5VA 5D71H 1S3KH 5ISZB 5CIPH 1OGAB 2OJEA 4KJYB 4MJIE 1CGYA 4PD4J 3VFPA 2Q6WA 1VFUA 2AP2A 3M1BB 5FYKU 5C9JB 3ULVD 3H9ZA 2YPKB 2VXUH 3NAAL 2X70A 5I1KL 4PJDE 2JCCA 3MRRA 5GZND 2M8XA 3MREB 2A2QT 3N9GH 3M07A 1BFSA 4Z7NF 4FNLH 3D0LA 3ARED 3O3EA 1UADC 3BH8B 4HWBH 2AV7A 4RAVB 4ZPTA 1D5ZB 4G43B 1H5BA 4IS6B 5J4MA 4KMTH 3V6BR 1KENH 4FXLA 1IAOA 3VFTB 1SY6H 1SBBA 4H88L 3KPRB 3REVA 2NYYC 3I6LE 3NACL 4MNQD 1UVQB 3TYGH 3UJTL 1GOGA 5HPMA 1HWHB 1CFSA 1ZTXL 3RVVC 3ULVL 4G9FE 5JHLH 5FUOH 4X98A 5E2UL 3IRPX 4YHIB 3WE6A 4XVSH 1IM3B 1KTDB 4Y5VC 2DDQH 3SE8H 3FTGB 5I15H 4G8IB 2A83A 5CEZE 1G7LA 3EFDL 5CJQL 3TA3B 4EI6A 2VLJA 3QXDB 1M6OA 1N59B 5FYLH 1ZLSL 1NC2D 4GW5A 3RIAF 2HVJA 2ADGB 1CU4H 1FPTL 2IPTL 3TBYB 1I8IB 4RGNB 4PREB 4MYWB 4HJJH 3T04D 4MD4B 3STLB 5JDJA 4TQEH 1D5BA 4GRLC 2EEBA 5F93C 3SKMA 3RZCA 1KOAA 2V7NB 2Q8AH 4HH8A 1OGAD 1BBDL 5D7KD 2X7LB 3HE6D 5KS9A 4QXGH 1IT9L 4R90L 4H5SB 3VXQA 2IQAA 5IESH 4G9DB 3WSQH 2FD6L 4PJCE 2XV6B 1LO5B 3RU8L 4WDIA 3BRGC 3MBEB 1UACL 1C5CL 3IGAA 2ESVE 4QTIH 3BP6A 4KI5C 4JKPH 5ICZA 4BZYA 3MRCB 1Z0MA 4OTXH 5JTWA 3RKPA 4OCWL 5HYJB 4Y4FC 5SV3A 3PGFL 5IFAH 4DUWA 4ACPA 2QQNL 4BFIA 4OZHA 1QRNA 1HZHL 2CDEB 3ZHKA 3GSRA 4HH9A 4LRNL 1W0YT 3SQOH 3LHPH 4C4KO 4JRWA 4ZUWA 1Q72H 4CN4A 2R0ZH 5DZLA 1K3IA 2AABL 4LSSH 2AS5M 3V5DB 1LHZA 1T20A 4G6KL 3PDDA 2XTJB 5DJCA 5HJ3A 3FRPA 2XXMB 1U92B 2ESVA 4NNYA 4P9HH 2V2TB 1U93A 4LSTL 3VFSA 1KN4L 4QGTA 4Q6IA 2AJYH 5I19H 2DAVA 3MCLH 5GS0H 3O0RL 2QQNH 3FN0L 1I7TA 3RY6A 1RJZB 5E24E 5IWLC 1WBYA 3TYGL 5DJ0A 4S10A 4F7EA 4FQIL 4LBEA 1CD9B 2NTFA 1UEYA 2EIBA 3QUXC 3D25A 2VWEC 1LO4L 1R3IH 1DE4B 3GMRB 1PLGL 3LAFA 1GPOL 3PXJA 1FAIL 3WLWD 5E2JA 5IKCB 4UAOC 3DETD 1TLKA 4XGZB 3R1GH 3BKJL 2PYEA 1G9NH 5JDSA 1SYVB 2Q7NA 3OJDB 3P0VL 4OGAC 4PR5B 1YC8A 4HFWA 1OAXH 1FNGA 2HJFB 2HWZH 4P49A 5GZOC 1WWAX 3O3AB 4ONHB 4KDVA 3OKOA 2APVA 1Z9OA 5KVDL 4LLUA 3WHXB 2DMCA 1CFBA 2I27N 3JTSB 2FBOJ 2HH0L 5DURB 4X6CF 5L7XH 3D85D 4J8RB 2DDQL 1WZ1L 3BQUD 3TFKC 1AXIB 4NO3B 5JHLL 2PO6B 2V2XA 5TQ0L 3ZT6A 1M7DA 1U8OB 1K2DB 4LEXH 