4ZFZB

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 15
structure length 100
sequence length 100
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzB00
2D7OA 2YPKB 3WS6A 1UB5A 3BP5A 3WFCH 1NUFA 3OL2A 1NFIB 2FX7H 5J06A 3O2DL 1R5WA 5DQ9B 4PR5A 1OARL 1F4AA 3H9SE 5IMKA 2FB4L 4TUJB 4Y1AE 4NGHL 3FL7A 1OTSD 1G7PB 4QHNB 4UQ2A 3FB8A 1N7ML 1FJ1A 3CVIH 5FO8A 4KVCL 2IBGA 1YNKH 2P24B 5C0JB 1LD9B 3O3EA 3RGHA 2BSSB 4MQSB 1LNUB 5DR5H 1EEYA 1DUYA 4PIRF 3P4NB 5L2JA 1IARB 3IS0X 4Y4KB 5F71A 4JAMA 1CDIA 4N9GA 3PHOB 1FGVL 4M7LL 2AI0L 3JV6A 4PRDB 5TGBA 3MREB 1QSZA 4F7EA 3LKRB 3ZZ1A 1ZLSL 4PLOB 5ENWB 3VXOB 4PJGA 1TNMA 5KSUA 5D7KE 2HT2C 2DQDL 2N4IA 2YRZA 3WNNA 4I3SH 4PYGA 1IAII 2XTLA 1MCKA 4NOFA 4PJAF 2EZ0D 5DFWH 3HRZA 4MB3A 3IXAB 3IJYB 1ZA3B 4ZO6A 1HILA 5GGQH 1CGUA 2OYPA 5MENB 5EFIB 4FTVD 1FVCA 4FQHA 4LEXL 1KSRA 4WWKB 3MV9E 3MOBH 3EOTL 3HB3D 3IU4L 5ANME 4J6RL 1GAFL 3G6DL 1MHPH 2HN7A 5J4MA 2ED7A 1WVZA 4QHUA 3ZSSA 3FAXA 3EZJB 2MCPL 4Y19E 1W72L 3SE3C 1S7SB 3PHQB 5E9DD 3FRUA 1ND0A 4Z7UA 4Y4HD 1CE1L 4QOKB 3QG6A 2Z31A 1YEIL 2VQ1B 3QCTH 2Z91B 2X40A 1YMMB 5TE6H 1KCKA 4LLDB 5AUMB 4OV5B 4LLVB 1IM9D 5MI0B 2E7LA 2R0ZL 3IDGB 1R3LB 4K55A 3BEWA 2P5WE 3BPCA 4HPYH 1PQZA 5ALBH 3QIWC 5EZLB 3WSQH 2NX5A 3P4LA 3TYGL 4S1SL 4KWUA 3BH9B 5D1ZC 5JDJA 5CMAB 1A3QA 2X4SA 4GXUN 2GJJA 2C1OA 2AK4B 4PRNA 1RZGA 2PXYD 1R5IB 1UWXH 3E3QE 1D5ZB 4ODSL 5E99H 2OZ4L 3T0XA 1SHMA 2AXHA 2EH7H 4ZD3L 5K9JH 2CGRL 4K7FB 4GW4B 5H94B 4WHYH 5JUEL 1QNZH 3LKSA 3MXVH 5TPWL 5CCKH 3H9SA 5FECB 4NT6B 3BVNA 2CIIB 3IFLH 2X89D 3ULUH 3WFCL 4NCDA 1UACH 4HIEA 4NN6C 2YUWA 4H0GA 1QFUH 5LAXA 3KPNB 5D2LE 1EHXA 1E4XI 2PW2B 1AHWA 3TPUA 3VFTB 2OK0H 4G5ZH 4KKAD 2OTWB 2YKLH 1EHNA 3TIEA 4ELMF 2IANA 1MCJA 3DRTA 4ZS7H 5D6DA 5D96B 3HCVB 4OCWH 1KYOJ 3JV4B 4HIXH 1IGCH 2CRMA 3KHOA 4LP5A 4WEMB 2HT4C 5IHBA 1G0XA 3VXRE 5KANI 4XB7A 1XGPA 5IW6A 2HAZA 1Z5LA 3FO0L 5BZWA 2XQYG 3QDJD 1YEDB 1U8JB 3OHXB 5I1LB 1DUZB 4JN2A 2EXWD 4PJ9C 4BFEA 2YK1H 3HZYA 4RRPA 1L0YA 1S9KC 1R3KB 5KSAC 1X44A 2HJKA 3O9WB 3RZWA 4HFWA 5DEZA 1JVKA 2F15A 3FQXA 3HKFA 4AM0A 5KVEH 2JCCB 5GJTL 2CXKA 3SE9L 3PWLB 4QHMB 4P5TC 3K80A 3SOBL 3BP4B 3EYSH 4AG4H 3QDAA 3TBVB 3KNBA 5ANMA 4OFYA 4OM1H 4HS6B 4HDIA 2B0SH 4QGYA 3DV6B 2Y4SA 1K4DB 5EA0H 3PWNB 4OKDA 1JZ7A 1DLHB 2ITDB 4AIOA 4TOYH 3N9GL 4MJ6B 3CX5J 4PD4K 1T7WA 4Y4KD 1YPZB 1WBZB 4JFED 1MHPL 4PJIB 3KYKL 4Y19A 5FO9A 4HKXB 4EVNB 1FORH 2DL2A 3D85B 4LQ1A 3B83A 3QO0A 4NPYB 3CAFA 4HX1A 4WO4A 1B4JH 2G2RB 2ZUQC 1DDHA 2JJTA 4MQ7B 1EDQA 4HCRA 1IEAB 3VJ6B 3ARSA 1ZVSB 3U36B 4D0DB 2OR8A 4OTXH 4BUHA 4NBYB 2P5EE 3NCBB 5MEND 3CFKA 4O2CA 1GVIA 5I76A 3HE7C 3S88H 2VWEE 3VFUA 4DCQB 1UEMA 1N59B 1U8LB 4P2QE 2VZSA 4M1CC 4QF1A 2LV4A 1JZ8A 4PJ8B 3I2CH 4HWNA 8FABB 2HVKB 3I9GL 1OGTB 4QT5B 3CDYA 3GMMB 3EHBC 3P30H 4AQ1B 5I1AB 4Q9BA 4NQEB 4MS8C 5CJXA 3PGCB 4AEHH 5IFJA 1OP5H 1KLFA 4KI5F 2XZZA 5JMRA 1HDMA 1BOYA 4P3CH 2WIMA 1CFNB 5IMKB 2NR6C 5DK3A 5IK3B 1BM3H 2VDKH 3P9LB 4NWTL 4MJ5A 3T4YA 3C5ZA 4O58H 4JO1L 3S37X 2AQ2A 2ESVE 2E8ZA 4GRWH 5DWUL 4QOKD 4ZMAT 4AT6A 3WIHL 1WGOA 3BQUA 5EN2B 3O45A 2AXFB 3O3EB 1IMHC 4XMKH 3LS4L 5D2LA 3EZ8A 1F6FB 3KYMA 2HRPH 5CCKL 1J0YA 2X4QA 2YPLE 3F7YA 4JFQA 3R8BB 1MCBA 1YMMD 2DQEL 4H25A 4JAMB 4N8CH 3ULUL 3X13B 2PCPB 4HHAA 4WNQA 4X7CC 3P40A 3MCKB 4Z77A 2GYSA 5DMYA 4ODXA 4UU9A 1AQDB 5E56A 2HYMA 1CYGA 2UY6A 2X4NB 5DMIH 1U2CA 1A02N 3QH3A 3VXRA 3UZQA 5KSUB 2ZCLH 2AK4D 3KLSA 4HIXL 1IGCL 4FQXA 5DJ2A 4U1SB 1PYWB 3X14B 2YHGA 4DOHE 1OLLA 4FABL 3S34H 2RR3A 2DLGA 2BVYA 2HRLA 5E8EB 4UBDC 5EU6D 5L8LB 2AJXH 1DQTA 3CVHA 5DS8A 4X83A 2MKWA 1FL5B 2NZ9D 2QADD 1WZ1H 4M5ZH 3GM8A 1HQRB 2QEJA 2XYCA 3VXTA 4LL9A 1IKNC 3BXNB 3T3PE 3GMOA 1PBYA 2A6JA 3EYSL 5FGBC 1CD1A 4Q9QH 5TDOA 5K9OB 1JGUH 3X11A 3A67H 4PS4H 5ESVA 2VUYA 5E2UH 3FRUB 1NSNL 3QUYA 1QSFA 4X6FA 5IJVA 4WUUE 2YMXH 4TOYL 2IG2H 3QG6B 1HEZB 3L5XH 1PDKA 4Y5YB 1H5BA 4UILH 4E42A 4G7YH 1KENL 4RGMB 4KK8D 1IC4H 2VLKB 1IQWH 1LK3H 1K8IA 5DRXB 1KN4H 4R7DB 3I84A 3PV7A 4HG4K 3MJ9L 3D9AH 4K7PL 1UM5L 5FUOH 3TA3A 4LSPH 1NKOA 4EN3D 2YBRA 2APWA 3O9WD 1HYRC 1RSFA 3QRGL 4XTRC 5EORH 4PY8I 2P5EA 4JRYE 3VDBA 3G5ZA 3AS1A 2APTA 5I6XB 3NA9H 4HUUB 3OJVC 3V4PH 5IBUG 1Z2KA 4P2QA 4KMQA 4EUPB 4AIXA 2CDFB 3NPSB 5FB8A 1S7TA 4HKZB 2ERJB 3H6JA 4V1DE 2HFGL 1RI8A 3O6KH 2DI9A 3SGJC 1R5VB 4LFHD 2X1XR 1NCTA 3MRBB 3I6LD 4I0PA 4PJ7B 3MYJA 2X10A 5LQBH 4Y1AB 5TF0A 4XPGH 1HH9A 1MRFL 1H9VA 4AJ0A 4PRPD 4LHQB 3D85D 2P8PB 3AMKA 2JJSA 2Z8VC 4R8WH 4WENB 2V5TA 4MXVF 4AEHL 3NVQA 5DEFA 3MOAH 1OAXL 4L8DA 1QLEH 3MBEC 2GI7A 4U1LB 1QBLH 3C5JA 1K5NB 3UPRA 2VO5A 1Q1JH 2KQMA 3CLEH 4CN6A 5JQ6H 3VFVA 3DIFA 4OLUH 2NLJB 1AD9B 1UCBH 3EYVA 4G6JL 2XACC 2HRPL 3K2MC 4HFUH 2H41A 2D31B 3NCJL 4N8CL 2X70B 3X3FL 1AIFA 3TWCL 4QNPF 3IVKA 2C1PB 3DLQR 4PJ8D 1IAMA 4MDJA 2HJKB 4ODBD 1HXMA 2GSGB 2UUDK 3O2DA 1P4BH 4OKVB 4KRPB 2AS5M 3RHWK 1DVFB 4OFIA 1N3NB 3ARZA 1FAKT 2B4CH 4RQQA 3D48R 1KJ2B 4PGDB 4NQED 4AEEA 5HSFA 2OX5A 1YQ2A 3MV9B 4P99A 4OD3L 4PGBB 1J12A 4G80A 3QG7L 3ULVF 2YD1A 3BEVA 2YD3A 3J8F7 4LVOC 1G7JB 2P44B 4JG1H 4FQ2H 