4ZG1A

Crystal structure of a nanobody raised against kdm5b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSTFGIRTMGWYRQAPGKQRDLVAIISSGGSTDYADSVKGRFTISRDNAKNTVYLQMDSLKPEDTAIYYCNARVGITMLAHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NB17
publication title Structure and binding properties of a cameloid nanobody raised against KDM5B.
pubmed doi rcsb
source organism Lama glama
molecule tags Protein binding
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zg1A00
4G8GA 1Y18A 5F1KC 3MRKB 3O3AA 4WHYG 4UT7L 1BLNB 2KUTA 3MMEA 1Q94A 4M61A 1I4FA 4BKLA 3W0WB 1A9EB 4GRWB 1WEJL 2VXQH 3GIVA 4YWGH 4L8DA 4PTUB 5D5MF 3E2HC 1AP2B 4NN7B 4CU8A 3MLZL 3SDCA 3QCUH 3VGAB 2DWEA 4N90D 1UCBH 3DHMA 3KYOB 2PUQT 3VG0L 5BVPH 3RUGB 4Y19B 2OM5A 3BIKB 3EFFA 4DZBB 1JN6A 1TVHA 4UI2A 2ICWJ 5C3TA 3FT4B 3A6BH 4G5ZH 4EI5D 1P7QA 5FYJD 1B0WA 2ZP0T 5I1IL 1WC7A 5B4MD 5DSCA 5ICXB 3VH8B 3IAPA 3HUJB 3EZ8A 2AKRB 2J88H 5F7WC 1PZ5A 1DFBL 2H1PL 5D7KE 1ACZA 1YYLH 5CIPA 4MDIB 3C08L 5ERWA 4LSTL 1MIMH 1HSBB 1YEEL 4FA8A 2WINB 3JVGC 3CFIC 3DTXA 3FO2B 3I02B 4WW2C 5I8EA 2Q76A 2IAMA 4RIRB 1OLLA 3PWUA 3TT1L 3RGVB 3H9YA 1NAMH 1G7MA 3ZHKA 2EYSA 1FFRA 1KPUB 3MLVH 4UAOC 5A16A 4YNYA 4P23B 1HINL 4M7LH 4YX2H 1F4XH 1NLBH 2HWZH 5T1LA 4G9FE 1QR1B 2APTA 1EGJL 4PLKC 5HYSB 3MA9H 3QWRD 1AD0B 3T4YA 1JWUB 4JG0L 2ZOLB 2A6DB 5A3ID 3QEUB 5KVEL 3SPVA 5GRVK 2YSSA 4F3FA 2H45A 4I8DA 2E7LC 4JFEA 5CUSL 4W6XB 1U3HC 1PY4A 3P4LA 2A77H 5EOCH 3OKNA 3JWDH 5EOQL 5IT2L 3P4MB 1VFUA 3CFCH 2DYPB 3MJ9H 4W4OA 1LDPH 3K3QA 4IHOB 5T5FL 5BRZE 2VXTL 1CICD 2WV3A 1QRNB 3UP1A 1AO7E 1JGUH 4P5KB 3V4UH 1Q9KB 4OFIA 4CVXB 4L29A 2W9DH 1NUFA 5DHXB 3VXTB 1XF1A 1V7MH 2Z8VC 3ZT6A 1CWVA 3OHXA 4HS3A 2C3WA 4PGBB 5EZLA 1QSFB 1ZANL 4E5XA 2YUWA 1HHKA 4ZTPL 1A6AA 2XRAH 3WXWL 5C8JB 1IM9B 1KOAA 4DOHB 1JWMB 4QRQA 3C6SA 2UUDH 2O26U 3HLAB 3AB0B 2X4OB 1ITCA 4J1UA 1CK0H 4NQVB 4M4RA 2ZKHL 3LRGA 5HHQB 1F97A 3O4LE 2AJXH 2ZCKH 3M1BA 1EUUA 3MX0A 3CSGA 4K3JL 4DAGL 2R2HB 3T3PF 3MGTA 2FX8L 1YPZE 4LAQH 4ODVH 1SJHB 1T5WA 5C0FA 3E6FA 3B2VL 5FECA 4M02A 1DZBA 4PP1D 1Z9LA 4P2RA 5L2KD 3FFCE 4PRPB 1QR4A 5D72H 4KGJA 4FOMA 4QRTB 5KZCD 2R23A 4AH2B 3S34H 3BRGC 5ITFA 5J6GA 2W65B 1W2KT 2IPTH 1AC6A 2FYYB 1KELH 2OLDA 3W9DB 1MIEH 3BUYA 1OTTD 5MEPB 4JFDD 4OIIL 3OKKA 1I8LC 3EJZD 3BVNB 3RWFB 1IC5H 4F8QA 2KBGA 1FJ1A 3OR7B 5B22A 4POZD 1G1YA 5IBTL 4F9LA 3RY4A 3V52H 1KCVH 5J12C 1P84J 1AHWA 4ODBD 3DETC 1N6QH 1FLTX 4N1EA 4AYFA 5J6HA 1MCKA 2JJSA 4M8VA 3MRGA 1RJLB 5T1KB 4XNZB 2YD8A 4PYGA 5C6TH 3D18A 4MA1B 4CL7A 5I8OH 4KK6D 4RMSA 5DS8B 4ZO7A 4MB3A 1OGTA 1ZTXL 2Y7QA 4AM0A 3HPLB 5I1LA 1F3JB 5E5MB 1F90L 2HTKC 1JUFA 4XMKL 1JK8A 1Q94B 2FO4A 4I4WB 4KMTL 3U9UA 3IKKA 1I4FB 2P5EE 3X3FH 1VGKB 4XPAL 3V6BR 3HR5B 3MLRH 3KXFA 1IBGL 2DD8L 1RJYA 4PS4L 4D0BA 3S4SA 1AXIB 3AVEA 4WO4C 3U30B 1G7LB 1RAMA 4H5SA 2OTWA 4JHWH 5JIIA 2OS7A 4M9OA 3EFFB 2OR7A 1T6WA 3T08A 1WSST 4UDUB 3RVVC 5HHOA 5ACZA 1WC7B 5DSCB 5EZOH 1U0QA 2DQTH 2DQFB 3SKOB 4BH8A 3QPXH 2Z0BA 1UEYA 5CIPB 3MSPA 1D9KC 1G7HB 4Q97A 5IK3A 1OM3H 5GRXG 3N0PB 5J89A 4IOSD 5EC2A 3HE6A 1RHHA 4RGMB 4JRXA 2XT1B 3KPSE 3LN9A 5DD6A 5I8EB 2Q76B 3DMMD 1MCJA 2DMBA 3V95A 3UJJH 3TN0B 2JJUA 5HHNB 4PV8A 1G7MB 1MJ7L 3NIFE 5E2JA 3X13B 3O6KH 1OP3K 2F19H 2C7UB 1IAOB 5I1DA 4ERSL 5A16B 4XNMB 4JFFE 1QSEB 2IAND 4KQ4L 3OTTA 1KN4H 1JF1A 1ZHNB 4QGTA 2X9YA 1RULL 1JTTA 2MWCA 1TJGH 1G1CA 4QRPA 3TEUA 1U8HA 5F6HJ 5DFTA 2EDYA 5IHZB 3CMOH 3FQNA 2YSSB 1RU9H 4F3FB 4KDVA 3PP3H 3JTTA 5IF0A 2YPKA 5TFSL 3OKNB 3QHFH 2XWJA 3EJJX 3QHZL 4ENEC 3GBMH 1NCAH 1T80A 5IJVA 1DEDA 1TFHA 3D69B 4MXWH 3NMEA 3G6AA 1Z3GH 1NUNB 3G5VA 3S96B 5JW4N 3HC4H 2XV6B 1K4CA 1WIOA 1NMCC 3SKJH 6FABL 2JCCE 4H1LA 1IQDB 5E1AB 3V6ZB 4WUKH 5CGYC 1HHKB 4XVUD 1JNNH 1A6AB 5ALBH 3AAZA 4K7PY 4XNXH 1BOGA 4GBXD 4J6RH 2AJYH 1CFBA 1MFCH 1WBXA 4MXVE 4PJDA 5SX4H 4JRYD 4P57A 3WFBL 3T2PA 3EFDL 4YC2C 2P7TB 3STLA 3D39E 2AJSH 3RNKA 4UU9A 3TVMC 3WUZA 4MQXD 2AXGB 1IKNC 1QZ1A 1T5WB 4OSUH 1BFTA 2OL3H 5L8KB 4Y4FD 2IADB 5C0AA 3PWPD 1C5BL 1G7IA 4IDJH 5CZXC 4P2RB 3CH1A 4ALAL 1OSZA 1CTNA 4U33A 2NTFB 1AI1H 1A7NH 3L1OL 5ITFB 1K5NA 1MHCA 2ATKB 3PHOA 3ULUL 3EYVA 4YDKL 4YFDB 4OLWH 4KVNH 1ED3B 3JVGA 2NW3A 3B5GA 4JY5L 4WW2A 4MJ5A 4NBYB 4PJ7E 1CD1A 1IM3A 4ZUVB 2YS4A 4Q74A 4LSUH 4TNWK 2SEBA 2PCPA 3PIQA 2BVQB 5KVFH 4S1QH 4MJ6A 1X9QA 1U8LB 1G9NC 4NC2B 3P2TA 4GG6A 5J6HB 4XPHH 5C0GB 2ENSA 4EDWL 4N1CA 1JMXA 1I7UA 4LSQL 1ZLSL 4XRCB 2A0LC 4GLRH 4PJDF 3QDJD 3BD3A 4AM0B 4R97C 3O9WD 4TUOB 3WFDH 2NPLX 1ZT1A 5JXED 5EC1A 5JHLH 1SHMA 4WWKB 3MLUH 1TZHB 3UPCA 2AI0L 1S7QB 5DJ6B 3U9UB 2E7LA 2CPCA 5F7EH 4HUWA 5DHYB 1N5AB 1U3HA 2ZCLH 1RJYB 1WBYB 4D0BB 1B2WH 5I9QC 2CLZA 3MUGB 5IFHH 2AEQL 2J5LC 3V0VA 5TE7H 2B39A 2NX5E 1P4LA 4QTHB 4H5SB 5DJDA 2HH0H 4QY8B 4OCYL 5EN2A 4OCWL 3DV4B 1YEIH 2EDRA 2AW2A 4ODHL 3WJJC 2QQLL 5ESAA 3QEQE 1J1XL 2NXZB 3QJFA 5CZVH 3BAEH 4BSVB 3S7GA 2YA0A 2AK1H 3D25A 4WW2F 4HKBB 3HAEH 3FOMB 3X12B 3F7RA 1XIWD 1Q72L 5JMRA 1T0MA 3KR3H 1RD6A 4MNGE 1AFVL 4MXQD 3EZJB 3QBTB 3K7UA 1QFWM 5HHXH 4B0MM 5DC9B 1BOYA 5IK3B 4K55A 4IRJD 2Q6WA 1ZA6B 2P5WA 5IB5A 4HKXB 