1BOGA 3OKKA 1MCPH 3EBAA 1DQJB 4KJWC 3MRPB 3C08H 4UTBH 4KUCD 3VFMA 2ADFL 3MGTB 3TZVB 3ARGC 4P46B 5DA0B 4G7YL 4LU5L 4JFED 1MIEL 3W0WD 5GGQH 1G6RB 1DBKL 3SJVA 4X9HA 2MHAB 1LVEA 3ARSA 5F88A 5GS1B 2BSSA 2E7MA 3GJFH 2JCCB 4Q0XL 4YHMH 1VENA 4JPVL 4Y5XC 4GBXB 1FZKA 5C0AD 2MCPH 4UT7L 2ICWB 3BAEL 4OIBA 3TVMA 3SDDA 1UZ6F 4F7EB 1YEKH 1ZHNA 5DUBB 5KSUA 4WI3A 5GRZA 4E9LA 2CDGB 5ESAB 5C0FA 4WI2A 5KSAD 1SJHB 1NCAL 1T04B 1TDQA 2WV3A 4E0RA 5HGBA 3T77A 2OM5A 5GS2H 3RUGF 1QSFD 1J1XL 3DUUB 1AGFB 4YHOL 4XXDB 3BWAB 1Q8MA 4LIQE 4QHLA 4HJ0D 3T0ED 1IILE 5GS0D 1FNFA 2DYPA 1RPQA 1CXEA 2R9HC 4GMSH 4NHUB 1ZE3C 3GIZH 3UBXG 1CD8A 1RZIB 4N0FB 1YEDB 2DQHH 5FHAH 1WCBA 3QWOB 3QXTA 1TCRA 4N90D 5E8DL 3ZHDA 4BQ8A 4Q2ZB 4WFFD 1BOYA 1MFNA 1NPUA 3L5JA 5IHUL 3F5WB 1VCAA 2H2PD 4Y5VA 2W9EH 5CCKL 1FIGL 4WI5A 4Z6AT 2ZSWB 3BJ91 2CD0A 1S9YB 2WK2A 4L8DB 3L7EB 2VKXA 2R1XB 1FGVL 3KXFB 4KXZI 4CVZA 1JGUH 5CEZD 1OTTC 1TJGH 4NQDE 5ALCH 3GJEA 2AJ3A 2YPVL 5E2VH 1U8JB 1FBIH 4EOWH 4HWUA 4S1DC 1LO5A 2MNUA 5IF0A 1A6TB 3D39E 5GRYA 3HNVH 1I1FA 1JGDB 3B83A 4NM4L 3PWNB 4UINL 1D7FA 4KTYA 2AJSL 3QUML 1KJ3L 4NC1E 2QSCH 3FRUA 3UTQA 1FBIL 4JFEE 1AXTL 2HVKB 1QFUH 5TDPA 1UQSB 1F3DJ 1R5IB 1RI8A 2X4OB 1NBZB 4JCMA 1UA6L 2BVQB 3DGCR 3CDGB 4UBDC 3GSRB 2VITA 3O6FB 1J10A 3RL2A 4LVHB 4RA0C 4E41B 1KCUL 5H94B 4QWWC 1SQ2N 1X5JA 4ZUUA 1TENA 1QQDB 4NN7B 1RZFH 1QYGL 2DQEH 3ULUF 1GOHA 2ICEB 2CK0H 3C60B 2HT4C 4WY7L 4Z7QF 4LHUD 4QRRB 5T1DH 2Q76B 4OIAA 1KCSH 3RVXC 1NLBH 4G8FA 2V5TA 2MJWA 3PWPA 4KQ3L 2PTVA 4G6FB 1I7ZA 1F3DH 1VPOL 1IEBA 4D0DB 4L8CA 1QSZA 2NY0B 1G7HB 2IBZY 1NMAL 3A67H 3CMOL 5D72L 5ALBL 4WW1B 4L8BA 1RJZA 1OT1A 1YEDA 1FFNA 5C0GB 2R2BA 5HYQB 3U30B 1IQWL 2QLVB 4P5TC 3ZE1E 1SYVA 2BC4B 1BJMA 4WWKC 5BJTB 1DEEB 1WEJH 2GKIA 4M1CD 2X6MA 3CFBA 5CINL 5FYJH 3V0VB 4OF5A 3P4NB 1DQDH 2Z93B 4W6YB 4JFQA 4MXVE 5B38B 1JUFB 1J87A 4I2XB 2ERJC 2WWKT 1NGYA 3P40A 3W5MA 2BNQA 2W9DL 3TNNA 1CLZH 1CGUA 2FRGP 3PQYB 3KPRE 4PJXB 1FJ1B 4HPOH 1WIUA 1EEYB 4OZHF 4Y4KA 4JJ5B 4NKIL 4AM0B 4HUVB 2JB5H 2EH7L 2WBJB 2RB8A 