4ZG1A

Crystal structure of a nanobody raised against kdm5b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSTFGIRTMGWYRQAPGKQRDLVAIISSGGSTDYADSVKGRFTISRDNAKNTVYLQMDSLKPEDTAIYYCNARVGITMLAHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and binding properties of a cameloid nanobody raised against KDM5B.
pubmed doi rcsb
source organism Lama glama
molecule tags Protein binding
molecule keywords NB17
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zg1A00
5FYKH 4MDIA 4QRTA 3BP4B 5TQ2H 4XBEH 2BXZA 5HSFA 5EU5A 3QISA 5IV2A 4HJGA 4MNGE 3P40A 3QDGE 1N2RA 1E4JA 4HC1L 1WEJL 2EYRA 5C70A 1MH5B 2V9TA 3CK0H 4P46B 5D2LE 1ZVSB 3DV4B 5IBLC 4KVCL 1NLDL 3EO1A 4NPYA 3V79C 5C09A 4S1RL 2ZCHL 3OR7A 5AWNH 1NC2B 1WV7T 1FNLA 2VQ1B 3PJSA 1MCHA 4H1LA 4APQD 1KCSH 1CFTB 3L5WA 4JQIH 4QGYA 1HHHB 4KY1H 5KBNC 3HFMH 4LFHD 5HDQH 4XGZA 1R6VA 2PYEA 4ZPVA 3T77B 1FZKB 3HZMA 3WKML 1FL5B 1FPTL 4XCNA 5DURD 3PHOA 1M7DA 4M61B 5IJVB 4NZRH 4N0UA 3WIIH 2CH8A 5KTEL 4EN3D 5CIPH 1BF8A 1FYTB 3B9KD 3QJFA 4JREC 1RUML 2V5SA 4D9LH 1GVIA 5IK3B 3MC0A 1P7QA 2G5BB 1ZOXA 1A6WH 1KTRL 5JXEC 4NWTH 2FEEL 1B9ZA 1T1YA 1J1PH 5IB5B 1ACYH 1GC1H 1F4WL 4BFIA 3RX7A 3KPRD 3FB7B 3QNZB 1FZMA 4GMSL 4PRPA 3SE3C 4YQXH 1U8OB 1QRKA 3D87B 3H8NA 1AHWC 5F7EL 4BH8B 1EEYA 3FT2A 4RFNC 5C0BA 5IQ9B 4HV8B 4PJ8B 5E8PA 5AZ2L 2X70B 3CPLA 4ELKB 2VDNH 5EUOE 1HILA 2R2HA 4XVTH 3BVNA 4QHLA 3NH7H 3P4MB 5FGBC 5DURB 4CMMB 3QDGD 1T4KA 4MJ5B 3VFMB 5DO2D 1NAKL 1NCCL 5L2JA 1X4XA 3DUHA 3ZDXF 5JOEA 3E6FA 4P5KB 4HWEH 3FONA 3D69A 2FO4A 3GMQA 4IIQA 3VMOA 4MJIA 2W59A 4HIHA 4FP8H 3DX9A 5E70A 4HMEA 5EBWA 1ZS8B 4G9FB 1OAXH 4IDJL 4FTVE 2NY3B 1IGYA 1R3KA 3C08L 1MREH 3T0BA 4TOYL 4YDKL 3KPRB 2NY3C 3REVB 2G2RA 5C07E 5FEBA 1YN7A 2ZUWA 3T2NL 3V4UL 1CDUA 3D5OF 1AP2A 2BY3A 3DURA 4Y4HD 4Y19B 3VCLA 5BOPA 1DLFL 1QO3A 4GW1A 5BZWB 5ILTL 2DYPA 4Z7UA 1RZ7H 4GAFB 3VI3E 1B88A 3SGDI 5GGTL 4E41A 1HKLH 2J8UF 2NTSP 3NGBB 43CAB 25C8H 3PGFH 1BEYH 5CEXA 4YC2C 5I73B 1OWWA 4LHJB 1JGLL 4KVNH 4EDWH 3RUGA 4MA7H 4PRDA 4XC3H 2AGJL 1LWRA 3HI1B 1OARH 1WK0A 1A9BB 2CKBH 3LDBB 4XBGB 3M17A 3TEUA 5IKCA 2XIDA 1MNUL 1NMAL 2WINB 5E2UL 5SV4A 1P7KA 3SDXA 4O02H 4FFVD 4V1DB 5JIHA 3CK0L 2XTJE 3WV0A 3GBML 4JB9H 4UV7H 1AO7D 4A2LA 3BIBX 2X40A 3SY0B 5JW3L 1CWVA 4WGVB 5HHOB 1QFOA 1LO3L 4JO3L 4OZIF 4PPTA 2LVCA 2B20A 4ZUUA 1TQBB 4M1CD 4XCEA 5I19H 1VEPA 4Z6AT 2QADD 2BVEA 2C4FU 2NY4D 3NZ8B 4HQQH 5D6CB 5E08L 4KZEH 5E9DD 5TH2A 5I1JH 5ALBH 5HYEA 4ZFOA 2BOCA 4NJ9L 2X4PB 1WZMA 1P2CA 3S96B 1DQDL 2PN5A 2E7LC 5I74C 4M03A 3Q5YA 5L2KA 4MJ4A 4XAKE 2E6JA 5LBSL 3V4PH 1EXUB 1P1ZA 2OR7A 2HVKA 4UV4H 4OCSH 4QF1B 7CGTA 5I1HH 1YNKL 3BESR 4X5XB 2AI0L 5HYFA 3VXUB 4UBDD 4MS8C 4LPYA 4ZODA 5EWIH 1BZ9B 4U0QB 1RZJH 1T20A 1ZHBB 4JAMB 1DSFL 3R8QA 4Z76B 1U8KA 2NYYC 3AAZB 4HK0B 2QJDA 3L95A 1CFNA 4PY8I 1A1OA 4AEIL 4QRPA 1T7YA 3LN5B 1VFAB 3OAZH 1YN6A 1XH3A 5F7EH 4I0PC 1YEEH 2AJYL 5T3XH 5E2TL 1X9QA 4QWWD 4PFEA 4P48A 1S7UB 4Q6IC 3ARWA 4OV6F 3TZVB 3W5NA 1WC7B 5C07D 3B5HA 4Y8DC 3ALXA 2X7LB 3C60C 1T2QH 1BX2B 4DGIL 1S8DB 4XI5D 3UTSA 3RDTA 4Z7UE 4QHUB 1MCWW 3V5DB 2Y7QB 3J7HA 1IAOA 4PLNC 1A7OH 1KCUH 4Y16D 1XF1A 2NCMA 4LCWB 4M4PA 4D0DB 1Q9OB 3H42H 2CIIB 2VLJE 3EO0B 2A0LD 2DQFA 1CVRA 4NM8L 1J05A 5D7IE 5HGHB 4GBXC 1F3DJ 3MPCA 4HX1B 5BJTA 5I66A 4J3XA 2EDBA 4D0DA 3E8UH 1CBVL 3TO4A 5DJYA 3QDMB 1D6EB 5H37H 1LNUB 1RZIA 2G60L 3V6OA 1FFNA 1OAKH 2VLJD 3GSNB 4WI6A 4XVSL 2DJ4A 4RZCB 5DT1L 4QT5B 4N8CH 3FQWA 1Y6MR 2Z93A 3CSYB 3K2UH 5D1XB 3CFEA 4HIEB 4Z78B 4BZ2H 3UTPE 4LPCA 3DVNB 3A6BL 2X4TA 2BY1A 4WNQA 4YUEH 2XWJA 4S1RH 3FN0H 5K9QI 1XGTB 3QRGH 3KVQA 1Z2KA 1DL7L 5F9OH 3PABA 2NW2B 2EXWD 4C56E 2FX9H 1LO2H 1MUJA 1QSVA 4FQHB 3MOBL 2DMCA 5C0JB 1IGML 5EN2A 1U95A 2ZCHH 1CFNB 3T04D 5I2IB 5DI8B 3IGAB 1KT2A 1EEZB 5IQ7H 3NCCB 3DXAA 3MA7B 4MX7B 4TNWK 1KB9J 3SGJA 3QUKA 2PKDA 3MRCB 4UU9B 1BF2A 1GIGH 2FX7H 4MAYD 1KJVB 3DMMA 4P2QA 1DUYA 1CDHA 3BOVA 5HYJD 3CDGA 5C3LD 3BQUA 3L3GB 4GO6B 4NWTL 4PRID 5D1QD 5ESQB 2X41A 1KJVA 2R2BB 4N8VG 1LO5A 3LIZH 1P2CB 4X7CC 4YAQB 4WV1B 2Z31B 3BHBA 4LAQL 3DBXA 3PE9A 5EC2B 4CVXA 1QBLL 