5ESVB 4GG6F 1I3RA 3HE6B 1UB5A 2JIXD 3MBEC 2R4RH 4YBQD 4XBEH 4LPVA 1C16B 4G7VL 3U82B 4W81A 5DRWA 4WFGD 3ZDXE 3FQTA 3QUMH 1MRFH 3BKJL 5I1DB 2FHBA 3TYFA 2VUOA 3P4OA 43CAA 2IMMA 2R39A 3MV8D 1KYOK 4KTEL 4KROD 2ADJA 4HCRH 1KLFA 3C09B 1GXEA 5ESQA 3QDMB 3E8UL 1I8LA 3GHEH 3HNVH 4V1DD 4I2XB 5E8NB 2FHFA 4XMPH 3GI9L 1U8HB 2Z4QB 4H8WC 3S5LG 1GC1L 3FQNB 1L0XA 3JTTB 2R69H 5LG1A 5BO1L 3WSQH 1RIVH 3ZE0F 1CFVL 2JF1A 4PRNB 4FG6D 3G6AB 3TIEB 1T5XA 4JFPA 1CR9H 1R5VB 1UH2A 3QFDB 3RWHA 5GRYA 5HPOA 5CSZA 4GQ9H 5IFAL 3T65B 2OQJA 2QEJA 3RZWA 3B9DA 3AAZB 2AEIT 4Z7WA 4Y1AA 4LASH 4WO4A 4X4YB 5KW9H 1U93B 1R3LA 5EUKB 4IJ3B 5DEFB 3STLB 5B39A 4GH7B 5H8DA 5EU6D 2VC2L 1EHNA 3BKMH 3IXTA 4I0PD 3UYRH 4JM4H 3GSVA 5FOJA 4P0DA 3TYGL 3ISWA 1CE1H 5DURD 1FL6A 1WK0A 1G7IB 4Q6IC 4BSWB 5D71H 3SDAD 4F15C 4MCYA 2QADD 3AMLA 3MNZA 3ULVE 4X98A 4QNPE 4ZNCD 3NH7L 5GGTH 1KG0A 4QT5A 3OB8A 1MHCB 3PHOB 3EYVB 3FB8A 4B5EA 4FQLL 5IVNA 3A6CL 2APBA 3IF1B 4IIQC 1CD1B 5GS0H 5J13B 5I75C 5JW5A 5EWIH 3HG1A 3BW9B 4G80A 4MJ6B 2BSSA 4PJEE 4EI5C 1IKFH 2A6JA 1DQDL 4E9LA 3FO9B 2FSEA 5B4MC 5HPMA 3MPCA 3DIFA 5BV7C 5GGRB 2NYYD 3QEGH 4NQCB 3BWUC 3PG2A 4ZPTB 1NUDA 2N7BA 4GW1A 4AENB 4Z7WF 2VDRH 3BFOA 1NQBA 3ZE2F 2OZ4H 3AFLA 4PJXE 1CBVL 3KG5A 5EC1B 4JCMA 1RJCA 2AVGA 4MYWB 4XX1G 2JELL 4HJ0D 5DJ0A 1AQKL 1D5ZA 4M1GH 2YZ1A 3OKOA 3O3BA 2P8PA 3EJYD 3V0VB 1WTLA 1P4LB 4KWUA 1ZVSB 4HT1H 5DJDB 3RWIA 2XI9A 5IHLB 2ED7A 5GRWA 2GTWA 4BFGA 1TJIH 1YC7A 4KV5E 2I07A 4N5UA 4JREC 3TPUA 2DDQH 5HDBE 3KPRA 3BKCH 3QJFB 5JOPE 4WI9A 3TV3H 5K9OA 4NCC2 2NR6D 2V6HA 3PJSB 1S9VB 5A3IC 3ZKND 2QBWA 1ZGLP 4O51A 1KULA 3DURA 4L4TE 5MP6H 1MCWM 1T0MB 2YMXH 4CN4A 1BZQK 3TVMA 1B6UA 2P5WB 2GK0B 4PY8J 4NM4H 1PKQA 1IKNA 2VJXA 4QKXB 1R3IL 2DQIH 1CICC 4R0LC 5E7BA 4EUPG 4K2UL 1UM4L 2R8SH 3HZMA 5F1OB 1FIGL 1CTOA 3QDGA 2QL1A 1PDKA 1GHFL 5D1ZB 3O45B 4IBLT 5F44A 3MLPA 1QSVA 4G43A 5E2WL 3FAWA 4JB9L 3P4OB 2YPVL 1UZ8A 43CAB 1JPTH 2ADJB 2F54B 3SQOL 5L88H 4X6CF 5ESQB 4TSCH 2OYPA 3BP5B 4GAJL 1Z9OA 3IB4A 1Z9MA 1BGXL 5I15H 1ZHKB 4HPOH 4HWBH 4PP1C 3PXJA 3QFJE 4X80H 4HZLA 5K9JL 3CLEL 2VXVH 4PJIE 3LDBC 2OMBA 4Z7NF 1V3JA 2DB8A 2VSDA 5C0CE 2OR9H 5SX5H 3QYCA 1H8OA 1JZ8A 1D5XA 2W0FA 1WBZA 4JDVA 5H2BA 1T5XB 1JI2A 3BDYL 1T2QH 4FQ2L 4JFPB 3GMNA 4LDEB 4ESKA 4KY1L 3HFMH 2BRRL 3MRIB 3LEVH 4X4MA 3QWOA 2CIKA 1OTTC 2F15A 1NBVH 3EJZC 2KZWA 4OCSL 2NY7L 3ILPB 4POZC 1PKOA 3WKMH 5ADOH 2NNAB 1J1OH 5GGVL 4HIXL 3L3GA 5B39B 3WJJA 3IXTB 4ZNEE 4RWYL 5JHDD 4JN1L 1BFSA 4KK6C 4BUGA 2YPLE 4U7SA 3QG6A 1M6OA 3VWJD 2J8HA 4GAGL 3BMVA 1N0XL 1WFUA 2CKNA 4PJHE 4GKOA 1FN4A 2HTLD 5F8RC 2IJ0C 2EYRB 2HFEA 3CXDL 2EC9U 1FNFA 2VDPH 4OUOA 4MQ7A 3MBEA 3EYSL 1FC2D 1CFTA 1AC0A 2Y06L 3HG1B 3U0WL 1WEJH 4G80B 1MEXL 3IDIA 4AT6B 2BSSB 3NA9H 5C07A 3SGDI 2FSEB 3HPJB 4GAYB 3MLZH 1QSZA 3RTQD 4JZNB 5F7UA 3VG0H 4BFEA 5LAXA 1CYGA 4L8SC 2X4TA 1JIBA 5AAWA 5KG9B 5KSUA 5I73B 4GW1B 1EFXD 1XGRB 5FUCE 4FFWD 5I1IH 4XPFL 5KSBB 1NPUA 2D7NA 3F7YA 3MV7D 2BNRE 4M43H 1C1EL 2HLAB 5D7IE 1A7RH 3BISA 5FGRA 2QSVA 3DMMC 4R90L 4BK5A 1DFBH 3KPMB 4G7YH 1D5ZB 2C4FU 3IFNL 3TBWB 4NSKB 4OF3A 3U83A 5F88B 1HHGA 4MD0A 2FHCA 2C5DC 4LSTH 5DQ9A 3ZZ1A 3T0DA 4UUJA 1YEEH 5A2LH 5TPWL 4HGKC 2AK4A 5T3XE 3GGWA 2FJFB 4PJ5E 2ZG3A 4OGXL 4UBDD 3DX9B 3PABA 3QUXD 3IDNB 2FD6L 3TCLA 3G9AB 1IGJA 5BOZG 4QCIB 1QPPA 3FQWA 3Q6GH 4O51B 1FQ9C 1KIQA 4CNIB 1XH3A 3BGFC 2WLZA 3QUKA 4Z7OF 4YC2B 1WQVT 4U3XA 3TVMB 1EGJH 1BECA 3CDFA 5K33A 3QI9A 4JG0H 1BVLB 1I9JH 3LEXB 4CAGA 3I6GB 3LSOB 4Q6IA 5KVEH 5T5NG 3D6GA 2BP3A 3RDTD 5CUSH 1QFHA 2Z35B 5E8EB 5SWZB 5EOQH 5IT2H 3GSRB 4XVUC 4ODSL 2VDML 4GBXC 1A22B 1OB1B 5DQDL 2P45B 2EH8L 4IIQA 3L5HA 1TMCB 3G6JE 1ZANH 3O4LD 4MQXC 5FUOL 5DMGC 1E4XL 1T4KB 4ZTPH 1A4KB 4Y4FC 1VEOA 4EI5A 4M7ZC 3SJVD 4HZLB 2EH7L 5F93C 2DTSA 1FNLA 1DUZA 5DJYB 3ULUF 2H8PA 3FFCD 3VFOB 4K3JH 4DAGH 5C08E 1P7KB 5JPMA 1ORSA 1D5XB 3B2VH 1WBZB 4JDVB 4YDJA 1RZKC 4PG9A 4F37K 3O2DL 5F72S 2CUIA 3DX8A 5F6IB 4L3EE 2QKIA 1A6UL 3P9MA 4XP9H 1B88A 1RUPL 4O2EA 5I9QB 3V4VL 3M45A 5EZJA 2EYTA 4WFHE 3GNMH 5D96C 4RNRB 3NIGE 4PLNC 2V5MA 3L3GB 1A3QA 4OIIH 3RY6C 3DGCR 4IRSD 1Y6MR 2YWYA 1ZSDA 4RMVA 1LNUB 3O9WC 3QWRA 4DVBA 1IE5A 4YXKL 3SY0A 5JXEC 1QBBA 5ICZA 2X7LA 4NHUA 1PYWB 1KNOB 5DJ8A 1BF8A 1MY7A 3UTTB 1XCTA 1FN4B 5F70A 2HFEB 4L8BA 4FZ8H 4HWNA 3U0PA 1ZTXH 2AEWA 4ZS6D 3LOWA 4MQ7B 1CICA 4PPTA 4R0LA 1CFTB 4KMTH 1T2XA 4RRPA 5EFIA 3U6RA 3VXUB 5E2UL 2B2XL 3CVHA 1Q9WA 4JQIL 2PTTB 2YBRA 4G8IA 4XPAH 2PTUA 4PS4H 4IDLA 1IMHC 4A2MA 3V7MA 3OJMB 3GMQA 4OZGA 4R4ND 4S2SB 3VXME 1YEKH 3OSKA 1JYNA 3MR9B 2EDBA 3V4PL 1XIWC 1U8QA 3FQUA 4HS6A 5C9JA 1PBYA 2D31A 4MXQC 4KKAD 4FZEH 3WIFB 4Z7VB 1GSMA 4IRJC 3ZKQD 5CEZE 2VYRE 4WEMB 3F7YB 3ESUF 1A7BA 1G7QA 4YBQC 2O5ZH 5BZDB 5L2KA 4O2FA 1QQDA 4V2CB 2OTUA 3MRRA 1BP3B 1B90A 4L4VE 3KPOB 4F7EA 5DQ9B 3QXAB 2CK0H 3U36A 2QQKL 2P48B 3C60B 1S7VA 2DF3A 2AK4B 5FO8B 3EO9L 3GGWB 4KROC 2VDLH 4ELMA 4JFFD 3Q6FA 5E8DL 3VXNA 1PFCA 1J86A 3DVNA 1ERNA 1YMHA 3ARRA 3U0TA 4YHML 4JFDA 5BQ7A 4XBPA 5CJOH 4LMQI 1MCFA 2X4QA 4ERSH 4Z95L 1J88A 4XGZA 1VFAA 3RQ3A 4WU5A 4XAWL 1I85C 2DBJA 3JTSA 2CIIA 1EO8L 4ZODA 