1FH5L 3LRSA 3WDJA 3IT8D 3TN0C 1AP2B 1T2QH 1ZWIB 1KB5H 5CUSH 2B0SL 4YBLB 4L8SC 4X6CB 4GQ9H 4P2QE 4NO3A 5HGAB 5E6IA 2CR3A 3AXLB 3KPLA 3HC3H 2XYCA 1CD1A 1SHMA 5T1MA 5B4MD 4BYHA 1OSZA 1HH6B 2W1NA 3T09A 2ADIB 2F58L 3VH8B 3FHQA 1OTSD 4LNRB 4W4OC 5DRXB 2OL3A 4G9FD 1CQYA 3CLFH 1YNLL 3VRLE 2XWTA 4PV8B 1TZIB 2BVQA 4HKBB 3OMZA 1RU9L 4Z77B 1BLNA 3RWJB 4JGMA 3GMOA 4ODWA 1FFPB 2V5SA 4XX1G 3KJ6L 1A1OB 1DJSA 4JRYB 3IFPB 4PJ7B 3TV3L 1KNOA 3QXAB 5C2BL 3WBDA 1D5XA 1R0AL 3QDMD 3RKDD 1MWAH 3HB3C 4I3SL 4NDMA 1YMHB 5CP3A 1ZHNB 5K59E 2NZ9C 2VZTA 3RP1A 5K93A 4LSQL 3TP4A 2FYYB 2W60A 3S8WA 3ARGA 1KJVA 2E9IA 4NZUL 3TBTA 1BD2A 4O00A 2X4QA 5CEXB 4FQHA 1PG7W 2G75B 4HXBL 3RDTB 2R2EA 3WUWB 1PGRB 4ZNCD 3RZCB 4RNRA 2OR7A 4X4XA 5SWSB 4PRBB 5IMOA 3KLAB 2X5PA 2Z93A 3OKMB 3PHSA 3KPOA 3MLXH 3NGBB 5C8JB 4Y88A 3GSQA 1ROWA 4MNHA 2WQ8A 1JTTA 4OM0L 3PF2A 1HSAA 3PUCA 4HIXL 5FUZH 3O0RH 4HX1B 2WBJA 3TO4A 5CHNB 3TT3L 3VWJB 2VXSL 4NWUH 1FC2D 5L8KB 4P2QA 3E8UL 1ZV5A 2YUVA 4BSWA 1WAAE 2IAMD 2G60L 3N06B 2EYTA 4HV8A 2X4SA 4ZOEA 3HAEB 5IB4B 2FJGA 3EYUH 4GBXD 1N3NA 3KDMB 2GT9B 1I7RA 4XNQB 2D3VA 3QNYA 3P30H 5E70A 2O5YL 4ZOCA 3S88H 2J8UE 1WFUA 1MI5E 2M2DA 4HIHB 1ZT7A 4LRNH 5D93C 4LFHD 4MQXC 4YGVA 4JGUA 2KBGA 4ZNEA 1AGCB 2F5AH 4J6RH 3O6FC 4L5FL 1RMFL 12E8L 3JV4A 1MJJA 3C6SB 3OV6A 4JY6A 3GRWA 2A83B 4JFDE 1R5IA 2X4OA 1BBJB 3AFLA 3FB6A 4KPHH 3WS6C 3L5WB 1JF6A 4K94H 4OTXL 1MCHA 1QSEE 1RSFA 1U3HC 1CE1L 4YBLC 5JZ7C 4JKPL 3QUKB 1RUQH 4L1HA 1UACH 2ZKHH 3NCYP 5HPMB 5T3ZD 2X89A 3MA7A 1YYLH 3WSQL 1ZMYA 5C07A 5TGBA 4JRXB 1URLA 2OL3H 2HRPL 5EUOE 3SKUD 2HLFD 3OJMB 3VGAB 5FO7B 4NQEE 4G8IA 3VW3L 2V5YA 1J0YA 3C6LB 4JO4L 4Y1AD 2QADC 4HIIA 4XT1C 4HK3N 5JQ6H 3BZ4B 4QT5B 4PS4H 3UP1A 2VDPH 5E8NB 4Y1AB 1EBPA 1VHPA 1F4WL 1KGCE 3WFCL 2NY0C 4NC1C 3BZFB 5CP3H 3QCVL 2P8MA 1QBLL 4HK0A 5DTFB 4Z9KB 2GFBA 5ADOH 3VFRA 1MRFH 4NN5B 2CIKA 1A4JA 4OV5B 2X4UA 3TJHD 5I1HL 2HG5B 2XKUA 4X9IA 3HE6B 2E6JA 5C0CE 1CIDA 1IRAY 3P77B 5H37H 1C8PA 3QG6B 3OKDA 4NJAH 1R5VB 1QLEH 4JM2A 1DBJH 1E4XL 1ZT1B 3ZKND 1CVSC 3EO0B 