5DMJB 1ZTXH 2VH5H 1I7TB 4PBXA 4HGWB 3VRLE 2IALB 4NFBA 4QHMB 1U91B 3VDCA 3BXNA 4F80A 1UH4A 3KHOA 3V7AE 5C8JB 1J12A 5MERB 2CK0L 4NOFA 2HJFB 4OFYD 3WN5C 1ZHNA 8FABB 1AHWB 3GSVB 5INCA 2I27N 3BDYL 3G6AA 4PRHD 5BXFB 4Y89A 1FORL 1B6UA 3BSZH 4IRJC 1IEBB 2QEJA 3ARDD 2J8OA 5E95B 3IVKA 4XP1H 2AXFA 3HE6C 5I1EL 4Y5VB 5DEGA 1EBPA 3MODH 3ROLB 4NYLB 3BP7A 3MRKA 3CXHJ 3WUWB 1ADQH 3IFNL 1ZHLB 5F9WB 3KPMB 1I75A 2ICEB 4JO2H 3SDAD 5CILL 5GGUB 4M5YL 4P2QD 5E6IB 1IKNC 4N0RA 2PW2A 3MUZ1 4U1GC 1A6UL 1MRDL 3ILPB 4ZFZB 3QFDA 3LDBC 5CCKH 4FXKB 43CAA 4P2OB 2BHYA 3BKJH 4IMKC 3KXFA 1TNMA 1NGZB 3TCLA 2E27L 4YWGH 3QO1A 1J05B 5CZXD 5DEFB 1ZKAA 4IIQC 2BFVL 3RX5A 4EIZC 4XC3L 4Z7VB 3KPQA 1AP2B 1NBZB 2A1WH 5GS1C 2F53D 4GMTH 1HZHL 2NR6C 5D5ME 1HEZB 3K1KC 5D7JA 5TFSL 4F58L 5JR1H 5T5NG 3PGFL 5J57B 4DK6A 4JLRA 5CZVH 3QEQE 4MMZC 1AGCA 5DVKA 4JPIB 4OLUH 2FLBT 4UV7L 5E2TH 4IS6B 1KCRL 5GRYA 2FH8A 3PP4H 3UX9B 4MXQC 4M7JH 4YXLH 3LAFA 4BKLA 3SOBL 1PDKA 1N5AB 1NMAH 3U30C 3RBSA 4BFBD 2J1KA 3N85L 3W9EA 2PNDA 5ITFB 4Z9KB 4NM4L 4Y7MA 1D9KA 5GSRA 3K74B 3IDNA 5C2BL 4AEFA 4LCWE 5CGYD 4X83A 4HJ0D 3G5YB 1XIWA 1NFDA 5IW1B 4YHMH 3RPKA 4GBXD 4NKIL 4ONOA 4H25A 3UZEA 4FFVC 4PJ7B 3ZT5A 4U6TA 3KYMB 2DL9A 3LOWA 4YGAB 4YDLB 2Y36H 3GI8H 3IS1X 4JFHD 4DZBB 3VD7A 3VXUA 5T1KD 5E08H 4KZEL 4PRPB 4X8XA 4ZOAA 4PGDA 3M8OL 4YFDB 3ULUE 4FZEL 4PUBL 3HZYA 4LLQB 4Y2OA 3RWJA 2VR9A 1DQDH 4HZAA 3L5IA 2CUHA 1I7RA 4UT7L 3DO3A 4MWFA 2OQJB 2HJKB 1IM3B 3DXAE 2JIXB 5T3ZH 3SDDB 4NN6B 1IC5H 4HCRA 4YZFF 1IZJA 3MREA 1H5BC 1H3WM 4HQQL 4OJFL 2VR5A 5CWSA 1C5BH 2YBRB 3EDDA 2J3SA 5GS2H 1OQXA 2Q6WB 3DYOA 5J6HB 4DZBA 3PWUB 4EZMA 3V0AC 1JPSL 2DQCL 1JRHL 1T1XA 4ZUUB 5HGAA 5I9QB 1A7QL 4PTUA 4HS6B 3WO3B 1HOCA 1BD2A 3BPCA 3H7BA 5FO9A 1CF8L 2LE9A 5BRZA 4OGAD 3MYJA 2F53E 4GBXB 1G7PB 2DF3A 2NTFA 4L5FH 4G6AD 2J6EL 1PG7H 2BJML 5EB9A 4GXUM 3RZWA 3F5WA 1INQA 1UEYA 5ITFA 3IU3B 1A21A 1MAKA 3AB0C 2WINA 4J2XA 1S9KC 3OKKB 2VE6B 1NC2A 1SJEB 5C09B 2OJEB 1IGJB 5AAWA 5GZNC 1NANI 3IAQA 3IAPA 1FSKC 1XGPA 3S35H 2VDOL 1IGFH 4G9DB 1ULVA 2XQYK 4KUCF 3ZHKA 4PJGE 3MUY1 4Z7UB 4LSUL 1NBZA 4RIRA 4ZXBA 4QCIA 4GW1B 3LSOB 5BZWA 1OAQH 2GSGB 3QPXH 2F8OA 2H26A 2FATH 5B38A 4QCIB 1RZKL 4YJZL 3C2AH 2C1OB 5FO7A 4BZ2L 3GSQB 5C0GB 1EVUA 2EIDA 3F6LA 4FXKA 2AK1H 4XH2B 3O2WH 2IPKB 3MJ7A 4FTVD 5H2BA 4QHKJ 5DD0L 1V3KA 2PW2B 1LEKB 3D48R 1UWEL 2OJEA 4G9FA 1AKJD 5GGUA 3F7PC 1FO0H 5D2NE 5I1IL 2EC8A 4A2MA 4K07A 2H1PL 3MBEB 1MCOH 3NCYS 4PG2A 3VXRE 1BBDL 4UINH 4RGNB 4XVSH 1X7QA 2Q87A 4YLQT 3QPQD 4LNRA 2CRMA 2H32A 4HBQA 3VXSA 1TVBA 4TULH 2XA3A 1U8JB 4TYUA 5BXFA 3RTQD 3S37X 1HILB 4Z7WA 1HH6A 4N9GB 3QIWB 2AJXH 4WENB 5HGAB 4HV8A 2BNUA 4PJ8A 4AENB 4JG0H 1WWWX 4CVWA 4XMKL 1Z9OA 3LH2H 1RZGB 4L3CA 4TTGA 4V2CB 5HVGB 1UEMA 2X4OA 3D2UA 1RQ5A 3FFDA 4UMGA 4UUJB 3BZEA 2KQMA 1UG9A 4CVXB 4OUOA 5IT2L 2YBRA 4MJ6A 3RZCD 4ZSOB 3FB7A 3LKSB 1QLFA 5CBEA 1MEXH 4R2GB 2C26A 4U6HA 1A2YA 1S7VB 4YDIH 3GMPA 4IOFC 4RQQA 2JIXA 1AGBB 3GSWB 1KEML 1FE8L 4RDQF 3MRGA 4R3SA 8CGTA 5IK3A 4P2YA 4GOSA 1UM4L 1JNNL 5DD5H 4AMKL 5BRZE 1W2KT 2UY6A 2AABL 4Y2DC 1JHTB 5E8OA 4FZEH 5I8EB 3MJ6A 5CUSL 2VNCA 5H8DA 4M1GH 3K3QA 4CKVX 3MA7A 3ZKNC 4OZFB 4XB7A 3X3GL 1H3PL 2Q20A 3D85A 4GRMB 5JORA 4RRPA 2AEQH 1ZT4B 3GB7B 4YGVA 2RIKA 3EZ8A 5I2IA 3G5ZA 4M48L 3PQYE 3WS3B 4QTIH 1EEQA 2H8PB 5J7CC 3B9VA 4I3GA 4MNGB 4H1LH 4DKFL 1ZEAL 3EJYC 5CILH 4ELME 1S7SA 4O4YL 1IZKA 5DF0A 1DLHB 3CFCL 3L3KB 4XP4L 2F9BT 4DAGH 1JGDB 5JOFB 4NJAH 2DTSA 1NCNA 4V2BA 4P4RA 4OF3A 4S1DC 4X5LA 2EKSB 3DVNA 1LEGA 2YOCA 1T7VA 3GO1H 3FB8A 2A83A 2Z93B 3CSYA 2AV7A 2FHFA 1XF2A 2R2CA 1P7QD 4OZGE 1N6UA 3DECA 5L8JB 1C1EL 2D4FA 3JBG7 1VDGA 5TF0A 4EN3A 5KSBF 2FD6L 5D4QA 1WZKA 4XMPH 5JQHC 3RVVD 3BIKA 1NGZA 1KBGH 3PV6B 5ITBH 3BKML 5EA0L 2LAGB 4U6XA 3EO0A 4Y4FC 1E28B 4X4ZA 5C0RL 2CSPA 4KI5E 1R3JB 4NDMB 4MS8D 2NXYD 2DLHA 1MHHB 3ARBB 1IFHL 3TVMD 4XNMB 3VXSE 1JYXA 3ZYJA 4G7YL 4OCRL 1A6TB 4YWGL 5I16B 2XN9E 3RVXC 2FNBA 4B0MM 1BQLH 5D7JC 1ZHLA 5FV1L 1IKFH 2OL3B 1UFUA 5I1DA 4I18B 3JWDL 5IHZB 4NYLA 5FOBB 3VWKD 5LCVH 5DRZB 1WAAF 2AK1L 2K3TA 4Y5VA 2H41A 5HYIA 