4PR5B 1VFBA 5DWUL 4M62L 5D5ME 4ODUB 1RULH 3RL2B 3BH8A 1TVBA 3LVEA 4MDJA 5C0BE 3QI9B 4FG6C 1SEBA 1DANT 1C12B 4Z0BH 3P9LA 1H3VA 5T3ZL 1XGTA 3ZYZA 4F15B 5DK0A 1LVEA 3D0VA 3SOBL 4URTB 3GBLA 4X4XB 3IJYA 3F5WA 3QHZH 4JANB 3W81A 4ZQKB 2FBJL 3FQRB 4WGWB 4NQXB 5DUBA 2H3NB 4LLVB 2GSIB 1FDLL 1A3LL 3ARDB 4I77L 5C1MB 1C5DA 3HI6H 4IIQB 4PJGB 2HA1A 1K8IB 3TNMA 1JE6A 2G2RA 1UKTA 3L5JA 4I0PC 5I75B 5INDB 4DQOL 4EI5B 2X44D 4ELMF 2EC9T 4OZIA 3GSNB 1MY5A 5E99L 3HNTH 4M6OH 3SDAC 2QADC 3F12A 1U8MA 2BZDA 3EFDH 4L8SA 2ITDA 2WBJD 4R26L 1SYSA 4FS0A 3OR6B 4G8GE 4X6BB 3DNKA 3KLAB 5DR5H 5JPMB 4IRZL 1MHPL 1HH6A 1C5BH 5I30L 1FYTE 1KT2A 2F5BL 2FIKB 4ODTL 4ALAH 1I8KB 4LF3A 4JR9L 1CLOL 1O7SA 1YDPA 3DMMA 5I19L 3DX8B 2CSPA 4Y5VC 4KHTL 1ETZB 3WFZA 1CLYL 3HMXA 3BPCB 3ECBA 1FZKA 1MCOL 3L5WA 2NYYC 2IANA 1FL5A 4S0TD 4LU5L 4JY5H 1CXEA 1ZLVK 2C4FT 3HZYA 3QR2A 2X1QA 4JREB 2NTSP 1I8MA 3CDYA 2ADFL 3X3GL 2NY3D 2XG5A 4OV6F 4X8XA 3WJLC 4HGWB 5ICZB 5MERA 1IAKB 4OGYL 4ZFOL 1NC2D 2W9EH 3PWLA 3FRUA 3L3JA 4LHQB 4EDWH 1S7RB 4ELKB 4HV8B 4Y5YB 3IFLL 4NKMA 4OZIF 2XQYG 2D0FA 2Q7YB 3U0PB 4LGSB 3EJYC 4P2QD 4LAJH 1IILE 4R0LB 3B9VA 1UZ6F 5A2JH 2AI0H 1VA9A 2NX5D 3T3PE 1OTUD 3NCYS 5L7XL 4X8JA 5EFIB 1L7IL 2YBRB 2GK2A 7FABL 1YJDH 4NPYB 1BMGA 3B6SB 2YKLL 1X4YA 1FAIL 2NR6C 3QISA 4LEOB 4NHCH 1NBZA 2MTPA 4OZGB 4GBXA 3ZKNC 1I1AB 3P77A 4H26A 3CU1A 4OCYH 4JZJC 1U8QB 1RZFL 2J6EA 4HS6B 4JRYA 2CH8A 4ODHH 4ZUWB 2D31B 4KXZI 2QQLH 4PRIB 1J1XH 2R2BB 1XF2B 4KJYA 4BH7A 4JFEE 2N1KA 2YRPA 5JOFA 4DN3L 2FBOJ 5H94A 4Y4FA 1N7ML 3PWPA 1HQ4A 1G7QB 2UZYB 1U8JA 5EU3A 5IB1A 1HDMA 4Y4HB 1XGUA 3WNLA 2V9RA 1Q72H 4O2FB 3ZKXB 2OTUB 3MRRB 3RWCB 1AFVH 3LDBB 3TBTA 5KZCB 5IVXA 3VXOB 4HWZB 4F7EB 4FQXD 3GJFK 5FYJU 1S7VB 4NKDB 2FATL 3RY5A 3WKNA 4MX7A 1DCLA 3Q6FB 4G8FA 4XAKE 2QR0A 3IYLW 4JFDB 4OT1L 3LKQB 5J1AB 4PJBF 1TLKA 1JL8A 3BKJH 2X4QB 2VR9A 3S6CA 1VFAB 2AQ2A 3AROA 5LWYL 1YC8A 4WV1C 3U4AA 2CIIB 1QBLL 2X70A 5J9PA 5HDLA 2KH2B 4PGZA 3RY6A 4MDJB 1AGCA 4RBPK 1CXIA 3O4OB 1E6OL 2BSRB 4G42B 4EBQL 4LPXA 3TM6A 3GI9H 2CLVB 3G5ZB 5E6ZA 1GC1H 1LHZA 3QDJA 4PGJA 4M4PA 2YD6A 3P4NB 3O9WA 3E1F1 4OZHA 3FRPA 5J1SC 5JXEA 2DIBA 2NY5L 2YD3A 5L9DL 1CFVH 2ICWB 1UM6L 3U1SL 4MCZB 1VKXA 1AIFA 3F5WB 3MGAA 3QUZB 3FTGA 1ND0B 2QLVB 1NDMA 4YIQA 1KTLB 4H0IA 3BIBX 1FVEB 4GW4A 1QO3A 1RZJH 2X4UA 5IVXF 4HUKB 4X7SH 2A2QT 1XGQA 3BX7C 3BRFA 5IFAH 2APFA 3QIBD 3ARFB 4BZ2L 3VWJC 4S10A 8FABA 1X4ZA 1CGVA 5IW3A 3F12B 4HSQA 1JRHI 1T1YB 2DLHA 5I1KL 2DQJL 2ITDB 1XIWA 4R7NA 1SYSB 3BPOC 1A14L 2VC2H 3ULVD 5IESL 2HTLC 1NGZA 2GITA 4IRJA 2VO5A 1HH6B 2RB8A 1MPAH 2JIXA 3LHPL 3WDJA 1I7RB 2UVEA 1YDPB 3DMMB 4WUUB 5HVHB 5EO0A 4FQJH 1MCLA 1JGVL 2PW1A 4LMQE 1MF2L 4UTAL 3LD8C 4HXAL 3OX8A 4Z7QF 4OZHF 4AIZA 4PG2A 1AD9B 3RTQC 3A6CH 4NYLA 1EBAA 5HHME 5HHOE 2Q8BL 3MV8A 3I6LE 3HZYB 1WCBA 4HW6A 4YDLC 5HHVL 1ZEAL 1A1OA 3DRTA 1I8MB 1KXVC 1BEYL 3MACH 4V1DA 4FFWC 1CL7L 5JIHA 2HJFA 3HI1A 4X83A 2DS4A 4XTRD 3ZTNL 4ODWA 5ID1B 2FL5A 3F7VB 4LVOB 1UENA 1I85A 5F97E 4W6YB 5FYLL 1FNSL 3PWLB 4TUJB 3FRUB 3L3JB 1DE4A 1FPTL 1SQ2N 4P99A 4JRXE 5IB2A 4JLRB 2EIZB 4P59L 4Y16D 4N0RA 2WIIB 5FYKD 4LIQE 3FONB 2FX7L 3FZUD 4QYOB 4OKVB 2LU3A 1R24B 3MXVL 2J1KA 5D2LB 1AQKH 1XZ0A 1U92A 3MGOB 1JBJA 2EO1A 4UBDC 2IBGA 5CSBA 4QHUB 1K3ZA 4UIMB 3QUXC 3MJ6A 3CGTA 2GTZA 5JOPD 3EKCA 3MOAL 2ZUWA 1NBZB 2EICA 4H26B 2CR6A 1VFOA 5FOBA 3FN0L 3GRWA 4UB0H 4L4TD 3QHTC 4KJYB 3CXHJ 1KCRL 2FH8A 5EU6A 3EYFB 4LSPL 1LEKB 4I0PA 4Z0XA 5H94B 3IDYB 2R15A 5EU3B 1IGCL 1T7YA 3RDTC 3SDAA 2WUBL 4LBEA 3F58L 5CIPH 3VXRB 1K85A 3C8DA 4ZS7L 3P73A 1NGWA 4QWWC 1LEIA 5EO1A 4S1DD 1R3IH 4JG1L 4K2UH 4MJ2A 1UM4H 3C9NB 3V79C 4MX7B 5ALCH 1T22B 1F11B 1FIGH 1NANI 4G8FB 1IAIH 1X5JA 1RZIA 2QR0B 2EEDA 2VLMD 4OLEA 2Q20A 1GHFH 5F1IB 4PJDE 1BQHG 4Y5VA 4JCLA 2H6PA 4U1IB 4CUCA 5EPMB 4NQDB 4NJ9L 1A47A 1J5OH 3O2WH 2YPVH 3TP4A 3PL6B 3CFDB 4TNVK 2X70B 3SQOH 5C0AE 3WHXA 5J9PB 3GMRB 3QFJD 4LCWB 2HVJA 2YOCA 4TVPE 4GAJH 3SDXA 4DK3A 5JA9A 1AGCB 3R0NA 2Q8AL 1LE5B 3EO0A 1BGXH 1UVQB 3QCVL 3O9WB 4K9EL 3PNWA 5K9JH 3WJLA 3KWWB 1J0HA 3OL2A 2ZSWA 5JQ6H 3CUPB 1MELA 4Y5XB 4PJFB 1AIFB 2XN9E 5FXCH 3VFPA 3UTSE 2PYEE 2DLTA 3IFPB 4YIQB 3ZDZF 2LU7A 4F58H 1BIHA 2WM0A 4FQ2H 1KJVA 4KY1H 1KJ2A 4MVBD 2BRRH 4GW4B 5INCA 2QSQA 1SMOA 1PZUB 4GW5A 4OQTA 4FXLA 2WP3T 2IC2A 3SQBA 4GG6E 4OCSH 4IRSC 2WQ8A 1ZLWK 4M6NH 3HRPA 5FB8A 4S0SD 3GSNL 8FABB 5FO7A 3VD5A 1QBML 2YPLD 4ONHA 4PTTB 5GGVH 4WI3A 4HIXH 1XIWB 3BP7B 2YD5A 3KJ4B 4QHNB 4JN1H 2VZ1A 4RFNC 3RZCB 5HYQA 4IRJB 1G9MC 4ZS6C 2JIXB 3NFPA 3QIUD 5BCAA 5IGXH 2OXGA 4R96A 4GAGH 3N50A 3SDXF 3AMKA 2N7AA 3T0EE 1YNKL 4K3EH 2PW2B 1EHAA 4HJJH 1RUQL 2PW1B 1J7VR 4L5FL 4GT7A 1HI6B 1RJZA 3CXDH 3RJQB 3OX8B 3RWGB 2I26N 4R4NC 2F53D 5BXFB 2RCSH 3D2UB 4H0HB 3ZE0E 3EYSH 3VJ6B 3MV8B 2Y5EA 1MWAA 1WCBB 2FEEL 4HIIA 4JJHA 4MNQD 1MUJB 4KKAC 2Y06H 2BY2A 1A1OB 5DYOB 4P9HL 2LTQC 5DK2A 2GCYA 2R0LL 4DKEL 4JVWA 1XF5B 4GXUM 2FL5B 4KKCD 1P84K 2MQ0A 3DROB 4WV1A 4LPUA 4D9QE 5C0JA 3G5XB 4J8RA 3ZSTA 1DE4B 5IB2B 4NKOB 4MQTB 2X4NA 1ZWIA 5HI5D 3D85D 1LGVA 3WFEL 3BPNC 1NEUA 4ORZC 5DZOA 4UNTA 1C1EH 5BW7C 5D1QD 