4ZFZB

Crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with myristoylated 5-mer lipopeptide derived from siv nef protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Crystal structure of the N-myristoylated lipopeptide-bound MHC class I complex
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 15
structure length 100
sequence length 100
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfzB00
1EH9A 3TFKC 5IMOA 3RKDC 4XZUA 3IKCB 4HLJA 4PJCA 2UUDK 3FN9A 4LGRB 2OL3H 1NCAL 5TF1L 2A6JB 4N90E 5E08L 4KH2A 5KW9L 4LASH 1VPOL 3QFDB 2LQRA 5DJ8A 4F37F 5D7JB 3DRQB 1G6VK 2EDYA 1IT9H 1VFOA 3GK8H 1ZSDB 2A6DA 1T1XB 5BZDB 2AV7B 1BQLL 4NSKB 4B41A 3E2HB 1N2RA 2OL3B 3U6RA 2EH8L 3PV7A 5CSGA 5FDYA 3T0DA 3GSVB 5E5MB 1OAKH 5I1IL 1OM3H 1ZEAL 5TDOA 3TBYB 5TH2A 3FCTA 5J56B 4DKEH 4UNVA 4MA3B 1AQKL 4ZUWA 4HIEB 2X2YA 1AC6A 4G5ZL 1YN6B 3NZHL 3ILPA 3S37X 4BZ1H 4PYGA 4HFUH 4O4YL 4P4RB 1EO5A 1LDPH 5FYJD 5T3ZD 4KJWC 2PR4H 4G8GE 4O5LL 1CE1H 2IC2A 3DBXA 2AI0L 2CRMA 1NFIA 3ZE0E 3ULVE 4W70A 2DQFB 4Y4KA 3KPMB 5M94B 4JGMA 1JPGB 3ARBD 4KTDL 5EORH 5KSUA 4HKBA 4YK4C 5TFSL 1F90H 4U1NB 3DYPA 2DDQL 1AH1A 5KBNC 3DX6B 4NZRL 1FBIL 4BFIB 4K9EL 5DRZB 4AL8L 2CK0L 2A74A 4WV1C 3VXMA 5FF6A 4LKXA 4WUUA 4XGZA 3JWOL 3OJDB 4XMKH 5CJXA 3HMXA 3GSNL 3V6FA 5EBGA 1UJ3B 4MQSB 1RHFA 3MR9A 2YPVH 4PJCE 3SJVA 2P44B 4WI5A 5GGTL 1KELH 1KJVA 1JF6A 3JVGC 3RY4A 4TNWF 5KN5A 4MNQB 3ALWA 4JQXC 4G42A 1NL0L 3WHE0 4LSRL 3VFWB 1P2CB 4NN6C 2FD6H 5CEYB 5BV7H 5EU7E 1OCWL 2ED7A 3FN0H 3LAFA 5KOVC 1YEIL 4P5TA 2BSRA 4PY8J 2IALB 3JXAA 2PO6B 4FQXD 4YHOH 3VWKC 4N9OB 1T66C 4XAWH 3WXVL 4LSTL 4Q6IA 4JQIH 3ARFB 3O3EA 1D5BB 4YX2L 1NAML 5BV7B 3GSWA 2VTFA 2E7CA 5LGKA 3GHEL 2D0HA 1PG7X 2F19H 4M5ZL 2OK0L 4Q9QL 1HH9A 4JZJB 4ETQA 4N1EA 5HHXH 4U1HA 3GMOA 1M7IB 3WBDA 2XG4A 3U4EB 2ATKB 5DJCB 1DVFD 3WMSA 5EBLA 2HLFC 3TNMA 4KMTH 5J11B 1WC7B 1IARB 4HHAB 5DJZA 5DJ0B 2FX9L 1X5ZA 1TDQA 3I6KB 4D0DA 1ZLUH 3SE3C 1F97A 2QADD 1CL7H 1UM5L 3HFML 4E42A 1E4JA 5ETUA 3PV6B 3S7GA 4JB9H 3VXME 2DQHL 4WUUE 2PCPB 5HHNA 4RISL 5SWSE 3V5KB 3VU2A 1J12A 4G9FD 3O9WA 2YD9A 1MIMH 1G1CA 4IRJC 1RJYB 3OZ9L 5I1AB 4R3SB 5JQ6L 4U2ZA 5HD8C 1LMKA 3RDTA 1ED3B 3MACH 3DX8B 1HINL 3QDGB 5IVZA 3BP4B 1N0LA 3BHBB 2OTWB 4JZNB 1RJZB 1YDPA 4YR6B 3QQ9D 1ADQH 1B4JL 3Q3GA 1PLGL 3ZKXB 1ETZB 1F3RB 1MELA 3MQIA 4K7PH 3Q1SH 1NUFA 1T20B 3MLSL 1EFXD 3O6FB 1XGPB 5CSBA 2XZZA 3MV7A 4X6BB 1AO7E 4XP9L 5CZXC 4HIIB 7FABL 1NMCC 4GJTB 4YPJA 3TJHC 4PJBF 1XR8B 3TBWB 4LSUH 2ERJC 3VH8A 4N1CA 1R0AL 4ODWB 3O0RH 2UYLB 2E7MA 5GSVA 5JDJA 4MGXA 1R3JB 4PJXB 5D7SL 3VRIA 3K46A 2NXYC 3EO9H 4OLWH 4FQ1H 2BY1A 4P3DB 5T33H 4GW1A 4D8PB 4XCEA 3BWUC 4PRHB 4NHCH 2GITB 1XIWD 4M6NL 3RTQD 1CFTA 4K7PY 5D5MB 1G7HB 5GGSB 1NANH 3ZZ1A 1E0OB 2DLHA 1DBBL 5C0CD 5JW4Q 3REWB 1HNFA 1ZHBB 3QHZH 1MVUB 2ZCHL 3PWJA 3PL6C 5GZND 4RIRA 3FTGB 4URTB 5D6DC 3RVUD 2ITDA 4JFED 3NVQA 3QEHA 3GHBL 1VEOA 1I7RA 1NGPH 1N59A 4EIGB 5I1DB 3MUZ1 2VDMH 3LIZH 1A7BA 3K2MC 1QG3A 1J8KA 4KWUA 3V5DB 5IM7B 3PHQB 1LO0H 1MAJA 2BSSA 1NDGA 2CXGA 3CXHJ 4ZXBA 4LHUD 5C70A 2ZOKB 4GKSB 1JIBA 4L4VD 1AGCA 3MTRA 2ORBL 2X4TB 5IQ9B 3ARDC 1J5OH 3D85D 1TXKA 3RP1A 3ZO0A 3MV7E 1MFDL 3RBGA 1TJGH 5GISL 1ZT1B 2EYRA 4NGHH 3QYCA 3T0ED 1DE4A 4LSSH 4XBEL 1ZT7B 3LN9A 3ARGD 4HXAL 4M7ZC 4OM0H 4TSAH 2GSIB 5FUCE 3V7AE 2KZ1B 1A7RH 2ICWI 1RZFL 3RL2B 5IKCB 1KB9K 3P40A 3T2PA 2R4RL 1T5WB 1VGEL 3D2UA 1CTNA 5JOPE 4PREB 5E9DD 4ODVH 2DQDH 4LCWD 4Q9CA 4E0RA 5IESH 3QIUA 4FQPA 5DUMH 1G9NL 4H88H 4TUOB 1YC8A 5I1EH 4MMXC 3KYKL 2A9MH 5E2WL 1LEIB 3OR6A 4XBGA 5IW1A 3MLXL 2ADFH 4ODHH 4PJDF 4XXDA 4YIQB 1OB1B 4QHKJ 1FORL 1TZHA 3ZTJH 3LSOB 4LLYA 3VGBA 3QH3A 4NQDA 4ZTPH 1GSMA 3VGGA 4U49A 3NZ8A 4LSVL 4Y4HB 4MD4A 1KPRB 1KACB 1WAAA 4HX1A 5IMLA 4WVRA 4Z7NF 4EXPX 1OP9A 2O5ZL 1TCRB 4AM0B 3FFDB 2GHWB 1U6AH 2FRGP 3FQUB 4M5YL 3BN9D 3L7EB 5DZNA 5LCVL 4R26L 1JWSA 4O2CB 1JTPA 2BDNL 4XBPB 2Z35B 4YBHA 4PJBE 3UTSD 3VXTA 4LPXA 3K7UA 5F89A 4HIJA 4RZCA 4Z7VF 4YDIH 4UQ2B 2WANA 3BP7A 1DBAL 3QEUB 1QBAA 5HDOA 4AIOA 3MLYL 2ESVE 3LKPB 4LLVA 4PJIF 4XP1H 5I30H 4HC1L 1BQHA 3PXHA 4JLRA 5F96L 5E6IA 1HK6A 3CVHL 1JPFB 4RQQB 5C0EB 1DLFH 4WI4A 4HULB 3T2QA 1MF2H 3TYGH 4FS0A 4AYFA 3JTSA 1ZK9A 1AR1C 1AGDB 1NLBL 4QXTA 2E9JA 2JB6A 1Q1JH 3C5ZD 3L3DA 3MREA 5J1SC 4NRXB 5TGBA 2HN7B 2VLJD 3UJTH 25C8H 1IGCL 3QIBD 2VLME 5AZ2H 2ZUSA 3VFUA 3X14A 1F4AA 1WV7T 2AJ3B 2H6PB 5F8QC 2YZ1A 3QXDB 1CG9B 3T8XB 2ZCLH 5ESVA 4NQDE 5F6IC 5FDWA 2HJKB 2DQUH 2F5AH 1PZUB 4NP4L 3EFDL 4ZUVB 5FO7B 4KJWD 3SE9L 4P2QA 4KK6C 1WAAE 2XA3A 3M45A 3MV9B 3B9KC 1KNOB 1OGTB 4GRWF 2EDWA 4ODXA 1YZZA 2FX7H 4LU5H 3QNZB 4JFDA 4JHAL 4HKZB 1AP2A 4X5WB 5EFIB 1ZANH 2HAZA 1FDLH 4HD9A 3TH3T 5IB5A 4JFHD 2EDTA 4I8DA 3GMPA 4RA0C 4ZFFB 5AD0A 1P7HL 1FNEB 2AEQH 3LQZB 3A6BH 3Q5YA 4GW5B 4WDIB 3ULUL 4JDVA 2E7BA 3MRGB 5KOMC 5FGBC 1XF2B 2HKFH 4MX7B 2WWKT 1WK0A 3BQUD 4OLYH 3VI3F 4FN0A 5EUKA 4O02L 3GSRB 5DTFA 3MRDA 1IMHC 4QRTB 1Z0MA 1GGBL 5DT1H 2IMMA 2J6EA 4NO0A 4H20L 5J9PA 4K3HA 3LPWA 1OHQA 3FAXA 2HFGL 2AJXH 2FBJH 3SOBH 4PJDE 3LD8C 5GRYA 5C0AA 3S96B 5I2IB 3VXUD 3VWKD 3CSPA 4C58B 1T66D 