1B4RA 2ARWA 4XZUA 2W91A 4M43H 1U41A 5DK0A 3BO8B 1A1NB 2X1WL 3AU1B 4HGMA 4LSSH 3OJDB 3O11A 2FR4B 4QY8B 4PRBB 3RL2B 2IG2H 3A6CH 3EHBC 3VW3L 1RVFH 3L3HB 3L95B 2DBJA 4YXHL 4UINL 1M05B 2IALA 3KDMB 2HLAB 1R0AH 4JQXA 4Y1AB 1I7TA 1KCSL 3U2SB 1U93A 4CN6A 3P9LA 1SJHB 3TH4T 3MV01 3RKPA 2CDGB 1S3KL 2Y5EA 5EPMA 3JZ7A 5HDLA 4O58L 1IL1A 4JDZB 4HH9B 4HCRH 5ADOH 1AQDA 1MF2H 5IEKA 1J8HE 2W9EH 3MJ9A 1KJMB 3O2DL 4TVPH 1NC4B 4Q9QL 4RMTA 3DMMB 1OM3L 4S0TD 3VXRB 5IESH 1HXYB 2NY7L 1BBDH 1XF3B 4F9LA 3HMXL 4UQ3A 4XAWL 3SE8H 2E9WA 3T08A 1I3RA 2YPVH 3LRGA 1YYLH 3NZ8A 3TBWA 5I1AA 5C0CA 5HPMA 4FXGB 1PG7L 2BJMH 1MRFL 2DQEH 5DFWH 5DI8A 4OCXH 4XHJD 1K5NA 3O3BA 4JO3H 5EN2B 3O9WB 1X4ZA 2D2OA 4DEPC 2ATKA 2QBWA 3SEPA 3L3IB 4OIIL 4MNHB 3HZKA 1N5YH 4PJ5D 5FM5M 5F96H 5D7SL 4DN4H 2ATPB 4BQBA 1A6ZA 1F90H 3VD9A 4HF5H 5CBAA 1NCAH 4FHBD 1N3NB 5DD6B 2OM5A 2DN7A 1CI5A 2IQAA 3O6ML 3PP3H 2APWA 1CGUA 1FBIH 1U8HA 4L4JA 4L8SB 4S10A 3SKNA 5TDNA 1Z5LA 4YQXL 5IIEA 3QIUB 1JF1A 3DX7B 4GS7C 1VEOA 5DJCB 1XR8A 4MYWB 5DO2C 1F6FB 5FGCE 3TWCL 2MFNA 4OZGF 5FCUH 1IGTA 2Z35A 1CK0H 3QHTC 1WWBX 1C08B 3TPUA 2XV6B 3ZLQC 1DBJH 3OG6B 1N59A 4GLRH 4KPHH 2EH7L 3DO7B 2P5EE 2DYPB 5C6PB 1OGAE 1RZJL 2AERT 5HGHA 4YE4L 4PBWD 5K9JL 3U9PH 3PG2A 1FO0L 3VMNA 2Y9RT 5CJQH 4DN3H 2YK1H 3TBSB 2BK8A 4X4ME 4KQ4L 3NN8B 1R5IB 3CX5K 1EO8L 2HKHL 5E2VL 3VDBA 3QXTA 1KIRB 2NLJB 4PJ5A 5C0AA 1FH5H 4Z5RA 3O4LE 4OI8A 2J8UB 4QO1A 3GIZL 1M1SA 1IAIM 4KK8C 2ARJA 3BKMH 1RZKH 1ITCA 4RMUA 5T1LA 1KB9K 2ORBH 4YO0A 3LEXA 5SWSE 5DMIH 4W81A 3NA9L 3DIFB 2A9NH 4NZUL 5F3BB 1ACZA 1F6AB 4HUWA 4YXKH 1MAJA 4Z0XB 3V95A 3WIHA 5D1QA 1FL6A 2GJ6E 2VLJA 4EI5B 4MJ5A 1BJ1H 4QRUA 3G9AB 1TZGH 3W9DB 3QXUA 4RGOL 15C8L 3RU8L 5IP4A 2F58L 4R7NB 1KCUL 2P4AB 2JKXA 3MNVB 3U0WL 2XACC 3ZE1F 2DAVA 1CFVL 4CU6A 4Q97A 1QTYT 1VEMA 3U7YL 3QEGH 3B9EA 2R0KL 4KVNL 5IM7A 1VSCA 3MLXL 3GMMA 1FVCA 4R4BA 4P4KC 4QRSB 4D9RE 3S9DB 3X11A 4X7FC 2Q76B 2VZSA 1LP9F 1OD9A 3ULUH 1Q1JL 4R0LA 5I17A 3CNKA 1EXUA 4OCRH 3D1MC 2VDQL 4S1DD 3T65A 1PZ5B 2NY3D 1PG7W 4C83B 4L3AA 1T1ZB 1KGCE 1WIUA 5I1HL 1AGFB 5D5MA 1AJ7H 1T03H 4RFEB 3AFLA 5TGBB 3VWKA 5HHXL 4PJCE 4GRWF 3UZQA 1D5ZA 4N1HB 1CICD 3BE1L 2RBLA 3FO2A 5TE7L 1FL5A 3EDFA 4TQEH 2MMXA 3VI4F 4YHNB 2BVQB 2XZCL 4JRXA 1QLEL 4PP2B 1OSZB 1FNGA 3AREC 4XNZB 3L3DA 3HNSH 1YNKH 1JTOA 4Z0BH 2CO7B 4XGZB 5J12C 2C4FT 5FYJD 4AM0B 3TO4D 2J2ZA 4HPOL 3VFTA 4X9BA 4LARH 4MA8L 4NUJB 5DHVA 5DRXA 3RNKB 1HHHA 5L2KE 4OCYH 1OP5K 2VIRA 3MLTA 2E8YA 2X1OA 5LQBH 3FRPA 4K71B 4Z8FL 2B1HH 5HYQA 4YIQA 1EA9C 5GSVB 2DQTL 4HIIB 4WI9A 3RY4A 4XB8A 5SWSD 3MROA 4ELMB 3O45A 1J8KA 3RIAK 4HFUH 3SJVA 3UEZA 4O00A 4WFEE 1HQRB 1QRNB 3INUL 5MP6H 1B0RA 5FECA 3O6MH 2HTLD 2EYRB 3WN5A 1T0MB 4HJGB 3S97C 5EU5B 5JXAH 1RFDH 1UWGL 4D9QE 2ZCKH 2ZUXA 4KQ3L 3D9AL 2APFA 4K71C 1NEZB 1QZ1A 5FYLD 4HFWB 3VXQB 3RPIB 3ZDXE 4M6NH 1CBVH 3QXDA 4QHNA 1A7OL 4I3RL 4NQEA 4OT1L 3VH8A 5GRJL 2P8MB 3F7VA 1U8MA 1M6OB 2MOVA 5BV7L 5DJZB 3QQ4B 4Q6YA 1JZ8A 3L7EA 4XX1E 3WIHH 3VD4A 3ULVH 1GGYA 5KVEH 1MVUA 4F7PB 4P0DA 1AI1H 3C5ZB 3DRQA 4XT1C 1C16B 1G7QA 2XN9A 4L3EE 5B8CC 3MBEC 4L4VB 3R8BB 3RP1A 3L7EB 1CN4A 5DJZA 1IM9D 4NBXB 1IQWH 3S5LG 1QHOA 4ZD3L 4OB5H 1IKFL 1F4HA 5HHVL 1IAKB 4LRIC 1IGMH 2HFFB 4NQEB 5E8PB 4JM2F 3QUXB 1T5WA 4MD5A 4ODUB 2Z31D 4BH8A 1J0JA 2IAMC 1AE6L 2D7NA 1DDHB 2G75B 4RMVA 3Q5OA 1U8OA 1A4KB 1DQLL 1FZOB 4NRXB 2E5EA 5I19L 1DBAL 3H9SE 2V7NA 4I3SH 4BFIB 5I18H 4OZIB 3CMGA 3Q48A 3JSSA 3FN0L 5IVXE 2V17H 1G7MB 2DLFH 4IRSA 4A6YH 3V7AG 1YEIH 3MTRA 4P2CG 5JMOC 4XMLL 1WZLA 3KWWA 2A6KA 3MFGB 5KSVA 5EZIH 4U0RB 4WFGD 2ORBL 3D39A 2WQ8A 1S3KH 1F3DH 2VDPL 2D7TL 4XWGL 4FQJL 5E1HB 1P4LB 5DJ2B 1RY7B 2EKJA 3MLZL 3TCXA 2VYRE 3KPLB 3AS0A 1MY5A 2ILLA 4CU7A 4Y5XB 12E8L 2B5IB 4M02A 1GC1C 5EWIL 3OBAA 5A43C 4AY0A 1KXVC 4UOJA 4Y4FA 1MJUH 2EZ0C 3DROB 1OWRM 4R97C 2B5IC 2EEBA 1NSNH 1PY9A 3QUXD 2H2PD 3WIIL 3CXHK 3TBTA 2R0KH 2Z0BA 4G8GB 2EC9U 5D7LB 1P5UA 4UZGA 5FF6B 3RWDA 3CSBA 1I1AC 2A77L 3CXDL 1A5FH 2AJYH 3GKWL 4EJ1C 5TDPA 5E8NB 1GSMA 3T0EC 4IRJD 4XVUD 1AGFA 5D5MB 1SYSB 4WHYG 5ICXB 3LEYL 4PJDB 2DWEA 1U3HD 4IDLA 