3L5XL 3VFNB 5GJTL 4Y7MA 4JRWA 4R90H 2YEZB 5DC4B 3QRGL 1NGYB 3RJDA 5T3XD 5GGSA 1XZ0B 2ZUUA 3IFNH 2A9MH 3K8KA 4MMZC 4PJ5D 3TO4D 4G8EB 2GTZB 1DLHB 3NAAL 4UMGA 3RL1A 3UZQA 3GHBL 3L3KA 5TPWH 4PJ9D 4LL9A 3U48A 3HZKB 4YPGA 5FOBB 3H8NA 1P4IL 2VAJA 5F7DA 4YHNA 4Q9RH 3KVQA 5EU6B 4NOBA 3H3PH 5IW1B 5A2KH 3VRIA 1TTGA 3STZA 5JHDA 4LCYB 3MRDA 5CBAA 3QG7L 2G5BA 3CX2A 3VWJA 4XC3L 5ACMA 1LE9A 4G3YL 1N64L 3SDAB 3PQYE 4RGNB 4TRPL 3PP4H 4OZFB 1NGWB 5E9DE 1LEIB 5EO1B 3WUWB 5HJ3B 2M2DA 3T8XA 4LVEA 4U6XB 4U1JA 4WDIA 2E9BA 3PGFL 3BH9B 4Z7WE 1RUKL 4Y1AE 5DMJB 1RZIB 3OG6B 3VCLB 1DBAL 1SYVA 4JPVH 2WK2A 3ZE2E 5A2IH 4XP4L 4ODSH 2VDMH 1DLFL 2IPUG 5I18L 1F6FB 4L8CB 2I25N 5IQ7L 3WHXB 5DQDH 2EH8H 4KRPD 2HVJB 2WBJC 1YQ2A 4D0CA 1S7SA 1JNLL 4M48H 3RX5A 1DN0A 4X99B 1E4XH 1EFXA 4FTVD 4UT9L 3WIIH 3DGGA 1J11A 5C08D 1JYXA 2CDFA 4HS8H 2EDLA 3WEXB 3BP4A 3S3JA 3MV7A 1UQSB 1JZ5A 2EH7H 1AGFB 5FUZH 4XCNA 2YK1L 1DQLL 3EO1A 4OD2A 2D4DA 3SE8L 5I66A 5F21B 4RGOH 3BQUD 2J3SA 4J4PD 4L3ED 5HGBB 3HRZA 2D3VA 3LKNA 3OGCB 3INUL 5I1GL 5JDSB 5AD0A 1T1XA 1DVFD 4QOKE 1ZE3C 3O2DH 4WFHD 5AZ2L 4H1LH 1V8HA 3P3YA 1KN2L 4K3DL 1D5MB 4V2BA 4RAUA 3KYNA 2J8UB 1A6UH 5IQ9A 3PDOA 25C8L 3B8YA 3QUXA 3V4VH 3LRSB 1F3DJ 3CFBB 3GZKA 5HDQH 4GRLD 3DRQA 5C92A 4L3CB 1MCWW 1OSPH 2CJUL 3GB7A 1MCDA 4CVWA 1AXSB 5FGCE 1CT8A 1YA5A 5I76A 5GRJH 1N26A 5HYQB 5BS0D 5B38G 2VLJD 4PJCA 4X6CE 4YXKH 1OHQA 4U1MB 4R96B 1X5KA 2BMKA 1RHFA 1OTUC 3RDTA 1QBAA 3QCTL 3ZDYF 1XR9A 1YEFH 2E8YA 3RU8L 2MKWA 3HMXL 3LKRB 3HE7B 1S5IH 2ITCA 3HZVA 4RMRA 4XXDA 3RIAK 4Z7NE 3CSYA 2NZ9D 4S1RL 4F33B 1T66D 5D8JL 1G84A 1T3FB 3CH8A 3VXMD 3DV6B 1SJXA 3CNKA 4HIIB 1N8ZA 2ESVE 1IC4L 5JOEA 4ZD3L 3O4LA 5IG7A 2HP4A 5CEZD 1YPZA 4QXWA 4UQ3A 5EBLA 1F8TL 1PKQE 3V4PH 3SJVA 2F58L 5FGBA 3NTCL 4J8RB 4RAVB 1CF8L 5D93B 3FFCA 2Y4SA 1EH9A 4FQXC 3ZKMD 4U1HA 3P11L 3QDGE 4L4VD 5EU7C 2HJLB 4OLZL 4AMKL 5GGSB 4UV7L 2JE8A 4ZUTA 4XWGH 1NCNA 4GAFB 2NY1B 4HUXA 4PJCF 5GZOD 4CMMA 5M94B 2JB6A 1R3HA 3KLSA 2QQKH 2GT9B 1A1MB 2Z93A 4RA0C 4OLVL 4AEHL 5E70A 1S9YA 5E8DH 2I24N 3W2DL 3C6LB 4YHMH 5AG8A 1IFHL 1GGTA 2L7UA 3H7BA 4OF6A 4IRSA 4PRAA 5JHDB 3MRDB 4Z95H 5CBAB 3VE0B 4XAWH 4KQ3H 2G5BB 5I0DA 1VFMA 1QLEH 1HZHH 4ACPA 4MQSB 1LE9B 2X4PB 4LVNC 1JGLH 1EO8H 1YN6B 2C9AA 2UUDK 3RWEB 1R5WA 3O3EA 4P49A 1A64A 4M62H 3BPOB 3R1GH 5IR1B 2ZUQB 1GRWA 3UBXA 2QQQA 1R0AH 4U1LB 3T8XB 5AUMB 2VISB 5SV4A 3RHWK 1CG9B 1GL4B 1JNHB 1A2YB 5CEYB 3MLTA 4DEPB 3SOBH 1CDUA 3LZFL 4U31A 2W59A 4NBZB 1M1SA 3QIBC 4QLRA 3EIFA 1MH5A 4HUUA 1JVKA 3HB3D 1Q1JL 4LCCC 2GAZA 5L2JA 3LS5H 1A3LH 3DX7A 5FV2A 4H20L 2E6PA 2ZWLT 5I1AB 3DI3B 4D0CB 1S7SB 3ULVC 1DN0B 1NH6A 5GSVB 5TDPB 1A8JH 4YDLB 1EFXB 5DEGA 3RIFK 1JWSA 4DQOH 1WISA 3ZO0A 5KAQG 3FT2B 3EOAA 1E28A 1MFDL 3BP4B 5E99H 4XP5L 1GVIA 1WFTA 4OIAA 4XCNB 1FYTD 4OD2B 3EYOA 5I2IB 3LV3A 3SKMB 5CKGA 4H25A 4MA3A 3MNWB 2N4IA 4I3RL 1AXTL 3VFTB 5E1HB 1AY1L 1YEGL 5JW4R 1KLUA 1X5ZA 1BFVL 1MHPH 2R0ZL 5I30H 2OP4L 3H9ZA 3IRPX 2F5BH 5ID0A 1MJJA 4Z7OE 1I9EA 2X1PA 4JR9H 5BW7A 1CLOH 5C07E 3ARBD 1WICA 5I19H 2I27N 1I9RH 4JFFA 4MZ3A 4KHTH 4JFYA 1P4BL 4G9FB 3PDOB 3QUXB 2X4SA 3G6DL 3GJEA 3MOBL 4WHTA 4XTRC 2FJGB 3IDXL 4JFHD 1AGDA 1MCOH 2I60L 1QFWI 4DN4L 3S9DB 1O0VA 5F3BA 1CT8B 2WW8A 5I76B 4AIXA 1FGVL 3MREA 1FZJA 3G04B 4HK0A 2ADFH 1DJSA 5DRNB 3X3GH 1NFKA 4CMHC 5DVKA 3FZUC 3LEYL 4Y8DC 1I7TA 4NIKB 5BRZB 3F6IA 1F6LL 3Q3GA 3RDTB 1AO7B 1G6RB 4IS6A 1XR9B 1RQ5A 3QXDA 5DI8B 3CFJB 3BYYA 2Y36H 2VERN 3LPGA 1U95B 5EULV 3ULUE 3DVIA 2VDKL 2NY6D 2D2OA 3TBVA 4N0YL 2FZ3A 4RX4D 5L7XH 1K9TA 2DQUL 1L7IH 4ETQA 3PV6B 4J3XA 3MV9D 5GISL 4AEIL 4HG4K 5ICYB 2B7DT 3O4LB 4X5WB 2YKLH 1FAIH 4CJ1A 1YPZB 1SMAA 1UWEL 4DW2L 2FIRT 2ZCHL 1HYRC 4NN6C 2VZTA 3FFCB 2WBJA 4R8WL 4YWGL 4DN3H 3WS3A 4X7EC 4S1DC 4NQUA 4PY7A 1N7MH 4U6HA 2VR5A 5FCUH 4HC1L 3ULSB 2F8XC 2IH3A 4Z5RB 2HKFH 3MRCB 1HHHB 1W0WB 1X3DA 3KYAA 4HDIB 1CZ8L 1I3VA 1QFOA 4XAKD 3PP3K 3SDYL 3W0WE 1NANH 4PJ7A 2JB6B 5D9SB 1GZPB 5HGAB 5CD3A 5CFHA 2Z93B 2FATH 3HAEB 4MA8L 3PUCA 2VLRD 3K2MC 4U3CA 5FYJE 4HH9A 5KANI 1U6AL 3L3DB 4OT1H 2XACC 1MIML 1U8OB 1F00I 5ELIA 5HI3D 2ZOKB 3ALWA 3C5ZD 3TNNA 3N1QC 3BZEA 1EVTC 1L9MA 4OFPA 43C9B 4E41D 1NC2A 4NO5B 5HI4D 2V7NB 2MCG1 5D7JD 2A73A 1E6OH 4EBQH 3QUMB 3UBXB 1KPRA 4U1GB 4RFNB 5DMIH 3TO2B 1F6AA 2P5EB 4WGVB 3AREB 4P46D 5F89A 1F4XL 1NLBL 4P2QA 5I1EL 4MVBC 4LKXB 5TF1L 5IMMA 2BVPB 2ZSVB 2I9TA 4J3WA 4I18B 3S35L 1VADA 3RPKA 2NX5A 4HQQL 4LLQA 3U1SH 7CGTA 2YR3A 2ARWA 2NY2D 2VZUA 3S5LA 1T04B 4JFXA 3O3UN 4NFBA 1QA9A 5L2JB 1E6JH 3S3PA 3F7PC 2H26B 3D0LA 2DQDL 1KIRB 1FSKB 4KDTC 3QO0A 4RA3A 4ZFFA 3KS0H 2C1OA 4G6FB 4WJ5B 5IKCB 4Z76B 3EOAB 1JGUL 3V4UL 1E28B 1J87A 4ZXBA 2KZ1B 3V2AR 3QIUC 4Z7UA 4P5TD 1OY3B 1J05B 4CDGC 3U79A 5I1KH 2DQJH 4MA3B 3FT3A 5EIIA 1A14H 2DM4A 5DD3H 3KPSB 1A6ZA 5TDNA 1OAQH 5E94B 3BPNB 4FQXA 2HYMA 1CK0L 1MQ8A 3OKDA 3LHPH 5ID0B 1MJJB 3EGSA 1CLCA 1Y6NR 4PV9A 2RAMA 2A83B 3UTQB 2ZCKL 3TZVC 4YK4B 4JFFB 3WLBA 3MRPB 3VGGA 4N9GB 5E08L 1NAKL 4NWTL 4ODVL 1JGVH 1MF2H 4UTAH 3R4DA 2X4SB 3PWJA 2DKUA 4HXAH 4RISH 4NRYB 3AC0A 1AGDB 4KKCC 3IDGA 3BDBA 2Q8BH 1NMAL 2P24A 4WIQA 