5IVXF 3B9EA 2H32A 1CICA 5ECJE 3W9DA 1WZ1L 3AXLA 3GMPA 4M62H 4QRTA 4V2BA 2R0WL 4YDLC 4X5XB 5TE4H 5AG8A 2Y9RT 1I7UB 3L95A 5MHSE 4HS3A 4WCYH 4IS6A 4WHCA 1ONQA 4WUUA 4LSRH 1P7QA 4ZPVA 3F7RA 4HUNB 3RKDC 2O5YL 1SJXA 1JGUL 1MUJA 1A14L 2DYPA 4KROD 4Q6YA 4J7RA 3V5DB 2P5WB 3FOLB 3ARGB 2OBGA 4JM2B 4JRYA 3T2PA 1IQWL 2FATL 1LK3L 2XQBL 1JZ4A 3LQZA 3D9AL 5D1XA 4QF1B 4KTYA 4TTDD 5E2TL 3HHRB 1CFBA 5CIPH 2LU7A 4ZUSB 4DKFL 1NQBA 3QQ9C 5JPMB 3OJ2C 1TZHB 4GS7B 4E41E 4V1DA 1V8HA 1KPUA 1NCBH 4YGVB 4X5WB 4OT1L 3RY6A 4LHUG 3UYRL 3RWHA 5GIRB 1I7ZB 3MTRA 3QUMH 1U58B 2ZCHH 4TQEH 5C8JA 3GI9L 1S9XA 4J3OC 4QHKI 1GXEA 2DMKA 1BJ8A 4HH9A 1XGTB 4U3XA 5DFVC 4W81A 1UEYA 4XRCB 4PJBE 4ODVH 2JB5L 4R8WL 4XCNA 4HZAA 3T8XB 4YBQC 3C6SB 3GBMH 3PGFH 4KDTC 3KYOB 4XAWH 1UCTA 3QH3B 5C0IB 2EH8H 1FN4B 4PJ5B 1QBLL 4XC1L 4YR6A 4OAWA 3CLEL 4FOMA 4UIKL 1F6LL 5IEKB 1X5FA 2ORBL 3VE0A 5JTWA 4FQQA 3C60A 4RA0C 1JWSA 1OP9A 5ICYA 5EO1A 2R39A 3RNKB 5DS8B 1IGTA 4DUVA 1IGFL 3VCLA 1CK0H 2HKHL 3B4NA 4I77H 4OLZL 1JPFB 1EFXA 4XX1G 4K23H 4Y1AD 3A0OA 1CG9B 1VEMA 2Y6SC 1P4BL 3THMH 4HQQH 5B38G 1ITCA 2B4CL 1A6ZA 3ARFB 4NZTL 5MEPB 3ULUE 2A6KB 3IDMA 4ODTH 3TZVD 5DD1H 4LKCA 4ZOAA 1T83A 3NACH 1I9IL 4MCYA 1EMTH 4TUOB 5ESVB 5F1IB 4WFED 2F8OA 4XPTH 4D8PB 3SO3C 5FO7A 3U7YH 1NCCL 3MRHA 4KXZH 2VDQL 1DE4A 3DI3B 3S3SA 4E42B 3ZE1F 3A6OA 4U6YA 3MLWH 1KG0A 3EOYG 1HHGA 4FN0A 1XGUB 4KKLC 3VXQA 5JOPE 3WFBH 3RGVD 2GY7B 4CU7A 3MUZ1 1JN6A 5F88A 2AGJL 1LEKA 5GRVK 3NBNA 2I26N 2XN9D 1F2QA 2H2SC 4Z78A 1FZOB 4LSRL 4XZUB 4YJZL 1DVFD 4DEPC 5FYJU 4FRWA 3RNQB 3OKMA 1I3UA 1RJYA 2ADJA 2OMNA 4TVPH 3OXRB 2FIRT 4KPHH 1RUPH 3I50L 3IAQA 2E8YA 4O9HL 3B6SB 5EZJB 1WUNT 5GPRA 1JI2A 1BBJA 2VDLH 3FQUB 1YZZA 4E41A 4HH8A 1U8OA 4C83A 3RX5A 1H3PH 4UMGA 2M1KA 5C86A 1RZ7L 5IMOB 4O02L 1EAPA 1CQKA 5IQ9B 1UB6A 1AXTL 3MLVH 2ESVB 1DR9A 5E94B 3MFFA 4G8IA 3GJFB 4LPXA 3QUML 2YPLB 1FZJB 2ZCHL 4TQEL 1AGBB 4GAJH 5F3BA 3T0BA 4HUMB 3VD7A 4PJBA 1XZ0B 1F4HA 5ACLA 1XCTB 4PLJD 2X05A 1WFUA 2P5WD 1UXWA 1HWHB 1G1YA 4P57A 4JM2D 4ZPTA 3TV3L 1YA5A 5C0AB 4S2SA 2BCKA 3P0YL 1NC2D 5JW5B 4Q0XH 2FGWL 4KZEH 1KIQB 1T5WA 3GBML 3PGFL 5EOCJ 3WEXB 3FO2A 4I48A 5IVZA 4XVJL 2EH8L 4XP4H 4HK3N 4NKMB 3EJZD 1QHPA 4WTZA 1KTRL 4XNQA 1JWMA 1WWWX 1HSBB 5I19L 1J8KA 2X7LB 3DVIA 5GZOC 2QSCH 4ELKA 4JY6A 2FJHB 3NTCH 3WIHA 3NIGF 1KIUA 5CEZL 5FEBA 3ARWA 4ZO7A 2HTLC 2WAHA 3MO1A 4PFEA 5C6PB 2EDYA 3B9KC 3OKKA 4K23L 3GMPB 4CDGC 3OKNA 4P2YA 3QWOA 3THML 4MXWH 4XNMB 2IQ9H 43C9B 5KVFH 2QJDA 2GAZB 4S1QL 4UAOC 1D9KA 5A16B 5FA3B 4K7PY 5HHPB 3WD5L 3GNMH 1IC7L 4KKCD 4PJ5D 5DD1L 1U8KA 5TQ2H 1YMHA 1A6UH 3D0VB 5EOQH 3RI5F 3DGCR 1B9ZA 2J8UB 3ROLA 2WANA 3ES6B 3U7YL 1IE5A 5HHNB 3MROA 5E6IC 5CILH 3WE6B 1C5DB 4QXTB 4GMSL 3CH1B 1J87A 2FNBA 4JRXE 4MNGB 3CCHA 2HMIC 3ZDZE 1AGCA 1J10A 3P9MB 2X4PA 3MLTB 3SQOH 2HT3D 3SKNB 3CFCH 4PJDE 5IV2B 3OR6A 4LLUA 3B9VA 3QQ3A 3ARFD 3D2UA 4JO4H 4X5LA 4TVPL 5ERWA 2L7JA 3WCYA 2BHZA 4PJXF 1W72B 4BFBD 4KPHL 1RUPL 2F58L 3STLB 3UAJC 3RWHB 3KPSE 4M6NH 2XWJA 3U9PH 3GSVA 4O00A 4P23A 4YQXL 4JFEA 1RIHL 4JFDE 1QEWA 5EU4A 1T1YA 1J86A 3DX6A 5DK2B 3SEPA 3DROB 1XF5A 4L8SA 1H3PL 2XTJE 1B0RA 4KFZC 5FV1L 5I16B 1TDQA 3QFDB 3V7AG 1HNFA 5IMLB 4G8FA 3U2SB 2XFXA 3TFKC 3RJDA 3T04D 3VFWA 2OLDA 3WFZA 1WIPA 2EDTA 2F74A 3V0WH 4YEFA 4W4NA 3AFLA 3OZ9H 2VITA 1ZHKB 4P4RA 4QLRA 3CGTA 2R2HA 1JCKA 4U6HB 5T3XL 4M48H 3TT1L 1T21B 4KV5E 1T1XA 1JPGA 4D9QE 1EJOH 5CZXC 2EO1A 5FGCE 4RRPG 4WI3A 3WUWB 1BBDL 15C8H 5D8JL 1EVUA 4FXGA 5TH2B 1OP3H 1V7NH 2CO7B 5GSVA 4Z7VE 5FDYA 1A7PH 3CFJA 2DQCH 2HA1A 32C2B 1K4CB 3QIWB 3GBLA 1IAOA 3ALWA 1PKQA 2MHAB 1FCGA 5D1ZB 3BZ4A 3NAAH 4NN5C 2HFEA 4H20L 4YHML 4Y89A 3QDMA 4KTEL 3IAPA 4I3GA 3ECBA 1YY8B 2ZNWA 4OZIF 4OSUL 4LCCC 4Q6IA 3BIKB 4KMLB 4UT9L 5IGXL 1QZ1A 3FCTA 4JR9H 4GAYA 4F3FB 3CJJA 5CUSL 1KIRA 3VU2A 1KT2A 5C0AD 3QPXH 1RIVH 5T33H 2FSEA 1MRDL 4NN6B 5JLZA 1AR1C 1JL8A 5KVFL 4DQOH 1MCNA 2WBKA 5I1EH 4JHAH 4DGYL 3B3IB 4Z78B 2W0PA 3RL2A 5IB3B 2C9AA 1RJYB 2WWKT 4Z7OF 3JBG7 4EI5C 2ICES 5CILL 1F6AB 5IVOA 4PJDA 3KAAA 3ZDXE 4PJ9B 3W81A 2J4WH 4JN1H 3WIFB 3JTSA 1BQHG 4E41B 5KSAB 3L3KA 4XHJC 4UV7H 3U83A 1CCZA 4RGOL 2ED9A 3CFCL 3KPSA 1SJHB 1XR8A 3WKNA 4G9DB 3LN4A 4LSVL 4P5TB 5I74C 5JXAH 4U33A 5CEYB 1B2WL 2A0LD 1QR1B 4ODUB 1AJ7L 3GSWA 4ONGH 3KXFE 4ZYKB 2EYTA 3U9PL 4N90D 1YEFH 4DGIH 3QZWA 4PRBA 5L2KE 3O81A 3OAUL 5F3BB 43CAA 2WLYA 4F7MA 3DSNA 3U48A 1RJCA 2FRGP 3RVVC 5SWZB 4XMPL 3E8UH 4P46C 3RZCA 3WJLA 2IMMA 3ZLQC 3MBXL 4P57B 5KVDL 1L0XA 3FN9A 5E7BA 4EN3A 2W9DH 5T3ZL 1INDH 3CSBA 4FHBD 5ITFA 2GK2A 1RZ8B 1FVDA 4M7ZC 3WS3B 2ZUQB 2GJ6E 1ERNA 3FO2B 5I17A 3VG0H 5H37G 1LMKA 2Z4QB 4MA8L 4W4OC 2X1PA 5DC9B 1Q94A 2V9RA 2WBWB 4Z7VA 4N0UB 1FNEA 3HE7B 3MNZB 1OT1A 3CK0L 1A64A 3GMNA 2BY1A 4JFXA 1DQDL 5DRZB 2E9IA 3RUGB 1W0VB 4YUEH 2KL6A 2F8VA 4D3CL 5I8OH 1A7PL 2DQCL 3ZTNH 2R23B 5A3IC 4MNHA 3FFCD 4M6OH 1FQ9C 4IIQA 5E8PA 4RZCA 3NFNA 5IF0A 3R0MA 3OKNB 2CJUL 2D0GA 3QWOB 3STZB 1MHEB 2YWYA 5FV2A 2Q6WA 3TBSA 3IJSB 3PUCA 1BVKA 5EO9B 3BWUC 3GBNH 4PLNC 5A2FA 2X44D 1PY4A 1FVEA 3D1MC 3BKMH 2V5MA 