4ZNCD 2ZCLL 1CR9H 4ORGA 4GS7B 3Q0HA 4JANB 2DQUL 2X9YA 2AJZB 3FQRB 2AXJA 2DOCA 2D4DA 1CL7I 3OB0H 3BP4A 2LU4A 4XNYL 1MQKH 4MJID 1QFUL 2WWKO 3X14A 1I3GH 1CD1B 1JPGA 3CCHA 2QKIA 3GIZH 4QRSA 4X6DE 2XWTA 3IDYB 5JW4N 4ZYKA 3GSXB 1LP9E 5AZEL 1TENA 3GJEA 3UTTE 4XP1L 4I2XE 4KKAC 4TUOA 1RFDL 2X4NB 5DJ0A 1WCBA 2HFTA 4M6OL 5TFSH 4M7KL 2DQIH 3A6OA 4G8GD 3QUYC 2RCSL 5D2LB 4HULB 5JOPE 3B8YA 4PJHE 3T0AA 1OP3K 3SGEI 4U1HA 1UKSA 1ES0A 2MSPA 4OLYH 4Z0XA 3W0WD 2KBGA 1X3DA 3LD8B 2N1KA 4WFHD 3C6LB 3V0VB 1MFEL 4GAJL 5HJ3A 1A7RL 3BUYB 5DFTA 4ZUSB 2C3GA 1UXWB 5BOZG 5F7UA 2SEBB 4TSBL 4HUKB 3UTQB 1P4IL 3FHAA 1WSST 4Q6IA 4M5ZL 5B39B 4PRHB 5T1KA 2IQ9H 4TTDD 1CDYA 1A6VL 1V05A 1Q0YH 1INEL 1RD6A 4GRLB 4YNYB 2AJVL 4IJ3B 1JGUL 1TJHL 2R0LL 4OT1H 2VL5A 3BWUC 4RGMC 5AD0A 4F9PC 4KHXL 1XCQB 2GJZB 4POUB 1SJVA 3GNMH 1D7FA 5I30L 4KY1L 4POZD 1N4XL 4K8RC 4HMDA 3MSPA 1UWXK 5ACZB 4RX4A 1IJ9A 5AG9A 4X99A 3UTSE 5HHMB 5EU3B 1J0IA 3VGFA 1UH2A 4O9HH 3NIGF 1ZLUH 1N7MH 1MI5D 3FOMA 3FRUA 4ETYA 2CLRB 1GZQA 5C09D 4F7EB 2VDQH 4WY7H 1AFVL 4X98A 3F7YA 1UCTA 1TJIH 4WW2A 4FQCL 1HH9B 4J3UA 1ZHKA 1W8OA 3LKNB 2R4SL 3AY4A 3RGHA 1QKZH 4NN7B 3EKCA 4NNPL 1RUQH 1NFDE 3EFDL 2ATKB 5FK9B 5JLZA 3IXAB 3R1GH 1ZHKB 3VD5A 3PWPE 1S5IH 1ZGLB 5BZDA 3FQXA 4WW2B 43C9B 4TNVK 2Z8WC 5C7XL 1DANU 1JN6B 2DQJL 4GH7B 5J9PA 3KXFD 1I3RB 1UJTA 5CP3H 4RA3A 5KS9E 3IT8D 4FTVB 1KLUA 4XMLH 4EBQL 2DD8L 4POZC 3HPJB 1A4JB 5E24E 1CGVA 4CVZA 3GMOA 2IPUK 3PNWB 4GRLA 4LSDA 3MV9E 3PWVB 3V7MA 1PW3A 2VL5B 3WFEL 4M4RA 3O0RL 5DJ6A 2IH1B 4UNTA 1JWSB 5EFIB 5JHDD 4GRWB 5FYLL 2Q86A 4LCCA 1NUNB 3M1BA 3AMLA 2H6PA 2FGWL 4WWKD 1B3JA 3KR3L 1DANT 4ODTL 1T3FA 3DSFH 4RNRA 2IF7A 2RB8A 3HKFA 2DKMA 5DS8A 5DD0H 1RZKC 3N1MC 2P24B 1UXWA 2GSIB 2J88L 1V3JA 2FZ3B 1A5FL 4XBPB 1HCVA 4CADB 5FCSH 1UB6A 4B50A 1YMME 4KC3B 3LEVH 4KK8D 1TVDA 3SE9H 4JHZA 1UJ3A 3SJVE 4ZUTB 1K2DB 2HRLA 3G6JB 4QOKD 3BN9D 1VFMA 3R0MA 3MLSH 4PRIA 1RIUH 3MV7B 5LWYH 1KTKE 5JDJA 1I1AB 1A6TA 3IB4A 4C57C 5F89A 4JRYA 5C2BH 3DPBA 4PB9H 2C1PB 5DJ0B 3STBA 2IH3B 2QQKH 2JJWA 2R69H 1YECL 2EYSB 1F58L 5K9KB 2AGJH 4LCUA 3TJEH 2QKIB 2VN7A 1G9NL 4GUPA 4D0CA 3A67L 5EU6D 2GFBB 1GAFH 3QIWC 4RAUB 3SGKC 3VGAC 3DETD 5KAQF 1UCBL 5GIRA 1CS6A 1WLHA 2YPKA 2ZWLT 2Y1VA 4JANA 1DQMH 12E8H 4O2CB 4K9EH 2CJUH 4YFEA 3OXRB 1Y0LA 4P4RB 1DUZB 4C56D 1FFRA 1QBAA 4U49A 3WD5H 3S37L 4TUJB 1IAIL 2J8HA 5SWZD 3SPVA 4G8GA 4UT9H 3VWJC 1QSFE 2A6IA 2BC4A 4MA1B 1FV1A 3BKCL 4G6JL 1IC4L 3KYOB 4J4PA 4KFZC 1F97A 5TF1H 5FB8B 3MLZH 3RUGF 2NY2C 5DQDH 4QNPE 5IF0A 4N1CA 4WEBL 1ZLSH 1QP1A 3QA3B 3TLRA 1INDH 2V9QA 2OMBA 3WUZA 4OZFA 4AT6A 2NX5D 4JFYA 4QRRD 4YHOL 4AMKH 3CVHB 4M48H 1NDMB 5EU6B 1FAIL 4UBDC 3ZT6A 3R1GL 1HXMA 2HFGL 3D39B 2VLRD 1YEFH 4OCNC 2R15A 2DM4A 5DD1H 2W0PA 3KWWB 3LIZL 5EUKA 3B3IB 3WE6A 4OF6A 2IADB 2YUWA 4YDVA 3U46A 5DGQA 3DETC 3WFBH 1QFWI 4R4FH 1Q94B 3CC5A 4DGVL 3SKOB 1RJYA 3BP6A 2XT1B 4JQXC 2VSDA 1ZANH 4L4TD 2AQ1A 1IAII 2QADC 4OLYL 1CE1H 2BVYA 1CT8A 1RV6X 1O7VA 1QSFA 3QUXA 3BEWB 1NUDA 3PWPB 3DV6A 4JRYE 1C7TA 3QZWA 2BSSA 4Y1AD 1MCKA 4UILL 4DOHE 4Y4KC 1G7QB 4HJ0C 2HWZL 2CD0A 2FBJH 2JJUA 2VXUH 5JQ6H 3ZDZE 5AZEH 4KV5F 5F7HA 2YA2A 4Q0XH 3F12B 1IEAA 1ZAGA 1FZJA 1OD7A 1BJ8A 1QBBA 2VLRB 3H42L 2DQIL 4DGYH 3GSNL 3PGCA 3ZTJH 4TSCL 2EDDA 1CT8B 4X4YB 1MFAH 1P7HL 1AIFB 5EOQH 5JW3H 3NVQA 3CFIC 3MUGA 3LKQA 4J3VA 5CEYA 2BSTB 3DX6B 3QG7L 4XH2A 4DZ8B 4G42B 5DT1H 1T2QL 3RPIA 3MLSL 2J6EA 2EICA 2A9ML 4GRWH 1KPUA 4WHYH 4YDVB 1FFOB 3JV6A 4I77H 2IADA 4PJ9C 2FGWH 1DQQB 2JCCE 3J8F7 3NFNB 4M6AA 4EOWH 1S5HA 1HDMB 1BHGA 3CH1B 3DTXA 1F6LL 2GTZB 4LLUA 3GMNA 3O3UN 1HHGA 2LTQB 5DUPH 4GKSA 4A6YA 3K4ZA 3QI9D 1LGVA 3S34L 4RFOH 2HKFL 4JGMA 1SVZA 4NC1C 1KYOK 5EU6A 5GSVA 1QRNA 2P43B 2FB4H 1ZLVK 3ULVD 1T89A 3SOBH 1F11B 4OF7A 2NXZC 1MCFA 1NBYB 3U30B 3FCTA 5IF0B 3MRJB 4YIQB 3G6DH 3OKKA 1EHXA 1T2XA 5JHLL 5F7LB 3HFML 3O81A 3O2DH 5KSBB 4ZAKD 5EO0B 3UYRL 2VXTL 2OSLB 5MHSD 3KAAA 4NOBA 1RURH 3OZ9L 3T4AA 1XAUA 4OGYH 4YH6A 1NGPL 1P9MA 1CFVH 3TVMB 1K6QL 3L3DB 1UT9A 3SO3B 1QPPA 1VFBA 4NQVB 5D7IB 3UROR 3DI3B 3GIVA 3VXMD 3LPWA 1UYWL 1KXQE 4JE4B 