3S34L 4Y88A 5HHVH 4TTDD 4EN3D 1ZEAH 4NO0D 1FZJB 5HI5C 5L2KE 1S3KL 3K74B 4M93C 1OWWA 4JQVC 4YEFA 1CL7H 4W4NA 5GS1C 3NFNB 3ZTNH 2XOTA 2IQ9L 1KELL 1FCCA 2P47B 3S36L 5D1QC 1ZVYA 2XZCH 1I7TB 2XWTA 2ICES 1OAYH 1FNSH 3S37X 5E00B 1E27A 4IS6B 1FPTH 5HYSG 3O41B 1YUHB 2IH1A 1MJUH 4MAUH 4ELME 3TO4C 4CVZA 4Z7UF 2JCCB 2FX7H 4XPTH 1N6QL 4PJ9C 3MXVH 3TBVB 4M3KB 4IOIB 4HHAA 4F80A 4P4KD 5C6TL 5I8OL 2VZSA 4OCLC 3CX5K 1HXMB 4KTYA 3PF2A 1XFPA 1YEHL 3QIBA 3ZDXF 3D39B 4K94L 3OPZH 1V3LA 1FLRL 1W72A 2Z92A 2OBGA 5D70H 4LCCA 3WL9A 4XMLH 4YGVA 1YNLL 1J0KA 5F9AC 3FN0H 3SCMB 3GSUB 2YC1B 1KCRH 4A6YA 1E4KC 4LSPH 3WS3B 4PY7B 3ROOB 4U6HB 4H8WH 4JHWL 1WFOA 2WUBH 4BA8A 1OF2A 1S7UA 4AJ0A 4PJ7B 2B5IC 4JG1H 5EZOL 4WTWA 2DQTL 1X5LA 5FDWA 5F71A 1NCTA 5D1XB 4X4ZA 4PJEA 3LN5B 5BVJB 5DJZA 3QPXL 2MHAA 4KRPC 4HH9B 4OZIE 4GMTH 3W39A 4KJPD 4JO2L 5DGQA 4EUPA 3KHOA 1REIA 2X42A 4NJ9H 1UZ6E 5E4EC 2ID5A 3TNNB 2NY3B 3DVGA 4XCYA 3H0TA 1KGCD 2HVKA 2PXYD 3S37H 2NLJB 1QACA 2BHUA 2A73B 3O6KL 5FO9A 3WN5B 3WE6A 1X5YA 2Q8AH 1KPRB 1NBQA 2AXJA 2FECI 3BQUC 4J4PC 4Y16A 3RVXD 2XN9D 4JM2D 4NUJA 1AJ7H 3UTSD 2PYED 3QCVH 5F89B 1N5YL 4M1CD 1DVFC 1EAJA 4AEEA 5IMMB 5DUML 1ZKAA 1VADB 4X5LA 2EDXA 2IANE 1TJGL 2DQHL 4JFXB 4FFZL 1QA9B 3QEQB 4GKNA 4GRLC 1EXUA 5E8OA 3D0LB 4R4FL 2FEDD 1JV5B 3REWA 4YHZL 1VHPA 2C1OB 2HG5A 1NCAL 2UY7A 4L4TA 4P2OC 5EBWA 1IARB 5E6YA 1DQJB 4MNGB 1IGTA 2G75B 3W82A 1Z3GL 3JSSA 5EUOA 5E6ID 3GSNH 1G9EA 3C5SA 3HC4L 4LLYA 4ZXBB 3MJ7A 3MRHA 5FKPA 4NKIH 5CEXA 3SKJL 2DLGA 4N8CH 3CFKA 4PJBE 4U49A 3FT3B 3ELAT 1ZA3B 4WUKL 32C2A 5ALBL 1JNNL 4X7FC 3T0ED 4D9LH 5TDNB 3O6LH 1FG2A 4J2XA 2ICEA 3OKDB 4OV5A 4LPWA 1NJ9A 1IC7L 4PV9B 3DBXA 2ENYA 2NZ9C 4WI6A 1YNKH 3MROA 1QG3A 4OI8A 1H0DB 1RUQH 1HHIA 4L5FH 4JRYE 1AKJD 1OGAB 2C3VA 3BO8B 2VKXA 4BQ6A 5FFLA 4GKSA 3H3KA 5KOMC 4M00A 3NABL 3T0XA 5GIRA 1A7NL 3KJ6L 3LKPA 3PWPE 3QFJA 4R7DB 4XP6L 3UJTH 4P9HH 4NQSB 1VENA 3BP6A 4LK4A 3ZKMC 1FL3B 4KVNL 5IVXE 3OXSB 3IKCB 5HHPA 2D9QB 2XWTB 2V2XB 4WCYL 5E0QA 1G6RL 1E27B 2YA2A 4PD4K 3PGCA 3V8OA 3OKMB 1EIBA 2IH1B 1HKFA 2WMPA 5EUOF 3WFEH 5GZOC 3FMGH 2XYCA 4HXBH 4JDTL 5GJTH 2B8OT 4HUVA 3QRGH 4HHAB 2BNUA 1CFQB 4YHYC 3MRQB 3T2QA 1EEYB 3L3OA 3GHBH 1VACA 1W72B 2Z92B 3MOQA 3KPQA 4APQB 4ZNEA 4LCCB 4O2CA 4C4KO 2EDWA 5DJAA 3WL9B 1J0ZA 2YPLA 4KDTA 4DGVH 1BZ7A 1P4IH 2AEPH 5DRXA 4I0KA 3QDJE 3SEPA 1ORQA 1AGBA 1KUMA 3PQYD 4OZHE 5IMOA 4Z7QE 1MHHA 2EDEA 3S88L 5TE7L 3DO7A 1DQQB 1ZT4A 4L9LC 5E9DD 4XC3H 2B0SH 2E8ZA 3QIUA 3TLRA 2CQVA 1NCWL 4RCAA 3SDDB 2JKXA 2XNAA 3KPNA 3VGHA 3EOYG 4EJ1C 5FK9A 5CZVL 3BAEL 3CMGA 5IWLC 4EOWL 2AK1L 4YAQB 3HB3C 5KVGL 3V5HA 5GGUA 3T3ME 3T77A 5FDWB 5SX5K 2BY3A 2IALB 1JF5A 1UXSB 2BFVL 2BVYA 4PJEB 2F53A 1BX2A 3PGFH 1RUKH 1XCQA 1E0OB 5HHXL 4MNQA 1GZQB 4FQ1H 4XP4H 1BD2D 1YMME 3IJHB 1DLFH 2C1PB 2R4RL 5I18H 2MPAL 4LGPB 3DVGB 4XCYB 2Q1EA 5IQ7H 3ARQA 5TE6L 3GUTA 4PJXB 1D9KD 2HVKB 1KTDA 1WAAF 1JNLH 4GS7C 3QUML 3ZLQC 4Y16B 3L7FB 4UT9H 1XF3B 1KEMH 1J18A 3D85A 5CJBA 4JQVA 4NUJB 5E7FA 4CMHB 4GMSH 5GS1A 5DK3A 5HGDA 1PG7W 5HGHB 4WFGE 5D1QA 5DA4A 3BXNA 2YK1H 5AYQA 1NKOA 1E4WL 3ARBC 2W60B 2KDGA 4QOKD 5KSAD 3GHEL 3RVWD 1UXWA 2JK5B 1LD9A 3CFEB 4PJ5A 4PBWD 4XMPL 5IMKA 1EJ6A 3TO4A 3INUH 4GKNB 3O81A 5I1GH 4X0KB 1EXUB 3D3VD 5E8OB 1KTKE 2PR4H 3E6HB 4WI7A 3UDWC 4MNHA 5DO2D 4PJ9A 1B3JA 4TOYL 4V1DE 3VD4A 3PDGA 1RIVL 4P5MB 3K8MA 1CE6B 4K3DH 2GJ6D 2HG5B 2VLLA 4L4TB 1L0YA 5EBWB 4I2XE 2R9HD 2GUOA 1IGTB 1IGFL 4Z78A 4LLYB 1SVCP 4NOFA 5FKPB 2F8OA 5CEXB 2E5EA 5GGRY 3VFGL 4CBPA 3VG9B 3NBNA 4OFDA 1FFNB 4K7FB 3RKDD 1FORH 1UB6A 1C08A 1CVSC 32C2B 1IJ9A 3NZ8A 1E4KA 4Y89A 1FG2B 1SJEA 6CGTA 1NAMA 1NJ9B 2NY6C 5GS2H 3NPSC 4HUMB 3BKML 3QCTH 3UYRL 3GMLB 4XB7A 1BWMA 1CDHA 1CFNA 2OMNA 1OQXA 3RU8H 3GMMB 2DL2A 3HMXH 2ESVD 4X7DC 3L95B 2ATPA 4JHZA 3U4EA 4GKSB 2EDKA 4S1RH 15C8H 5GIRB 5C2UB 1CGSL 1AGEA 3QFJB 3QUYB 1T20A 1T03H 1IC4H 4K71C 3ZDZE 4PJIB 4MAYC 5F7LB 5C7XH 4LARH 4WW1A 1JPGB 4FTVA 4RMUA 4JFQA 1EAPB 4LKCA 5C08A 5C0CB 3IU3A 2EE6A 3RRQA 3V5DA 5DDHA 1ZLWH 5GS0L 4HUNB 3NTCH 3PGCB 1HCVA 1N0LA 4QXTA 4PLJD 2RBLA 3OKEB 2VMFA 2JJTC 3LQZB 3P11H 1ZGLM 3BQUA 4J4PA 4L3EA 4OBSA 1P2CA 3H6JA 1MHEA 3VXSE 4LFHD 3QEGL 1YN7A 1CGXA 3QIWD 1DVFA 2UZIL 5CILH 2BNUB 3GSOA 2VZOA 4U3HA 5FYKU 5D2NE 5ANMA 4YR6A 1VACB 5HI3C 3WFCL 4DVRL 3KPQB 3C5ZC 3BHBB 4O2CB 1FVCA 4OLVH 3SDXE 1ULVA 4GRLA 1PQZA 1ZOXA 4MD5B 2J6EH 1RZ8A 2YPLB 4F7MB 5EOTB 1HXYA 3W2DH 4ZOCA 4U0QB 4YBLB 1CDYA 3T1WA 1ORQB 5HI4C 1IFHH 5IMOB 5D7JC 1MHHB 2A0LD 3ARGB 4PJHB 3DO7B 5DJCA 4LRNH 5BS0A 4P46C 2V2WA 2VLJA 1T2JA 4YXLH 1ACYL 1TITA 1QFUL 1G6VK 1CXHA 2XZAL 2XNAB 5E8PB 2FJHA 2HLFD 3CSBA 2NY2C 3H7LA 3TV3L 4YHLL 2VR4A 5GGUB 1RZKH 5EH1A 4LGRB 3FOLA 1BX2B 2IQAA 3FB7A 3LB6D 4Q0XH 3VFSB 3LZFH 3VXMA 4K3GA 2C4XA 1S5HB 2A9NH 1Q1JH 3JV5A 2MCPL 1S7TB 2R8SL 2DTML 4GSDH 4MD4A 2BC4A 3VGDA 1A6VH 4MGXA 3OF6D 4P5TC 2BVUA 1OOAA 2WUCH 3BZDA 1LK2A 2BNQD 2BNRB 4H20H 4PRBA 1YY8B 1KTDB 4H88L 3L3HA 5D7IB 3MRFB 2FR4A 3MLXH 1QPXA 3D85B 4M93B 1VDGA 5HVFB 4L4VA 4U1SB 5GS1B 3RHWF 4XP5H 5L88L 5D1QB 3BXNB 5GGQH 1EEZB 2FRGP 5T3ZE 4I3RH 4YDIL 2HT2C 5D4QA 4ZFGH 