3QULA 3GJFB 1T7WA 4MAYA 5B39G 3QAZB 1WBYB 3F7RA 4YHIA 2W65A 3QO0A 5JXAH 1ND0B 4AQOA 2VDPH 2D31B 4Z7NE 3TCLB 2VDNH 4MXVE 4S10A 4WNQB 4Z77A 4U7KA 2R2CA 5ADPH 4WW2C 3CFCH 1XGQA 2JJSA 5B3NA 3W5MA 1BFVL 3OAUL 1F3DJ 2Z8VC 3ES6B 4P2QE 4EDWL 3OKEB 4TPRH 1P7QA 4G7YH 1KJ3H 3V6OE 4BSWA 3JV6A 4WFFD 3UTQA 1VFAA 2HLFD 1CXLA 3MO1B 4JFDE 1CFQA 1HSBA 4GRMB 1MIEL 2VZ1A 4I9WD 2F53D 5I8KL 4W4OA 4CN6A 3KPQB 4CU8A 4K71B 4XVUC 2EICA 3PP4H 5GRZA 1MFEL 4XTRC 2YKLH 4PJIE 1V3JA 4I3SL 4JM2F 4M6MH 2DYPD 5DD1L 4QXUH 2GAZB 4ZOEA 5I1KH 5DEFA 3U0PB 1A7PH 2PW1A 2OP4H 4IRJD 5IB4B 4Q2ZA 5FM5O 3H8NA 5EOCH 1I9RL 1WISA 1WF5A 4EXKA 5HD8D 1MCKA 1G6RL 5B8CC 4UIMB 3HI5L 5D1QA 1MWAH 4S2SA 5DQDL 1V05A 4HKJA 2ARJB 3L5XL 4JFPB 1NCBL 2W0LA 4JQVC 3SDXB 3PGFL 1N26A 5DYOB 1A6TA 3QUXC 5C0AE 1UH2A 4A6YA 5DJ6A 5FHBL 5D7LA 4KJPC 5TPWH 1I1RA 1PKQA 5EOTA 4BH7B 3OB0K 2JK5A 2VIRB 5DLMH 2AS5M 2GCYA 5CZXD 1IFHL 3OKYA 4Y2OA 1MWAB 3TJHD 4GRWE 5F7MC 2FB4L 4Z0BH 3GUTB 1KXQE 1H8NA 2HA1A 5HYJB 5I74C 4KZDL 5C8JB 1NFDA 5F70A 1T83A 3ZDYF 2VL5A 5D2NA 5DUPL 2NXYD 2Y36L 5CHNB 3IS0X 2V5RA 5DVOA 3MRNA 3SDCC 4CVWA 4IJ3C 4EOWH 3U1SH 3NCEB 4OBSA 2Q8AL 4U7MA 1FZJA 3MODL 3QPXL 1CQKA 3H42L 3H2WA 3QNYB 3UX9B 1TTUA 3G9VA 3DUUA 4HUWB 2ICWB 4N0CC 2IH1A 3ZDZF 3BKMH 4PJ5D 3VI3E 2H9GB 4IMLA 4U6XB 3STZB 2NX5A 1KFAH 2Z4QB 1RIUL 5KTEH 1S7QA 3RGVC 4QGYA 3V2AR 2FHCA 1IGTB 4WO4B 1NQBA 5IV2A 4ORZC 3ZE1F 3QDMD 4TOYH 4I48B 3W9EB 4QXGH 2WIMA 2DQEL 5GGRB 1T3FB 4JZJC 1D5IH 1JGVL 1K6QL 1JHTB 4PRDA 2O93L 1AKJA 1DQJB 1JZ8A 3JWDL 3I9GL 4U3CA 1IQDB 3ZLQC 4ZSOB 2Z8SA 5GGUB 2XA8L 4DKFH 5BW7C 3C60B 4GKOA 1KCRL 3HC3H 3I75B 4RGMC 4TVPE 3EOAB 3ARDD 1BD2B 2R0LL 5D7LE 1CLYH 4G8EA 5EIIA 4CDHA 3WD5H 2HT4C 3MXVH 4MSWA 5KG9B 2AK4E 4YHPB 4YXHH 4G9DA 4GAGH 3QRFM 3C09C 2OLDA 3IU3A 3JWNC 5LG1A 4NM4L 5BZWA 1NFDE 2VNCA 3V6ZA 2OXHA 5D2NE 1Y6MR 4PJ8B 3B2VL 1JF5A 2H26A 2PXYB 3LB6C 2BHZA 4P23B 1XGTB 2OR7A 4DK6A 4MXWL 3QIWA 4LEOA 3C87A 3AREB 3KPSB 1MCEA 3H9YA 1P84J 5F7DB 1I3GL 1XT5A 5CBAB 3Q6GL 3I2CH 4GKZB 2CRZA 1E4WL 4HH9B 2VDOH 5D9SA 4LPYA 1NAKL 1R5VA 4UT7L 3G5VA 3OKMB 5CSZB 3OPZH 1XCTA 2FR4A 2CDGB 2W38A 3PWVA 2VLKB 1P9MC 3QNXA 1WFUA 4JJ5B 5A43C 3BD5A 2OTUA 1QSEB 4PRBB 1T4KA 1KJ2A 3S36X 2YPLB 4X7SL 4ZFGL 1KCSH 4X6CF 5CS7A 3GNMH 5TDPA 1CFBA 5INCA 5DDHB 4IRSB 1OSPH 4FFZH 2C3GA 3QQ4B 1HZHL 3BH8B 3VD4A 3R0NA 4NM8L 4LFHG 2UVEA 5AUMB 3IU4H 4KROB 2FLRT 4X5LA 3V5HB 1B0GB 3U36A 3CC5A 4XCYA 3A6CL 1WEJH 1JHLL 3L1OL 3KJ6H 5ACLA 3ME0A 3HE6B 1UH4A 3WUWA 4MD5A 2K7QA 1D6VH 5ID0B 2DQJH 1EDQA 1QKZL 1CR9L 4PB0H 1M71B 3MSPA 3OR7A 3X3FL 4PS4H 4GSDH 1KEGL 5TE7L 3BW9A 3FOLA 4L5FL 3ZDZE 1AR1D 2YPKA 2A73A 4JY5H 3W0WA 1SY6A 1EPFA 5EN2A 4XB7A 2JIXB 4RGNE 1BLNA 2XQBH 2P5EA 4X6FA 4FQJH 3ZHDA 3LRGA 4WGWB 2F54B 4HUUA 2YUXA 5BS0A 3NN8A 3ZE1E 3B3IA 3QPQC 1CCZA 3T08A 4YDLC 4XNZB 1UA6H 2AXGB 4YGAB 4Z8FL 5E1AA 3TZVB 4F9PA 3FO0L 3HI1B 4WY7L 4OI9A 3VMPA 1DTUA 4KK6D 2PKDA 1QNZL 4XMLL 1SEQL 1TJIH 3B9KD 4B7IA 3S88H 3W2DH 4PJ9B 4KPHL 5LWYH 3ETBF 4ONOA 4CDGC 2BOCB 3OSKA 3N06B 3D39D 1VACB 2OL3L 4WHYG 5C6WH 3RWFA 2C4XA 5J6HA 1T7YA 1WVZA 4LMQI 1Q9KB 3X13B 4ENEC 5DMIH 1F6AB 4PGEA 3WFHA 1X5XA 4PGBA 2DI7A 2HT3D 1WWBX 4M00A 4NDMB 1UKTA 5E99L 3SQOH 2DLEA 5I9QB 4OIAA 1BWMA 2CKNA 1JTOA 1YECH 5D7IA 2F8OA 4J8RB 1Q9LB 3RZCC 4JRYD 2ZKHL 2FO1A 1EFQA 1GGCL 3L6FB 1OAKL 3GO1H 3P0YH 1OM3L 3HPLA 4OQTA 4PRPB 3OJMB 1ZVSB 3WCYA 4DKEL 3TPUA 4G8GB 1YEJH 2FIRT 2JCCB 4P46D 5SX4I 2Y9RT 3W0WE 1ACZA 2C5DC 3BIBX 5HVHC 5IJKA 1C8PA 4HFUL 3AU1A 4GBXA 1T7VA 1UWEH 1LDPL 2P5EE 3HCVB 4UU9A 2PR4L 4W4NA 1CE1L 1XZ0A 2CIKA 1L7IH 4MLIA 4NQUA 5BS0E 4CADA 3R06B 4HIXH 3IAPA 1GZPB 2EC9T 1ORSB 2UWEF 1VADB 3T2OA 3BJLA 4F7TA 5I1GH 3DTXA 4X6CE 2QHLA 5IIEA 4FOMA 4TUJB 4X6EA 1JVKA 2R69L 1D5ZA 5J89A 3FB6A 3MRHA 5ANMB 3KYNB 3Q48A 4M3KB 1RZIB 2YRPA 3HZKB 3P4OA 2DWEB 3LKSB 3P30H 4B50A 1T22B 4WI9A 2PETA 3NCYS 1AXTH 4XMKL 2BRRL 4AIZA 3SGJA 1S78C 2YPVL 4N9GB 5IB2A 1MRDL 4JG0L 4XVUD 1MREL 2QR0A 3IFNH 1CGYA 4XTRD 5F7KC 4EN3B 3TO2B 3NH7H 3FB8A 1CDUA 5F1NB 2DOCA 1C5CH 3KS0J 1ZTXH 5BV7L 1JK8B 5B38A 2BNQA 2EDJA 1HHJA 1I7UB 1H5BA 4YHOL 5DK3A 1A7QL 1S9WA 3ECBB 4UQ3B 4XAWL 4WFED 2QQQA 1IC1A 1KTRL 4UILH 3TNNA 2ZSVA 3FFCB 1Z5LA 4J1UA 3QZWG 2EDFA 2G2RA 4QF1A 1C08A 3UP1A 1MLCA 3QUMH 4NQVA 4CW1B 3G6DH 3FT3A 1ACYL 4NT6A 2X4PA 1OQOA 3S6CA 3VFVA 1DQDL 1G7JA 4IS6B 4KJPD 3DMMC 5HHXL 3O3DA 5I19H 4RRPG 1IKNC 3TN0C 1A6VH 2YR3A 1LO5B 3D6GA 2Z93A 4KMTL 4XNUH 4MXQD 1ZLSL 1TNNA 2DLIA 4MWFB 5SWSB 1XGYH 5C09A 1MHHA 5BRZD 3QUMB 2PF6A 4KKCC 2XZQL 4P9MH 1QFPA 2BVYA 1CL7L 1EK3A 4OCWH 1JNJA 2AJZA 1HQRA 2GK2A 5IFAL 5T1MB 2IPUG 3KJ4C 1N7MH 3S3JA 3SDCD 5CZVL 4J3WA 1MIML 4JFFD 3WKNA 4ZAKC 1Y0LB 5FM8A 3BRFA 5IROA 1XGRA 1JFQH 3K0WA 2EDOA 3X11B 2AQ2A 3CH8A 3U9UA 1H3TA 1LD9B 1NCWL 1NEZG 2HLAB 4NJ9H 3K3QA 1CK0H 5KZCD 1FZOB 3QCUL 4G7VH 3BZDA 4MNGA 3P77A 2EIEA 2A1WL 2YK1H 1JNLL 3WDHA 5E6YA 1ADQL 4C83B 5EOQH 3ARFD 2BNQE 1I8MA 1AO7B 2J8UB 4Q9RH 3Q1SL 2Z9TA 3X3GL 3VXRA 5D1XB 5DA4A 1RZGB 1X5IA 2NPLX 3MOBL 5C7XL 4OZIA 2VDRH 3UBXG 1CD1B 3C8KB 4IEFB 2CR3A 4LKCA 3UYRH 3K80A 2B4CL 