1P4LA 4M6AA 4PV9A 3U79A 1SM3H 4KZDH 5J9PA 4WI6A 4JR9L 4NRZA 4DN4L 1I8IB 3D25B 5KG9B 3AREA 4NBZB 4UNUA 1JWUB 3MUHL 5GGTL 4ZAKC 1FE8H 3QPXL 2BDNH 5GGUA 2A2QT 3Q5OA 3MRJA 2EC9U 4RFEA 1QKZH 4QTHB 4XPBL 4DQOL 1Q9OA 3QIWD 4IHOB 2J12B 5F44A 4XI5C 5CEZE 4W70A 1WJ3A 5D1ZD 4XBPB 1QACA 3OR6B 3K2UH 1OHQA 5LGJB 1J1XL 1MCPL 2Q20A 4UTBH 4GKOA 3H42L 5J1AB 3I6GB 1OP5K 3L3IA 1YEJL 2DAVA 3JV5A 3C8DA 4JG0H 1XF2A 4X7FC 5I8CA 1RJLA 3QCVH 3D0LB 2J6EH 1TCRA 2P47B 5IT2L 1C08A 1D6EA 1LP9E 1VDGA 2K7QA 4UTAL 2J4WL 1UJTA 1FHGA 1SYSB 4PJFE 4GQ9H 3BI9X 3KXFA 3PIQA 1ZLWK 2UVEA 5IWLA 2AJ3B 5L2KA 3Q6FA 4WW2C 4JHWH 1GGUA 5C6WH 1TVHB 3REVA 2EIZB 2L0DA 3QIUA 4N0FB 5F9AC 2VSDA 4H8WH 3LQAC 2HT4D 3CSYB 4YFLI 5B22A 4NC1C 3V5HB 5JORB 4RWYL 5T1KA 3SKMB 4ZS6D 5F9JB 4NQSB 1QSEE 4BK5A 3EFDL 2GJ6A 4TVPE 4WFFE 1BZ7B 4PJ9D 3MA9L 4JZNA 2N7AA 3O3AA 1AO7E 2ZPKL 5KSAD 5GSVB 4X7TA 3ILPB 2QSQA 3CFJB 5CIPA 4OM0H 4DUWA 3WFHA 4ZXBC 3RY5A 5GRZA 3NCMA 4H88L 1OD9A 3L3JA 3VG0L 1DN0A 3QHTC 4P5TD 3BZ4B 4PB9H 3O3DA 2HFEB 3LQAL 3QUMA 5DGRA 1OF2A 2IGFH 3VH8A 1ZGLM 1AP2B 1CGSH 4WI2A 5EU7E 3GSXB 3BMWA 3ECBB 3EYOA 1G7LA 1N6UA 1IZKA 1P84K 2GK0A 1S8DA 4PB0L 5AEAA 1RVFH 2NZIA 1BZQK 3RA7L 5I75C 1FSKC 2XY1A 5SWZD 1VERA 5KVGH 4NKDB 4YUEL 3KGRA 5F9DC 3T2NL 5T3XE 3V6BR 1VGEH 3UTQB 1J05B 5C09E 2I5YH 2YWZA 4CU8A 1BQUA 3MRKB 2FSEB 2J2ZA 4M7JL 5IOPB 2ADIA 5FAAA 4XCYA 5TDNB 1UKTA 3GRWH 5IFHL 5K9QI 3QO1B 1N5YH 3LHPH 4I3RH 3O3BA 4M00A 3MBEB 5CZVL 1F97A 3LKNB 1J9CT 3ET9F 1HKLL 1NGXB 3CZFB 3FO1B 4JRXB 5FKAA 4KZDL 2JE8A 2CLRA 5D7IA 2QQLH 5DT1H 1ZGLA 5F3HB 3I02A 5BOZG 4OGAD 4EOWH 4M1CD 1FE8L 2BDNL 1ROWA 1QVOA 3ILQC 3OAYH 4O2FB 3VRLE 5EIIA 2BNUA 4DKEL 4A6YL 3KPSB 3EHBD 4PREA 3DYPA 1TJIL 5GRXG 3HC4H 4HJGA 4PG2A 2PTUA 4JANB 4UTBL 1MAML 1LE5A 1LP9A 2NR6D 2OL3H 4JFDB 4RSVA 1FG9C 5HDOA 4J23A 1GPOH 5HPMA 1MIEH 5ID0B 5D2NE 1G7IB 4PJFA 3QCVL 2H3NA 5CKGA 4XXDA 5DEGB 4LVOB 5T1DH 3S96B 4TULL 1QLFB 4IOFD 3GIZH 5C0BE 5CWSA 5C0CB 3RGVA 2G5BA 2MPAL 2A6IB 2D9QB 3TCLA 4MQXC 4QHLB 1OW0C 3MJ7A 3W9EA 1OAZL 1UVQB 2UWEA 1DSFL 5FYJD 5C7XH 5E4EC 4X0KA 1FVDB 3FRPA 1A6AB 3MRPB 4IRJC 1H0DB 5BS0B 1QSEA 4EKXA 4XAKE 5ITBL 4H8WL 2AEWA 5GS0C 4YDVA 1TNNA 1AO7A 2HWZH 4YPGA 5ID1A 5C0GA 3QA3B 3OF6D 3DX8A 4UBDD 2DQHH 3GFUA 4HEME 2YN3A 1JPST 1TPXC 5FK9B 3HZKB 3S36X 4XP6H 2YUZA 3SDAC 1MCWW 1DBBL 3RWEB 5GQBA 1P1ZB 4MSWA 4LGSB 1TVBB 1U93A 4UDTB 5F70A 1BVKB 1Z0NA 4AH2B 5I1JL 1T6VN 4FXKA 3HNVH 5T3ZE 3ZKQD 3S5LG 1CGSL 3EO1A 4J3UA 2A73A 4JZJC 1A21A 3BIAX 3FQWB 5C09A 4RGNC 1RVFL 1KFAH 1OAKL 5TFSH 1T22A 3RL1B 4YHKH 5DUPH 3NCEB 2V7NA 1D5IH 3PDOA 4M02A 1NC2A 1MAJA 3L5HA 3VXPB 5GGUB 4JDVA 3IDIB 1UWEL 3NN8B 2BVQA 2A9NH 2NTSP 4XTRD 2R29H 4I3RL 4HGKC 5EBLB 5KJRL 2VLLB 5B39G 4K3DH 4U1NA 1WZKA 2F5AL 3F7QA 4HUKB 1RK0A 1IBGH 5HHVH 4YPJA 2VQTA 3ZMRA 3L3IB 1QRNB 4NKIH 2Z35B 3P2TA 1GYAA 4ZOEA 3QEHA 2QQLL 3BGMB 4MNQD 5CJOL 3BYTA 5EU3A 5DVKA 5F7DB 1AQKL 3JUZA 1S9VA 4LCWA 2XG4A 2WWKO 4I4WB 4BZYA 3S37H 5EBGA 4YXLH 2COQA 3QB7C 3VFGH 1ZWIA 5D2NA 4KJQC 1UC6A 3TM6A 4K07A 5EOTB 5L8JB 3O4OC 5L2KB 2E7HA 4AY0A 3EYUH 2MNUA 1RPQA 3U82B 3MBED 5C0BA 4QXGH 4XP9H 1ZEAL 5SX4I 3EBAA 3QULB 1BAFH 3GMQB 2ICWB 1U3JA 1NEUA 4HJJH 5DMJB 5T1DL 3ZE2E 3SO3B 4JQXA 4BH7B 1YNLL 5E8OB 2BVOB 3EJJX 3H3PH 2SEBA 4JLRA 2E27L 3FFDA 1IGJA 2XA8H 4PRAA 2ZKHL 2V9QA 3GMLA 3SGDH 4R3SA 4C4KT 1YNTA 1YN6B 1H15B 2AEPL 2W9EH 3BMVA 4PG9A 1IKFH 3RJQB 3T65B 1L0QA 3ZKNC 2E3VA 2EEDA 2W0FA 1CFQA 2VDPL 5F1SA 1F8TL 3DSFH 1N8ZA 1MVUB 4DEPB 5HDQL 3P11L 4KI1A 1U91B 2EEAA 3MJGX 3IXTA 4XCEB 4DUXA 2CKBL 4WHYG 1NGWB 3GKWH 1AC0A 1RY7B 5KS9E 2HWZL 2EE3A 3QXDA 5IB2A 1RQ5A 3SCMC 2KBGA 5BQ7B 5CKAA 3HR5B 4FQJL 4ZTPH 2FJGB 1YJDH 1ZSDA 3IETB 1G7LB 2DQHL 4WEUD 1A3RH 3JWOC 2R0LH 4D0CB 5JQHC 5TE7H 5HVGB 5C0CD 3WLWC 2BOCB 4ZSOE 1A4JA 4TPRL 4ALAL 1RHHA 1Z9OA 1MNUH 3LPWA 2VYRE 2DLFL 1LQSR 4ENEC 4MD5A 2BNRE 3PWUB 3C08L 4JVUA 4XCYB 3RKDD 4PD4J 3O3BB 5B3JE 1B0WA 4GRLC 1QR4A 5BS0D 1U2HA 1DL7L 5IEHB 5J7CC 4JB9L 4BM7A 4GRMA 5BO1L 1F11B 3JWOL 1U3HC 5TFSL 1QFWH 5DUPL 3RWDB 2ATKA 3KDMB 3DRQB 5B3NA 1MFBL 3FB5A 1N64H 1A9EA 4QYOA 5MEQA 4NC1E 4FG6C 4GKSA 4WW1B 2A9NL 2HH0L 2Z0BA 3WN5C 2R29L 1MAKA 3OKDA 5DZNA 3QQ9D 4MMZC 3M17A 4AL8H 4GQPH 5CINH 3VFPB 5HI3C 4UOJA 5FYLD 3RVTC 1LO2H 1LO0L 5HHVL 5TF1H 1LP9B 5HYEA 3GIVB 1PLGH 5EIVA 3MLZH 4LDOB 4Z0XA 3WIIL 3U4EA 1MFNA 4X6BB 2WINB 1G6RL 2OXHA 4C56E 2HG5A 3I6KA 4X8JB 4URTB 1F3RB 4G43A 4CW1A 4L5FH 4F7PA 5DFVD 2R1XA 4BKLB 2K7PA 4LCIL 1XGQA 1V3KA 3B9KB 1I1CA 3G9VA 3S37L 3VFGL 4K71C 2IH3B 1A1NA 2CO6B 3HMWL 3PP3H 3BKYH 2FWOA 3MJ7B 3ZSTA 2JLLA 3W9EB 2XV6B 4UAOB 5A2KH 4E5XB 3HE6A 1AE6H 2DDQH 2VR9A 5CP7A 3OGCA 4K3EH 4XP9L 5FM5O 1HYSC 2YD8A 1BAFL 5IHUH 1RJZB 1WZLA 2JCCF 3FT2B 5EOCL 3TO2A 2VZ1A 3RIFK 1V7ML 1QRND 4NKOA 5CSGA 5FUCC 3B8SA 3KLAB 4LRIC 1BPVA 5E6IB 3S97C 4EQ2A 3MR9A 4M43L 1CXEA 4PJHE 2D4FA 4R96A 5DVNA 1WWAX 2D4DA 3D69B 3BPNC 3DARA 2B5IC 3DO7B 3MRMB 4IMKA 1YPZF 3L7FB 4Z0BH 2VISB 3SY0A 4OLWH 4U3HA 1NFDE 4NNXA 4DVBB 3HI1B 4Y0GA 5DD0L 2VZ3A 1VFAB 1RZKC 5ADOH 4ISVB 1JV5B 1MCCA 