1R3LB 1G1CA 3X12B 5MHSE 3RI5K 4PTTB 3BKCH 4G6JH 3VWKB 2JCCF 4N90E 2CUMA 3MGOB 1DE4A 2NY1B 3MRHB 2X4UA 3KPSB 1IT9L 4NT6A 4P23A 5CWSB 4RAUA 1G9ML 1QBLH 3H9ZA 3QDJD 2PXYA 2UWEA 4I8DA 1R24B 2J4WL 3S4SB 1PZ5A 1IM3A 4XC1H 3DGCR 3RGVA 1YMHB 1S7QB 3SCMC 4LLQA 4EUPG 3QQ3A 2R8SH 1ZWIA 1E0OB 1KXTB 4EUPA 3GK8L 1FORH 1QOKA 4FS0A 2C1PA 1WFUA 2I26N 4X6EA 5D2LF 3RTQC 3T1WA 2VUOA 3OKDB 3O8XD 2W38A 1NLBL 4E42A 4EI5A 4R4FL 4UNVA 3HN3A 4MDJB 4OLZH 3QPQC 4J6RH 4NKDA 3VRJA 6CGTA 1EO7A 4YHLL 4AEHL 1K2DA 4JPKL 1GH7A 1UJ3B 4C4KO 1U8QB 3B2VH 3LEXB 2O5YH 5GS1A 1WWAX 4HUWB 3ULVE 1KTDB 1FYTE 2XNAA 2E3VA 3RVTD 3T4YA 4I13B 2VTFA 3H9SA 2MCG1 5EIIB 2GI7A 5ID0A 1YECH 1PSKL 1UZ8B 3F7RA 4X8JB 5SWZE 4NQSA 5GRWA 3WSQL 4F7TB 2DTMH 2PCPA 1OB1B 4JY6A 2WUCH 4OLWL 1II4E 4WDIB 4WUUA 1UA6L 4QTHA 1OVZA 2WBKA 5B4MC 2EE9A 2Z8VC 3TBSA 1E4WH 4N0YL 1JNHA 3O9WC 4BA8A 4JCMA 2EH8L 3BJ91 4X6CF 1XT5A 5AUMA 4WUUE 4U1NB 3GMOB 4WFHE 4PJ7E 4FA8A 4PB9L 5DYOA 3LMJL 2QQNL 3SDCD 3C5ZC 4YK4B 3HC3H 4J3TA 3SGJC 1M7IA 2X4SA 3HLAB 3QIUD 1IC7H 4NSKB 5CSGA 3B9DA 1U8HB 1F02I 1N6VA 3NPSB 2GTWA 5E2UH 4GXVH 4HJJH 4TVPL 5JA8B 1MCQA 1Z5LB 3CX2A 5IIEB 3MXVL 2YPLB 4APQA 2CJUL 4H20L 1TLKA 4NCC2 1MPAL 1QR4A 1LHZA 5CBAB 3BW9B 3GJFK 2IFFL 4OLXH 4J8RA 4KK6C 2ADGB 2FYYB 5SWSB 2R2EB 4F33A 4G5ZH 4URTB 4WU5A 2YHGA 4P99A 2Y25A 1WFTA 4OLUL 5DD6A 5D8JL 1VKXA 5KN5B 3FQTB 2DWDA 1A7NH 1KFAH 3KPRE 2I07B 4P9ML 1S7WA 2O61B 3QXWA 4OLVH 3WFZA 3D3VD 4OIBA 1BOGB 4R90L 1A6WL 1GGCL 2CR6A 4FFYL 4HK3N 1U91A 4HIXH 1N5YL 3EOTL 3H0TA 3LKRA 5D93B 2UZIL 3O6FC 4NJ9H 5CJXA 2AKRA 3OF6D 5I1AB 3HAEB 1HXYA 3BX7C 5ACZA 5F1KC 3KJ6L 3VRLF 1FNHA 2X6MA 4ZO6A 5E5UB 4YAQA 1NAMB 1LO5B 4HPOH 3Q6GL 1CGXA 2UY7A 3FQNA 1MWAH 4M7LT 2QV2A 5KSBE 1JRHH 3L3GA 4K94H 3T3PF 5GGRB 1CDBA 1EJOL 3MCLL 4NNYA 4TQEL 4JPVL 4N5UA 3T0XA 4MB5A 1IL1B 4JDZA 1EIBA 4UNUA 1BQHG 4U1LB 2JJSA 32C2A 2FSEB 3GBNH 4JQVC 3VFNB 1DBMH 4N9OB 4P5TB 1FJ1A 1TJGH 2WLYA 5T5FL 1M05A 3OL2A 3L5JA 3ZT7A 5GJTH 5IJKA 4L4VD 1LO0L 4AEIH 2APTA 2NZ9D 2OZ4H 5LKNA 2X4QB 5DMGD 4CUCA 3O11B 3CFDA 3IGAA 3UO1L 3D18B 4P46D 3BO8A 4P23D 5FDWA 4LVOB 5GGSB 3BDBA 5DMGC 5DUBA 5DWUL 1ZA6A 1ZANL 3ESUF 2DLGA 2AI0H 3VFGH 4I18A 1E4XI 4WW2C 4AG4H 3LRHA 4FMKA 1CDJA 3VFOA 1J88A 2VKWA 4Q0XL 1JE6A 1XGTA 1QRNE 5J4MA 4G8EA 3MXWL 3OKEB 4DQOH 1HIMH 2X4TB 1TVHB 2CKBA 2E6QA 1SM3H 4ODHL 5KVFL 1G9MC 3B5TA 4WFFD 3ARBA 1G6RB 1R3JA 3FN9A 4Y4FD 4UT6H 4LLVB 5L0QC 3DJ9A 4OKVB 4HUXA 4U6XB 3WXWL 4WUKH 3VXNB 5TE6H 1I4FB 1MFDL 2WWMD 4MLIA 1OGTB 1YY9C 1NDGB 3W2DL 2ZG2A 1MY7A 4PB0H 2VJXA 4EI5C 1OP3H 1KB5H 1KG0B 1E4KC 3HB3C 4U1KA 4ZPTB 2O26U 1FNAA 3FHQA 2W9DL 3ARXA 1E6JH 3U83A 1CFSA 1H3UA 1OAKL 3V4VL 5IB4B 5FYKL 1OCWH 2BSRB 1AI1L 3UYPA 2VQUA 5E6IC 2PUQT 2AV7B 3H9HA 1JWMA 3PHQA 4NCDA 4JPKH 5FYLE 4NC2B 2OYPA 2FL5B 2NY1C 4HD9A 5KS9A 4Y2DB 1Q1JH 3CIQA 4LCIL 5DUML 5F1NB 5D7LD 5HXMA 1I7ZB 2VKXA 4ZOCA 4X6FA 4J7RA 1DLHA 1QBML 4TSAL 3DUSB 5ADPH 1MIML 5HHNA 3GSOA 5JPNA 4NN6C 4IRJB 1WC7A 1GGIH 1NGQH 3E0GA 2UZXB 3L3KA 1XF4A 2PTTB 3MRQA 2P44B 4Y4FB 3WS3A 2JB5H 3GDBA 4KXZH 4L4VE 1P4IH 2W65A 1LP9B 1CLZH 3IJYB 4YDLC 1A1OB 2HT3C 2K1MA 2QQLH 1IBGL 4X9HA 1P84J 5EUOB 3WNPA 5E00B 3TGXA 3GGWA 4XRCA 1PX3A 5MEQA 2D7TH 4XNXL 3RWHA 4OIAA 1JHTA 1OLZA 4KZDH 4QF1A 5FKAB 3H3PL 5GS0D 4Y2DD 3MACL 1AH1A 3MRLA 4BZYA 3MYZA 4OD3L 4D3CL 3K46A 4LPVA 3NTCL 2J4WH 4MJ6B 4QXTA 1R5WA 4ZQKA 2EDHA 3FOLA 1A7PH 1N7ML 2D7OA 5JW4Q 4JPWL 2X4OB 4MNQD 1KJ2L 4LVHC 2BOCB 4GJTB 4L8BB 2M2DA 3QCVH 1JFQH 4LLYB 1UXSB 5TH2B 3K8MA 3P30L 4YDJB 4N9GA 2F74B 4YPGB 3LKPB 2F19H 4JM2D 1XF5B 1EUTA 1NBQA 1VB9A 3BZ4A 5CEZH 4MNQE 2ESVD 4CDGC 4NN5C 1A0QL 4L29A 2WQRA 5DGRA 1KGCD 4F57L 1TJGL 4UB0L 1Z3GH 4K8RL 4K7PL 3ZYZA 1CXLA 1MLBB 2A6JB 3C5ZA 5A1AA 4Y4KB 3P73A 1AY1H 4ZNEE 1L7TH 2V2XA 4MAYB 3WXVL 2P8MA 1WUNT 3Q6GH 4P3DB 5C0DA 3U79A 3VH8B 4EI6B 2DD8H 3HI1A 3MNZA 2XA8L 3TWCH 1RJLB 2X4RB 5KSAA 1AC0A 4H0GA 3VXQA 1G0DA 1NEZA 4M93C 4JKPH 1MSPA 1HHJA 4GG8A 4K3DH 4JEGB 3MUJA 1DBML 1VADA 1ZT7A 5F1OB 3MGTB 5FO7B 2COQA 4AYFA 1SM3L 4ODHH 3MRNA 3VXTB 1ZT1B 5F72S 4FZ8H 5HBBA 4HXAH 3ROOA 2HG5B 