3L9RA 4PLKC 1FG2B 2AJYH 4PG9A 3CMGA 4YDJB 1IC4H 5E4IA 1FAKT 5BVJA 2PTUA 4X80H 2J4WH 2X70B 4RSVA 3DI2B 4ODTH 1SVCP 2HT4D 3JTTA 5DI8A 1MHCA 4FQ1L 2X7LB 3H7BA 1JF1B 1YEEH 4YHLL 5IWLC 4NHCL 1N6UA 4PB9L 4C56B 4OF8A 3OXSA 3JZ7A 5CP7B 3EFFA 3LB6D 1S9VA 1T03H 2AXFA 2AW2A 3MYZA 4HFWB 1BF2A 4KTEH 4O51A 4Y5XA 4FFYH 2NTSP 2HRPH 4LVHC 4U1SA 3L5HA 1OTUC 2P48B 1FP5A 2VSCA 3F7YB 3PP3H 1FVEA 5C08D 1XCQB 5ABDE 3RAJH 1G7IB 4HGWB 4M48H 1QSFA 3PQYD 1GAFH 1DQTA 4OCNC 5ACZB 1R5IA 3LIZL 1WIUA 3C8HA 4K2UL 2XI9A 4ORGA 3MCKB 2KZWA 2GK0B 5F44A 5ICYA 2H1PH 4DJMA 2V5TA 4DW2H 1L6ZA 1RFDH 4F7PA 1IGYB 3WN5C 3GKWL 5DMKB 4Z18A 3B9DA 3RY6A 4GW4A 1R6VA 3SKMA 4CBPA 3SO5A 1W0WB 3GMLB 5C0BA 3ZE2F 5CIPH 1JZ7A 2H32H 2BNRD 1H8OA 3FQXA 3F6IA 1CDHA 4LSSL 4PRHD 4OM0L 2FZ3A 3CXDH 5D71L 2SEBB 5L88H 4TSAL 1VFUA 2I24N 2EYTB 2JE8A 5AZEL 1WT5C 1EO7A 1V7MH 2BVOA 1BECA 3M8OH 5JW3L 2R23A 3C2SA 4R96B 1CFTB 5E70A 1VEPA 2DQDL 2KQMA 3BGMA 5IESL 4JCMA 2Z92B 3TO4B 4H88L 1E4KA 3LN5A 5I1EL 3LQAH 2VXTH 4G9FA 4L8SB 2H32B 5CIPB 1BEYL 2A9ML 4F2MB 2JJVA 5CJOH 1AC0A 4XCFL 4E41D 3HI6H 5DHXB 5HI4C 1NCCL 3K4DA 3GSNA 5SX4H 1JL8A 4ODHL 1S5IH 5EZIH 4PUBL 1D3CA 5EH1A 5F7YC 5GGTA 3WFDH 4XP6H 1G0YR 1U8NB 4ZTPL 3KXFD 2V2WB 3F5WB 4GQ9H 5C0GB 4ZUUA 4X9IA 1I8LC 5F88A 5MEQB 1YEGL 1WZKA 1MQKL 1JN6A 3NCMA 3I3DA 3QHFH 1QSFE 2P24A 3QPQD 2IFFH 2DIJA 3HE7B 5D6CB 1A21A 3BPNB 1ZE3C 1U6AL 4PJBB 1CFSA 1NC4A 3VWJB 4OZ4B 5I15H 1U58A 4NC0B 4LPVA 5EC1B 1N4XH 5K93A 4DUWA 5KVFH 3PGCA 2DTML 5EBWA 5T1LD 4DGYL 5AAWA 2BXZA 4KJYA 5C9JB 1YN7A 2ESVB 3VMNA 4CGTA 2WIIA 3BGAA 1JUFA 4NQTA 1H3VA 1NAMA 2MCPL 3I02A 1FZKB 4JVUA 3RA7H 4RWHA 5DGQA 5C0DB 1BIIB 2PXYC 2FCBA 3ALXA 3TV3H 4NO3A 5C0BE 4P57A 4XP1L 1NGZB 1MFCL 5GRVL 5I1JH 1F5WA 1EZVY 4OV5B 3G5ZB 2X6MA 1J1OH 1N3NA 4MJIA 2F74A 1XH3A 3LRSB 1MF2L 5JHDD 3ABZA 1IBGH 4QCIB 4OZFA 1Q1JL 3WSQL 3WFBH 3RZCD 3WFEL 4G9FE 4NQXA 1T89A 1I8KB 4CVXB 1RZ8B 5FYLL 25C8L 5JOFB 5T3XH 3U0TA 2W1NA 1RSFA 2WW8A 3DV4B 2DKSA 2GSGB 3RPIB 2A83A 4BFBD 3BZFA 2ZCLL 2CLVB 5J12B 3Q6FA 3VFNA 5DRXB 3GI8L 2F9BT 2DQUL 1MPAH 4FQLH 4PV9A 5E2UL 1KCKA 3SY0B 2OR8A 3AS0A 4UDUB 3O2DL 1CU4H 2B39A 2XKSA 3FRUA 2VAAB 4OM1H 3TM6A 2AKRA 3PWPB 1I4FA 3DHMA 3QXTA 1KENH 4X4YA 2W0FB 4LHQB 1P4IH 4DZ8A 2UY6A 1R3KA 3O4OB 3EOBB 1YC7A 2EDHA 1FDLL 3WNNA 1DANT 5IOPB 3NACL 4JY6B 3ZE2E 2R8SL 3AMLA 4KRPC 5H94A 2HFEB 3PGDB 5TDNA 1G7PB 3ARGA 4YPGB 2UY7A 4R97B 1ZLVH 1J11A 2H3NA 3O81A 4OSUL 2R1YB 1S78D 3IFLH 5FM5M 3CK0L 5FOBB 3V4UL 3TESA 5HYSA 1I1YB 4NUJB 3WV0A 2DLFL 4OD2B 5I1LA 5KSAA 5E8OB 4PJDB 1IAII 4QY8A 2XFXA 3RWDA 2X4RA 3VXPA 4EQ2A 5DT1L 2UV3A 4W6YB 3RX7A 1NBZA 1CD9B 4Y16B 1QACA 2AJXL 3SOBL 2V5MA 2B5IB 4XNZC 3P9MB 5F9WB 1PKOA 5FA3A 2E9IA 5DEGA 3TZVC 2LVCA 3CZFA 5JZ7C 1LK3L 1Z9MA 3QQ3A 3ARZA 4NFBA 2IBBA 2FYYA 4MZ2A 5FUOH 1M7DA 5HYQB 4WHTA 2BC4B 4APQC 4JFEE 4MLSA 1K4DB 1OGAB 2OJEB 5JXAL 3TYFA 4U6YB 4I18C 4HWBH 3KVQA 3LPFA 4X9HA 5DK2A 3VXOB 4D0BA 3CFCL 2F8VA 2IBZY 1IRAY 3O2WL 3SDAB 1INDH 3VJ6B 3HZYA 1EIBA 5CBEB 4Z0XB 2WWMC 4Z7VB 4ZO6A 5DS8A 4IMKA 3SKOA 1KJ3L 3RWIA 3TH2T 3TN0D 6CGTA 3CSYA 3L3GA 5DRNB 2Y25A 4YHNA 4ONFH 4PJIB 5CCKH 3H0TA 3WLBA 1S7VA 3RHWK 4F7CA 4KKCD 5SX5H 5D8JH 1UZ6F 2L7UA 3T4YA 3VE0B 4EDXB 3WYRA 3PP4L 1I7TB 3T0EE 2GTZA 4K23L 2YKLL 5MP6H 1V7NL 2BMKB 4ZFZA 4ZPTA 5KSBA 4FNLH 4QRSB 3P9LB 4ZDHA 4ZAKD 3FO9B 3O3BB 4Y2DB 4YUEL 5EOCL 3IJHB 1HHGA 2HG5A 3HUJF 3GSOB 4LCWE 4DFIA 4HH8A 5LAXA 3C5ZA 3G5XB 4KVCH 1WZ1L 4IRZH 4J4PC 5H2BA 2XXMB 2VLJA 1MWAL 1S5HA 3EKCA 1SJXA 1U95B 5HPMB 3DARA 1HILA 2Y06H 3QIBA 5EO1A 5J4MA 2VOTA 5MEPB 2OMNA 5IEKA 1ZGLP 1IEAA 4WHYH 5E8NB 4DN3H 1INEL 2PTTA 3UJJH 4HV8B 3TP4A 4FP8H 5CAYB 3HMWL 4BQBA 4JZOA 1F13A 5D2LA 5J6GA 4N0YH 1PEWA 2DKUA 2D4FA 1EJ6A 4M7LH 3FN3A 4PLKD 1UM6L 1MCJA 1NC2D 4OD1L 3DVNB 3RI5F 1G7QA 2OTPA 4YXLH 4Z0BL 1IGJB 1S7TB 2ZUYA 1A3RL 4UV4H 1KN4L 4OB5H 4WV1A 3HZVA 2E9BA 1NLDL 4K8RC 4RMRA 5EBMB 1LO4L 1HIMH 4XWGH 3UTSE 1EHNA 5HBBA 3U1SL 3QCVL 4F33A 4OKVA 1QO3A 5CZKA 3BQUA 5CUSH 2EZ0C 3BKML 4PGCB 3P11L 3HUJA 3PUCA 4OLUH 5I1HH 3X12A 3GZKA 5DJDB 4F7MA 1U2HA 3FT2B 2GFBB 5C92A 1BIHA 2JJTA 32C2B 4H25B 4HC1A 5LGHH 1GJIA 5JW5A 3BWAA 5IBTH 3CVHA 1OTUD 2AGJL 4D0CA 1X5FA 2NW3A 3VG9B 3O2VH 2A9NL 1J8HB 1LE5A 1RZKH 3OKKB 2BX5A 4Y4FB 1RVFH 1D5IL 4UTBL 2VLJE 1IQWL 4JJHA 3VI4E 2QKIB 5C0IB 4L8DA 3SDDC 3W39B 4DKFL 3MLVH 2VL4A 4PRNB 4OCSL 5DO2C 1WCBA 2AK4B 3OJ2C 4PRIB 4ALAH 1LP9F 1MJ8H 2O5XH 1T6VN 3B6SA 3WJLC 1U92A 1NBYA 1GVIA 4FFWC 3T77A 4RWYL 5F7NC 3QG6A 3L3JB 2XWTB 1NUNB 1BQUA 4BELD 5DRWB 2OMBA 4Z7OF 4NQSA 4KTYA 2DQTL 4XH2B 5FA4A 3CMOL 4YXHL 3RJDA 2CIIA 3W9DB 3NIGE 3S35L 4JM2B 4BSJA 2P5WA 3VD9A 4PJGA 4AZ8A 1DEEB 3D5OF 1GZQA 2IH1B 1IM9D 1IC5H 1ZV5A 4HBCH 4IIQC 4P3CL 5DR5H 2BSED 3MV01 3FO2A 1AGBB 3WIHL 1ZGLB 2XG5A 3I2CL 5HI4D 3QFJA 2MTPA 3DGGB 1G9MC 3RWJA 3HUJE 5IVXF 3DROA 5A2IH 3TLRA 2KDGA 2XPGB 3OPZL 3EDKA 3QEQB 1T21B 3MA7A 3MRCA 1MJJA 1UQSB 3QZWB 2P42B 5H37G 4ODUB 3LZFL 1DP0A 4FXKB 5CP3H 1PSKH 4ZS7L 1MY7A 3WKML 1U3JA 3QUZB 4XVTL 4K7FA 3VXUE 5KANG 2CRYA 4G8IA 1KCSL 5DC4B 4QRRD 4HZLA 4JO4H 4LHUG 1PYWB 4H26B 