3MRDB 3CC5A 4X4MA 4XP5H 3ZTNL 1QLRA 2HKFH 3RWGB 1F2XK 2XRAH 4OUOA 4YWGH 1JFQH 5F6HJ 2XPGB 5IVXE 4KKCD 35C8L 4CU6A 4Z0XA 4L4TB 2Y36L 2BNRD 4QRPA 4G8EA 1NGWB 3MYJB 2FEEI 4GAJH 2AJVL 4JQIL 3FQXA 4LNRA 3BKYL 4Q97A 3DX7A 2GSGA 5C09B 4Z8FH 1PYWB 3DV6B 3QG7L 4P5MB 1XIWB 5FV1L 2GK0B 3IKCB 4WHCA 5I1CL 2WW8A 2X41A 3GSVA 3TYFA 4I18A 1FZKB 2VDRL 3FAWA 4Y2DA 5FYKD 1J1OH 3BX7C 2VQUA 3B9AA 4R96A 1HHKA 1WT5C 1MFDL 1AO7D 1G84A 1CXLA 2C4FU 4MD0A 2PXYA 5DJYA 1BJ1H 4BZ1L 5CGYD 4QHNA 3VFSB 3RIFF 2OJZL 4ZSOB 1FVDA 3GI9H 5D1ZD 3RVUC 1NDMA 4JRYA 2I9TB 3HR5A 1R24A 4C83A 4LSUL 5LWYH 5C6TL 1IMHC 4MS8C 3JXAA 3U9PH 5F8QC 1WBXB 4F7TB 1MHCB 2GJJA 3CUPA 2IPUG 3HAEG 3DROA 5FKAA 2WWMD 4XWGH 5I8OL 4I5BA 1D3CA 3P4OA 5CP7A 5INDB 3ZKQD 4HFWB 3VXRA 3CH8A 4S2SB 1DVFC 2Y07H 3ROOB 2IH1A 3V5KA 1KBGL 3DV4B 3PJSA 2G75A 1XIWC 2MCPL 1PJ9A 3CSGA 4GXUM 5FYKE 1L9MA 4JPWH 3LN4B 4G6JH 4Q6YA 1N0XL 1XH3B 1NGPH 1UB5B 4GLRH 4WV1C 5CHNA 4PGBB 4NCC2 3IDIA 1R3KB 3H8NA 1X4YA 4NQED 1A1MA 2PETA 4YX2H 3U9UB 1T21B 5F7NC 5K9OA 2PO6A 4OFVA 3A6CH 5JXAL 4I0CC 4WEBL 1LDSA 3QFDA 4KVCH 4WWID 1U8OA 1VFMA 2XKSA 3QNYB 1MRCL 4PJ5A 3DURB 4WUKL 1F3RB 1PKOA 1X44A 4EUPA 4OIIL 3LV3A 4U1IA 4FQIH 4MB4A 3V7MA 5IUSA 2DLHA 3O6FD 3LS5L 3GK8H 4HUNB 5DZNA 1OAQH 1B3JA 3ZDYF 4P2QB 5KSVA 3OJ2C 3TZVA 5E1AA 5C09A 3RI5F 5BS0B 1GOFA 1NCWL 4ODHH 5I75B 4U6HA 2D2OA 5B38G 3HE6C 2Z31A 4NRZA 3I6KA 4OCXL 3FQWA 5E8EA 1EJOH 3D39A 5KSBE 3LS4L 3MX0A 4NN5C 5L88H 1EZVY 2VWEE 2V17H 3PHOB 1GC1H 5EOQH 3RI5K 3QPXL 5IT2H 3IJYA 4IOIB 4R4NC 3O81A 4NCC1 2ED9A 1CFNA 2YRPA 1T7XA 1I8MB 3BYYA 5ESVB 1S7TA 2F58H 5GS1A 1LK2A 3K81A 1I8LA 4OFIA 1KLGA 5AD0B 3F8UB 2CDGA 4YO0B 5ESAA 3HZYA 1IAIH 3BH9A 4PRPB 4KV5E 4QF1A 4G5ZL 3CSBA 4LDOB 3QYCA 3HC3L 1TTUA 3QSKB 5EULV 1V05A 1JNLH 3SDXB 1QFWM 4MAUH 3MV8D 4PJ9A 2RR3A 1PSKH 1WBXA 4ZUVA 3F7VB 4UB0L 3LKOA 5F9OH 1NAKH 3T3ME 4MQTB 1JPTL 4X6DA 3BW9A 1BQHA 2Q1EA 3GSXA 3MOBL 3MROA 5EOCL 2Q87A 3K46A 5B38A 4HIIB 3NN8B 3T2OA 4QXGL 1C16B 5GSVA 2Y7QB 2VISA 1A4JB 1ZSDA 3TBSB 4M7LH 1U8QA 4ZXBB 4MHHG 