3IDXH 4ZSOA 5EC1B 3JZ7A 3JVGA 1YJDL 3KPTA 1A3RL 1U8PB 4LSUL 3WXVH 2BMKA 5TE7L 4WU7A 1MREL 2UZXB 3ARYA 4IBLT 4L9LC 3U4BH 4OUOA 4KJYB 3CFEA 3FB7A 4KKLD 4H0IA 4ORGA 2NW3B 3OXSB 1HSAB 3GSRB 5C3LD 2BVQB 5LGHH 2FH6A 3RPIB 3JXAA 2HTKC 3MACL 3UTOA 5AZEH 3RX7A 4MGXA 4OI7A 3V6ZA 5CS7A 5CHNB 2R1YB 1Y6MR 2OR9H 1JTOA 4HG4J 1S7UA 1MPAH 2EKSA 4L8BA 4MWFB 4FZ8H 1QFWL 3J7HA 5DMGC 4PJCE 1MFAH 5DDHA 1M7IB 4YIQA 2VXQH 3VFSA 5IR1B 2IJ0C 1KUMA 3CFBB 3FFCA 5EUOA 5JHDE 4DK3A 3RWJA 4EDWL 1DQQA 1S7WB 4ERSH 3AAZB 1BEYL 1UH4A 3LSOB 3N85H 5D2NB 2EDKA 3LCYA 1MJUL 1ZT1B 3D18B 4C56A 5CZKA 5BJTA 2ZSWA 3QZWG 4L3EB 1T03H 1MFDL 3FT3B 4XCFH 3MLZL 4TRPL 3P77A 1JHTB 4LCCB 1M1SA 2DKMA 1OAUL 3T0EE 4YAQB 3U46B 2FH8A 2EIBA 5HYQA 1OGAE 4L5FL 5H35B 5DVLA 4Q9CA 3QQ4B 3FFDB 2ZUXA 1YECL 3EO9H 4P2RE 4RGNE 1KPVA 2VLRB 4Y5XC 3CDGB 3RVWD 1YNTB 3BDYH 1OP3K 4PG9B 4B53A 4NZRH 4U6VL 1OPGH 4R26L 2CR3A 3LRHA 1AE6L 3RBSA 4PRIB 4GG8B 4K3EL 3RTQA 4XCCH 4PJHA 3G6AB 4JKKA 1U92B 5IHUL 4D9LH 3GGWA 4JY5L 4LQFL 4JJ5B 4LFHG 1E0OB 3VXSB 3QDHA 1A7RL 5GZOD 2FL5B 4EI5B 1JGEB 1INQB 4XPFL 3QXDB 1HCFX 1CGVA 1BVLB 1V3LA 2J6EA 2F19H 5KN5A 3HPLA 3HZVA 1GHFH 4U1JB 2XWBB 2VL5B 4MA7H 1NFDA 1JNNL 2XZCH 2HTLD 1A9BB 5F89A 5TQ0L 1KB5H 3B9KD 2K1MA 1I1AC 4YZFE 3PWVB 4LPYA 1QFPA 4LDLB 4LLWA 1I4FB 2A6DA 1RHHB 1CLOL 1LK2A 4N1EA 2FLBT 1JRHL 3V2AR 5I74B 3TNMA 4BQCA 1UZ6E 1NLBH 2ADFH 3F7VA 1AXSA 1U8IB 2ZUSA 3CC5B 4JPKL 2LFGA 5ADOL 2HJFA 2ADGB 1JK8A 2RJMA 3HI5H 4WFHD 1XGRB 2W91A 1JHKL 1MI5E 5E6ID 1U8MA 4Z7WE 1SBSH 4W6XB 1I3VA 2DJUA 3DBXB 1HHHA 3UEZA 3UTSE 3MV01 3U4BL 4MJIE 5E2WL 1VFBA 1I85C 5C2BH 5HGBB 4YE4H 4M7ZB 2DD8L 4PJ7F 3OKDB 1FPTH 2AV1A 5AZEL 2DRUA 1X4YA 2IAMC 3QUKA 4Y16D 4PJCA 5EU5B 4AEIH 3QI9C 4QXWA 2OR9L 3IFOA 3CLFH 4PUBL 4MA3B 4QRPD 4YC2B 2R2CA 2XNAB 3UAJD 4S1RH 5JHDA 3HRPA 4FQCH 4NDMB 3GHBH 1EEUA 2ICWI 3UTZB 3FQNB 1MFAL 2LVCA 3HNSH 5I1GH 4TYUA 1NEZA 1GGIL 4C54A 1TJHH 3TC9A 3HAEB 4B0MM 2Q1EA 2GTZB 4OCLC 3MV7A 1MF2H 3IFPB 2F53E 5FGSA 3N85L 1NJ9B 4L3CA 1IAKB 1U3ZA 3GRWA 3T0EA 3P73B 5H2BA 2X4TB 2OS7A 5C6TL 1FYTE 1OGAA 1T03L 4YHPA 1TZIB 3O4LB 1PEWA 1WC7A 4WGWB 2FCBA 2FDBP 4BUGA 2VNCA 4ZFOL 1F45A 1UKSA 4NQUA 5CZXD 1CL7L 1JPTH 3X17A 1T0NB 2FBJH 3RDTA 4ZAKB 2IFGA 4GLRH 3QNXA 3EO9L 3DECA 3LEVL 5ETUA 2H6PA 5FGRA 2E7CA 1T4KB 5IUSA 5HGHB 4NZRL 1OPGL 4RX4A 4KY1L 6FABH 3FQRB 4P5MA 2BVPB 3EDDA 3BDBA 5KS9B 2ZG3A 4HXAH 2ZJSH 4HKJB 2AJZA 2OL3A 2WUCH 5KVMC 4C4KO 1I1FA 3WUZA 2X9XA 4L3ED 5IB1A 1ZHNA 5DQDL 1T2JA 5IVXB 2F54E 4YHIA 3GI8L 1UQSA 1P5VA 5DURB 4YDIH 5HI4C 3SDYH 5FHAL 3OB0H 4H1LH 2F19L 5J3HD 1UA6L 4MA7L 1TTGA 2XZCL 5EC2B 5L6YL 4GG6A 2BMKB 2BNRB 4H26B 4MDIB 5EPMA 3VXUE 2OQJA 4ZUUB 2CK2A 4P2CG 2Q86B 3FB7B 1IQDB 1SJEA 2VLRD 4JM2F 5DJYB 5B8CA 2QHRH 5LWYH 1AR1D 1CFSB 2Q76B 4GUPA 3EOAA 4NSKB 4WW2B 5C08D 2W0KA 4EUPG 3DUSA 2VXVH 1MCDA 4PRID 3LIZL 4L1HA 3H9YA 5D93C 2OJEB 4PLKD 3UTSA 1FZKB 1CBVL 4MJIA 1J1PH 3VXSD 5T1LB 4MHHG 4ODWB 2CRYA 4EI5D 2GUOA 3HS0A 1S3KH 3EIFA 3QUZD 4OCNC 1KBGH 2JELH 4KGLA 3SDXE 3IF1B 3QNYA 3PQYD 3VFSB 5D71L 5C2BL 5GISH 2FEEL 1Z9MA 1RV6X 4XHJD 5F72S 1B88A 1WAAF 3C5SA 1UM6H 4ZXBB 3WXWL 2B2XH 1FPTL 4QRSB 5IMMA 4CKVX 2DL9A 1SMAA 1H8OA 3PABA 5DJDA 4LSQH 2CXGA 4HUWB 4C56B 5IHZA 1RUMH 4I2XE 3LKQA 4P59H 4RMQA 4RFNC 4S1RL 1A2YB 3ARTA 1RMFL 4XBEL 3NFPB 1GOHA 2K3TA 1N0XH 4YBLC 3QJFA 3HNSL 2F53A 4L4TE 5I1GL 5I75B 2ICEB 2AV7A 1FSKB 3QR2A 5JXEA 2XPGA 4FQLH 5FKPA 4X6DB 4P46D 4HC1H 5IBTL 1FFOA 4MZ2A 1LO4L 1X5IA 2X9YA 3ARDC 5HTSA 4NHCL 3CFDA 3FRPG 3U0PA 1WBXA 3VRIA 4M61B 3IJHA 4A6YB 2MOVA 2EDOA 4NQVB 1OVZA 1WF5A 2NYYC 3C9NB 2XKSA 2P8LA 1MOEA 4PJHB 1LE9B 1Q9KB 3SBWC 4N8VA 2CR6A 3QIBC 4MNQA 5ADPL 4WDIA 4ZTOH 1TETL 4PTTB 2BNQE 5FDWA 2OM5A 1I8KA 3WFEH 5EBMB 2AERT 5EZIL 4ESKA 5KN5B 1BOGB 1NFDB 1DQML 3BP6B 4UINH 1IL1A 1E27A 2PTTA 3H0TB 4CVXA 3V0AC 3GSQA 3U6RA 2P8MA 5F1NB 2EE9A 5BZDA 1G9NH 5TDPB 2F54A 5GGRA 3DI2B 2UV3A 4HXAL 5FYKU 5JW4N 4KVNH 2NTFA 2GTWA 2WUCL 3UTTB 3F7VB 4E0RA 5AD0B 3VXUA 3O4LD 2HP4A 3O11A 4GKZB 4YDIL 3Q3GA 1HXYA 1DLFL 1Q0XH 3SKOA 3MRGA 2DM3A 5DMKB 1A6WH 2UZYB 4GT7A 1M71B 2X09A 4S11A 5LG1A 1TLKA 4ZAKD 1FH5H 4KQ4H 3FQTB 4LSTH 5GJSL 5IP4A 1QYGH 4RDQF 5E4EB 2H1PH 2VXSH 3IFNH 4XI5D 1R3HB 4IRJB 3QEUA 1R3JB 3VD3A 1G7MA 3ULVH 3OQ3B 4PJCB 4LCUA 1QFWM 2ZCKH 3SDXA 1NKRA 1IEBA 1X5JA 4U1MB 1OWRM 1X3DA 2FJFA 3L3OB 1H8SA 5DURD 3A6CH 2D7NA 4JZOA 1J8HD 1S3KL 2R56H 1KBGL 5DD5H 5KZCB 4EJ1C 5GISL 2Y06H 5DUBA 3IT8D 1TPXB 1BJMA 2EDQA 4I2XA 1XF3A 1SQ2N 1UM6L 3SDAB 5IROA 4U1IA 1NC4A 2VDNH 3I85A 4M1DH 2QTEA 4O5LL 1JNLH 1MIML 1CZ8L 3GHEH 3DETC 5F1OB 3NIFF 4YHLL 4PP2B 1EXUA 2CIKB 2ICCA 4MD0B 5HYSG 4JZJB 1WK0A 1ZT7B 2EYRB 4RBPK 1N0XL 4P2RB 4ODHH 3F65A 4RGNB 4ZUTA 5T1LD 4JKPL 1BIIB 2Y07H 3WL9A 4Y2DC 4FQLL 4YHNB 2A77L 4YFLF 4FFWC 4HC1L 2ZOLB 5C3TA 5I1DA 1UH3A 5INCA 4J3SA 3TBYA 3B2VL 1NAML 2JIXA 4HS8H 1HHJB 4F33A 1PX3A 4PGCB 2QLVB 4PP1D 3F8UB 4BSVB 3HMXH 4GFTB 4X80L 4ZXBD 1Q0YH 2P4AB 3QHZH 3VWKC 2DQGH 2BNQA 2G9HA 3MRIA 2PO6C 4MLSA 2V2WB 1S5IH 4MQTB 3QBTB 5ICZA 2YPVH 1I1FB 4R4FH 5D96C 4JPWH 