1D3CA 2EDQA 1QEWA 4N9OB 2DWDA 4PJ5B 3OJVC 2Z91A 4KTDL 4GQPH 4UDTB 4HPOL 2R0ZH 4BZ1H 4X80L 5AWNH 5AZEH 1WIPA 3WYRA 4MNHB 5CJ5A 4PJ9B 2F54E 2X41A 1JGDA 1WJ3A 1QFPA 3VXQA 1I9IL 4TTDC 2VLLB 4EN3C 4P3CH 4LPTA 3WNMA 3RIFF 3TIDA 3G6DH 4CKVX 3CZFB 1T2QL 5MEOA 1S8DA 5D5MA 3IDXH 1KB5A 3LEVL 3DVFA 4DZ8B 3MRMB 1UB6B 2QHRH 4HH8A 5IB4A 3VD9A 1NDGA 5MEQB 2BX5A 3WKML 4C56D 3LEYH 4JAMB 1SJEB 3FB6A 1HWHB 1OL0A 3O6FD 1J1OL 4L9LA 2B1HL 2D4FA 4QHMA 3ULUD 1MREH 1H5BB 4HMCA 1R5IA 3VFVA 4P4KC 3NCBB 2MKLC 2CMRL 1RK0B 5IWLA 2P8LA 2HFGL 1ROWA 1KCKA 2B5IB 2APWA 1X5XA 3G6JB 3U4EB 2ZZUT 3LKOB 4EXKA 4MJIE 3S35X 2GIYA 2VXSL 4N0YH 1OAZH 5HDOA 1HSAB 1AGEB 2VDNH 4KRPB 1T20B 4AEIH 5J06A 1CCZA 5MHSD 3U2SB 5K59F 4LLDA 4ZTOH 3QDAA 5FGSA 3UTZA 5C08B 3QEHA 3N06B 5DMKB 2FO1A 1UWEH 4DW2H 4PFEA 1FVDA 5ENWB 1VGEL 2ZCHH 4LNRA 4M7KH 3IRZA 5JW4Q 4QXTB 1JYVA 3HMWL 1FYTA 1G7JA 2HRPH 4R8WH 3NA9L 1EMTL 3S3SA 3PHQA 1I8IA 5F96L 1I1FB 1IEHA 4ISVA 3BWAB 3W0WD 4L3EB 5BZWB 3QNZB 4HC1H 4YH6A 4MA7H 1M7DB 3RKPA 2XFXB 3MUJA 1YN7B 2YXFA 1GPOH 1DVFB 3ZHDA 1B4JH 1KENL 2GQHA 3G08A 3ARBA 1CZ8H 3SDYH 4Y19D 4KJPC 2CUMA 4NNYA 1LO5A 4G9DA 2ARJB 2XPGA 1SBBA 4UIKL 1W72L 4M43L 4DUVA 2EKSA 4LVHB 3MUY1 4AG4H 1A7RL 3DUUA 4GRLB 5H37H 2NY0D 3UDWA 3ZDYE 1RZ8B 4MA8H 4CW1A 2OK0H 4G7YL 3GRWH 2OL3A 4ZUUA 1DBBL 2PXYC 1U6AH 3VRJA 1VESA 3MV7E 3LQAC 3QQ4A 1IEBA 3RVXC 4BQBA 5DVLA 4M03A 4JM2C 3RAJL 1X44A 3VFWB 2R2EB 4M1CC 5B39G 3HNSL 4P4RA 2FNBA 5KSVB 1PSKL 5JIPA 1UJ3B 2OJZL 1BBDH 2VZ3A 4WVRA 1T7XA 4OZFH 3LN4A 5F9WB 2V2TB 3RGVD 1P9MC 4OLXL 3RI5K 2FH6A 4LLUA 3Q6GL 3S36X 3X11A 5I6XB 1FRGL 5I1EH 2FEDC 2IQAB 5TF1H 2V5SA 4JGJA 5EO9A 3MFFB 3TBYB 2A6KA 1J1PH 3S35H 4CN6A 4HQQH 2D03L 5IB3B 3VXMB 2RQ8A 2DQEL 4RX4A 3B9KD 3MV9A 1I9JL 3B2UD 1KPVB 3GMOA 4N8VG 5E6IC 1MCEA 4ZPVB 2I9LA 2DQDH 3GSQA 2BC4B 3H9HA 1D5IH 1CGUA 1LK2B 1NGQL 4JN2A 4X6EA 4PJCE 2P44B 1D6EA 2ERJB 3CVIH 2FEEI 5CWSB 3T0EC 4OUUA 3PWVA 1TQCC 4L4VB 3UC0L 1O7VA 1P5UA 5EIQA 2NCMA 3KHQA 2H2PD 2I5YL 1KXTB 4WNQA 3I6KB 1QEWB 3HKFA 2Z91B 4Q6YA 1ONQB 1T7WA 2JJTA 1KJ2H 3FO0L 2BCKB 4ZG1A 1IM9D 2AQ1A 1JGDB 4FQQB 4F57L 2VLRA 1JPFA 5E08H 1NAKH 3B83A 4NWTH 3SJVE 1M7IB 1PX3A 1DTUA 4TQEH 5MEOB 5D5MB 1KB5B 5C0BB 5JO5A 3C5ZA 1NMAH 3QT2A 2CLRA 1IZKA 2O5YH 5ACLA 1CU4L 4ZAKB 2APVA 1NDGB 4E41A 2FWOB 4XP9L 2DI8A 1S3KH 5CGMA 5IMLA 3P0VL 5D7JA 4QHKI 1UJTA 3GNML 1LILA 4LRIC 2IQ9H 3S36H 3ZMRA 2GYSA 4P46A 4NGHH 4HAGA 1R5IB 3VFVB 3PWNB 4DCQB 4KZEL 3MXWL 1D7FA 3R06A 2VDOL 1DEEB 4HCRA 3NCFB 5J8OA 3THML 4M8QB 5LCVH 2GKIA 2H9GA 4K8RL 1MWAH 1N4XL 4KKNA 1YEDA 1QYGH 5DTFB 3Q5TA 4NDMA 4PB9H 3PE9A 1YEHH 4FZ8L 3QJHA 1WWWX 3JBG7 1PX4A 4K94H 5EU5B 5T1KD 3QULA 1D5BA 1FLRH 1TXKA 3QEHB 4YZFF 4DWHA 4G8GB 1Y18B 3GM8A 3O3AB 4YLQT 3MMEB 4M61B 3ARPA 4LNRB 1YNLH 4P5TA 4BKLB 1FYTB 3GIVB 1FO0A 1G7JB 4L8DB 5ABDE 3PHQB 1I8IB 1II4E 3SDCB 1KTRL 2DWEB 1UH4A 4KZDH 1YEKL 4BUHA 1HIMH 3OXRA 1F4WL 1FZOA 2AJZA 2X09A 1JN6B 5C6PB 1F2XK 5FDYA 1TVHB 2IG2H 4FZEL 4FMKA 3RWDA 4KPHL 1P7QB 4NNYB 1NCBL 1LO5B 4G9DB 3HTLX 4ZO8A 5J1TC 3SKNA 5JUEL 5ILTH 2O5ZL 5ETUA 1PZ5B 2XQBH 4HMEA 4CW1B 3T0VA 2CXKA 3CLFH 3DX6A 4HGMA 4ZUUB 3Q5OA 4HULB 3JV6A 3UO1L 1U8PA 5ERWB 1JHKH 1AE6L 4JO2H 4EN3A 4NO0A 3AS0A 2DOCA 2CK0L 2DLFL 1UG9A 3DTXB 4XPGL 5A43C 2VLKE 2VDLL 2IAMB 3PWUB 5DXWA 1BQHA 3CDCA 1RUMH 2HJKA 5KSAC 5CJOL 3LN4B 1F42A 2EYSB 3RVWC 3TN0D 1LO3L 1GOFA 5IBLD 3RBGA 1IGMH 4YNYB 2FCBA 2WLYA 3BPLC 2BOCA 3X11B 2J2ZA 1N5YH 5T1LB 4I3GA 5DO2C 3SGEI 4NNPH 5DUMH 2A6KB 1QSED 3NPSB 1ZHBA 2LV4A 4P4KA 3T4YB 2DQHH 2R9HC 2DI7A 4FFZH 4HX1A 4QEGA 4LDLB 4Z0BL 3SPVB 3GSQB 4X5XA 4R4FH 4JFEB 5F3HA 4KJWD 2UZXB 4JN2B 4WENB 2R1YA 3D87B 4YHZH 3RKDC 4I3SH 3FB5A 2OZ4A 4GXUN 4N0FA 3M17A 5E2TL 3WDHA 2B4CL 2VH5H 4HEPG 4L29B 3ILQD 3LPFA 1MCPH 3IVKA 3HI6L 1PW3A 4JO3L 1PEZA 3OHXB 4HS3B 5EZLB 1KCUH 4XCEA 4ODXA 5T3XL 4WTZA 4E5XB 1AR2A 1S9KC 2GFBA 4QRQB 1PAMA 3C6SB 5TF0A 4J1UB 3HNTL 1J9CT 4M6OL 5DD5L 3NZHH 1IC7H 5J11B 3M1BB 1T1ZA 1W0YT 1TQBC 4HIHA 2DICA 3MGTB 5DMGD 5C09E 1NFDF 5C0FB 5DR5L 3A67H 3E6FB 3ABZA 5I71C 3L3IA 5FECB 4ZOAA 3VMNA 5JO5B 1RI8A 2R23B 3NABH 3KJ6H 4XP6H 5J6GB 3QSKB 4PLJC 2ARJQ 2PXYA 3WIHA 2E6JA 4JO1L 1U42A 2XN9A 4JM2A 3BUYB 3UTSA 4JE4B 2PYEA 5F7MC 4WCYH 3QIWC 5FF6A 2OI9C 3OKKB 3FFDA 1G6RH 2C3XA 4HPYH 3C8KA 1FJ1B 5TH2A 2CRYA 3UCRA 1AHWB 1P9MA 4HK3J 4JDTH 2W9EL 1MFEL 2E7HA 3MRGB 3D18B 4IM8A 4JQXC 5L0QB 1OW0C 1OGTB 4BQCA 1WTGT 2Y7QB 3Q48A 3VFMA 2CKBA 5I1LB 1D5BB 1TCRA 1JCKA 1JUFB 4M5YL 1J0JA 5E6IA 2C3HA 1JK8B 2NW2A 5CD5D 2FO4B 4LSSL 4R3SA 5DFWH 4FQIH 3KXFB 3K46A 2LU4A 3AM8C 1FO0B 1YJDL 4WWKD 4P2QE 2HLFC 3S4SB 1TPXC 4XBGA 4NHCL 4OTXH 5HGGS 3S88H 3T0EA 2QJDA 3ZHLA 2CDGA 2V9QA 2OTWB 2W0LA 3WNNA 3LB6C 1NCWH 4LHUG 5LXGL 1I1CA 5HHMB 5HHOB 5ACZB 5IIEA 2IPKA 4EOWH 4JM2F 3MLWH 2NXZD 5KVGH 4OM1L 3NACL 1AKJA 1YMMD 2BFVH 5IBUB 1U58A 4BH8B 4EQ3A 2ADIA 1J0IA 1FNAA 4Z7UE 1RHHB 3CCHA 3I50L 4JRXB 2MPAH 3JV0A 1CIUA 5DD6B 2YD2A 1ZGLA 2APXA 2RR3A 4PV8B 5TE6H 2HFTA 4BFIA 5KJRH 1ADQL 5TE4H 2HJKB 3DI2B 5EU7E 2F5AL 2D0GA 4C55A 2VSCA 1HHJA 1G9MH 2BOCB 3H3BC 3SKUD 4CGTA 5D6CA 2DM2A 4LRIA 