1IGJA 2NY7L 4PRHD 5HDLA 5IVZB 6FABL 5CMAB 1CGSH 2H41A 2AJYL 3TNMB 1YMME 4O5LH 3BEVB 1DEDA 4KI5E 5F9WB 3U46B 4ZOAA 2RQ8A 3SDXF 1CD1B 2AK4E 2VIRB 1JMXA 4M4PA 4WGVB 2OK0L 2Q20A 4K3GA 4QTHA 1XR8A 3L3OA 2QR0B 2YEZB 3FCTA 4Q6IC 1KYOJ 5DJ6B 1ZAGA 4IHOA 3WEXB 4U4BA 4M9OA 3QIWD 15C8H 25C8L 1A3RH 1NBZA 4PJGF 4I48A 1G0DA 3O2WL 3UTTA 4QY8A 3ARFA 3HLAB 1NEZA 4PY8J 5DGRA 3RGVB 2HT2C 2XKNB 1FO0L 3IF1A 3OAUL 5DWUL 3REWA 3U4BH 2ATPB 4XWOC 4WFED 2VLRA 4RQQB 4QTIL 5HYIA 1L7TH 1N5YH 3MRMA 5CIPA 4KQ4H 5JORB 5C0GA 1L7IL 3MC0A 5FA4B 3ZHLA 4RAHA 4DK3A 5IEHB 3QEUB 3UEZA 1A7QH 1K8DA 4DCQA 3D85B 2XWBB 3EFFA 3KPSB 1LO3L 1NCUA 3OSKA 3B9KA 1HYSC 1KCRH 3TO2B 3QJHB 4JO2H 5KZCD 5IBLC 2R39A 3GO1L 2IANB 3X3GH 2R1WA 2HKHH 2F8VA 5TQ2H 3JWOL 4IRSD 4RGMC 4YFLI 3MNZA 2VDLH 2BC4A 5JOFA 2VLKA 2YKLH 4OCXH 4HFUH 1CK0H 1Q0XL 5T33L 3QIBB 3GMNA 2FBJH 5D5MA 1VFAA 4K3EL 2R29L 4JZNA 4LPXA 4RMUA 1QPPA 2OQJB 2AV1A 4M62H 4PRIA 1FJ1A 3WMSA 1B2WL 1EA9C 1J8HB 1WAAA 1X5IA 1Z9SA 2IBBA 5EDXA 5ESQA 4JFXA 4OZGB 3V6FA 4X7DC 2X4SB 5DK2B 3RL1A 1LE9A 5JXAH 2C7UB 4PJHE 4FQXA 5TF0A 3ARDC 4L3EE 5DFVC 4JRYE 2XNAA 4ONOA 5TJWK 2BNRE 1MPAH 4LQFH 4PJHB 2XN9A 4HWNA 3OGCB 5GGVY 5EN2B 1JWUB 3GO1H 3DOSA 4PGBA 2VXUL 2FHBA 4C56B 2XWTB 5MEOB 4M03A 1GC1C 3BSZH 2VSDA 3BPOC 4O2FA 5FK9B 2EDYA 3GSUA 5J7CC 4R8WL 2OI9C 4NO0D 4WUUD 1H3GA 1JZ8A 1MNUL 4H0IA 2NW2A 3ZYZA 3BPOB 3S5LG 3CFKA 1RUMH 5E2TL 1NBVH 2PYFB 5EO0B 5ACMA 4Y4HD 2GITA 2I07B 1K5NA 1TXKA 2UYLA 2UWEA 4XP5L 4PJXF 1J18A 3MNWA 2QL1A 3S96A 2F74A 2A0LD 5C0EA 1JNHA 1IM9D 4MA8L 5GGVL 3L9RB 1A7RH 4P2OD 4C55A 2IANA 3VRLF 4DAGH 1GH7A 3CVIL 1I9RL 5DD6B 4ZUSA 1SM3H 3MV01 3UTOA 4FQHB 1W0WA 1YPZF 3I2CH 3ZKMC 1IAKB 1N7ML 1T0MB 5TF1H 5DQDH 5F3HA 5TQ2L 3DRQB 1EK3A 2H3NA 1NFKA 1L4IA 3NOIA 3MUHL 4ENED 4HXAH 2DJ4A 3QIBA 1YMMB 3VXPA 4ZAKA 1KJVB 4M6NL 4LVHC 5FYKL 3EJZD 3N1FC 5HGGS 1K2DA 1PKQA 5LGJA 2JJSC 2PW1B 4ZYKA 4MWFB 5SX5K 3TBSA 4LCCA 6FABH 2JJTC 4CKVX 1P5UA 1L7IH 1ONQA 4TNWK 1NC4B 1Q9KA 5EFIB 3VWJA 3IB4A 2DIAA 2C7UA 5I8CA 1IGTB 3PIQB 1GRWA 4HGMA 4KUZL 