1VENA 5AAMA 4XVUD 2G5RA 3QCUH 4YHIB 2D3VA 5E1AB 3PJSB 1P6AB 3W2DH 2HKFL 4UINL 2J8UF 2EDNA 4L29A 1GCFA 1OT2A 3KYNB 5GS1C 3L3HA 5E2JA 5D1QA 3SDCC 1T1WB 1RZIB 1VKXA 5T5NF 3A6BL 3MCG1 1BWMA 1XAUA 3RIAK 3MMEB 3O4OB 4OF8A 5J11C 2IQAB 5E2VH 2NW2B 2ENSA 3Q1SH 4KVNL 3TVMC 1XF4A 3VW3H 1MI5B 1T3FA 1C16B 4Z7WB 4Y5VC 2EDRA 1E6OL 2R4SH 1WTLA 1JF1A 4HSQA 3SQBA 4PV8A 2CKBB 4OB5H 5ACMA 1H3VA 1ZVHA 3LV3A 1A6WL 1CD8A 3MLSL 3WNKA 1HOCB 3DTXB 3LQMA 1PEZA 1LEGB 3KYAA 1FL3B 2QQNH 4KQ4L 4CNIB 1MHCB 4LSTL 3RWCB 3ILQD 4PJEE 1QYGL 3VFMB 4G6FD 3V8CA 4ZFGH 5CLWA 3HG1B 3IFNL 4MJ2A 2OCFD 1BQLL 1BX2A 4PYHA 1G0YR 3L3DA 1WWCA 5DJDB 5SV4A 4X98B 5CLTA 3UTTD 1W0YT 1F3JA 4ELME 3LKQB 3SCMB 3L5WB 4XP5H 1C5BH 2CLZA 4LVHC 4XH2A 1A7QL 3QJFB 5DD5L 2F53B 2G60H 2VIRB 4TSBL 2FO1A 2AJSH 4GW1A 2FYYA 4MQXD 3FB6A 1FYTB 3FZUC 1FFOB 4MX7A 3HUJB 3UPAA 2X4RA 1YYLL 2QR0B 4HUVA 3WS6C 3CFDB 4K9EC 3ARBA 3U0PB 5F96H 1KLUB 3FONB 4KTDH 1JI1A 3C2SA 3PV6A 5FUZL 4IRJD 5GZNC 3E6FB 4GRLB 1S7XA 3P0VH 4ZUVA 2IALA 4JO3L 1AD0B 5GS0D 4ZUWB 4ZFZB 3SJVD 2I9TB 1U3HB 4PY8J 2R2EA 3C87A 1G6RB 4V2CB 3U0WH 12E8H 2H26A 4HK0B 4HWZA 4K8RH 9CGTA 5HHOD 5KZCD 1N6QH 1MFEL 1E4KA 4R7NA 4CN1A 2VDOL 4K8RD 2O5XH 1KEML 2ZOKB 3PXHA 4N0CD 3PWPE 3SDAD 1ODAA 5SWSE 2P8MB 1Q72H 3QHZL 3EO0B 2DLIA 2GSIA 2EXYD 4N1HB 1K8DA 2GHWB 2Y5TA 3W5MA 2QKIB 3G5YA 5D6CA 5CSBA 5A1AA 4R4FL 1C7SA 3O0RH 3F12B 3VXUB 1HKFA 5I9QB 3TN0D 1G7HA 2OSLA 2V7HB 4OZHE 1NBZB 3F58L 3KPPB 3Q3GB 4KU1A 4RGND 2YSSB 3MGTB 4X9HA 4KKBC 2EC8A 2RGSA 3W2DL 5KW9L 3BP7A 1CT8A 4ZNEE 2YR3A 4K71B 4JFOB 1FCCA 4P5KA 4CADB 1F02I 1FFPA 2DQIH 5E2VL 3Q1SL 4OZFH 2VAJA 1ED3A 3EDJA 1KJMA 1NBYB 5FOBB 4S0SD 1P6FA 3HLAB 4NO2A 1KTLA 4KI5E 2X41A 4O51B 4IRSD 5GSRB 1A1MA 2HJLA 1MCRA 5JO5A 3H3KA 2W60B 1CXFA 3DVNA 3QXAB 4JZOB 5BVJA 4DTGH 4CGTA 4P48A 4NQCB 2Z31C 4NQDB 4F15C 1M7DB 1KB5A 2Z8WC 3MRCA 2YEZB 3R06A 3SPVA 3SGKA 5A40E 3BPNB 1QBMH 2B5IB 3PP4H 4PBVC 4ZFGL 2LU3A 3NMEA 4GKNB 4I0KA 4ELMA 2WM0A 3QJHA 1J0KA 1DTUA 2E7LC 3CMOL 4KJQD 1PJ9A 1RUKH 3UBXB 1NC4B 2OR7A 3FO9B 4X6CE 4I9WE 5HY9A 4L4TB 1MI5D 3I75A 4LPCA 4GJTB 5M94B 4OF0A 1C5BL 3VRJA 1FNSH 5HDBF 1RUQH 2OTUA 1YEHH 3GK8H 4ZUTB 2B1HH 4R2GD 1JNHA 1AKJA 4L9LB 1NUNB 2RFXB 1FC2D 5IFAL 1UG9A 1FBIH 3M8OH 1YEKL 3ZKND 4F33B 4XVSH 5F96L 3HG1D 4XPHH 3RUGF 4X4XA 4IDJL 4O4YL 3PGDA 3IB4A 4NHUB 1JUFA 3S4SA 4QRPA 4R4BA 1AHWC 1CFTA 1E6JH 4NRYB 5I66B 1GZPB 3UPCA 2NY7H 3B2UC 5D6DC 4J1UA 1MWAB 1BECA 4J8RB 4FMKA 5E5MA 3BHBA 1ZT4B 2OP4H 1A6TA 1NDGA 2XIDA 2LVEA 5SWSA 1T5XA 4QWWD 1YUHB 3H7BA 5IG7B 4NRXA 1WICA 1PZ5B 1FV1A 5DRWA 3WLWD 3SDDA 4GSDH 4G42A 1U8NB 1HHIA 1FFNB 1ZA6B 5IM7B 5BRZE 5DUML 1Q72L 1N2RB 4ENED 5ICXA 2D03H 5SV3A 1VKXB 1P84J 1FO0H 2RHEA 3DXAB 2IPTL 1LO5B 3TIDA 1T2QH 1XF4B 1I9RH 4GRLD 2ATPB 1OSZB 5LJYH 2BOBA 3O0RL 3W0WB 1SEBA 1A6PA 1TQCC 3BSZH 4ZOCA 5HYJE 3DX7B 5H37H 5LXGH 4PV8B 1G9MH 1U3HD 1CDBA 3L9RB 1HWGB 1IGMH 2CRZA 2VH5L 2AABH 3Q6GL 4NO5B 1H3TA 1EZVX 2A83A 5DJXA 3SE8L 4FG6D 4Y5XB 2H9GB 5AZ2H 1OSPH 3MRFB 3TT3H 2DQIL 5BXFB 2Z8RA 3I3BA 4ETQA 5HI3D 4Q2ZB 1F4XL 4MXVE 2R1WA 3RVTD 5T1MA 4WO4C 3SBWA 2JJTC 1D5MA 2DWEB 2R8SH 3RWIA 5E24E 5I2IB 4JDTL 1F3JB 5DK0B 1QFHA 1NEZG 4QO1A 3U30C 1D5BB 4DTGL 4Y8DC 1MRCH 1WFOA 5DHXB 5CFHA 4I1NB 4TUKL 4X6CA 1T04B 2OXGA 1QBML 3PP4L 5JR1H 1I1AB 3CPLA 4LCYB 4MMXC 1JHLL 5DJZA 5C08A 4QNPE 2VN4A 1ZHLB 5HHMB 5DSCB 3BX7C 4ETYA 3OGOE 4YO0B 4X9BA 5HJ3A 3NABH 4TTGA 1I8MB 3BGFC 4EBQL 2YRLA 1IFHL 5H8DA 1HZHH 1UM4H 2AJYL 2E9BA 1HYSD 4J4PA 5CJXC 1TJGL 3FT4B 5J6HB 3SE4A 4GXVH 2WIIA 1XT5A 3PDDA 1MEXH 3OKLA 5ISZE 2DQUL 1ES0A 1DFBH 3KPMB 3VWJA 3QUZA 4XX1E 3ZTJG 3PNWA 3C5ZC 4U1KA 3TBWA 2B1HL 3ELAT 3C6LA 4LNRA 3ULVE 3PQYA 5EWIH 4F58H 3C8KA 3BQUC 3BJLA 4NQCD 3QEQD 1AY1L 3K8MA 3NZHH 3QFJE 4NQDD 4AMKH 4XWOC 2Z93B 2D7QA 4U2YA 3L5JA 3QHFL 3UTPE 1BZ9A 1C5CL 3DX9B 3MSPA 5IIEB 1YY9C 4XC3H 2IAMB 4ZFFB 3O2VH 3OJMB 1VADB 4PBWD 3QI9B 3S35H 4NJ9L 1KIPB 2FEDC 2IPKB 4JY4A 3R1GL 3S36L 4J2XA 2YUVA 2AXGB 4BK4A 3OBAA 5CD3B 4I5BA 4HV8A 2OP4L 2OSLB 4DKAA 4FQXC 5BRZA 4ZFOB 5I30H 2EDFA 1F90L 4LOUC 4YDJB 1LGVA 4HC1A 4WVRA 4OJFL 4R90L 5FF6B 3ZDZF 4GSDL 5DLML 1DP0A 1XCQB 1JZ5A 1NCDL 3CMGA 3BH8B 2D03L 2BSRB 3BDXA 1U0QA 1FO0L 1IAIH 2HTKD 1WISA 1N6VA 3G5VA 1T2QL 1Y6NR 4Y4FA 5DI8A 5C0DA 4ZODA 1KTLB 4MVBC 3D5OF 1PG7W 2IADA 3MA7A 4LHUA 4PJEB 2WBJA 3PG2A 5DMGD 3QUYC 2BXYA 3AM8A 2FHBA 1SEQH 2AABL 2P7TB 3CVHL 3K8KA 1FDLL 4LLYA 2CDEA 3WHXB 1H5BC 3OKOB 3KPRE 4DZBB 4P4KA 5DHVH 1OSPL 1TZGH 3G6JB 3EDFA 1KCUH 1T80A 1AI1L 5FYKD 3TA3C 5DJ8A 1A1OB 3Q5TA 25C8L 3DXAD 3C2AH 3KWWB 1ZS8A 4GW5B 5C9JB 1VGKB 2Z92A 1KLGB 4WHTB 2VWEC 3NIDE 3W0WD 3ZDYF 1CTNA 1HQ4A 2VLJD 1GH7A 4YHZL 1OWWA 4H5SB 4ZQKA 1CLZL 3V4UH 2XXMB 3LEXA 3KPOA 4YNYA 5JIIA 2A1WH 3DVFA 1JYWA 3MRLB 1XH3B 4HIJA 2WP3O 3D39E 2DOCA 2YZ1A 4YDKH 4I0PC 5DTFA 1W0WA 2RCSL 3O8XA 3NABL 3WHE0 3GSNH 3HTLX 1S7VB 2BSED 4M1GH 2JJSC 5JW3L 2FBOJ 1DBAL 5D93B 4F7CB 1FGNL 4OCMC 4R4BB 1FIGH 3MLUL 4GXVL 2JF1A 1CDUA 1MEXL 2IBZX 1T66D 4UB0H 3QFJA 3UROR 3WDHA 5IB4B 2Y1VA 4XNXL 1A8JH 3KLDA 2AXJA 4M6MH 4QRRB 