1AE6H 5B38B 2Y07L 1DZBA 4BH7B 1CD8A 4X6DB 4ZUVA 1FIGH 5CZVL 3IJHB 3SKJL 1HQ4A 3UCRA 3CLEH 4XVUC 4TUKL 5F7KC 1VGEH 1MJ8L 1LK2A 2VE6A 1I1YA 1YDPB 1A7RH 4WV1C 1YEIL 2N7BA 4QXGH 1TIUA 1QEWB 3JWOC 4XXCA 3OHXB 1B0GA 1INQB 3VXUD 3R4DA 1JGUH 1TJHH 3QDME 4G6AC 1MLCA 3OKLA 1MLBA 2A6JA 4DJMA 5CUSH 1HSAB 3QEQA 4U6VH 2ED8A 1FYTD 3B9KB 3OXSB 3PQYA 2DB8A 3VFMA 4GXVL 1TTFA 4NO0A 3HNVH 4IM8A 4JHWL 5FGSA 1J5OH 2WAHA 1HYSD 4ODXA 1MJJA 2R0LH 3BVNB 1LO3H 2OZ4A 3H7BB 1XF5A 4DEPB 1A9EB 3S3JA 1FCGA 4PTUB 4HIXL 1KPRA 5IQ9A 3GJFB 4PGZA 1AFVH 5ESVA 5FO8B 5I30H 4PRHE 1JHLH 4U2ZA 5T1LD 3MCLH 5GS2D 3PDOB 2W60B 4NM4H 4FQXA 3DWTA 3TNMA 4GG6B 2AXHA 2Q8AH 3EYSL 1JP5A 3MA9H 4NC1E 5DUMH 3MRLB 4LGPB 4D8PA 2AJSL 4ZFGH 5MENA 4JY5L 4JHBA 3U7WL 5F44A 2OJZH 4XRCB 4AL8L 4J1UB 3IS0X 4H0IA 3WJLC 1NMCB 3HC0A 3QJFB 1KTLB 3AM8A 5TDOB 2UV3A 3DNKA 2ZPKH 1S9YB 1NGXB 4F9PA 1JJUA 1NFDB 1M71B 5DJ8B 4XXDB 4I2XA 1RJZB 4OLEA 3HHRB 4U7MA 1JV5B 1A7PL 1F5WA 2VLJB 5K59F 1AXSA 4UDUA 1BGXH 3T77A 1MVFA 4MMXC 4WU7A 4F15B 1NMCC 5F3BA 1QSEE 4JFPA 1Q9KB 4U1GB 1INDL 4LIQL 1DFBH 1BREA 5IGXL 4PRPD 4HS3B 3EO9L 4BKLB 1J7VR 5H35B 1I7ZA 3S8WA 1QSED 3ZKMD 2AJ3A 1WIOA 1KENH 3U82B 1R3HB 4I18C 4Z5RB 3WIFA 3RDTC 1J8HD 3NCJH 2FL5A 4M1DH 3KLAA 1GL4B 4P46A 3M45A 1JWMB 3PHQB 2Z8SA 4JLRB 2Q7YB 1UADC 3WXWH 4DKEH 1DCLA 1EO8H 2HKHH 3BKYL 1JI2A 1N2RB 2J5LB 1F3JA 4JVPA 3IFPA 4C56B 1EFXB 3N0PB 1T04B 1ZT7B 1FHGA 1WBXB 4MAUL 3HG1A 2LV4A 2O5ZL 3RHWF 3TJEL 2VXSH 1ERNA 1SY6H 4MXWH 2VXQL 1QQDB 4V1DD 3NFSL 2ITCA 5AEAA 5KSAB 3FT3B 1QYGH 4LOUD 1H8OA 2EIBA 1XIWD 4MXVF 2I9TA 5E4EB 1AO7B 5CJ5A 1G6RA 2F5BL 2GT9A 5C0DB 3TBVA 4HCRL 3EOAA 3S35X 2V2XB 1YMMB 4U3CA 4NKMA 5JO5A 4P57A 4G8EB 5J13C 2C3VA 1JPST 3KLHD 3TN0C 1I7UB 3SKJH 4K3GA 5E56A 1IEBA 1OL0A 2CPCA 5EIQA 1B6DA 2Q7NA 3ISWA 5DRWB 2ATPA 3I6GA 1KUMA 3VG9B 1VENA 2HJFA 4TOYH 4WO4A 4WUUD 3TH2T 1HHKA 1SYVB 2JF1A 5C8JA 3U7AA 1G7JB 1JGVH 1K5NB 3O3BB 4K7PY 4UT9L 4FFZH 5INCB 1W72A 4LSQL 5FYJU 2VAAB 1G9NC 4DW2L 5GHWL 3ARZA 3H9SD 5FYJH 5EC2A 1UB5A 2BP3A 3HI5L 1UVQB 4JN2B 1DBAH 1KNOA 1BQUA 1ZLVH 2P8PB 2Z92A 3DRTB 1F42A 3KGRA 5D70L 1NCTA 1EAPA 4L4TB 1KB5A 1UACH 2CLZA 4POYA 3DBXB 1QFPA 1FVDB 15C8H 1P6AB 3RU8H 3GHEH 5C6TH 1NJ9B 2NW3B 3N1GC 4CMHB 1H15A 4JDVB 4K55A 1BZQK 6FABH 1WISA 4Y5YA 4TVPD 2DL2A 2N56A 3BAEL 3QYCA 5AZ2H 3B2UC 3FL7A 3L3JA 4OD3H 4GRLC 1U8PB 4AIXA 3Q5TA 4UIMB 5D1XC 5EPMB 3QUKB 3GMLB 3ZDYE 5F3HA 1LK3L 3BN9C 2YRZA 1NJ9A 4ZOEA 3EYFB 2FGZA 5M95B 3X3FL 1EEZA 1U93B 2AV1B 4GW4A 3I02A 4JRWA 1T5XA 2IMMA 4KRPC 3HRZA 4JY5H 3L3HA 2NZIA 3DXAB 3LQAL 3QDAA 2LVEA 1G1YA 3MLRL 3C8KB 2FR4A 3IU4H 4OFYA 2ZOKB 2PW1A 2PXYD 1WAAE 3HPLB 2QR0A 4JR9L 2JB6A 2DWDB 1A1NA 3EYQD 3UTSD 1SYVA 3KG5A 3STZB 4WU5B 1HHKB 1TNNA 3JV4B 4HFUL 4S0SD 5DRWA 3JVGC 3GSOB 1HN1A 5I1DB 4LCWD 2WSKA 3VFUA 3WNKA 3NAAL 4NP4H 1CGWA 3U0PA 4X6FB 4KUZH 1I7UA 4OUUB 4XPAH 4JKPL 4R2GD 2IPUG 1P5VA 4P46C 4QXWA 3NIFE 3SE9L 1VGKA 2EECA 4XPBL 4HIEA 1TCRB 1MHHA 1G7LB 3DVGB 3RKDC 3QDMA 4Q2ZA 4XPHL 2GK0B 4G6ML 4S1SH 3PV6A 3OKYA 1FFNB 5C1MB 3TYGH 1NEUA 4ZS6D 5KSAC 1A14L 5GJSH 2HJLB 5EA0H 4W6WB 2KPNA 1V7NH 4XVJH 4MQ7B 2YXMA 5BS0D 1T04A 3DXAD 1OARL 4XWOC 1MREL 1EFXA 4TRPH 2RAMA 2HH0H 2Y5TA 1OW0C 5T1MA 5MP6L 4FFWD 4HX1A 5FYKE 1YYML 5F9AC 2D9CA 4PRAA 2VLLB 1XF2B 3HE7A 4QHUA 2A83B 3FB8B 4KKBD 1ONQB 1DBKL 1S8DA 2JIXD 3LCYA 4PP1C 1W8NA 4FZ8L 3RDTB 4S2SA 1ED3A 2EC9T 4G6KL 4RWYH 1MFEH 3LHPL 4UAOB 2YWZA 3V6ZB 3D2UD 2NY1D 5AWNL 4JFPB 2H8PA 1RSFA 3NCJL 4M1DL 4QWWC 5F71A 1MJ8H 1KYOJ 2ZOKA 3WIHL 2GY5A 1N26A 4LHUG 4UDUB 2WUCL 4OLWH 4NNXA 1F2XK 1G0XA 3O3DA 2XTJD 4JZNA 1RURL 5HYJB 3LB6C 4JJ5B 2JJTC 5F1IB 4XXDA 5BCAA 4J3WA 1WT5A 1KELH 4MCZB 1AXTL 2GCYA 1RZ8A 2GAZB 1BLNB 3QEQD 3S34H 2AJVH 4U2YA 3I85A 2D0GA 1KTLA 1FLRL 2VLKB 5FA4B 3EYFA 4PJ7F 2HVKB 1FL3A 3UYOD 5L0QB 2Y36L 3GI8L 3I6LE 3OGOE 2KQNA 3JTSB 4UIMA 3EJZC 3HI5H 4LSSL 1JL8A 2VLME 3FQNB 4PG9B 2UWEB 4XCFH 3X3GH 3ARGC 4G7VH 2OS7A 3PUCA 3QQ9C 4EXPX 4PJFB 3K4DA 5E2WL 3QNXA 3RDTD 4GG6A 3I6LD 4XPTH 3PDOA 2VL4A 1MPAH 4J12A 3D2UB 4ZFOB 3ZKQD 5DVLA 3LKRB 4UTBL 1PEWA 5J8OA 3P77B 