1DLHA 3ILQC 4MDJB 1ADQH 2J2ZA 2R0KL 1I1AD 1BHGA 4YZFE 3VGBA 3KVQA 4QTHB 3OR6B 3LEVH 3RPKA 3HE7A 4AYFA 1I8KB 2GJ6A 3WS6A 4CVXB 4RX4A 1HQ4A 3FONB 2IMNA 1MJJB 3ALXA 3I6GB 3RWCB 3R8BB 3ARRA 1SJHA 2DB8A 2UZIL 2XN9D 2VDKH 3QPQC 4P2YA 4KROC 5AG8A 1KLFA 2R4RL 3MLPA 1XIWD 5I73B 3ZE0F 4NPYA 3P30L 1GC1L 5EOQL 3IU3A 2E27L 4X6BB 4GG6F 5IBTL 4GMTL 1H0DA 4I9WE 4WEUD 3W2DL 4H8WC 5JORA 1JK8B 2Z9TA 2BJML 2X42A 1TJHL 1PG7X 2HRLA 1P6FA 4URTB 2ED8A 4OI7A 4PRID 1LO2L 5IMMA 5DS8A 4L4TD 3TT1H 3C6LA 2FX8H 4PRHE 3VXSB 2A6DA 3WNKA 3F5WA 3A6OA 3FQRA 3IXAA 4NZTL 5I1EL 3FKUS 3C60C 4R26L 5JW4Q 3KYMA 2VLKD 3DROB 2NY4C 1NAKL 1IKNC 1S9YA 1MAKA 5F89B 3SE9L 3VA6A 1G7PA 3TN0A 2PCPB 4HXBH 1FVCA 1KB9J 3OB0H 3RTQA 4JHAH 2F5AL 3OHXB 1BWWA 3B9KD 3MRRB 3MGAA 5HHQB 4GKNB 4JPIB 1TNNA 2FX9L 3QHZL 1MWAB 4XPTH 4NGHL 3VH8G 1M7IB 2Q6WB 2VDRH 3U9UA 1JYNA 4UQ3B 1CU4L 1ZKAA 3BVNB 4OD3L 2JB6A 1MWAL 5AZ2H 3UAJD 3AREB 2IG2L 2G60H 1GZPA 1ND0A 4NYLB 3E8UH 1EEZA 3MLRH 1FSKC 3LZFH 6CGTA 4X5XA 5C9KA 4JFXB 3G08B 2DM2A 5IOPB 5C6TH 2P24A 3MO1B 1PG7H 2FH8A 4OZIA 3ZTJH 2VE6A 3UJTH 2NLJB 5E8EB 5F8RC 4UOW0 4FA8A 5IF0B 4Z0XB 2JIXB 2B4CH 3DBXA 4K3JL 4UV4L 2XTLA 3NFNB 4M5YH 1JN6B 1R24B 4C83B 2WP3T 1WV7T 5IBUB 4HK3J 2P5EB 2O26U 1D5ZA 3BMVA 3C09C 4G6AC 2NY5C 5KTEH 2NW2B 5D1XA 5T1KA 2GI7A 4LF3A 4OZFG 4PGEA 4GQ9L 3DV6A 1T2QL 2WIIA 3FT4A 1N4XH 2PXYB 3HI6L 4KMLB 4YDKH 3E6HB 4NRYA 1EMTL 4OQTA 4MGXA 2OR8A 2MFNA 3NAAH 1TZGL 3REVB 1DLFH 3VXRB 5FGCB 5KOMC 4ESKA 1P4IH 3GMMA 3RZWA 3LEXA 4JG1H 3MRNB 4DN3L 4Z7VF 1TZHB 5JW3H 1OT2A 3U36A 3H3PL 1LE5B 2QV2A 5FYJL 35C8H 5IJVA 4K7FB 3DHMA 2Z92A 1VESA 4UIMA 4ZSOA 4PGJA 2OZ4H 3QEQA 4JFFD 2B2XH 5F7DA 5GS1C 4YHLL 5HVHC 1QSFE 3SKJL 2GQHA 3OB0K 3T3PE 2B1HL 1S7XB 2VC2H 3CH1B 3V0WH 3K2UH 4U1IB 2R2BB 1JHLH 3MNVA 1M7IA 1Y6KR 3WN5C 5EIQA 4M7LT 1RHHB 4IJ3C 3ROLA 2EDEA 5D7JD 3WDIA 4S0TD 4C59B 2OL3B 5E99L 2BRQA 4OBSA 3KYKH 1XFPA 3LDBB 5I8CB 5J12B 3MLWL 2H8PA 1UM6H 1CICB 2IJ0C 5KVFH 4NQXB 1AJ7H 2WBKA 2PR4H 3NABH 4MQXD 2UVFA 4L4VD 3QXVA 3D39D 4MJ4A 3CZFA 3I6LD 