3VXME 2X4UB 4P3WA 1AGEB 4APQA 3QWRD 5EWIL 4F58L 4AQOA 1UWGL 1ACYH 3PWPB 4P2OD 3UC0H 4DGVL 1FRGH 2GITA 1NGZB 1SYVB 4HPOH 1T1ZA 1A7NH 1GC1H 5E00A 4F2MA 5AWNL 4R97C 1C12A 2BRRL 1I1AD 4WFGD 4RMUA 4ZOBA 3GSUA 1E4XH 2OJZH 1C8PA 3ROOB 4Z76A 5HHMD 1VACB 2CMRL 3O2VL 4U3CA 1DBJH 4OZHB 5AYUH 3S35L 2YRPA 1T89A 2G75A 1VPOL 4LAQH 4RFNB 4UT7L 5GRYA 4HIIB 1MHHB 4AENA 2C4XA 5FA4A 4P3DB 5HGDA 2GKIA 1AGDB 4L8CB 2B39A 4LLQA 1FYHB 2NX5E 1KNOA 3MUJA 4UIMA 1PX4A 4YBLB 5DD6B 5DO2C 5IBUB 5CD5C 1T20B 2VDRL 4GO6B 3ZDXF 4JDZB 1EEZA 4DVRL 3M1BA 4LASL 3TO4D 1JPSH 3VXNB 2A83B 2UY7A 5GRVL 3ARDB 1CICC 4OZGB 5FIEA 5C07B 4QCIB 4PRHB 4XNYL 3ARRA 1I7RB 1D6VH 3HMXA 2EYSB 2FR4A 2XWTB 5KAQF 3ZHLA 1XIWA 5M7QA 3UBXI 2IAMD 3CUPB 3QI9D 2R1WB 1MCSA 5I71C 4KAQH 3LKPB 3DVGA 4OV6F 3U1SH 3VG9C 3BT2L 3OWEA 3KPRA 4G6MH 4JGUA 3QIBB 3V7AE 2D7TH 2NY5C 1A7OL 4HKBB 5ESQA 3IU3A 3QNZA 5FHBH 4WJ5B 5I18L 3LH2L 2IANE 2Q8AH 1PW3A 3G9AB 1INEH 4OZ4A 4D0BA 5D72L 5KTEH 1NGPL 1WWBX 3UDWA 5A43C 1KCUL 1PVHA 3P4OB 1KTDA 5GGVH 5D1XC 4P49A 3OX8A 3CIQA 4GMTH 4X7EC 1ORQB 2C3VB 5BV7H 1B0GA 1PG7X 3C2AL 4NCC2 4NUJB 4UDUB 5HJ3B 4L9DA 3CX5K 3GB7B 3QISA 1Q9WA 1MLCB 1R0AL 2NY5L 2PETA 3P4MB 3QDGB 3GJEA 3RY6C 3D39A 5EO0A 4OLXH 1XF1A 4UUJA 2HLAA 1HH6A 1D5XB 1VCAA 1IVLA 4NP4H 1QFOA 4W68A 3V95A 4QRUA 1ORSB 1CDYA 2A1WL 1U8HB 3RAJH 3GMRB 4K2UH 5CJBA 1YEEH 2BJML 4CVZB 3QUXA 4Y88A 2ARJA 1ETZB 5D70L 1N4XH 1E4JA 3BKCH 5CBEB 3TNNB 3VXMA 3H9HA 2GY5A 3MRRB 1FL6B 1FIGL 2C26A 1M05B 4ONFH 1S5HA 2VXTL 2VR4A 5LCVH 3NFSH 2Y7QA 5JA8B 4MB4A 3CDFA 2DWDB 5HI4D 4OD2A 3MLPA 1ACYL 5BVPH 5F7EH 1AXIB 1S7QA 3UC0L 2H45A 3C60C 4HWBH 4OGYH 1JTPA 1A3LH 3MODH 2XICA 1T7ZA 4OGXH 3HR6A 3O6LL 1QO3B 1NAMB 1XMWA 3DUUA 4KJWC 4JPIB 1NCWH 5HYJB 5C2UB 2I60L 2YA0A 3LZFH 4OQTH 4BFIB 3GSOA 1JRHI 4LAQL 4U2ZA 5ELIA 2DLEA 5MERA 2D0HA 5C0EB 5E95B 4JFFA 4YXHH 4PJXE 3FKUS 3IDJA 4OCXH 2I24N 1J0ZA 1T83C 2VC2H 4Y2DB 1ADQL 4QRRD 1VHPA 4ACPA 1LP9F 1MCHA 2VAAA 3X3GH 1PSKH 5HHOA 1GGCH 3V6OE 1JPSL 5CEXA 2PUQT 4U7MA 4LLYB 3LEYH 1JGDA 3H2WA 4G8GB 3BW9B 2FX7L 4XMLH 2ZSVB 3CH8A 2ITCA 4EDXA 3RWFB 3VWKB 3G04B 4HGWB 3O6FD 2PO6B 4LAJH 1FG2A 1NGYA 5GHWH 5I1IH 3OJDA 4XHQA 2R4RH 3TN0A 3CVIL 5GRJH 1YNKL 3D3VB 3LRSB 5DR5L 4JJHA 1CIUA 1A4KA 4PPTA 5DJCA 5DJAB 2JJVA 4ZQKB 1BFVH 2Q8AL 1JJUA 4HK3J 4G9FE 4JGMA 2DB8A 2Q8BH 5K9KB 2R2BA 1KC5H 5GS1B 5CJQH 1DEEB 2W65A 3SDCB 5C07D 4GMTL 4PRHD 5J11B 3T4AB 5INDA 4U0RC 2GT9B 4ORZC 4OZFA 4RISH 3L7EA 5ISZB 3TVMB 2A74A 1G7QA 2YC1A 4I3SL 2CK0H 4IRSA 2PYEE 3L1OH 4Y5VB 2EIDA 4YX2H 1Y18B 5B38B 4NZJA 4OF7A 5DYOA 5L7XH 1REIA 5GGQL 2VXUH 4NP4L 7CGTA 3DURA 5T5FH 2O5ZH 4JFHE 2QHLA 3GUTB 4OZIE 1ZTXH 3IGAA 1QOKA 2M8XA 3MOBL 4BH8A 1W2KT 2DJ4A 3PWJA 5BOPA 4BQ9A 2PN5A 1CL7I 3OKEA 3ULSA 4F2MB 1QSFE 1N4XL 4UT6H 1CR9H 3MUGB 2DQJH 5K59F 4WGVB 3FOMB 1P9MA 1QQDA 1KPRA 4LEOA 1QG3A 4PTUA 2YD6A 1LEIA 2F5BH 3EYFB 1X7QA 5CGTA 3QDGD 5F9OH 4I13B 3BJ91 4LVHB 5ESAA 4XVTH 1ZLUH 4UIMB 1J18A 3QCTL 1P7KB 5F7EL 4NJAH 3T1FB 4HWBL 4CMMA 2EC9T 4WY7H 5TE6L 4WWKD 2GFBB 4OIAA 4OGXL 1XR9A 2XRAH 3MV8E 3VRLF 1HHKA 3N1MC 3VGBA 5DQJA 1FAIH 1UB5B 4HPYL 3T09A 3ULUC 3BP5B 4PJXA 1NCWL 5ALBL 1BQHA 4L1DA 3WSQL 1I7TA 4KJPD 5KOVC 4HLZH 4OQTL 1R5WB 1FP5A 1Z9SA 4PR5B 1MJ7H 1D9KC 2UVFA 3V6OA 2VABA 2BVTA 4JM4H 4OLVH 5E99L 4AIZA 3DVGB 2EH7L 5FOJA 5K9JL 4UQ2B 3FB8B 5D7LE 1WBYA 1FJ1B 4RCAA 1AGFA 5FO8B 4Z7QF 1CS6A 3X3GL 1MH5A 1QNZL 1I1RA 3ZKMC 1OQXA 5IB5A 1DJSA 3MXVL 1EEYB 5SWQA 3U0TA 1DUYB 5L2JB 3N1FC 4OZ4B 3IFLL 4OLYH 4NM4H 4N9GB 1HK6A 1RFDH 3JV6B 1ZLWH 5TGBB 3OTTA 1UACL 4XMLL 2DQFA 2NNAA 2WZPD 1QFUL 4F7EB 1FO0A 2FEEI 2OK0L 4PJGB 1EBAA 1Q38A 4G5ZL 1B0GB 2YKLL 4OIIH 3DETD 4U1HA 4KMTH 4ZS7L 4G9FA 1JMZA 3MLRH 4OCWL 4EXKA 5GRJL 1DQJA 3HRZB 1LDPH 1HILB 5HGGS 2EDHA 4P23C 4OCRH 4QGTA 1ZLVH 4FFWD 1FVCB 3ME0A 4FQHB 5JW4Q 4MYWB 5CJQL 2YK1L 3TYFA 4JFZH 2PYEA 4EIGB 5JPNA 5IKCA 3KLHC 3UYPA 1IT9H 4L8SC 4DZ8A 2HN7B 4G8GD 1CLYH 3S4SG 4RISL 1HI6A 3WNLA 4QHUB 5HHQA 5KVEL 3VWKD 1MY5A 4OZIA 4MAYA 2PO6D 4YX2L 3BZFA 3V5KA 4AG4L 3QEGH 2YD4A 1P2CA 2RAMA 1EHLH 4IM8A 4OM1L 2B0SL 1ND0B 4Z7UB 3KPLA 5HXMA 5EA0L 1TVDA 3D3VD 1J5OH 1VFUA 1IM3A 2IH1A 2Z31B 4GBXA 5A2JH 4F15B 5FCUH 2VLME 4UT6L 1UZ8A 1CR9L 3SDCD 2DQJL 1FORL 4HBCH 2Q7YA 4WV1A 4OF3A 3BEWB 3BPCB 1PQZB 4L4VE 2VE6A 1B4JL 2IFFH 4JEGB 3TVMD 3B5GA 2F5BL 2NX5B 2AK1H 1CE6A 4U31A 4Y2OA 4MCZA 1YQVH 4X9FA 2X4SB 4KHXH 2C1OB 2X42A 4PRNB 2GJZA 1RZGB 3BZEA 2MQCA 1BREA 3FTGA 5J13C 3MV8A 4OTXL 3UZEA 4XVTL 4XWGH 2ARJQ 2AVGA 3S88L 1VESA 5GGSY 3MJ8A 1F00I 3HZMA 3U9UA 3RU8H 3UTPD 2XKNA 1UXSA 4FP8H 4Q6IC 3LKSB 4G3YH 1NANI 4NNYA 3I2CL 3PL6A 1OM3H 1MCWM 1IAIM 3DMMA 3H9SB 4HJ0D 1FAIL 3BVNB 1JFQH 3BFOA 4B50A 5D7LA 4UQ3A 4HZLA 4HIEB 3P30L 2BSTA 2Y36H 5LAXB 4JCMA 1AHWB 3TPUB 1MJ7L 4TN9A 5DD3H 3IKCA 3V6FA 4P3CL 4F9PA 4P9HH 3ABZA 4OLVL 3RI5K 2FO4A 1BM3L 2VDKL 3TIEB 2IANB 4H1LG 3DRTB 4O58L 1BD2E 4EEEA 4F57H 3ZE2F 1BLNA 3OPZH 4QY8A 2DI7A 4BZ1H 3HC0A 1W8NA 1IGYA 1NDMA 4XMKL 1RURH 4G7VH 3RWGA 2CUHA 1XGPB 5IW6B 1Z5LB 2PTVA 3PHSA 5BZWB 1BGXH 2CDGA 4IOIA 1ZOXA 