3ZTJH 2DJUA 3NGBB 1JF1B 1E4WH 3ET9F 4QRUA 1Z0MA 1IAIM 2VOTA 4FMFA 4QRPB 3BMWA 3QDMD 2DM3A 4HBCH 1OAXH 4X5XB 2BJMH 2EDNA 5CEZL 5IF0B 4TOYH 2YPKB 2XXCB 5KTEH 1W0VA 4X9GA 5I74C 2XWJB 3V5KA 4YUEH 3BESR 5IJVB 4N0FB 4KHXL 3PQYA 1IGFH 3B5HA 4Q9QL 3G5VB 4UQ2A 3RFZC 1K4CB 3VFUA 3O6FC 1RZJL 5E9DA 1S9XA 3VFGH 4EKXA 4X7SL 4OLUH 3ULUC 4H1LB 2OTPA 1R6VA 1BOGB 3TJEL 1EK3A 3E2HB 3EDEA 1WBXB 3TT3L 1FGNL 4PJDB 4P57B 1MCHA 1F2QA 2DKMA 1T83C 3RNKB 1KEGL 4UU9B 5K93A 1RZ7L 2BVOA 4JEGB 4XX1E 1FHGA 5C0AB 5ADPL 1MNUL 5DT1H 5LGJA 1BD2A 1KLGA 5B8CC 1MPAL 2M1KA 3CH1B 3ROLA 1OSZB 1Q0YL 1LWRA 4AQOA 1EGJA 2EIDA 3TJHD 1CGSH 4FQJL 4LCUA 1K5NB 3VDCA 1D9KA 1KF9B 4JGUA 2PXYB 1F4YH 4QF1A 5KS9A 4NCC1 2XN9B 2NW3B 2PYEB 3NCJL 4MJ5B 4WW2B 4KK8D 5FF6B 1IM3B 1EZVX 3VXSD 3VGAC 2SEBB 12E8H 2PCPB 4FNLH 3X14A 3PIQB 4QOKA 4PJAA 5KSAA 3MACL 3DHJA 2EIEA 4UAOB 4X9IA 3NCCB 4NJAL 3VXPA 2A6IA 4GG6B 3D3VA 2NY0C 2JJWA 2UZIH 4OCRL 1I7UB 4AL8L 2GJ6A 4NQCD 2R1WA 3GK8L 1ZT1B 1TCRB 3WFCH 4DVRH 4WEUD 2NW2B 3BN9D 4R3SB 3WNOA 4KKBD 5FYKE 4X6DF 4HUWB 1U3HB 4X6CA 1PEWA 1UWXH 1A7OH 3OZ9H 2CLZB 3RGVC 4MLIA 2CDGB 4ZSOA 4NM8L 4P2CG 5EN2B 1TQCB 2AGJL 2A1WL 1ACYH 1TZIA 1QFUH 2BDNL 4PBVC 4UB0L 5ESAB 2XZAH 3JWOL 3PXHA 4JHAH 2AV1A 1BWWA 2UV3A 5KS9F 5KBNC 3B9KC 3RX7A 3D25B 2L7JA 4YHLH 3B2UC 4K23L 2KL6A 1MVUA 2ESVA 1UFUA 3EUUA 4S11A 1U58B 3UX9B 4PJAF 5EUOE 5IV2A 3BEVA 5HYJE 1GC1C 1OPGL 2Q6WB 5IB5B 1JZ7A 5I1HL 2CDEA 2DLEA 1I3RB 1UB5B 3CCHB 2MCPH 5BOPA 1QUNA 1PGRB 2DTMH 5ALCL 5DRZA 1LP9F 1ZT7A 4UINH 1IAIL 3L6FA 4GFTB 4TTGA 2AJVH 3UZEA 1ES0A 3QRFM 2H2PC 4UNUA 5DRWB 4H88H 1BBJA 5C0RL 1NSNL 3FQTB 3IDMA 5T3ZD 1OCWH 1YEJL 3TYFB 1J5OL 3O2WL 3BSZL 4WWID 5D1ZD 3OAYH 1UGNA 2R4SL 2VLME 4JO4L 3U7AA 4QRUB 3QIWA 5IHUH 3NN8A 1DN2A 4YDIH 3FCTA 2F54D 3TH3T 1QNZL 5E5RB 4KTDH 2ORBH 3JUZA 5J12B 4U1KA 2NZIA 3N1FC 5JQ6L 1W0VB 3V5KB 4AIOA 1I9IH 4I0CC 4JQXA 5JDJA 2RJMA 3PQYB 2OSLA 1OW0A 4FQPA 4F58L 5CAYB 3VFUB 3RWHB 5E9DB 2FX9H 1S9XB 5AYUH 1XR8A 1IL1A 5CSZB 4EDXA 1UACL 5LGHH 2OQJB 3OJDA 4M6NL 3AM8A 3W11D 1KFAL 4Y1AB 4Z7WB 4WO4B 1GOGA 1R3LB 1EJOL 3ARWA 1BPVA 1WUNT 2B1HH 1WAAE 3RPIA 1VPOH 5CP3A 4LQFL 3GSVB 3OBAA 4MJID 2RIKA 3UEZA 4KRLB 3K2UL 2CMRH 3KDMA 1FL6B 4QXGH 4KI5D 4FXGA 2HFGH 1KLGB 1XEDA 4JDZA 1Q9LA 4XNZC 3ROLB 5IGXL 4MCYB 3GSXA 4MA1C 3MNZB 4X98B 2VN7A 4K3EL 2VXSH 3L7EA 3OF6A 1U8KA 5KAQF 1KG0B 2XKSA 4HJJL 3ESVF 4QT5B 2BNQA 1NGPL 1D9KB 1JHLL 2PN5A 4TUKH 3DLQR 3VRLF 3UJIL 3FB8B 4YHPA 1G7PA 4XNYH 2RCSL 1K8DA 3OAUH 1FNGA 5I1JL 1CDBA 5KVDL 2PTVA 1MRCL 1QRKA 1VGEH 3K1DA 5JW5B 5EG6C 4UTBL 3HMWH 1GYAA 4QOKB 2F53E 4MSWA 5E4IA 1EMTH 2A6JB 3BRDA 5F96H 5HPMB 1WZ1H 1GJIA 3DIFB 4OKDA 2EDJA 1RMFH 2A6IB 3K1KC 1XMWA 4PLOB 4MNQE 5FA4A 4WTXA 4NFDA 1ODAA 1FV1A 5CCKH 1KENH 3ORJA 1T21A 3DUSA 5IJKC 4TPRL 3U9PH 1B0GA 3PGDA 3EW3B 4WHDA 1IGYA 4UIKH 1W72H 3REVA 3DECA 3SO5A 5K9QG 5DJ0B 3TA3D 4IMLA 2ADGA 4FABL 2A9ML 3QNYA 1DBBH 3OKOB 4RGMC 4WU7A 3ULVH 3O3BB 5FIEA 1DBJH 2P8PB 1CXFA 3TN0C 3NCEB 4C58B 1BFOA 3MTRA 4M1DH 3Q5YA 5IBLC 3VFRA 3RAJH 3RWIB 5IUSA 4C56A 3HNSH 2GTWB 3HC0A 4JVUA 1NMCB 1PSKH 3O6FA 2I07B 5DZNA 3TPUB 5L8LB 2QQNH 2OJZH 4PGCA 3KPRB 2PF6A 3MQIA 4Q9RL 3H3PL 2CRIA 5K9OB 4OLXH 1H3TA 1Z5LA 2Q3ZA 2ESVB 3DURB 4HMDA 1FRGH 4I13B 2V17L 1KIPA 1WFNA 4KJWC 5SX4I 5JW3H 4BYHA 1HCFX 1T83A 3BEVB 2D03H 1TQBB 3PP4L 2DQEH 1S9WA 4EUPH 1PKQB 2CDEB 2EXWD 4C83A 3FO1A 3HZMB 2YUVA 4LIQL 1H15A 5B8CA 3ILQC 1YQVH 3QDGB 2XG4A 1NGQH 3HCVA 4O9HH 4BM7A 1BBJB 4JPVL 4QWWD 3QQ3A 4OZ4A 4G43B 5E2VL 1N3NA 5SWZD 1UZ8B 1BLNA 5J7CC 2ICCA 2EZ0D 5KOVC 3W0WA 3UC0H 3ZT7A 1V7NH 1A9EA 4AZ8A 3LMJL 4PTUA 2I5YH 3QIWB 1AP2A 2VXUH 4M48L 3T0AA 2GI7A 3WIIL 3KYOA 1NCDL 4Y19A 3RBSA 4HS8L 4U1KB 1GGBL 1R3KA 3FO0H 5FUZL 2G60H 3FT4A 1EHLH 2CGRH 2DKSA 4FTVE 3BZ4A 5DVNA 5ICXA 4F57H 4MHHI 4RGOL 1SBSL 3HUJA 2BHZA 2W0FB 2AKRA 5H2BB 2OSLB 3OB0H 2LAGB 3I2CH 5FM4A 2BRQA 2XKNA 3GMNB 4GLRI 4NUGL 4R97B 4DKFL 5I8KL 1WZLA 3J7HA 3B9EA 5F7YC 3HC3L 4MDIA 1IVLA 3QWOB 2CIKB 5JORA 1XR8B 1IL1B 4L9DA 3SE9H 4IOFD 1CU4H 2UWEF 2WINA 4KC3B 2BSTA 3FO2A 1DP0A 3I02A 4U6TA 5DVOA 4DJMA 1A1NA 4D9RD 3P0VH 5HDQL 3RGVA 3VMPA 2J5LB 1OSPL 2XZQH 2Z8RA 4FXKA 4S1SL 4XZUA 5FHBH 3WNKA 5JR1H 2LQRA 3F6LA 3TBSA 1JFQL 2RHEA 5ANME 3IXAA 5FM5O 4OZFG 5GGSY 4HAFA 5GRJL 5F9OL 2J4WL 1MFAL 3WUWG 2YWZA 1BQSA 4KZEH 3MXWH 1ZS8A 2VDOH 3QG6B 1M6OB 4B7IA 4FXGB 4GRWF 4TVPL 3B9KA 4P3WA 1Q8MA 1SY6A 3THMH 4OB5H 3DWTA 4POYA 5CD5C 4K8RH 1NLDL 2V5TA 5HYSA 1N4XH 1U8KB 4J23A 1JWUA 2CRMA 4JKKA 2ZOLA 2A6DA 3RUGF 5BS0E 2VLJE 4PGDA 4WWKC 1YEFL 3WIHL 3QEUA 3UTTD 5FYLD 1S5IL 4YHPB 1H3XA 3WXVH 3MBEB 1FNGB 4J3SA 3MCLH 1LEGA 3P4MA 3FHQA 5CHNA 5SV3A 3HUJF 4PRHE 1ZV5A 5GS3A 4P5KA 3IDIB 1Q9KA 5DHVA 5D7LE 5C07B 3O0RL 1HK6A 3UYOD 3VXUD 1K2DA 2NXZC 2XICA 2X89D 3MRBA 5LAXB 1BJ8A 2DBLH 2YD7A 5GHWH 1F4WH 2X4TB 1LDSA 4GRMA 5MENE 4XVSH 5KSUB 5C8JA 2XA3A 1IM9A 4KPHH 3ARYA 3IU4H 3DUSB 3HLAA 2X4OA 5ITBH 1M4KA 3WDIA 4NQVA 5HHQA 1NCBH 1B0GB 1IGYB 1NL0H 3REVB 5JUEH 3HI5L 4KMQA 2AJ3A 2R2HA 2X1XR 3WCYA 1MQKL 4IMLB 2VLKD 2ADGB 5AEAA 1INQA 1OT2A 3GO1H 1HHGB 2R29L 4XWGL 3UO1H 2AV7A 