1HDMB 1MHHA 4ODXB 1U3HA 3VXMD 1MCWM 3B5GA 2ZUYA 2YS4A 3LCYA 5IMKA 2A6JB 1Z2KA 4PJBE 4PLKC 2EDLA 1CLZL 3VXTB 3IYLW 2XT1B 4JFZL 3GHBH 2GJ6D 4HWEH 4QCIA 3CXDL 5DJZA 1MRDH 3HE7D 1I3GL 1X6NA 3F7YB 2DRUA 3IU4H 4N8CH 5D7IB 4KY1H 1FZOB 2XIDA 3QIUA 1FFOB 4I4WB 1IQWH 1J1PL 2X1WL 2VLRB 3PE9A 1FRGH 1NAMB 2VLMD 3G6AA 4AH2A 3X17A 5I16A 5HI4D 2W0KA 3QFJE 3IU3B 1NCCL 4X6BA 3DX6A 1LEIA 5DEFA 1YYMH 5HJ3B 4TNWF 4DKFL 4Z77A 2WLYA 5IB1B 5L2JB 1VFBB 1YPZA 32C2A 4YC2C 2YA2A 3OKYA 1YEGL 5JUEH 3TO4C 4RMVA 4WY7H 1AH1A 5JOPD 3WO4C 4LARL 1TMCB 3EDEA 5J6GA 4JFPA 4D9RE 3OJDA 2DLIA 1VEPA 4H1LA 4LNVA 2YSSB 4JLRB 4M6AA 1EFXA 1AGEA 4LIQL 3SKMB 3BGFB 3IKKA 1S9XA 4KROD 4Y89A 4OFKA 1ED3A 3GUTB 4Y5YA 5L2KE 2H26A 1GGUA 2PCPA 2J4WH 1XR9B 3C8HA 2IAMC 3WLBB 4WDIB 2F19H 1I9JL 3V5HB 1UWGL 4NRXB 1FRGL 1P1ZB 5ADPL 5HSFA 2VZOA 1BQUA 3C8KB 3RQ3A 2BHUA 3NZHH 4PJCF 4ENEC 5KANG 3VRIA 3P4MB 4JY6B 4YXLH 4J4PC 3SHSA 3TM6A 1BBJA 3RAJL 1K85A 2COQA 5I66B 4C57C 2QADB 3U0WL 1J0HA 2AQ2A 4J6RL 2VXTL 4WO4D 3QQ3B 3K8KA 5JLZB 4NZUH 3RNQB 4RGOL 1TITA 1N3NB 3KDMA 2Z91A 3L3DB 5E8DH 4M93B 1QR1A 4C4KT 2BNRA 3MV9B 4LEOA 4BK4A 2PF6A 3MLUL 2ITCA 2EYSB 2EC8A 4QT5A 3DECA 4C56D 2C3GA 1RK1A 1CTNA 1HI6B 3S7GA 4JB9H 4P2RA 2E9BA 4P23C 3QWOA 5FUZL 4HUUA 4D9QD 3QEGL 4PJFA 2J5LB 4XXDA 2FJFB 1GSMA 1J11A 2V9QA 3VCLB 3R0MA 1UXSA 5C70A 5T3ZE 3QDGB 5JW3L 5M7QA 4Y5VB 5E95B 1T0PB 1G6VK 5HHNB 2H32A 3S37H 4OGZA 1LD9B 1RJLB 1UM4L 3BUYB 3GRWH 4F7MB 3B9KB 2AEWA 1G9NL 1XCTA 3SQBA 1NDGA 1D9KB 3TA3C 5GGQL 5I9QC 4Y1AA 5BQ7A 1OQXA 5C0ND 5C0JA 3W5NA 5BVPL 1P84K 2ICES 3HPLB 1IC7L 1ONQB 4UT9H 4ZFOB 4I3SH 1JNNH 5DD3H 3CU1A 2R56L 3VRIB 4EI5D 5GRVK 1R0AH 3D5OF 3G6JF 3WXVH 3AY4C 1XGPB 2YD1A 5D1ZC 2BOBB 1BVKB 2OQJA 3CH1A 5TE6L 3FO2A 1FNEB 2WBWB 5L2KD 3QULA 1DQJA 4K55A 5IBLD 3K3QA 2JCCE 2CLZA 1X9QA 3A6BH 3BH8A 4NN6B 2NY3C 2EDBA 1MCQA 5FA3A 4G43A 3SO3C 5TDPB 1UQSA 3CC5B 2NTSP 5F7HA 4WO4A 4LLVB 1U8MB 4NBZB 3D6GA 5CBAA 4ZO7A 1F4XH 5EC1B 4P23B 1A7BA 1A6TA 1X5YA 4WI9A 4KKNA 4Z7WE 4DUXA 2XQBL 4NPYB 4L8CB 2LQRA 2CDFA 