4FFZL 1MCPH 1AXSA 4LPCA 3AS3A 5I8CB 1RPQA 3C9NB 2X89D 2VXUL 3OMZA 2B2XH 1U3ZA 1KEMH 2MQCA 2W9EH 1YY8A 4YE4H 1BBDL 2COQA 5CINH 5F3BB 2VISA 2PXYD 4O2EB 3RNKA 3FO1A 3GMQA 4X7TB 2X1XR 5KSVA 1WEJL 1IAIH 4WFFE 3KJ6L 3QUYA 2X4OB 1D6VL 1LK2B 1A6ZB 1RJLB 2DQJL 1U3HB 2I07B 3CGTA 2R39A 4I9WE 2F53E 4RGNB 3UAJC 4Q7DA 2P5WE 3G6AB 4PS4L 4GSDL 3EDDA 1ZS8B 4PJGE 2DTSA 1JV5A 4B7LA 5BOZG 3HNTH 1DQMH 1CLOL 1BOGB 3H3PH 5TQ2H 3VH8G 4YFEA 3KR3H 1Z9SA 2XQBL 2VLKD 3S98A 1EERB 3ULUE 4PYHA 3QFJE 1QA9A 1HYSC 2FO4B 4DOHB 1QSED 2OM5A 4KUZH 5I0ZA 1IZJA 4XP5L 4BJLA 4G6KH 3DLQR 2OR9L 1MFBH 2FJGA 5BVPH 1TQCB 4PJAF 5DD3L 4W6WB 5CEZH 1E28A 1P4BH 1X5HA 2HJFB 4YHKH 1U8LB 5JUEH 4DGIL 5DVLA 2QHRH 3WNKA 2FL5A 1EEQA 3CAFA 1DUZA 4U0QB 4B0MM 3ARDA 2APVA 3ROOB 1AGFA 2ICEB 2AQ1A 1G7LA 2I9LA 4NC1C 5T5FH 3WIFB 2C1OA 3TO4C 4KRPD 4L3EB 4Z7OE 2VDLL 3EYQC 1OP5H 3QQNA 4Z76A 1FYTA 2AEPL 2XRAH 3ULVL 3HLAB 5K9JH 3CX5J 5JIHA 4L4TD 3CDCA 3TA3C 3OJVC 1IGFH 1SBSL 4JDTH 4WU5B 2O26U 3DPBA 4O58L 5FKAA 4HT1L 3ZL4H 2JIXD 2ADGA 4OFIA 1UT9A 4JFYB 4HS8H 3IFPA 1KPVB 1C16B 2WP3T 3MRPB 5D72H 1KJMB 2NQCA 4M03A 1U8HA 3MA9H 4Y5VC 4MJ6A 5C07D 1F4HA 5KAQF 2XY1A 2QSVA 4BZ2H 1MEXL 3TZVD 5JZ7D 3LKRA 4LRNL 3VWJC 1UWEL 4M7KH 3F6LA 1UWXK 2D7QA 3WS3B 3Q2CA 4X6CB 1KCUH 5IK3B 3QDME 1DUYB 4I4WB 3E3QC 4APQD 4K3EH 1S7RB 4HIXL 4P59H 4PJFF 1FSKC 2NZ9C 5I18H 2XNAA 5B22A 5I1GL 4R2GB 1M6OB 1CXEA 2F15A 1UWGH 2HFFB 4CNIB 2WWMD 4K3GA 2R1XA 4K94H 5J0BA 3GB7B 4HCRL 4OCLC 1DSFL 3G08A 1AXTL 4JO2H 1BFOB 3GM8A 2YA0A 4EI5A 2Q76B 3ZKNC 5HSFA 2EXYC 1Z2KA 1TJHH 1WICA 3P4MA 3KDMA 5SV3A 5FB8A 1CVSC 1LEGB 2YMXL 4YZFF 3PABB 3WLWC 2K1MA 4U0RC 3IFNL 1OAYH 2K7PA 4OD3H 1R5WB 1MI5D 1S8DB 2Y5TB 4MB5A 4XNYL 3VFOA 5LJYH 4UT9L 3OKOB 1I3UA 4UB0H 2F58L 5LVEA 1MAMH 1ZTXL 1FYTE 3QT2A 2EDKA 1IEBB 5FGCB 2VWEC 2WINB 4N8CL 1X4XA 2IH3B 5J12C 3U7WH 1MRFH 4J4PD 4MS8C 1MCNA 4ZO7A 3SPVA 5MERB 2ZP0T 3LKNB 3QHTC 1K4CB 2XICA 3FKUS 15C8H 3CLEH 1DDHB 3PWNA 3HC0A 3QUML 4WHDA 5I17B 1LE9B 1NGWB 4XNQA 1EO8H 4OUUB 4CADB 1J87A 4PJAE 1KTDA 2IQAB 5DF0A 3TF7C 5L0QB 3EOYG 5E8DH 3S37L 3ULSB 4OV6F 3RNQB 4ZO9A 3MBEB 4OGXH 5T1KD 1QHPA 4XNUL 3SO3C 5K33A 1YYLL 4YDKH 4JG1L 4WW2F 5IB1A 4NJAH 3NPSC 1E27B 1FNGB 4QHUB 5DXWA 1JGEA 1HHHB 4P9ML 3GRWH 4XAKE 3TT3L 4WFHD 5I6XC 1E6OH 4EN3D 4K8RD 1CD8A 3QO1B 1N7ML 2J7LA 5K9KB 5HHPA 3X17A 1ITCA 1RK1B 1KIUA 2V7HA 4NKDB 5F7WC 43C9B 5K59F 1RK0B 3ZYJA 5GS0C 5CWSA 4Y19A 3LKOB 2BSTA 4U6HB 2NY1B 3VD7A 1EX0A 3UTTB 4ESKA 1F45A 1CICB 3QRGL 1JZ6A 1CK0L 1WFNA 1HSAA 3LHPH 5GGVH 5HDQH 3VXSA 3FFCD 1T04A 4LK4A 3RL1A 4ZOBA 2V2TB 1W0VA 5FYKD 5KANI 4EVNA 1J0YA 4P46A 1EHAA 3PHOA 4JO1L 3U7AA 3CFKB 4TNWK 4WWKA 1T0MA 4ACPA 4LDOB 4R8WH 3L3OA 2UWEB 3WNMA 2PYED 1JE6A 1K8IB 3G04B 4KMQA 1Q94B 3SDDD 4O2FB 1IAMA 5DO2D 2YD5A 2Z31B 1YNLH 1GIGL 3U9PL 4PBXA 2YA1A 3IKCA 4PJFE 1SJEB 3HAEG 4X80L 4ZG1A 2DBLL 5EU4B 2XYCA 2A6JA 5E1HB 2I25N 4FFWD 4ONHB 1ZA6B 3QFDA 4ODTL 5DMJB 3SGKC 1PG7L 2Y23A 4OLXH 5GGVY 1M05B 3IAQA 3DRQA 5D7JA 1YEEL 5J3HC 1ZSDA 3BOVA 3UZQA 1T1XA 5BZDA 3D39E 2AV7A 4NSKA 3ZHKA 5I66B 2E8ZA 4G3YH 4N8PA 2OL3A 1XF4B 1XGUB 2D03H 2N7BA 3GSVA 2DRUA 5FYJH 5T3ZH 5E5MA 4NBZB 4FFYL 1OLZA 4UTAL 4HDIB 3TBYA 1UC6A 4Q0XH 2LABA 2DLTA 4MA3A 5JO5B 5L2KD 2DQGH 1UXWB 4HIEA 1A14H 2ZG2A 4PTUB 3RAJL 1GGIL 1YN6A 4M48L 4Y19E 2VXVH 1GAFL 4P4RA 4RFOL 4QRQB 4XPBH 2GJZB 3VXSE 3K8MA 2D9QB 4F9LA 1JI2A 4UI2A 5GZOC 2DQFA 3KPMA 1JPGA 4DW2L 2FWOB 1GCFA 1RFDL 3SCMB 3JV0A 2HKHH 4U1NA 4MCZB 3ARBB 3OV6A 3DX6A 3STLB 3P73B 3OKNB 1J0ZA 4QGTA 2BFVH 2GUOB 5DRZA 3T3MF 4BFIA 2FDBP 2AABH 4DQOL 3CFEB 3OJDA 3FQRB 4NCDA 1CQYA 5DI8B 2EDDA 5MEND 2BVPB 1UJ3A 3HPJB 3L5IA 4C56D 5CD5C 5L8KB 4H5SB 3MV8B 4QOKB 5MEOB 4GXUM 3KPTA 3GIVB 3PDOB 4MNQA 1OSZB 3VFWA 1P2CA 1FIGH 2BCKB 4NQCB 5CEYA 1L0YA 3MRIB 4LAQH 4U1MB 3R8QA 3UAJD 5JNYB 2NY5L 4QRPD 3BIAX 3IDUA 5K59E 3WNPA 3QI9C 2IALA 1I1AB 1S5IL 2PO6A 5BMFH 3WFDL 4U1IB 5C6PB 4XP6L 2A6IB 2MFNA 4FQXB 5C0NC 1N8ZB 4L9LC 3ARFA 1RUKH 5F1SA 1D5BA 4NBYB 1HYSD 3NGBC 4TSBL 3PXJA 4W6XB 3NIFE 1EHXA 5EWIL 3H3BC 3TBSB 2BOBB 2MCG1 3EIFA 4RA3A 1ZVHA 4JZJA 3V7MA 4WFEE 35C8H 1M7IA 1RZKC 5I15L 1DFBL 2EYSB 1H15B 4OFYA 3U4EA 1N4XL 2ATKA 5KVFL 5DJCA 1SYSB 1UGNA 3KYAA 5ERWB 1QSZA 2VDKH 3SKJL 1W0YT 1WC7A 4HHAA 1DVFB 4M9OA 5DJ0A 4JREB 3B9EA 3I6KA 3MGOB 4JKKA 3RA7L 3OGCB 3VD5A 3UYOD 1JYWA 1HWGB 3PV6A 3TV3L 3VFPB 4H8WL 3DGCR 4UOW1 4MMZC 2PCPA 3TO4D 3V5KA 1A1NB 1MJUL 3JV5A 3EYQD 4K7PX 5BRZE 3MJ8B 1RJYA 1J1OL 2CLZB 5I1AA 4R3SA 5F1OB 1MJ7H 4I2XE 1I85C 2KQNA 3TA3D 1ED3A 4PP2B 3DO7B 1OPGL 3RRQA 3AB0B 4BH8B 3DX8A 3QDGA 3WFBL 1II4E 3BP4A 4PRAB 3TVMB 4MVBC 3BHBA 2OTWA 1GC1L 1RJZA 4JZNA 4YR6A 1QLFB 4JFFE 4S1RH 3CPLB 1F8TH 4KRMB 4WTWA 3IXTB 1XF5B 1IGIL 5T3XL 1A2YB 2RJMA 1ETZA 4GMSL 4M93C 1QFUL 3V95A 1T20A 2VUOA 5F72S 4HKXB 2ZG1A 3O6FA 4ZTOH 4I0PB 1XGPA 3MJ7B 2FGZA 3QSKB 1DL7H 1S9YB 4YAQB 3VWJD 4X6BA 1EFXB 1CF8H 1KGCD 3BPCB 4HIIA 1WQVT 2NY0C 2MJWA 1CU4L 1MNUH 4NWTH 5JOEA 4JPWH 1XR8A 3TBWA 3IETB 1ADQA 4TUKH 1JBJA 2XN9D 1KENL 3SEPA 3BPLB 2UYLA 1R3JA 4JFOB 3HNSH 4G43B 4JAMB 4PJXA 2VABB 2R29H 1KN2H 2C3XA 