4N0CD 4MD0B 4LLMA 3O11A 1AE6H 1INEL 2X2YA 1MAJA 4UUJB 3MYZA 4C54A 2DLFH 2IF7A 4XPGH 4AH2A 1QLRA 2JB5L 4KK9D 2WWMD 3O6FB 3W5MA 4PB0H 3C60D 4QHKJ 3EOTH 3MZTA 1MI5E 3PABB 2FYYA 2R0WH 3UTPD 5K59E 1IAMA 3TCLB 3C09C 1LO3H 1IGJB 3W9DA 4KRMB 1BM3L 2K3TA 1P6AB 4LNVA 3FQWB 4KQ3L 4YO0A 5MEPA 1QLEL 1HZHL 2AJUL 3RA7L 1KIQB 5JXAH 3BVNA 1JGLL 1XH3B 3RWFA 3CDGA 5FKAA 3QUKB 3OR7A 5GRUL 3GMPA 3HHRB 5LVEA 4LP5A 4Z9KB 1S9WB 3R1GL 2VWEC 4QTIL 1KIUA 1R0AL 5T1DL 4C83B 4Q6IB 1RJLA 2GY5A 5T1KA 5B8CB 5DS8A 4U7MA 3HCVB 2O5XH 4J3TA 1OWRM 2VABA 5EORL 1F3JA 3QQ3B 2P46B 5E5MA 5I1CL 4HWUA 5E2TH 4J3VA 1N3NB 3K4AA 2KPNA 2B4CH 4I4WA 3LS5L 1H3PL 2YD9A 1VGKA 3HR5A 2E9JA 4JO3H 4RSVA 5T3XH 1G7LA 3ARDD 1GOHA 5CP7A 1JRHL 5SWSE 2DMKA 4IJ3C 5C09D 3I9GL 1R3KB 5DD5H 5BV7B 4UDUA 5LGKA 1DUZB 5DD0L 2H8PB 2ZPKL 2NY0B 3BZ4B 3O8XD 3FQXA 3TJHC 1MAKA 5FHAL 1ORSB 2DM7A 2DQFA 4YDJB 5IJKA 4OAWA 2XKNB 3SKOA 4LHUD 3MUHL 2BSED 4PG9B 1G7HA 5JORB 1OAKH 4CU7A 4KK8C 2MOVA 1I9RL 2QKIB 2BSTB 4YGAB 2BVEA 3P9MB 3QQ9D 1A1NB 4O2EB 2VAAA 4JO1H 5HBBA 5EZJB 5J13C 3RWJA 2EYTB 5TQ0L 3TN0A 5HHNA 4JKPH 4FXKB 4XZUB 1GIGL 4QXUH 5D2NC 3X13A 3TBSB 1ZXQA 4B41A 3IXAB 2C7UA 1IAOA 1JZ6A 3I3DA 4XNMA 3CAFA 5B3NA 1N6UA 1QSEA 1ZS8B 1CDCA 4JFHE 1ZSDB 4LCIH 4DVBB 3B9KB 3SY0B 1ZHNA 2VL5A 3EDJA 2X7LB 4NHUB 5DJ8B 3ARXA 1MFEH 3I3BA 1XGYH 3BN9C 3D9AL 4KKBC 4R6UA 1XCTB 1EBPA 2Q86A 4KVCL 4FN0A 3GI8L 4PGDB 4L8BB 5IHZA 2Y36L 4PJBA 1CICB 1ZLUH 1WLHA 4M5YH 1LEGB 5CHNB 4LSSH 3CIQA 3D69A 3U6RB 4NQEE 3CVHB 1Q9WB 4U2YA 4G8IB 4TNWF 4YE4L 5DHVB 3S96A 4OF7A 2EE3A 4ONGL 3GMQB 1K2DB 4Z8FL 3MRBB 1IQDA 4DKDC 2HKHL 3FQUB 4GRMB 3MV9E 5E1AA 3V6ZA 5C9JB 4WI2A 4RWHA 5LXGH 1I1AD 4WHCA 4OJFH 4PRID 2P7TA 5FCUL 4OM1H 3NACH 2D7TL 4TSBL 2VN4A 2AJ3B 5L2KB 5H35A 3BJLA 2AXGA 1QQDB 2HKFL 1WITA 1TTFA 4U6VL 2IADA 1INQB 3I84A 2EDDA 2AV7B 4Y4HD 2D0HA 4LLMB 3O11B 2V9TA 5IROC 3U36B 3I50H 5D1ZC 2NTFA 2LAAA 4ELMB 1DQMH 1QLRB 2ED8A 1EFQA 3VXNB 4XHJD 3DVNB 1YMHB 3U0TB 2ATKA 4UV4H 1ADQH 5BQ7B 4XBPB 4NZRL 3QPQD 4JY4A 1ED3A 4YZFE 4D8PA 2F5AH 2GEEA 3X17A 4XGZB 4WU5B 3FN3A 4YO0B 2VQUA 4ZUVA 1L9NA 1PLGH 2VLRE 2ZUTA 2CR3A 3JTSB 2VQ1A 3CDGB 3SGKC 5BJTA 1SEQH 1YYML 5FKAB 2BVQA 1VFBB 3KYMA 3GMPB 1U8LA 3BH8B 1TVBB 2XZZA 3K4ZA 1JZ2A 5DMIL 1SEBB 5C0GA 4O5LH 3P9LB 4WI8A 4E41E 5AG9A 4UOW0 1PY9A 1XGTB 5CEZH 4MHHG 5DK0B 3D0VB 4M5ZL 3WNPA 4NWUL 1B9ZA 4XRCA 4R2GD 2VABB 3IJYB 2PKDA 4TUOA 3WBDA 3MFGB 4WWKA 4KHXH 3W11C 1K6QL 1TZHA 1S7QA 5DJ6A 5DUBB 4Q9QH 1OTSD 1E6JL 1TZGH 1LK3L 4LHJB 5DHYA 1N5AA 3QUZD 1C5DB 1WBYA 3TNMB 1M05A 3MUGA 2G2RB 2ZJSL 1RIUL 5CP7B 4QTHA 1NCUA 4QY8A 3TJEH 2XWBA 4KI5C 4OZIB 3DV4A 1G9NL 4J3OC 3TT3H 1FGNH 2IWGA 3ARFD 1U8MB 3MRLA 1YMMA 5CINH 4L8SB 1KEGH 4BSVA 3FQXB 2WZPD 2IFGA 1RZ7H 5DD3L 3MCKA 4HKBA 2NMSA 2HAZA 3FOMA 1OAQL 3X12A 5ADPH 1MNUH 4OAWB 3HAEG 4PUBH 5EA0L 1KT2B 1KB5H 3VWKD 4LF3B 1Q0YH 4PBXA 3H42L 4MLSA 3MLYH 1ZA6A 4HKXA 5ESVA 3VGFA 2AAVA 4UILH 3QQNA 5GS2D 2VAAB 4RISL 1CGYA 4WUUD 3RWJB 1C16A 3ECBB 1FZKB 2HT3D 3UPAA 3L5WB 2IANB 1FL5B 4ZOEA 3NCJH 3SGDH 3SE4C 1CLZH 4TSAH 4MMXC 3UBXG 3DYMA 4XCFL 5DFVD 3I85A 5I73C 2EE2A 3IS0X 1U2CA 2VL5B 4NJAH 4UOW1 3ZTJG 4KRNA 2XZCL 3OJ2C 3QDMA 4P3DA 5MERB 3P0YL 1FE8L 3UTOA 4X9BA 3T3MF 4I2XA 1OAYL 5E8NA 3TA3C 3BGFB 1BHGA 4OCRH 2Q86B 3TH4T 2Z4QA 1MJUL 4AL8H 4NKMB 4MAUL 3IFOA 5HVWA 5JPNA 1CFSA 4PJBB 1G0DA 5L8JB 4XPTL 1LO2L 3GK8H 2ZUSA 4PRNA 1NFDE 4X8JB 3TIEA 4LSVH 1EZVY 4G6KL 1F3DH 3UAJC 1R5VA 3QFDA 5EC2B 4BFBD 3V0WL 3OPZL 3O2DA 4GBXB 5D70L 3MJ8A 3P77B 4NM8H 1YY9D 2AGJH 3KAAA 2A1WH 4XMLL 4JRYB 3T65A 3V6OC 5HD8D 9CGTA 4X7TA 2ZG2A 2BDNH 4IMKC 3JWOH 3WO4C 4B50A 4OFYD 1TDQA 4X4YA 4BH7B 5JOFB 1U93A 5HYJD 5EUKA 2EXWC 4Y4FB 1I1YA 3PWPB 4H8WL 1HQ4B 4K23H 4M7ZB 5DEFA 1U8JB 5IB1B 1HDMB 1XGUB 5H35B 2WNGA 4JJ5A 2W1NA 5DUPH 3TBTB 3Q0HA 4MB4A 5IVXB 4RDQG 3MODH 1OPGH 4P2YA 4BSWA 5I1HH 3BIAX 4YFEA 3OGOE 2CO7B 2NY5C 3VXRD 1IT9L 2EZ0C 5ECJE 1UA6L 4F7TA 4W68A 3U7WH 5GRVL 4GMTL 4O58L 3VXSA 5C0RH 1NSNH 2JLLA 4JY4B 1TNNA 5CLTA 4D8PB 1WGOA 1YEJH 3IF1A 3BSZH 1J8HE 2R4SH 2VQ1B 4D3CL 5D96B 4JO4H 5BJTB 3BW9A 1BJMA 4NQDD 4GXVH 2YUZA 5D2NA 3KYMB 3VW3L 3S37L 3FO9A 3PL6D 5F1NA 4D94A 1VB9A 1ZMYA 2P8MA 1QNZH 1Z6JT 5GGRA 4LCWD 1A7PL 4NQCA 3QDJB 1AJ7L 3K4DA 4XVTH 4ZPTA 4OZHB 1KGCE 1QVOA 2ZNXA 4NN5C 3LAFA 4AENA 4JY6A 4IOFC 1VKXB 4YXHL 1AR1D 1TIUA 3FTGB 4U0RC 1NDMB 4CADA 1JNJA 3C2AL 5CJQL 5F6IC 2PO6D 5D6DC 1QO3B 2X4UB 4OD1L 5EOCJ 1OP5H 3JXAA 1M05B 1XGQB 1UACH 1ZVSA 4OIBA 1KFAH 5FYJL 2XWBB 2E27L 4BK4A 4NKIL 5BV7L 1EJOH 2X5PA 4N8CL 3MRLB 1YMMB 4JZJA 4R7NB 5FCSH 3PJSA 1S9VA 4LQFH 3MCKB 1NGZB 4D9LL 2QSTA 2GITB 3K2UH 3O6LL 2CK2A 1QP1A 2BHYA 5JQHC 1W8OA 4Y8AA 1FYHB 5E95B 1UWGL 4E42A 2DI9A 3RZCD 4WEBH 1X7QA 2GK0A 5GJSL 1DBMH 5EO0B 4CRPA 1RVFL 1A4JA 1NGPH 3CPLA 1JHLH 4G6JL 3UJIH 5IROA 4AIZB 5I1JH 3BD4A 4NYLB 5DC0A 5D1ZA 3O45A 5KVDH 1KV3A 4PYHA 3DARA 3HA0A 1MRCH 4KROB 3TZVD 5A1AA 1KCSL 5ISZE 3UJTL 1Z2KA 4UTBH 3DRTB 3D2UD 4V1DB 4YHKL 4Y2DD 2F54A 2HJFB 3HI1B 4ODWB 1SY6L 3DSFL 1OGAE 1BQLH 4P3DB 3BP5A 4I5BA 3OG4B 1DBKH 3SGKA 1ZHKA 3GEWB 4N0CC 5EB9A 3IFOB 5JPNB 3UPRA 3FMGL