4JN2B 3RKPA 2NZ9C 4WHDA 3CSGA 3FZUD 3HZYB 3BISA 4K9EH 2XZAH 5ACZA 3PXJA 5DMIL 4HFWB 1C1EH 1EPFA 3LB6D 3FQXB 1R24A 4AM0B 2ZCLL 2A74B 4ZDHA 2CQVA 2BK8A 3NCCB 2UYLA 1TQCB 5GGSA 5KS9F 1WCBA 3F5WA 4NQXA 3KNBB 5ANMB 1EO5A 3TPKA 4MXQC 5DHYA 2XTJC 4HDIB 1U95A 3S34L 5ILTH 4IMLA 2AJXL 4TSCH 2I07A 3N06B 5IW1A 3IGAB 4LLMA 2BHUA 5E08H 5DHVA 4G8EA 3BUTA 4WUKH 2OI9C 3RZCC 3AUVA 3WJLC 2BC4A 4Y19B 5FO9B 1ZANH 4M5ZL 1KB9K 4EN3C 5D7JA 1IJ9A 3QO0B 1KPRB 1BFOA 1QSVA 5DRNA 5DJ6A 1X5YA 5B3JF 4HX1B 2AEQH 1BFTA 4WO4B 4RAVA 4JFYA 4Q9QL 1DDHB 3E6HA 2VLJA 4WW2F 3A67L 4PS4L 1KGCD 3CU7A 4OFVA 5E2UL 4HULB 3FN3A 3U30B 2YMXL 4CU6A 2QQQA 2IG2L 3L5XL 4M9OA 4UILL 4X6EA 3CFKB 4O2CB 5I76B 4LRNH 4G7YL 4L4VA 3MNWA 2E7BA 4HIHA 3HPJA 1IC4L 3VFUB 3GEWB 3VD9A 1KN4L 2PKDA 5EUKA 1I8LA 4HBCL 1HHKB 5FUOL 4LSPL 3TBTA 2Q3AA 3GSNA 5EORL 4IIQC 1BQHB 2IFFL 4MA1C 3BGFB 1MLBA 2AK1L 2LQRA 3UJTH 1YQVL 3LVEA 3NA9L 1P4IH 5IFJB 3V4PL 3WLBA 1HDMB 2JB6A 3D6GA 1EGJH 3BD5A 4Z95H 2LU4A 5J0BA 4MJ5B 3T4YB 3C5ZB 4P2OA 5E9DE 4AT6B 3HAEG 4XGZA 3BQUB 3O6KL 3BRDA 3O45B 2Z31D 5D2LB 3KYMB 1JP5A 3VI4E 2X4QB 1JNJA 4PY7A 3F7YB 4JFQB 3AREC 4H25B 2VLKD 4ONHA 5LQBL 4XPGL 4K94H 4HHAB 4WNQB 4X6DF 1BD2A 4NO0A 3HC3H 4LBEA 4Z77B 2Y36L 4ODXB 4UU9B 3ALXA 1OOAA 1YEGH 5DD3L 3MOAL 3MXWH 3VXRB 1QLEL 1WT5A 4U1HB 3S6CA 2B4CC 4EUPH 4F57L 1Q1JL 2C3GA 5F9WC 5D9SA 5JQ6L 5DJ2B 4FQXB 2DKUA 4OLUL 2AKRA 5DZOA 3UJJH 4ZG1A 1UCBL 1ADQA 1DEDA 3MCLH 1RURL 1LILA 1KCSH 1M4KA 3QXWA 4G7VL 1MFCH 4PJHF 5LBSH 3TO4A 3ZE0F 5F7HA 4HFUL 3JTTA 5I8KH 4QRQA 3CVHB 1JZ3A 1E28A 1N5AA 4F9LC 4OUUA 1CWVA 3LN5A 3H9SD 2KZWA 1NFDF 1SY6H 4HUXA 1HIMH 3SGEI 3VXTB 5IWLC 1RU9H 1DQLH 1W8OA 5ALCH 3GMOB 3T77A 2A6JB 2FIKA 1CD1B 3TH3T 2AJUH 5TDOB 4FXLA 3X11B 4NYLA 4KROC 3QIUC 3MLYH 3KPLB 3QUYB 1QSFB 4X6FB 5IJVB 5BW7A 4TSCL 4JG1L 3S5LA 4FQ2L 4Z5RA 2KDGA 3BUYA 5E08L 1H5BB 2YA1A 3FAWA 3ARXA 2GW5A 5D7KD 3HI6H 4M62L 1CF8H 4F8QA 1K8IB 4TTDC 1CGYA 3QDJE 5TE4L 3TA3B 2BVEA 2YBRB 4WCYL 2R0KH 1MVFA 1KJ2H 4KRPD 4EXPX 2P5EB 3LPFA 3BPLC 3G5ZB 2JJWA 4FQ1H 3KR3H 3BZEB 2PYFA 3MV9D 4P2QB 4FTVA 2DJSA 5B39A 1F13A 5JIKA 4PJCF 4OFYD 5FB8B 1S7TB 3LN9A 1ZHBA 2IF7A 1ZMYA 4I0PB 2JJUA 35C8H 3DMMB 3MYJB 4Y19D 3QPQD 1HH9B 1GZQA 1FZMA 4JFEE 1NMAH 1SBBA 3MRDA 1CXIA 4OQ1A 4DFHA 1HE7A 5E9DA 4Z8FH 1NCBL 3JWNC 4WO4D 4FFYH 3MRQA 5DEFB 4HCRH 3IKCB 4NNPH 4I18A 4UOW0 4L8DB 4Y4HA 3SO5A 2BFVH 1NAKH 4Z95L 3C5JB 3UPRB 4M5YH 3EDKA 1VSCA 3VFVB 3DIFB 4FFZH 5I8EA 4RMWA 3VD4A 3VFNA 3EYVB 4HWBA 1IM9A 3W39A 2I9LA 3ARGD 5I0DA 5CSZA 5MEOA 4R97B 5MENE 5D4QA 1X5HA 4K94L 4ODVL 1AIFB 3NZ8A 3IVKB 1I1YA 4MDJB 1XGYH 4XAWL 2PXYA 1HXMB 4EI6A 4OQTA 4DOHB 1RZJH 1MJJA 4XNZC 1OL0A 1Y0LA 5I1HH 4RQQB 4ZDHB 2IEPA 3WJJA 2UYLB 4PG2C 2VTFA 4YHOH 4LP4A 1PKQE 4PGEA 3SKJH 3VFOA 4G80B 1U9KA 3C5ZD 1KCSL 4YBHA 3BRGC 2ID5A 3BEVB 2M26A 2MFNA 5C0FA 3BQUD 4LKXA 2X89A 2Q3ZA 4NO3A 3QDME 5J6GA 1CK0L 1TTFA 2H32B 2YUXA 4YZFF 1CICB 4QOKE 4I77L 2HFFA 3W9DB 5EBWA 5KSVA 4XWOD 3RGVC 4GRWE 1I3GH 3AXLB 4RMRA 4QRTB 3O6FA 1P53A 4HQQL 1HIML 1YMME 1RZFH 1YY9D 3L95B 2W59A 4HS3B 1DQLL 4IS6B 4WUUB 1ONQB 1UENA 4M8QA 1JBJA 1P7QB 5I71B 4ZPVB 3VXRD 4ODTL 3DV4A 3VG9B 2YXMA 1EIBA 1QA9A 2X4OA 5C1MB 3NACL 3VDCA 1EMTL 1MUJB 4M3KB 1QLRA 2GCYA 3MLYL 2DYPB 4XPTL 3MNVA 2PF6A 4FQXD 4Z7WF 2AK4E 1FC1A 1OB1A 3QDJA 3BN9C 4LOUD 3MLWL 3T0VA 4L4VB 2YPKA 4GXUM 1CF8L 3HPJB 4JRYB 3B9DA 3WFBL 3LQZB 1NFIA 5EU6E 5D1XB 2X1OA 4XPAH 5D7SH 3MUY1 5DQ9A 5E4IA 2R0KL 4C55A 1X5ZA 3AY4A 3MFGB 4TUJA 4DAGH 1NMBH 3EAKA 5EU7C 3KJ6H 1F4WH 1G7PA 4V1DB 1KPUB 4MVBD 2P24A 5C0JA 1LD9A 2BSSA 4CJ0A 1LNUA 3QUYD 5C8JB 3P4NA 4PLJC 7FABH 1S9XB 4Y4KA 2VDLL 5F93C 3PHOA 2XZQH 4PRDA 3MREA 4HH9B 2ENYA 4BFGA 4POZC 4KK9C 2WWMC 3LKRA 3LPGA 4ONHB 2L7UA 5ENWA 3VXOA 1T7VA 2R9HC 3MLVL 1O0VA 4XCNB 5HD8C 4Z8FL 1X4ZA 3HUJF 4R6UA 1T7XA 2P5ED 2NXZC 3G08A 4F8TA 2BFVL 1NAKL 4KUCD 3IXAA 1NMCC 3IJYA 1ZA3A 2QQKH 2J7LA 3RQ3A 4QTIH 4YR6B 2AP2A 3DGGA 4GAJL 1CFVH 4OAWB 5EFIA 5MENA 4WTWA 2JCCE 4P2QD 3T2QA 3KPQA 1A47A 1PZUB 4WWKA 3O6MH 3VE0B 2UZIH 4FQQB 3C60B 2DQTH 1JWSB 3CXDH 3EJYC 3U7WH 5ICYB 3JTTB 1U36A 5EO1B 1IC5H 3JWDH 4O2EA 4U7KA 1IGTB 5C0ND 3VCLB 4OZFG 1NGQH 4I0PD 4Q0XL 2HLFC 3TH4T 4KZEL 1EFXB 3I6LE 1YPZE 2E9JA 3K74B 4PJIE 4XP4L 5D2NC 1S7SA 1K6QH 1J7VR 2ESVD 1A6ZB 1EFQA 3GJFH 4PRPE 2IMNA 1PD6A 3D87B 3IDMB 1NPUA 2Z9TA 4QOKA 4LKCB 4CAGA 2YPLD 2QSCL 4MCYB 2VQ1A 4NYLB 5IQ7H 3NTCL 2Z91A 4MD4A 5I1KH 5KBNC 2LAAA 4DK6A 1YMMA 5FO7B 4JQXC 3MRHB 4LLDA 4OV5A 1DE4B 4LLVA 3HNTH 1Q8MA 4U6YB 3IDGA 1R3LA 4HMDA 1KG0B 4OCSH 1HHGB 2YZ8A 2HT3C 3VXQB 5EZLA 4MXWL 1ZGLP 1JN6B 1LEKB 2IQ9L 1RZFL 2YD7A 5F88B 3BH9A 4KGJA 5CMAA 1AR2A 2AK4A 1R5IA 8CGTA 3GNML 1D5ZA 4NGHH 3OKMB 5TQ2L 2WUBH 2VRAA 2ADJB 1A6UL 1WFTA 5EOQL 4K7FA 5GS2D 4RFOH 5DO2D 4NQEE 5EZOH 5EU6A 5H94A 5B39B 5CD5D 3ZYIA 5FECA 4NT6A 2CIIA 1BBJB 4OBRA 1FGVH 4M7LH 2AI0H 4DKDC 3WO3B 2CUMA 1CICD 1U8OB 4C83B 4LVEA 3SQOL 3KPNA 4U0RB 4XXCA 4WI5A 3TP4A 2PW2A 3NGBC 1EAPB 3VFTA 1UB6B 4J3TA 2OTWA 3B9AA 2DQDH 3KJ6L 4JO4L 4WUUD 1EUUA 3HCVA 3MFFB 3JV4A 4G8IB 1BP3B 