1S7RB 2YN3A 3SKOA 3QNXB 5F6HI 1RURH 3VXTA 4DVBA 1C12A 2F9BT 3ETBF 1QRKA 1W0WB 4ONGH 4PG2C 1YA5A 1JBJA 2JB5L 4MD5B 4NZRH 3ARWA 1U58A 2R15A 5D96B 1W72B 2DM7A 3ECBA 3SGDH 4QRPE 1NMCC 2QQQA 2ZCHL 1HHHA 2I26N 5CGMA 5F71A 1NAMA 4RBPH 4ODTH 5DC9B 2X09A 1QSED 3SKNA 1FORH 3MBEA 3D9AL 1IC4L 3DO3A 5CINH 4NZTH 2PYFA 3LPWA 1E28B 3DVGA 1NC4D 4JN2B 4HQQL 4N0FA 1DBMH 2X7LA 4LAJH 7CGTA 3I50H 5KSAC 3HRZB 1EFXB 3O3BB 1MREL 4H5SA 3VXQB 1NMAH 5ALBH 1FVDB 4MHHI 4L4VE 4X0KB 3W81A 3R0NA 1S78C 4CNIA 4O02H 2OTUB 1G7MA 2KZ1B 4ONFL 4M93C 4Q9QH 4LLWA 4ZO8A 1RUKH 2FECL 1MVFA 1F8TL 3V5HA 4F58H 4UT7H 1TVDA 4D0BA 4KTEL 5J9PA 1S7VA 3L3JB 5HGAA 5B8CC 3HZMB 1YMMA 1U2CA 1WIOA 3KXFA 4M3KB 3VXPB 1AY1L 4U3HA 1KSRA 3V4PL 2CGRL 3BGFC 3CXHK 4I13B 3X12A 1DL7H 1FYHB 2BXZA 1SEBB 4Z7UA 3VFWA 3QIUD 1LO0H 3VH8A 2YN5A 3WFEL 3ZKXB 2OTWA 4R3SB 3KXFE 3S97C 4LU5H 1LNUB 1KXQE 5F7LB 1IGIH 1A7PL 3CZJA 4U1KB 3BIAX 1ZHKB 1GL4B 4PJIE 4OGXH 3FRPG 3TWCL 4CVXA 2GUOB 5JLZA 4G9FA 1CDYA 1VACA 1Y6NR 4JN1L 4PY7A 3TFKD 2LAAA 3CDCA 2D0FA 2ZUQB 4XCCL 5BZDA 3BH9B 4PRPA 3IDGB 4NO2B 5ALCL 4HWEL 4AJ0A 1KTKE 4OCYH 4DEPB 2BVYA 2YWZA 2CLVB 1JZ4A 2WLZA 1NCDH 5HHPB 3L3KB 1FFQA 4WEMB 3S3PA 4RNRB 4UMGA 3STZB 2NY2D 1SMOA 5DFTA 1OF2A 5AZ2L 4P4KB 2W60B 1ZLSH 4EBQL 5FYLL 5KVGL 4XPBL 5GGTA 3AMKA 1B6UA 3F12A 4GW5B 1DLFL 2EE2A 2ADGA 5EU6B 1YEHL 4ZXBA 2EDDA 5EIIB 1KIRB 2JCCF 5F6IC 5ESVA 2DQHL 4KK8D 3U4EA 4TUKH 1G7QA 2C26A 4HV8B 4WGWB 5IG7A 3C87A 4Z7OF 4K3JH 4P9MH 3UZQA 2NNAB 4IJ3B 1IGYB 1S5IH 3T0EE 3HTLX 3G6JB 4N8VA 1JPGB 5JXED 5DJ6A 5GRUL 3HKFA 3V7AG 2X4NB 3TT1L 3FB7A 5T1KD 5JHDB 4NKMB 1PX4A 4UU9A 1P4IL 1AKJD 4QHMA 1LO2H 3BRFA 3FMGL 1C16A 2VE6B 5GSVB 1T03L 2NR6C 3I75A 4JGJA 4Z78A 4NKDA 2A1WL 1UYWL 4R3SA 4YDKL 3VFMB 3FT3B 2WM0A 1IC1A 3IFLH 5HDBE 1BFVH 1MPAL 4YEFA 1L9NA 2UZXB 1AO7B 4QCIB 2HFGL 3HC4L 1T89C 1U41A 3OG4B 4EJ1C 5C7XH 1HN1A 3W11D 4GSDH 3VMNA 5IEHA 1Q0YL 2B4CL 1YNKL 3BP5B 2DKUA 3S35X 5EZLA 4PG9B 4UTAL 2VUOA 3CMGA 5FIEA 2C3XA 3BE1L 1Z0NA 4HHAA 2CJUH 2AI0L 3IDXL 3NCBB 4L9LB 5C0CD 1DR9A 5FM4A