4P3DA 3DO3A 4D8PA 2MOVA 4GH7B 4R90L 4PRHA 2QQNH 4TN9A 2GITA 5B3JF 1ZHLB 2I27N 3BVNB 1FQ9C 3D1MC 5D5MA 1G7HA 3ZKND 5GGSA 3WFCL 2EXYD 1XIWB 2P8LB 2GEEA 1W2KT 3RTQB 4LHJB 5H37H 5BQ7B 5C0JB 5DUBB 3REWA 1ZHBA 1LO2L 4JFQB 3O6KH 4CRPA 1MVUA 4QTIH 2W0KA 4NHUB 5C0CB 1N5AB 3MBXL 3FTGA 4R0LC 3VA2C 4I77H 4BSVB 3WJJC 4LQFL 3GSQB 3QDGE 5I1DA 1TETH 4JFEB 4MS8D 4PTTB 3V5DA 5IM7A 3D25B 1S9XB 3PHQA 5FUOL 1JGUH 5F93C 2ZOKA 1WITA 3CDGB 4GKSA 3PQYE 3WUWG 1BZQK 5GGQL 5IQ9A 2X4TA 1AIFB 1EVUA 3OG6B 4LHUB 4L4VB 4LGSB 4P5MB 4OI7A 2ZZUT 1INDL 3GFUA 1WLHA 1ZT1A 3D85B 3EYUH 1NSNL 4LLDB 1YJDH 1ZT7A 3ARXA 1K8DB 3T0EB 2GSIA 4UDTB 3CXHK 2GTWB 3IAGC 1H3XA 3RL2A 1FVDB 5CCKL 5AG9A 5IKCA 2HWZL 1RZJL 1T5WA 3MNVB 4KY1L 1G7MB 4R4FH 4L8BB 4PJXE 5D8JL 1FHGA 2CK2A 1A6AB 4PREA 1OD7A 2XXCB 2X9YA 1KB5H 4TUOA 4PRHE 5E9DB 1FN4B 4LSPL 4WW1B 4LCWB 1FGVH 3QEGL 3NFPB 1LEIA 2P47B 5HDLA 4Z7QF 5D5ME 5BO1H 1NCUA 5EU3B 4ODSL 4YIQA 1OB1A 4X7EC 1AD9B 4QTHB 3LSOA 4P49A 1A7NL 3V4PH 1KB5B 1TMCB 4Y4HA 1IKFL 1KPRA 4KXZH 2VE6B 3L3HB 3QDAA 1F4YH 5GS1B 1QFWL 3ARRA 4DN3L 3U46B 4H1LG 3UJJL 4FP8L 1TCRA 4AM0A 3FFDA 4MD0B 1QFOA 4NBXB 2DWDB 3BD3A 3KXFE 1RZ7H 3FQUA 4GAYB 4AG4H 3L7EA 4ZUSB 4O2CA 1RULL 4LFHD 4M7LL 1EGJH 4AEHL 4XBPA 3KYMB 1EEUA 2Z35A 2RIKA 3LH2L 3D87B 4XCCL 5IEHB 4UQ2A 3UTSB 3T1WA 3MV11 3QEUA 5ESQB 3ZTNH 1Y18B 4U4BA 3LKPA 2VXQL 1CTOA 1BJ1J 1ZVYA 1PJ9A 1HIML 4CJ0A 1JPFA 1QQDB 4HXBL 4RQQA 5J3HD 3BKJH 3EYVB 5B3JE 5C0EA 4Y2DD 5C2UB 4J6RL 5ACMA 1AHWC 1AGDA 2QL1A 1NKRA 4TVPL 4OLUL 4NRXA 1HHIB 2KPNA 2HN7A 2VITB 5LGHL 1UYWL 5D70H 5H2BB 2H6PA 2AJ3A 5JHDE 3EHBC 1CG9A 3O2VL 1TVBB 5ELIA 1KLUB 3T8XA 3MRQB 1FPTL 3RJQB 2J88L 5D96C 5I8EB 2HJKA 5FECB 1FO0B 3TT1L 1RVFL 3K74B 4N8VB 2Q87A 4ZUVA 5FO7A 5L0QC 3S97C 1FCGA 3BDYL 1IGML 2OSLB 5I16B 1GOHA 4LVNC 5ILTH 2FHBA 5GZOD 3MRRB 3MV9A 4FFVC 1KNOA 1OGTA 3MBEC 1FV1B 3MLVL 4BUHA 1BZ7B 3QNZA 2EKSB 4HKZA 1CBVL 3T0WA 4ALAL 4X5WA 5EFIA 2R4SH 5B38G 4IOIB 2DQIH 2GY7B 4YK4B 3AXLB 2NY2C 3QXAB 5DC9B 4H0HB 4JR9H 5F1KC 4ZFFA 4EBQH 1FNEA 3TN0A 3LQZA 3IFOB 4GW5A 4WDIA 4LCCC 3O2DA 4WV1B 4ZNEA 1HI6B 3BEWB 3KGRA 4P2RB 2VQ1B 3MRGA 2W0PA 4HPYH 5CD5D 1XF2A 3A6OA 5J1TC 1QLRB 4HUKB 5E8PB 3EBAA 4XC1H 1RUAH 3GSRA 4HBCL 5IP4A 4QRTA 4F7MB 1QVOB 2JJWA 1MOEA 4Z7QE 3PE9A 5HI5D 3SKUD 4NN6B 4CVZB 4JKPH 1U8PB 5EU6B 3SE4A 3QI9D 3OF6D 2NYYC 3S96A 5AWNL 5A1AA 5I2IA 3HTLX 3W11C 2CO7B 2ARJQ 3V0WH 1FIEA 3GJFA 2YBRA 3D18B 4JFXA 2QQKL 1B3JA 5C0ND 3VXUB 3VWKB 1WBYA 5IF0B 5FV2A 3LOWA 3CLFH 5D7KD 4S1QH 3SDXF 4M1GL 4Z78B 1ND0A 3MNWB 1PSKL 4G6MH 2D31A 1Q72L 4K3JL 2GJJA 3TCLA 1N0XH 4WNQA 3CJJA 4WI3A 3R1GL 1MHPL 4NN5C 4KDTC 3ES6A 3K4ZA 3OKEA 5DJXB 2GJ6D 1SM3H 1OT1A 4HAFA 1MRCL 2AJVH 3MO1A 4GRMA 3B5TA 1T2XA 2B2XL 1QR1B 1KC5H 2X5PA 3KPQA 4YE4L 3MXWH 4FQ2H 2F53B 5CINL 5GRJH 4HWNA 3BMVA 4GOSA 4P2CG 1BGXH 1DQQB 2GAZA 3U0PA 2R1WB 2DYPB 5IB4A 5LGJB 1OWRM 3OHXB 3OKLB 3FQNB 1CLZL 4CN4A 2L4OA 1AGEB 4HGKC 4IRJB 4DCQB 2A0LC 2VC2H 4UIMA 2AXJA 4X8JB 2HTKC 2VO5A 3H3PL 3JV4B 1W8OA 3ARWA 3KR3L 3MRLB 4MVBD 2OCFD 1J7VR 4M43H 4JPIB 3T1FB 1UZ8B 3MRBB 5F9JB 3BAEL 2ARJA 3HAEH 1D9KB 4P2OC 2WM0A 4JFPA 4KUZL 1PFCA 3SDXA 5L7XH 5DYOA 3SCMC 4G6KL 5B21A 1A3LH 1RURH 1EAJA 5BVPL 1V3KA 1X44A 4BH7A 1JZ5A 5CEZL 2HJLB 2DJUA 2WQRA 1P4BL 5HTSA 2VIRA 3H6JA 1LP9B 1U8KB 4V1DD 3U4BH 2NY0D 5A2KH 1MWAA 4UOJA 2VLRD 5D1ZC 4ONGL 3FMGH 3GUTA 2ZNXA 3HAEB 1SBBA 1NMCB 4H0IA 5C8JA 4ELMF 3ULVC 1U8OB 3IDNB 2ERJB 4FZEH 4P4KC 3S36L 5CHNA 2AVGA 1Q9OB 2K3TA 3NCYP 2NXYB 2HH0L 4U1KB 1QFHA 2F8XC 3QNYA 4P9HH 2OX5A 4NNXB 3K8LA 2XRAL 5K9JL 4HUWA 2ICWA 1I1AC 2H9GA 4OIIH 4U6XA 3STZA 2NY7L 5CJ8A 3ZL4L 2Z4QA 4PJ5B 3HG1D 2VKXA 1Q0XL 3IJYB 5GSRB 1MAKA 5IVXB 3L95B 5ESAB 4F3FB 5JPNB 1IGTA 1LWRA 4WO4A 5L9DH 1RUMH 3PL6B 4FTVD 1JGLH 4I48A 3W9EA 4XPGH 5GS2H 1QBLH 5GGRA 3QDMB 2UVFA 1T3FA 4OTXH 1IZKA 1JHTA 3P0VH 1DQJA 3UDWA 1IQDA 5LQBH 4ZSOA 3WL9B 5IGXH 5GGUA 5KVMC 1E6JH 1J0HA 2ZUQC 4C59B 3TBTB 1C12B 3C60A 5F1IB 1BAFH 4PP1C 4XPHL 3ZTJG 3SDXE 3I75A 5CJQL 1F3JA 3EOAA 4P59L 1BD2A 4YHYC 2R15A 5HHOD 3NA9H 3NCJL 4DGVL 5EO0B 3WNLA 1YYML 4PGZA 1UWGL 5KG9A 1IAOB 4OGYH 1LEKB 4YHPA 3WFZA 1EAPB 4K94L 3WO3B 4L3ED 3MUGB 4XVJL 3VGDA 1EUUA 4UNTA 4YDVB 2X89A 5T1DL 4ISVB 4LIQH 4JO2L 4AY0A 4OQTL 2I26N 4M7ZB 4Y4KC 1TJHL 1VEMA 4TULH 4PJ8A 4P23A 2PXYA 5C0RL 1XGTA 5EZJB 5FYJU 4X99B 1OAYL 1JPTH 3O6ML 1YEKL 4OD3L 1A6UH 4WWID 3AREA 3KPSA 4XNMB 2XZAH 5DA0B 5F9DC 1RIVH 5FFLA 1PG7W 5F7DA 4FA8A 1VHPA 3BUTA 5CBAA 2VZSA 1MAML 4GKZA 1J0KA 4FABH 3D69B 4JN1H 4HH9A 5CJXC 1EXUB 3OKMA 5CSZA 1DBJH 5AG8A 2CDGA 1EEYB 3LN4B 4YHML 1MRFL 3DUSB 2YUZA 4HUVB 2VLKA 4WEBH 4JJ5A 1L7TH 1U41A 4OJFL 4PJAB 3WO4C 3EZJB 4OZHF 1QSEA 4PRBA 2YPLA 3WIHA 4WI8A 4LDLB 1V5JA 3MMEB 2V7NB 1HNGA 5ITBH 4LCYB 1WZLA 4R2GD 1AI1H 4G6AC 4P5TC 5DDHA 1ORQB 4ZSOE 4IRSA 4ZD3H 3QQ4A 4TTGA 1HHKB 3BH8A 3EO1B 5E8DL 1MH5B 3BISA 2XKUA 3QXUA 1DBKH 5AUMA 2RCSH 3D0VB 3T2NL 3MX0A 3V5HA 4YDKL 4WTZG 4LCIH 4ELME 3HS0B 1B0GA 1HEZB 3F58H 1WIPA 1FL3B 3GBNH 4PJHF 1JGDB 1F4WH 2F5BH 3P4MB 3IVKB 4HF5H 3HE6A 1E6OL 1A9EB 2Q7NA 3INUL 6FABH 5ID0A 5FCUL 1M71A 