4F7CB 3BPLB 1YPZE 5LGHL 3PL6C 1SHMA 4DWHA 1A9EA 2XXMB 4OCSL 2F8VA 1Q9LB 5EO9B 1MJJB 5D7SH 1U8JA 4I5BB 1PLGH 4OLVL 2QQQA 5DC9B 1VKXB 1SEBB 5J6GA 5J13B 1X7QB 2IGFL 4Z7VF 2C9AA 3QEHB 3VD3A 4OCWL 5CHNB 1H3PH 4HWBA 4PRNA 5BV7C 1OTTC 5MI0C 5LG1A 2F5AL 1YMMA 4Z95L 4O2EA 4NM8H 1YEKL 4NSKA 5IVOA 5CIPB 1URLA 3GK8H 2PO6B 3VFVB 1EDQA 5DYOB 2ITCB 5CD3A 4JRXD 4KTYA 1KLFA 4I4WA 1JHKH 3DTXB 1LDPH 2GK2A 4IRZH 3B43A 1VPOH 4PJIF 5EULV 2YR3A 4M7ZB 3VCLB 5DVNA 2V5TA 2UYLA 2WK2A 5E99H 4C56A 2IPTL 1YN7B 1BBJB 2P49B 4MD0B 5DJAB 4KRPB 3FO1B 1ITBB 3QPXL 4WDIA 5D7KE 4ODTH 4YEFA 3KPPB 2CXGA 3SBWA 4XCCL 4KUCD 2E7LA 2VMFA 1XGUB 4PJXA 3WIFB 2ZSWB 4NRYA 3D3VB 5IWLA 5DXWA 1T80A 1Y18A 4PV8B 2ERJB 4BSWA 2FWOA 3BH9A 1R3KB 2MPAL 4JY4B 2VLRA 2DIJA 2YXFA 3GMQB 3LEVL 1IVLA 4M3JA 3LVEA 1ZS8A 3O6FA 5CJXC 3E6FB 3V5KB 4KTDH 1E27B 2A6DA 3JV5A 2BDNH 4NQUA 4YXKL 4LASH 5B21A 1CFQA 2NX5A 3MXWH 1U8QA 1T4KB 1NCBH 2VAJA 3MYJB 4GBXA 5I8KL 4KXZI 3ZKSD 4AEEA 5CP7A 1BD2B 4F58H 4MDJA 2OR9L 4HIJA 2E7MA 3BKJL 3CPLB 2EXYD 3OKNA 4H8WH 1JGVL 2X70A 4Y1AE 2DBLH 1ODAA 5E8DH 1EEYB 4BFGA 2RR3A 1TCMA 4X6EB 5JMRA 5J6HA 3QP3A 1N6QH 4YDJA 1FVEB 4LKCB 4F8QA 2ZNWA 1OM3H 5IESL 4DTGL 1WAAA 3ARPA 2BMKB 4J1UA 3ULVC 4KMQA 4ORZC 2VZUA 4OQTH 3IXTB 2IAMD 4XAWH 1UACL 5BVJB 3BWAA 3CAFA 1N64H 2VSCA 3HTLX 4HW6A 4KGLA 4QKXB 2WUBH 1P7QB 4OZHA 4P23B 3TT3H 3EAKA 1S9XB 3MBXH 1L0XA 3EDKA 4FQXB 3S36H 1MJ7H 3VXPB 5ECJE 3BPLC 3UC0H 4AT6B 3B9KC 5IR1B 1MQKL 1VFBB 4PLKC 5K9QG 1JZ4A 3HZMB 3P4NA 1KC5H 4BFEA 3A0OA 5GJTL 1KN2H 4PUBH 5IJVA 3CFKB 5HI5C 3IDNB 4RBPH 1UC6A 3SDCB 3THML 4JO2L 5IG7A 5GGQH 5TJWK 5I15H 5GZOC 4M6OH 3PJSB 4HMCA 3V6FA 1JZ5A 2Z91A 4PJEF 3TFKD 1JPFB 4OCXL 3D0VA 1PLGL 3S7GA 2RJMA 2ENYA 1SBSH 1QA9B 2HRPL 3HI6L 2VQ1A 4OIIH 1I1YB 1YDPA 3P2TA 4PJFE 4WW2F 3TA3D 1N8ZB 5FYLH 1V7NL 4GKSB 2R56H 3X13A 5CJQL 4FQ2L 4BJLA 4UT6L 1DQQA 1Q72L 5MEPB 1T1WA 4AQOA 2HG5A 1CFSB 1AKJB 3LPGA 4M5YH 1KG0A 1VADB 1MFBL 2B1HL 1S7TB 4LP5A 2AJUH 4PRPE 2W9DH 4PIRF 1VPOL 1PYWB 4G6KH 1BQHA 3SDDC 4F7MB 3D25A 3OJ2C 2HT3D 4HUXB 1TQCC 4ODSH 2X9XA 3EJZD 2FIRT 3MMEB 2YA1A 1FZJB 4MAYA 1DN0B 2DI8A 4RGOH 4ZUTA 3P73B 5MI0B 5JR1L 1VFOA 2BNRA 2I9LB 3MV9A 5SX5H 2V7HB 2F8XC 1Z0MA 1IGCL 3TZVC 3BN3B 3QCUL 4XCYB 2VDOH 1Y6NR 2IC2A 5DUBB 2GSIA 1RHHB 3OTTA 5TQ2L 4JFZH 4W4OC 1QSFB 3BZ4B 3SKMA 5DHYB 2JTDA 3GMRA 4ZDHB 3VG0L 2FX9L 5ICYB 1ZK9A 3QUMB 1HI6B 2CGRH 4MNQB 1UXSA 1SMOA 3AY4C 2G5RA 3BP6B 5D72L 2ZSVA 4U1IB 4WO4D 4BQ8A 5A2FA 1NLDH 4P4KD 4E5XB 2R2BA 2ZOLB 4P2RD 1OF2A 3B3IA 2DQJH 3E3QC 4LFHG 4EDWL 2XWBB 3PWJA 1GGBH 2XY2A 1UQSA 5E1AB 2BVUA 4FQ1L 5IMOB 3QFJB 4G7VL 5IOPA 3V0WL 4CW1A 1WZ1H 3FTGB 4W6YB 4FQJH 1QLEH 2R39A 2NY5H 2R0WH 2JB5L 3FFCE 4JN1L 2VDRL 1O7SA 1DP0A 1E4XH 1FNFA 4LASL 4Y4KD 1A02N 3VXOB 5ENWB 5EUOA 3TH3T 2OTWA 2L7JA 5C71A 1TZIA 4NHCL 2AK4A 3TIEA 2OX5A 4FQIH 1ZLUK 1ZGLA 4WEBH 2XFXB 5FHBH 5DK2B 5IW3A 2NY4C 4OBRA 2WMPA 4PR5A 2BNQA 4KRNA 3ULSA 3QH3B 5I6XB 3PABB 1FPTH 4Z7WE 1U3HA 3B4NA 1CLYH 4EXKA 4LP4A 4HLJA 2O5XH 4PJCB 4LRNH 3P9MA 4PJDF 2AEPL 2D7PA 2XWJB 4BK5A 1Q8MA 4XWGH 5DK2A 2YD1A 3VE0B 5D5MF 3KNBA 3MR9B 3W11D 3KPSE 4ODWA 1B4JL 4XXCC 2X44D 1P4BH 2EDQA 2HT4C 1MCEA 2MHAB 2KZWA 3MODL 4FOMA 4AIOA 5ENWA 3D9AH 4QT5A 2F5AH 1LEIB 3MV8E 1S78D 2PXYC 4F57H 4BSVB 3CFBB 4LPXA 4D0BA 2AABH 3TV3H 2DQHL 2KL6A 5DJYB 1G7HA 4EKXA 5AD0B 1FAKT 2H45A 1MWAA 4NO2A 5LQBL 4GUPB 5J11C 4YHYB 5E1AA 1I1FA 1I8IA 2A38A 3G6JF 2CRYA 2MQ3A 2CIIA 5FKPA 2XZQH 4PREA 4NQDA 1NDGA 3D6GA 2FHBA 2FJFB 3DVFA 4E5XA 1YQVH 4R8WL 2ZNXA 2DQDH 4J3OC 4JY6B 4EDXB 3RVWD 4PJGA 2HT2C 5HI3C 5E03A 5E4EC 3MV7A 1XFPA 4X8JA 1H0DB 1TVHA 3QDJA 3SKMB 4JFXB 3TZVA 4K94C 3BZDA 4ETQB 3RZCA 2BHZA 5E9DA 1KACB 4WI8A 2ZUQC 1KTDA 4JG0L 2JK5B 5DMKA 1YN6B 3IRPX 2P24A 4K3DL 5FDWB 2OMNA 3T0EE 2IMNA 4PJ8D 2VABB 5IT2H 3ZE2F 4JM2B 1QNZL 3SDYH 5IUSA 4HHAB 4MJ2A 5DK3A 4DKDC 1KEGH 4E42B 4TUOB 4ZOBA 3WFDH 3VXSD 2D7MA 4Z7QE 1U2HA 1DLFH 5JNYB 2R29H 2IH1A 32C2B 1OAZL 3BDXA 3MLUL 4NQXA 2F54A 4NQDB 1ZWIB 5LGKA 3PDDA 4NNYB 1RHFA 3GHBL 2HVJB 5DJXB 1I1FB 1I8IB 4G9FD 4UIKL 2CGRL 5L2KB 4KI5F 1KLUB 1OGAD 