2ZNXA 1L6ZA 4M6NL 5JOEA 5IBLC 2CKNA 1BJ1H 2DYPD 4PJBB 4TVSa 2NY0C 1F58H 1YEDA 1U8JA 3OHXA 5I1LA 1DUZA 4LEXH 1JIBA 1UXWB 3DJ9A 3W39B 1PFCA 1JMXA 1WFNA 1R3KA 3G6DH 4JRYD 4ZPTB 3O9WA 4S2SB 2BCKB 5D1XD 3BPOC 1KV3A 2JCCA 3PWLA 3V0WL 1T5WB 4QHMA 3S9DB 2HT2D 4I48B 3OZ9L 5IVZB 3BP4A 2MCPH 3TBVA 1MJJB 1W72H 3NCFB 1LHZA 4V1DD 4HS6A 1CFVL 4YC2C 3DV6A 4XNQB 1JWMB 4M48L 1K4DA 2V2TA 1CE1H 3PWNA 2ITDA 3O6ML 4MJ6A 1EJOL 4ELKB 1YEIH 1M6OA 4JY6B 3CXDL 3DHJA 4S0TD 1YPZA 1U42A 1WBZA 3Q5YA 4PJIA 1UKQA 2XG5A 15C8L 1IC5L 3JWDL 4HKXA 2CPCA 1V7NL 3MO1B 4PRPA 4EVNA 3D85A 2R0ZH 1RD6A 3OKKB 4NPYA 2E5EA 2G2RA 3TYGH 4S1SH 3GKZA 3NAAL 3KHQA 3T0DA 1D9KB 1IEAA 3B43A 3HE6C 3VJ6A 5FM8A 1ZVSA 3U36A 4D0DA 1U8KB 4ODSH 2XY2A 2OZ4H 3K81A 1YMHB 4N5EC 3ESVF 4ZD3H 2CGRH 3G5XA 5JIPA 2EDWA 3ROLB 4DCQA 4J3XA 1N59A 1U8LA 1ZLUK 3HNTL 3MROB 3C60D 4PJ8A 5TPWH 8FABA 2HVKA 1SVCP 1RIVL 4OCSL 5T33L 3F6LA 3CCHB 1OGTA 4KJWD 1AGCB 4QT5A 4YEEA 3AGVA 3GMMA 2W0LA 5D7IE 1PAMA 2X4PB 1EFXD 5I1AA 5I1EL 4JHAL 4NQEA 4IMKC 3PGCA 4PJ7E 1CFNA 4LLUB 1ZXQA 2A0LC 2MSPA 5IK3A 3QQ3B 2WUBL 1CGXA 3P9LA 3D2UB 4BQ8A 1NH6A 5ERWB 5HPOA 1CGWA 4RFOL 5EZOL 2XWJB 5F97E 4WIQA 3GSVB 5EN2A 2AXFA 2APVA 4P23B 3QXUA 1I3RA 3JVGC 3FO0H 4JFEB 4F9LA 1QEWB 1WLHA 5EU4B 4JN1L 4WFEE 1T1YB 3CXHK 3OR7A 5J12C 3X13A 2PCPA 1BF8A 3DX6B 5MHSD 4LNVA 4AEFA 1RULH 3UBXG 1UJ3A 1XF5B 4L8SB 3MCKA 4UV7L 1B0RB 1UH2A 1AQDA 4G8FB 2X4NA 2XFXB 3VFWB 5JXAL 3W11C 5GJTH 3SE9H 4PGZA 2F74B 3SOBH 2C4FU 4ONGL 2VITB 5F6HJ 2XN9E 3G08B 4P4RB 4U1SA 1PYWA 2R2HB 1YEFL 3X14A 4DGIL 2UWEE 1SVZA 3DGGB 1II4E 3N1GC 1PG7H 5E8EA 1F58L 1WITA 3KPQB 4TNWF 4U6TA 5I73C 4WI8A 4F7TA 1T1XB 1KXVC 1JPGB 3N9GH 3E8UL 1FL5A 1ZLVK 2J3SA 3KYKH 4O2EB 2W9DL 2MTPA 3VGDA 4E41D 4FXGB 1HQRA 1INDL 1JF6A 2N7BA 2RBLA 3OV6A 4POYA 1IAOB 3BXNA 1PKQB 3X12A 4BZ2H 3BO8A 4IRZH 5JMOC 5K9OA 4YGAB 2CH8A 5J13B 4LSSH 3K46A 1EGJA 3QDMB 3BD4A 1CTOA 1HEZA 4Y5YA 4GRWB 4QXUH 4Q6IB 1EX0A 1ITBB 4MD4B 5I0ZA 1CDGA 2VLKA 3FCTB 5DRXA 4R7DA 1O7VA 4GAYB 3QSKB 5I8OL 3ZTNL 1KIRB 4M6OL 1KT2B 4NIKB 3I9GH 5JLZB 3WHE1 3NCYS 2XA3A 4HUUA 5SX4H 3RL2B 3GBNL 4M9PA 4EUPA 4N8PA 5FM4A 3RTQC 3UX9B 2CDFA 3BKML 4NWTH 4HKZA 4JO1H 1SM3L 5DWUH 5EU6B 3NPZB 3WIHH 2O93L 1R5VA 3HE7D 3LS4H 3MRBA 4PJDB 4PJ7A 3ZTJH 4PJEF 2QADB 2DQEH 4Y1AA 3JTSB 1QKZL 1DANU 2P8PA 3ULUD 2EE2A 3L3KB 5F8RC 1CDJA 1X5AA 1SY6A 1Z3GH 1WAAE 1XR8B 3LN4B 4BSWA 3G6JF 3TZVA 3K2UL 4MS8D 4LCWE 4U1LA 1D9KD 1UFUA 1K5NA 5J56B 2VZUA 3OG6B 4JG0L 4C58B 3GSWB 3VI3E 2NLJA 5JW4R 2EYTB 4H8WC 2XTJB 1AD9A 3QZWB 4PRBB 4PJ5E 3WDIA 4ZS6C 4KK5C 4FABH 2J6EL 43CAB 2GEEA 3ZKMD 4F7MB 2D31A 3FHAA 4M8VA 3DNKA 5F7MC 3FHQA 5HBBA 2X70A 4HLJA 1KEGH 3I3EA 3WV0A 1RULL 2Y5EA 3RZCB 2OI9B 3AU1A 2C1PA 4GQ9L 1ZAGA 2XN9A 4EN3B 5FYJH 2GSGA 4OKVA 1DVFA 1N3NA 4JHWL 5ITFB 1KJ2A 4PGDA 4LVNC 1DN2A 5I17B 5KANG 3MV9A 3D2UD 4PGBA 4RBPH 5FGCB 5KOMC 4JQVA 1Q94B 1NSNH 1PG7L 4NC2B 2V2TB 1G7JA 4Z7VB 4OI9A 4P23D 1FNEB 1M6OB 1BIHA 1KENH 1RK1A 3GMNB 4JFXB 1N0LA 3KLHD 2X1WL 4X5XA 4PRPB 3MJ9H 4K7PH 1I7UA 2EDEA 1UM5H 4BQ6A 4MNHB 4IIQB 4OM0L 5E8PB 4MA1B 3NFNB 4RZCB 5E70A 5IF0B 3QRGH 5F7UA 1SJVA 4BZ2L 4IRZL 5A2LH 4PB9L 2Q6WB 3T0EC 3TBSB 4LSSL 2BXZA 2IGFL 2JK5A 2FX9H 4OZHF 3ETBF 4LPUA 4YXKH 1FVEB 4Q9RH 1P4LB 4W6YB 3V5DA 2P5WA 1K3ZA 3TJHC 1U3YA 4QXUL 3S8WA 3FOLA 4PV9B 3G5XB 3ARGA 4JM2A 5J9PB 2HFGH 4NRZB 5KVGL 4OGAC 4YFDB 3AREB 4DFIA 1VGEL 3RDTC 4X9GA 2I5YL 3T3MF 3MRJB 4ZUSA 4RFEB 1MRFH 2APBA 3VMNA 2VN7A 4X8XA 5JPMA 4KDVA 1Q9OB 3GRWL 1TZHA 4OZGF 5F7FA 3LHPL 1N5YL 4P9MH 4YGVA 4X5WA 1OAXH 3HFMH 5GIRA 1CD0A 1I7ZA 5C71A 2DICA 5F9WB 2VQUA 1I75A 1U58A 1EZVY 3QDMD 1OTUC 2CLVA 1BMGA 1XF2B 5I8CB 1RJLB 4IOFC 1WAAA 4G6JH 5DT1L 1XGTA 1I3RB 1TCRB 4EOWL 1TQBC 2AEIT 1C08B 1D6EB 3NCJH 2B8OT 3GZKA 1AFVH 3OR7B 4XRCA 3X3FH 2NY4C 2NMSA 3TWCH 1UJ3B 1Z3GL 3T8XA 3KXFB 3C6SA 2B1AH 3KYOA 3PIQB 5J89A 4X6CF 5EULV 5B8CC 1G1CA 5C0IA 3HC4L 1FN4A 4PJ5A 3LOWA 5C0AE 3Q6FB 3V52H 2OL3L 1EEQA 3NIFE 1GPOL 3REVB 1MIEL 2ZUTA 5LGKA 2Y72A 4OD3H 5IEKA 4KROB 1G0DA 3QIUB 4CDHA 4JRXD 4Z7NE 2B20A 3QG7H 5HYSA 2E6PA 3QXTA 3GIZL 5T1KB 3RNKA 4F7TB 1KEGL 3MZGB 2GJ6B 2P46B 1JPFA 3IDNA 4JZNB 4KKNA 5FYJL 1CG9A 3HA0A 2R0WH 2WQ8A 4BJLA 3O3AB 3UXFA 2QSVA 5IJKA 3BOVA 4X7TB 3LRGA 5C7XL 4X4YA 3NH7H 5CIPB 3ARFA 1EERB 3KPSD 4LPVA 3WFHB 4HWUA 5MEPA 5E5RB 2A6KA 1FIEA 3BPLB 3L3JB 4PBXA 3X12B 2O5YH 1DN0B 3BO8B 3O3DB 2W9LA 1MELA 4JFDD 4TUOA 5F1IA 1A14H 3QUMB 4D8PA 1OF2B 3VH8B 2KH2B 4MXQD 2XTJD 5DGQA 4CL7A 3EYOB 5L0QC 2GK0B 1S8DB 4N90E 2O26U 2W38A 1XGUA 2FATH 3S35X 2XQBH 5JXEC 4FQPA 2J8UE 2ZUWA 3RZCD 3DO3A 4NFCA 2P43B 4XP6L 5E2TH 5B21A 1GOFA 1FZOA 4XZUA 2DMBA 4DKFH 4MNGE 3RNQA 3PDGA 2ADIB 3OXRA 2YN5A 1RUAH 4OT1H 3UYRH 4D9QD 2FX9L 3HNVL 4OD1H 3S3JA 2QBWA 3B6SA 4YXKL 4Q9RL 4X7SH 4EIZC 5EZJA 5FKAB 3GI9H 5D5ME 1JGLH 1KFAL 4YHKL 2CLRB 3FQUA 5M95B 5FCSH 5D7IB 1D5IL 3EYQC 5FXCH 2Q87A 1ZGLB 3I02B 3KS0J 5IMOA 5IQ9A 2FD6H 1QVOB 2JB5H 5EIIB 2BNUB 2ESVA 5FYLH 4P9ML 2AW2A 5E94A 1F5WA 4PREB 4XNZB 3MQIA 3H7LA 3HFML 3FFCE 5EUOE 1ZE3C 3GJFA 4BSWB 3TZVB 4K3DL <