4OAWB 1A64A 3RVXD 1QFWM 1MFAL 1MCIA 5KVDL 5TE6L 1CZ8H 3FAWA 3IKKA 5EIVA 3BP6B 2QSCH 5JMOC 2JIXA 4NZUL 1BFTA 2DIAA 4ERSH 3U2SB 5HDQL 1YY9D 4PV8B 2F54A 2VRAA 4RBPH 4WCYL 1U93B 3EHBD 1CIUA 3OAZK 4KVNH 3O9WC 4KK8C 1ZXQA 2AXGA 3H9SD 4DVRH 3TZVA 5LBSH 1UACH 2VLKE 4Y8AA 3HI1A 2K9UA 4PJFB 2EKJA 3RDTC 3MRFB 4NFCA 5F6IB 1J1PH 1F3DH 1ZWIB 2NNAB 3G5YB 5F7FA 1KYOK 1QSEE 4FFVD 3QA3B 3QCTL 4OF0A 3MBED 3WIIH 4RNRB 3GMMB 2YPLE 1WTGT 4PJ9A 2NLJB 3VG0H 2WUCH 2BOCA 4RX4D 3B9KB 4PLJC 4IM8A 3HNVH 3SBWA 5DFVC 1VACA 4EIZC 2IWGA 3EYOB 2NY2D 2Y4SA 1Q9KA 3X13A 3D39B 1F6AA 4IOFC 5GJSH 5CILL 4HQQH 1IC7H 3DXAD 2CJUL 3GJEB 4NDMA 3AS2A 1YJDC 1IEHA 1CXIA 2B7DT 5FUCC 5JW4N 3UTTD 4J8RA 1Q9LA 2D03L 1YQVL 3L6FA 5FYJL 4WRLA 1AE6H 5T3ZL 1T2QL 1GRWA 4PGDB 3KYOB 1X4YA 4PRPA 1UM4H 4JRYB 1ZVSA 4HWUA 4G8GA 1CFNB 3GKZA 4NOFA 4R7NB 2DM4A 1A14L 2JCCA 2FJFB 2FATH 4J3XA 4UIKH 1SY6H 3C6SB 3HCVA 2ILLA 3UJIH 3LD8B 4C55A 4S11A 5I73B 2F54E 4JY4B 2VDQL 4HK0B 4B5EA 1SYVB 1HXMB 2BNUB 1XF3B 1ZGLM 4OZHE 3R06A 3ZDXF 4UINL 3C8DA 3B4NA 1GZPA 1N64H 2MPAH 2X4NB 1ORSA 1VADA 4NRYB 4U33A 2ED9A 1ZHKB 1ZMYA 3HKFA 4TUJA 5F97E 4FMFA 2BFVL 5ANMA 4WW2B 1HOCB 3KYNA 4FQCH 1RZIA 3HZKA 2DWEA 3LKSA 4LP5A 1T22A 3VGEA 3N9GH 2FHFA 4RAHA 1X5JA 4LARH 4NN7C 1A1OB 5E2JA 4N9GA 1N6QL 3FZUC 2Q86B 5GXBB 3OGOE 5ID1B 4PJHE 3TIDB 4DUVA 4EN3A 3TO2A 3OX8B 5EDXA 4KJQC 4N90D 2ZUUA 5F1NA 4H1LH 4Z7UF 1FIGL 4LLMB 4HCRA 3KPRB 2H8PB 1JK8A 4LAQL 3MOAL 4XRCB 5JR1H 4I0KA 1XEDA 3BKYL 3CCHB 1I7UA 1MCFA 2A0LD 3SGDH 4MCYB 4UQ3A 2HTKD 2Z91B 3ECBA 3HC4H 1A02N 3L5JA 3NTCL 2APFA 2LV4A 5B8CB 3FFCA 4PRPE 5HGGS 1F4XH 3S5LG 2J8UF 1YEHH 4P2OD 4KAQH 3U7YH 3BJ91 4H1LB 4CW1A 4MJ5B 2JCCE 1QLEL 3PJSB 3SCMD 1TLKA 4X5XB 4TRPL 5DJAB 4IS6A 4MA1C 3QUXB 35C8L 4UT6H 3LCYA 3C2AH 2EH7L 5IMMB 5D1ZD 4M7JH 3O6LH 1LO5A 3E6HB 5IG7B 1TITA 1X5KA 3T09A 4MWFA 5SWSA 5E56A 3QUMA 1KCVH 3MV8D 4QOKD 4JM4L 4LNVA 5I74B 2ATPB 5BRZB 1INQB 5ANME 3NFSH 4I2XB 5T1MA 5EUOF 4XXCA 4HS3B 1OAUL 4KHXH 2OZ4L 4NQCD 3V6BR 5KVEL 1Y0LA 4KFZC 3SDCB 4XPTH 4IJ3B 3KPPB 5E4EC 3RKPA 1MJ7L 1CFVL 3X11A 4JFFB 2CDEB 1CE6B 1I1AD 5SWQB 4WFHE 1LD9A 3IDIB 2HLAA 3T65B 1FZOA 2RR3A 1DQLH 3FB7B 2DQCH 5KZCB 4C83A 3D3VB 3KWWB 4LBEB 4WIQA 1A5FH 1AO7A 3RGVB 2J8UA 5E6IC 3ZKMC 2D7OA 4D9LH 5D1XA 1RZGA 2G75B 3Q0HA 1G0XA 1DL7L 3OAYK 1CD1A 3C8KA 3FFCE 2DS4A 1CF8L 5SWZD 1FG2A 1D5XB 3VFTB 4YDJA 4OCRH 1MNUL 3TH4T 4PP1D 4JPWL 1FFRA 1TTGA 4TUKL 2XACC 2X70A 5I71C 4RGMB 4NNPH 3ALPA 1FLRH 1P69B 2R29L 4X6DB 1CIDA 2R0KL 2X7LA 1MCWM 1JF1A 2VH5H 1AFVL 1OL0A 4PG2A 5FAAA 4C56A 4YJZL 5I8OH 4Y4KD 3C09B 2B0SL 3N85H 5CP7A 4WUKL 1DBML 3MFFB 5ICXB 3CIQA 4HFWA 3O6KL 2IPTH 3TVMD 4QTIL 4YWGL 3IDXH 4DK3A 3IF1B 1D9KC 3F7YA 4WUUD 1XCQA 1G7IA 4DN4H 4HGWA 3S34H 4J12A 4GG6B 2NY4C 3ZYOA 3L3KB 4RAUB 5C08B 3SJVD 4I0PD 4OFVA 3MFGB 3S4SG 3PQYB 1QRKA 2IMNA 5ACZA 5B39A 3UPCA 2QSTA 5EPMB 3D9AL 4NKOB 3MCKA 3F8UB 1FRGL 2GK0A 5AYUH 5L2KE 5F3HB 2J8UE 2M26A 1JGUL 1IGYA 5SV4A 4RMVA 1FYHB 1KT2B 5DMKA 1TZIB 5DD5H 2XTLA 5DQ9B 1CT8B 1UVQB 4G6AD 4P5TD 3VRLF 1E4XL 2W60B 4Y5YB 1W0WA 3GMLA 5IHUL 3V52H 5IHZB 4G8FB 2JELH 1MY5A 4QWWC 4XMPH 2GT9B 2SEBA 4MAYC 2EYTA 2R0WH 3MJ9L 2BNRB 4HPOL 2AP2A 4ZQKB 1MUJB 2A6KB 4BA8A 1FL5B 4IHOB 4R96A 2FSEB 3AROA 2M8XA 2Z92A 3TO4A 2JJSC 4EUPG 4R4BB 5CIPA 4L8SA 2H32A 2FIKB 1FNLA 4PY7B 4F2MA 2IGFH 4C56E 3QP3A 4O9HH 4Z6AT 3LV3B 4M9PA 2X40A 2CGRH 1Q0YL 1SMOA 4E41B 2AJUL 1NPUA 4P9HC 4M7LT 4W4OC 5JIKA 1U8NA 1EEZB 1NCAH 2V2WA 3F5WA 3GIZH 5C0GA 1VPOH 2UUDH 3KXFB 5MEQA 5C86A 3O41B 5DHYB 1RMFL 4OI8A 3NAAL 1P4LB 5IMKB 3R8BB 3O9WD 4U6VL 5D6CA 3HE7A 4KK8D 2I5YH 2YC1B 4LVOC 4ELKB 4RMSA 4PJBA 2CUIA 5DK0B 4OZ4A 3VWJA 4YDLB 5EC1A 1FFQA 1T1ZB 3RDTD 3UMTA 1VENA 1YEFH 2EH8H 1EGJL 4HMCA 5D1QC 5C9JA 2ESVA 2X9WA 5I1IH 1ZEAH 5T1LB 3LKQB 3H7LA 4PLJD 1U8MB 4UMGA 1FZKA 5ALCH 5DFVD 1AJ7L 5C0DA 1BIIA 4G5ZH 5GRWA 3ZTNL 1KIQB 4O4YH 1FFPB 4IOFD 1NGZA 4JHZA 4KDVA 4GS7C 4QHNB 1OTSC 3MLZL 2YD2A 3MV7D 3GM0A 4OV5A 3G5ZA 4O5LH 2AI0H 3KS0H 1OARH 1S9KC 3LRSA 3VFGL 1J86A 5L8LB 4KTDH 1FO0L 4QCIA 2B1AL 5TFSH 5E94A 4RFNC 5JHDB 2DDQH 4LMQE 1T83C 1XR9B 1NDMB 4NZRH 1FBIH 5D2NC 1I8KA 4CVXA 1RZ8A 3LQMA 4AL8H 3HB3C 2CK0H 1A6WH 5JOFA 3RZCB 5D70L 4XHQA 4LF3B 2GYSA 3DV4A 2GSGA 3RPIA 1C5DB 2XWJB 3GSNH 2CLVA 2X42A 2HYMA 4MA8L 5DRXA 4GAJL 5HVHB 2FX8L 3SY0A 4U1JB 4UDUA 5ILTL 2VAAA 3IXAB 1NL0H 4LSRH 5KS9F 2C26A 3PWPA 4OCYL 2WBJB 2W0FA 3QUKB 3TFKD 3RKDD 3EOBA 1Q8MA 2IBZX 1YEIH 4ZOCA 1KGCE 4DVBB 3VRLE 5IOPA 4JY6A 5IBUB 5FUZL 4PFEA 2DN7A 2HFEA 3PGDA 3WXVH 1G7PA 4YPGA 4EBQL 3GSUB 1B6DA 4LSTH 2RGSA 2XN9E 4KKBC 3ILQC 3KPLB 2R1YA 3BO8B 1JHKL 2EDNA 3I6LE 1NAMH 3T3PF 3FZUD 1IL1B 5FOBA 4UV7L 5MHSD 1I1YA 5F7LB 3GHEH 4LSDA 4NUJA 4TNVK 4M5ZH 4XX1G 4Q9QH 4OD2A 3CFDB 5E8OA 4XC1L 4PJDA 1KLFA 1EMTL 2W07A 4NOBA 1EA9C 3GBML 4KJQD 5GHWL 1HYRC 3PF2A 1PZ5B 2IANB 1G0DA 5E03A 1NUDA 3D0LB 4Y16A 1C5BL 4JKPL 5DZLA 5HYFA 2ADJB 8CGTA 2FX9H 3P9MA 5DVNA 1FNAA 4LLAA 3V0WL 1UM5H 3D2UD 3HFMH 3A67L 1LILA 2DQHH 3MROB 4NC2B 3QIWC 3LMJL 4HG4K 5HYQA 3I6GB 2BC4A 4GMTL 4Q74A 4R7DB 1K4DA 1OGAA 2OJEA 4FRWA 1ZLWK 4U6YA 4AT6B 3V6OA 1WBZB 3OZ9H 3VXOA 2VLMD 1KUMA 1LGVA 3VJ6A 3SDAA 1RAMA 5CBEA 4Z0XA 4Z7VA 2W9DH 3DMMB 5IFHL 4NQDD 1SM3L 5DRNA 3PWPE 5DD0L 1TIUA 5T3XE 1QYGL 4P2RD 4PJIA 1B4JH 3TN0B 1PLGH 2V2XB 1KC5L 4BK4A 4IDLA 4EDXA 3VE0A 4FQ2L 4HWBA 1H3PH 4FHBD 1H8SA 3QDJB 1G84A 3MLSH 5GRJL 4OT1L 1I7TA 1FL6B 1FFNB 2BMKA 4XP9H 2WUBL 4QRSA 4D2NA 1JTTA 7FABH 1G1YA 3P9LA 3KJ4B 3FO9A 3O3BA 4R9HA 4Y2DA 3M1BB 3IJHA 5EU6D 2Y72A 3GSOA 1R0AH 4MB3A 4ZAKB 3NPZB 2JB5H 1ROWA 3UPAA 3G5XA 2RAMA 3I3BA 2VC2L 2CR6A 3C08H 2Q3AA 5D7SH 1U95A 4M43L 5HPMA 2X1QA 4LLQB 3DECA 5I73C 2NY6C 2YBRB 4JFXB 1OWWA 5MEPA 1YUHB 3LPGA 2DL9A 2E6PA 5E8NA 5E6ID 4HV8A 3ZKMD 1YNTA 1H0DB 4M6NH 5L7XL 4N0FB 3V0VB 1HKLL 4JE4B 4UNUA 3KG5A 4N0RA 1DBBH 1ZT4B 1YEDA 2EEAA 2YXMA 1AY1L 3DVNA 4OF6A 2EDBA 1RIHH 1BVZA 1OGAE 1T7XA 3U4AA 1IGJA 1J0JA 1NC2B 1S7TA 4Q97A 4FQHB 5INDB 4HS6B 3GHBH 4Z7VE 4F80A 3G6JF 4BQCA 1HXYB 5EBMA 1VESA 4F9PC 2XY2A 3BH9B 4CKVX 8FABB 4P2QD 2X1OA 5EA0L 4NWUH 4LDEB 3MCLH 5DEZA 5ALBH 3T3PE 3B83A 4P0DA 4PGCA 3GMNB 4NZDA 4OIIL 3BDXA 2R0ZH 4HWEL 5DJDA 3FT2A 1QOKA 2GFBA 3OQ3B 2BXYA 5J13B 5FO8B 3TGXA 32C2A 4H25A 5GISH 2ZNWA 5HGDB 1D9KD 5L9DL 3RWHB 4XBEH 4HXAH 3WS6A 1PY4A 1URLA 1J8HA 4LVHB 2XKNB 2BVEA 4XPGL 1QBLL 2NY4D 3OKKA 4Y4FA 1RZFH 2WP3O 2E27H 1UADC 5DHVH 4OTXL 3E8UL 2IJ0C 2E7HA 5IGXL 2QKIA 5C0IA 4FXGB 4BFGA 1E6JL 3W39A 4NKMB 4ZOAA 4PRNA 4UUJB 3K1DA 1KG0B 1BAFL 1NGYB 2NMSA 4KU1A 2AK4A 3QWRD 4PRIA 4ZS6C 4MA7H 3QB7C 3MLXH 1YMHB 4ZNCD 5BOPA 5DQJB 3WN5B 4AK1A 2XT1B 3L3JA 3HZMB 2XWTA 4AMKL 1FORH 3IJSB 4JO3L 1W8NA 5IJKC 5DHVB 5DRWA 2B20A 4GBXC 4XH2A 4QWWD 1EBPA 4CN1A 4LSVH 3W9DA 4X9BA 3ARPA 4LIQL 4JM2A 5ICZB 3NCFB 5CMAB 1DJSA 2P43B 2AK1H 1DEEA 2O5ZH 1X6NA 3KLSA 2GW5A 2Y1VA 1JPTL 4M5YH 5IW6B 5MI0C 2VERN 1JYXA 1GHFH 1AGBA 1IM9B 2BDNH 3L3IB 1P7QD 4I0CC 3RWCB 4F58L 1ZGLA 3PL6D 1KSRA 5EZOL 3LS5L 4POYA 3DGGA 4ZFOB 4JKMA 3SGJC 5F6HJ 4WGVB 1IM3B 2XPGA 3QEQA 1TPXC 1KIRB 1T21A 1KTLB 4XPFL 1LVEA 1UQSA 3QZWA 3MLYH 3S5LB 3AY4C 4ODUA 1L7TL 1KLGB 4KK9C 5D93C 4FXKA 5F96H 5JW4R 1J8HE 3CVHH 4JRWA 3QUZA 1NJ9B 4N5EC 3L5WB 3WHE1 3ZT7A 1VFMA 5GS2D 1F3JB 4RRPA 1PYWA 4H26A 2ZOLB 3U82B 2VYRE 1H5BC 4QRRB 4ELMB 5BXFB 5D7KE 4KC3B 5I8CA 5D1QD 4PRIE 3C9NA 4GKNB 5GJTH 3IDJB 1IGCH 1FNHA 1OLLA 4LCIL 5F3BA 4O2EA 3RHWF 4X7TA 3ET9F 4FZ8L 1F4WL 1M7XA 4HF5L 2X4OA 1RJLA 1LK2A 1A6ZA 1OTSD 4JPVL 1U3HA 2I07A 3SE9H 1WFOA 5DC0A 2XTJC 3MRKB 2DMKA 1YPZB 1P1ZB 1UCBL 3G6AA 1V3MA 1ZS8A 2WLZA 5E2TL 1CZ8L 2VUYA 1S7XA 2QSCL 1BOGA 1KOAA 1J18A 3JUZA 1UB5B 4ERSL 5F71A 3HB3D 5JMRA 3Q5OA 2FO4A 3BZEB 1CVRA 1GOGA 3K8KA 4KVNL 3TBVB 4LSQL 4F7EB 1FVCB 4DVRL 4J2XA 3QEQE 4LPUA 1BJ8A 2HJFA 1UACL 4Y5YC 5GRUL 1U8LA 2G60L 2R2EB 2AJSL 1J1PL 2NX5D 5HGBB 4O02H 4ZUTB 3BYYA 4POUB 2J5LC 2AV1B 3FHAA 3VG0L 2WUCL 1HDMB 4CMHC 4U1LB 4H20H 2AEIT 3HNVL 2HFGH 4NCC1 1NGXB 3ROOA 4HGMA 2X4UB 4MZ3A 2ICEA 3BPOC 4V1DE 5DSCB 1JNHB 2N4IA 3WIFA 2I9TB 3ZDYE 2VLRE 1TTFA 4L3EA 5GJSL 1AKJD 1BHGA 4KKBD 1IC7L 4KRPB 3ILQD 3UTZB 2X44D 2LFGA 1S7UB 2A77L 3DSFL 4PBVC 3HLAA 1N5YL 3ZT6A 3LY6A 4WU5A 3CUPB 2APXA 1L9NA 4L4TB 3UCRA 4CVUA 4JFYA 1BFVH 3OAUH 4ZMAT 1JZ3A 5BJTB 1KPVA 1C16A 1Z3GL 3MRPA 1JNNL 2C4FU 1KJMA 4U7SA 1CXFA 1T7ZA 5F7HA 1T1YB 1KYOJ 2W92A 1T2JA 4Z7WF 3CX5K 2NXZC 4LLWB 4AQ1B 2VQUA 1MIEH 2A2QT 2FATL 3S4SB 3WE6B 3DRTB 2CDFB 3ORJA 4OZHB 1A4KB 1U36A 3HG1E 5C07B 3RY5A 2YOCA 3UJIL 2ZUWA 3WS3A 5JXEA 3OXRB 1MFEH 3RQ3A 4X6CA 3DV6B 4M62L 4YGVB 3VXNB 3QIWD 5IK3A 4DOHE 1ES0B 3HRZB 1BVLB 1DUYA 4WFGD 4Y5XC 5DD1H 4I4WA 2VXSH 1S7RA 2LVEA 3W81A 1CYGA 1N64L 2MPAL 4Y89A 4OLEA 4APQB 2RBLA 1I9RH 4EUPH 5L6YH 1M6OA 3B2UC 1KXVC 4I18B 5IJVB 2HFFA 4CNIA 1G6RH 1DLHB 3KHOA 4FQCL 3GB7A 3HI5H 4LASL 5DQDH 5KVGH 3EOTH 1W72H 4PJHB 1BFOA 2Q76A 1JPSH 3NFNB 4LARL 5HHOE 1IT9L 2LAAA 3L5XH 1NCBH 1LEGA 2ZPKH 3DSNA 3IB4A 3GK8L 3PABA 5K9OB 4PJ7F 5CEZE 5CEXB 4JRXB 2PNDA 4EUPB 1R5WA 3WEXB 3O45B 1S8DA 2Y5TA 4L3EE 3AVEA 1G6RB 3OKOA 2MHAB 2O5YH 2NR6C 1MI5B 5ITFB 1NGQH 3OB0H 1IEBA 1CN4A 1W72B 2WINA 5JR1L 2FB4H 4NQED 1NMAH 5FCSH 2IH3A 1VSCA 3STBA 4KZDH 2MKLC 2QADC 3HC4L 5DD6B 5DUPH 4BZ1L 4EQ3A 5MERA 3LKNA 1K4CA 3UPRB 1F4XL 3U7YL 1YEHL 4K9EC 1LE9A 1DDHA 5I17A 2A38A 2D7TH 2WBJC 1NGWA 2Q8AH 2HRLA 3ESVF 3JWOC 2OJZH 3MODH 4OUUA 2ZUVA 3H42H 4GUPB 2IQAA 5EORL 1FZMB 1F90L 5L2JB 1XF1A 3DHJA 3EGSB 3C2AL 3ULSA 3W0WD 4K8RH 3RNQA 1K3IA 3BESR 3MBEA 3QJFB 3QQ9C 4R4NC 3RX8A 5T1KB 4D9RD 1E27A 1FNGA 4QHUA 5BS0D 3SDYH 1HHHA 1VFBB 3VFMB 4KUCD 2DQEH 2EDEA 2QJDA 3T0XA 3NFSL 1KELL 4X4ZA 1JGVH 1K6QH 5C3TA 3QO1A 2OI9C 3P0GB 3JWDH 3I9GH 2OQJB 2XA8H 3KPRD 5K9KA 3RUGB 5FYKH 1TFHA 1YMMD 4NKDA 1RK1A 4XPTL 1P7KB 43C9A 2FD6L 3C5SB 5HJ3B 1RK0A 1KCRH 2YD7A 3FB5B 3LKOA 4U6HA 3UTTA 3FN0L 1CICA 4NCC2 4TYUA 4GRLC 2V2TA 5FGCE 4LNRB 4JQIL 2P7TB 1T0PB 4NM4H 5DZOA 3CFKA 2C7UB 3MRJB 4JVWA 5HDBF 1XMWA 1X3DA 3DX7B 3B2VH 3QUXD 5FO9B 2F19L 2UWEA 1P5VA 4MXWH 1K8IA 3G04A 1Q94A 1SJHB 4O2FA 1LO3H 2Z31A 2PYEB 1T89C 3MZGB 1I3GH 3SDDB 4ZS6D 4LRIA 3H9SE 1SJEA 1ZLUK 5EU4A 4L4JA 4ONHA 1ZA6A 4NNPL 2AERT 2YRZA 1M05A 4GBXD 3DVFA 3AMKA 4JB9L 2VH5L 4YBLB 5IHLB 2CRIA 5LXGH 3OWEA 4ZYKB 3BE1H 4Z7UB 5I66A 3CFJB 3MRMB 3N85L 4X7SH 4J3OC 1G9MH 4JGJA 3KPOB 1XF4A 4PJ7E 1XGUA 5DJYB 4N0CD 5B4MC 3NABH 3O4LB 3DXAE 1O5DT 4HDIA 3MACL 1HZHH 3IDXL 3D3VD 3NBNA 4IIQB 4NM8H 4MQTB 5JO5A 3RGVD 3ARGC 1UXWA 2FECL 4DZBB 4PTUA 9CGTA 1MCQA 3S34L 2V9TA 4QRQA 2EIZB 3UTTE 4DWHA 4K7PL 5L2KB 1OW0A 2GJZA 5EB9A 3IGAB 1Z0NA 2YEZB 3V4VH 1L0XA 3IT8D 3A6CH 1JHLH 3L1OH 4E5XB 5KSAC 1OAZH 4KK9D 5AYUL 3VW3H 1BVKB 5C9KA 2FWOA 4M3JA 1JWMB 1SEBB 3SCMA 4N5ED 4MCZA 1PX3A 3X3FH 3ARBA 1KEGH 5DD5L 2EDQA 3B43A 4LSUL 3STLA 3P73A 1UG9A 3OKNA 4WTXA 4L5FH 2UWEE 2GUOA 3O0RL 5HGAB 4NZTH 4NYLB 2JELL 2NCMA 3CFEA 3FQRA 3EO9L 4OLWL 2BVPA 2R0WL 1F2XK 5T33L 1J05B 3HPJA 2IQ9H 3EDFA 5EUOB 5MENB 4H5SA 1PX4A 3MV8A 4QOKA 5MEOA 4PR5B 2FH6A 1X7QB 1TVHB 3GIVA 3O8XB 3PDOA 4J23A 3WXWH 1OSZA 4Z8FH 1HWHB 5J13C 2BCKA 3FO0H 4NQCA 4TVSa 2V6HA 5JHLH 1QNZH 3MRIA 3QHZL 1KULA 2XTJD 3AM8A 4U1MA 5JNYA 2PTVA 4TTDC 4IMKC 4O9HL 1YQ2A 4YHZH 4DTGH 2CGRL 4KPHH 1I1AA 4QRPB 4U3XA 3U30C 5C09D 5JDSB 4U1IA 2A6IA 4JN2B 4YEEA 3O3AB 3RIAK 3MYJB 3GIZL 4YFLF 1NGPL 3GBLA 3GGWB 4FQXA 2CLRB 1N8ZA 2VDML 5B39B 2NTFB 2ZCKH 4I5BB 1WSST 2BHUA 5E99H 1IVLA 4HWZB 3TBSA 2BOBA 1LO0L 2I5YL 4L29B 3MNZB 2Y07H 5HDBE 1Q38A 1GH7A 3VFSB 1L6XA 2EYSA 1H15A 5SWZA 1J5OL 5FYJE 3C5ZC 5T3ZE 1SYSA 5ERWA 1YEFL 3DX9B 1LNUB 1TJGL 1U3YA 2ZKHH 1GGCH 4NGHL 1G9NC 1DVFA 3QIBC 3C6LB 3MGOA 4O00A 5ALCL 3OGCA 3VXRD 1K2DB 4YO0B 1A7RL 3VFPA 4JVPA 1IILE 2HVJB 1A1NA 4ODVL 1I3RB 4QT5B 2EXWC 5DUML 3DVGB 2CLZA 3MJ8A 3CNKA 1OARL 3MV8E 1JMXA 4QOKE 1QEWB 2NY3C 4YC2C 1B6UA 4Q9BA 1R24B 4PP2A 3DO7A 4BH8A 5J1AB 2ADFL 3FQTB 3TA3B 3TVMA 4PRAA 3RVWC 2R69H 4NQCE 1QLFA 3CPLA 1A6WL 3IXTA 1XF5A 1A2YA 4UAOC 2OZ4A 4GFTB 2NXZD 2BRRH 3FJTA 1T1WB 3MLWH 3CU1A 3QDHA 4Y5VB 4HKXA 1QBMH 4I0PA 5AAMA 3MJ7A 1MRDH 1S9YA 4YAQA 4JG0H 1EFXA 3BQUC 1MREH 2YN5A 3BUYB 3BPCA 4OIBA 1J88A 4G80B 1TQBC 4XCNB 3IETA 2JJTC 2IPKB 1D6EB 4RGOH 4H0GA 1J10A 3IDGB 3RWGB 2XN9B 4JFOA 2YD1A 4G43A 4JAMA 1FSKB 3B2UD 1QSFD 5SWZE 2VABA 4QLRA 4YDIL 4M8QA 4U3HA 5GRVK 1A7QH 1FNSH 4OQ1A 4ENED 2J2ZA 1ZHLA 1S3KH 2CKBH 5I30L 3BVNA 1DEDA 1S7WB 1XIWA 2P8LA 1ULVA 3RTQA 5L8JB 1ACYH 4OCMC 2VSDA 1DLFL 4P5KB 5BQ7A 5C0JA 5DUBA 3TYGL 3FRPG 1DQDH 4JFQA 4JANB 2ZWLT 4NHUA 4U0RB 5C0CA 5E94B 3PWUB 1N5AA 1F11B 5C0BD 2NR6D 1U8IB 3DOSA 4M8VA 3UJTL 3SKNB 4BSVA 5JA9A 2CKBB 1P6AB 1ZLSH 5AZ2L 3HR5B 3GSQA 1U2CA 5TE4H 4JFEA 5J8OA 4KZEH 2XZQH 3EJYC 2AXHA 4LOUC 5FV1L 4PTTA 4Y1AB 3D25A 3P9WB 4X4XB 2EDLA 1OT2A 2F5AL 5HHMB 2ZUTA 1S9XA 5IFAH 3E0GA 1AD0B 5CZVH 1Z6JT 3CDGA 4EI6B 2QTEA 2WBJD 2IG2H 1AIFA 3SJVE 2DB8A 5IVOA 3ULUC 4LHUA 4CMMB 4D9QD 4L4VA 2CQVA 4DEPC 4P5MA 4LU5L 2FX7L 4NO5B 4M61B 5IW3A 3D85A 1ZANL 1NCWH 2W9DL 4LLDA 1HE7A 3WHXB 4EJ1C 3QCUH 1GOFA 1K8DA 3E6FB 1I75A 1UXSB 2A1WH 3T0EA 4UDTA 1Y6NR 1JNLH 2GTWA 3REVB 3UC0H 2AEQL 4R4ND 1FVDA 4OF3A 3A6BL 3HR6A 3MNVA 1G7MA 3X3GH 4L8BA 1I1CA 1OY3B 3SO3B 4HSQA 3GJFK 1A6AA 3WUZA 5GS0H 1H3PL 2XQYK 3MOBH 1DN0B 4X9FA 5C7XH 3NPSB 2HKFL 4OLYL 1FN4A 5E9DA 4WW1A 4LCWA 1NC4D 3BN3B 4QXWA 3NFPA 5I6XB 2B4CH 2IAND 2LTQC 3IDYC 4U05A 4KHTH 3T04D 1U8QB 5IR1B 3MJ9A 5EU3A 4HG4J 1AD9A 4QTHA 5GQBA 2JB5L 3FT4B 4G6FD 5E5UB 3UBXI 2FBJL 4GXVH 3C08L 5C0CE 3RFZC 4GRLD 1KB5A 1GXEA 4WU7B 5JIPA 2VE6A 3L3HA 4GT7A 5FK9B 5IFJB 3QUYC 2E7LA 4YHLH 5GS1A 4AIXA 3U46A 4PB9H 4OLZH 4HJJH 3VRJB 4MD0A 4RMQA 4MJID 1MCCA 3QISA 2IAMB 2DWDA 3D48R 4GAYA 3CX2A 2VDPL 3ARTA 5KS9B 1SJVA 2IEPA 2R56H 4ZUSA 2VDNL 3BGFB 5ADPL 3DMMD 2HVKB 4KGJA 3KYMA 1RIHL 4TPRL 1CD0A 4ZPVB 4G7YL 5IEHA 5GGSY 4L4VE 3UTSA 5E0QA 5ESQA 1B88A 3QDJD 1Y18A 4XWOC 3MLRH 1WJ3A 3C5JB 4U6TA 2EO9A 3H9ZA 1QQDA 3L7FB 3KLAB 5JLZB 3EYVA 4K2UH 1WAAF 3UYPA 1EGJA 4M6ML 1CGUA 4QXUL 4NWUL 5I1KL 1A7PL 1VB9A 2OP4L 3MCLL 5ALBL 3CFBB 3VA6A 3GKWH 3M17B 2R0ZL 4NFDA 5E9DE 1HHIA 2FEEI 5B4MD 2FBOJ 2C9AA 4JDZB 2VITA 3ZT5A 5D71H 1QPPA 1TVBA 1KLUA 2D4DA 5AZEH 2APBA 3MRQA 2WNGA 3OKDB 3THMH 2DI9A 3KNBB 5I8EA 5FECA 3LEXB 1FO0A 5JW3H 2E27L 1YNTB 3CU7A 4RAVB 4N8VA 1UB6B 3SE8H 1UKQA 2OSLA 3EYSH 5TPWL 5I16A 3MRRA 1DANU 1FV1A 5KSAD 1JYNA 1WWWX 1BZ7A 1D5MB 5DLML 1BEYH 1YEDB 2EKSA 2LU4A 1CDIA 4MA7L 3VCLB 4XCFH 1NCCH 5H8DA 1BX2B 4IOIA 3DIFB 3AXLA 2NZIA 3QXAA 4BKLB 4FQQB 4PUBH 3EJJX 4HJGB 3IFOA 4RMUA 3BIKB 1HI6A 4I1NB 3BEWA 4P2RA 2VQ1A 4ZFOL 3FQWB 1YEGH 1MQKH 4EOWL 4NPYB 1QLRA 1WWAX 2AK1L 4MXVF 5E8PA 5E7BA 3JVGA 1F2QA 4HW6A 3CVIH 5FHAH 5CD3B 4JQXA 4WJ5A 1QVOA 1KFAL 2FJHB 3JWDC 1GHFL 2DTMH 4DGYH 5KTEL 1R3LB 4TTDD 4CVZA 1MLBB 1U8PA 5EU6A 4L8CB 5MHSE 4JKLA 3MLPA 1OVZA 5GIRB 3VFRB 4EI5C 2MCPH 4TOYL 3RZWA 3D18A 4QXGL 3QI9B 3GSXB 1I9JH 2VR5A 3VXUA 3VWKA 2D7MA 5E6ZA 5IF0A 3B9VA 1MFCH 4Z78A 3MNWA 4L9LB 1Q9WB 3NCCB 5F9OH 3NGBB 5CGTA 3HC3L 1UFUA 5I75C 2EE9A 1F6LL 3FONB 1CLYL 5DJXA 3WSQH 3P4NB 3S3PA 2EECA 3WFEH 1FC1A 3WD5L 3MXVL 4YBLC 3EZ8A 2GJ6B 5FYLH 5JA8B 1DR9A 3G6JB 5GJTL 1QR1A 4MDJB 4QEGA 4GAGL 3BT2H 1QSVA 2F53A 2YRLA 3SE3A 2W9LA 1UZ6E 4JFHE 3GI8H 1DQQA 4NRZB 4S0TD 5EO9B 2X41A 5E2UH 4P2RE 2EXWD 2R1WA 2DYPA 3AAZB 5LGJA 3O2DH 4OUOA 1EJOH 3TWCH 5CGYC 3OHXA 3OKLA 3FQNA 4X9GA 1AGEA <