5MEPA 4FTVA 2KUTA 3VGDA 1NAMA 1KJ3H 1TETH 3A6CL 3O6KL 5L6YL 1IEHA 3QRGL 1W72L 1HHIA 3BRFA 1N8ZA 4YPJA 1DE4B 4JHWH 3NZHH 2DIAA 1ZGLP 3WMSA 1C5BL 3KNBB 4JB9L 4OZ4A 2HN7A 4M8QB 4EN3C 3RWIB 1BFVH 2VZOA 5HHXH 4P5MA 1UM5L 1P6FA 2NY5L 2R0WL 1WCQA 1FQ9C 4L8DA 3EFFA 5GZOD 4LSQH 3QUZA 4K3JH 3ARUA 1BJMA 3VGBA 2NXYC 2ZCLH 4NBYB 2A73A 4ELMF 3L5XL 3GUTB 2AK4B 5EU3A 1S7RA 1T22A 3FQUB 4OM1L 3LN4A 3U4EA 3PV7A 3OAZK 5EDXA 3MRPB 2LABA 1YNLL 1NGPH 1MWAL 3O8XC 4QXUH 5F6IB 4PLJD 3WLBB 4JPVH 3QFJA 1WT5C 1S9VA 1A8JH 3GMNB 1FG2A 4G80A 4NQED 1ZV5A 4OZIA 3I3BA 5AUMB 4RMQA 3Q3GB 5HHMD 3EW3B 5T5FH 5BO1H 1KPVB 1FZOA 5ETUB 5DQJA 3C8HA 5T1DL 3VWJB 4CAGA 3NABH 3QULA 3MOAL 2VISA 2EDFA 4WUUB 1CDGA 4G42A 3KPRA 4ZS7L 3QCTH 4EQ2A 2FCBA 3F7QA 4RCAA 4X7SL 5F9DC 1UZ6E 2NY6C 2I60L 3IF1A 4RDQG 4X9GA 5KVGL 1Q0XH 2AQ2A 3BIAX 3BUYA 5J1TC 4EVNB 2R8SL 5EBWB 5DWUH 4ODSL 4HSQA 3UPAA 4QRQA 2O5XL 3H9SB 5IHUH 4ZFFB 1YEHL 3JWOH 3PGCB 3T4YB 3SJVD 3FRPG 1C7SA 3STLB 4RSVA 2EDXA 2FO4B 4IIQB 5CP7B 5LGJB 5I1CL 3LN9A 4M9PA 1AD0B 3F12A 4N5EC 4XPAL 1MVUB 4F7PA 5ALCL 3MV9B 1EEUA 4N0CD 5HYSB 3MLPA 4P59H 3LQAC 4P2QE 2AP2A 2EZ0D 3K2UL 1AD0A 3O6FB 4QHLB 5EIVA 2PYED 4GRWE 3WNOA 1FLTX 3STLA 4M6ML 5DA0B 4WW1A 1IILE 5F7DA 1I85C 4YE4H 2ADFH 2XZQL 1GYAA 3QIBA 1FZMB 4GMTL 4KHTH 3F58L 3QNZA 5DMIL 1Z9LA 5IVXF 1TZHA 3PF2A 3FB5A 4WJ5A 3SKOA 4MD0A 3WJJC 3VW3H 5ISZE 3RGVB 4HPYH 1KPVA 4N1EA 1T1WB 4PD4J 5FECB 1CICB 4JGUA 4ZXBC 3MLVL 4X6BB 4PJ9D 1CTOA 1X5LA 1ETZA 4YC2B 1NAMH 2DWEB 5JUEL 1D9KC 3SJVB 5CEZD 1A6UH 1MRDH 3O45B 3MRHA 1LO4L 2GQHA 4ZO8A 3W39B 4Q9CA 3VFVA 3KS0J 4YK4C 3MGOA 5E8NA 1CIUA 1H9VA 1JNJA 1I9RH 3UJTH 3GHEL 5C6TL 3UJJL 4LEXH 4RGNC 5DZNA 2VDPH 1F90L 1MIEH 1EFXD 4FFYH 1BFTA 5A2JH 3LS4H 3RNKA 5I76B 2A1WL 5CINL 2LFGA 5DHVB 5DRXB 3V6FB 1CLZL 5DC4B 3T4AB 3SDYL 4PGJA 3KYAA 3IKKA 4G6FB 3ES6B 3CX5J 3QUZB 1D5IL 2R4RL 2BVOA 3NA4A 1D5ZB 1T7XA 3PL6D 4RFEA 1QFWH 2O5YL 3WL9A 2ICWB 3P77A 3ARDA 5C08A 3WD5L 3S37H 1MHCA 3TT1H 4JM4L 4C83A 4O2CA 4PJ9B 1IGIL 1U8NA 5JOPD 2XZAL 4LCYA 1NMBH 4PRIE 5K9JH 3T0ED 4A6YB 3T65B 2YPKB 5I1EH 3QNXB 2RHEA 3OJVC 4Z7QF 1U3YA 4F37F 3NFNA 4B7IA 4QRTB 4K3EL 3WSQH 3VGAB 1YPZF 2XG5A 1UH3A 3LQZA 4PJBE 5FYKD 4WVRA 1CE1L 4YHOH 2HTLC 3DX6A 3OGCA 4LKCA 2EIEA 2HH0L 2IH3A 4OSUL 5C6WH 4FQPA 1CK0L 3MNVA 4YBQD 3GFUA 4JKLA 3TPKA 3BQUD 4G6FD 5F1IA 2IGFH 3TYGL 5BVPL 1J1PL 1ACYL 1EGJH 4KKLD 4CN1A 4DQOL 5FGBA 4KRLB 3CVHL 4HKJB 3OPZL 5HHOD 4NFCA 4G7YH 3RAJL 1RU9H 3C09C 4C59B 1BM3L 3I2CH 2EE2A 1CGSL 3SDAC 3WXVH 2R1WB 2I60H 2D3VA 1AD9A 3V6OC 2NX5B 3VI4E 4JHAH 3ECBB 5DMKB 1NBVL 5I1GL 1E27A 2A6DB 4KU1A 2JK5A 1ZVYA 2FZ3A 5E9DB 3ZSSA 2R29L 4OLXL 5HHQA 1BD2E 3BEWA 5KW9L 4OI7A 4HWBH 1Y18B 3QXDB 4QHNB 2EDRA 5GRJH 1QPXA 3D3VA 5D6DC 1KLGA 5GGVL 1R5IA 3H6JA 4KMTL 4YHKH 3MFFB 1L6ZA 2FIKA 3EYUL 1EH9A 1RJYB 1YZZA 5I1LB 3CDCA 3BPOC 2FJGA 3CZJA 5D96B 3VWJA 3CC5B 1Q94A 5DQJB 4UQ2B 4NRZA 3PL6A 5H94B 4LVOC 3RNQA 1UWEH 3OWEA 1KCVH 4G80B 1HQRA 2R9HD 2WBJC 3MOQA 3MQIA 1S9VB 2XICA 5TE7H 1QACA 3QIUA 4OGXH 1T66C 5EOQL 3ZE1E 5IMLA 2DDQL 5TDNB 4DVBB 3CVHA 1B90A 1QHPA 4O2EB 5TQ0H 4OZFG 2J12B 1CYGA 1FP5A 1GAFL 3ZO0A 3ZE0E 4LVNB 3W81A 4YR6A 3BYTA 3UBXI 5I8KH 1RULH 4ZO9A 4OCYL 1T2JA 1T7ZA 3QHFH 1G9EA 4AM0A 4LCIH 3IXAA 4KKNA 2F53B 3HAEG 3RBGA 3ZE2E 4WFFE 4H8WL 5E2WH 1FV1B 4QYOA 1SEBA 2BVQA 1NEZG 2CMRH 4JRXB 4PP2A 5J1SC 1R3IH 1EHLH 4IOIA 2H9GA 4UT7H 3N1PC 2B4CC 2XQBH 3I6KA 3EFFB 2YZ1A 3EFDH 3INUH 2BNQB 4N8PA 2YN3A 4JZJB 3RY6C 3FRUB 3U48A 3EYQC 4KRPD 5D2NC 3HS0B 4LDLB 1AGEA 3I02B 3SBWC 4PS4L 2P5ED 4PJEB 4XNQB 4L5FL 1HHIB 1DJSA 1NC4A 2DM3A 2YUVA 1B0WA 2OP4H 4PJFA 5KANI 3OZ9H 1MQ8A 1GOGA 4WTZG 3L3JB 3FT4B 4D9LL 1YEJL 1QLRB 2YRPA 2IANA 2XWBA 3PWJB 2VOTA 4Z7NF 5CS7A 3L9RB 5D1XD 1U8IB 2F54B 2WBWB 3TO2B 4TNVF 5C2UB 1QVOA 4NWUL 3W0WB 5LXGL 1YJDH 5JNYA 4JRYB 3PIQA 3UTQA 1FDLH 3ZL4H 1W0WB 5D2NB 4PJAF 4JPWH 4Z7OF 4ZUSA 1W72B 1YEKH 2D9QB 1F6AA 3B6SA 1RZFH 2FEDC 3P30H 4KJPC 4OD2A 4OB5L 1I9EA 4O2FB 3CDYA 3IDJB 5KG9A 1CU4H 4YBLB 1SMAA 3V4UH 4YFLF 1IGIH 4X7DC 3LQMA 4LHUB 4L9LB 4U4BA 4JFXA 1FYHB 1Z3GL 3I75A 5FUOH 4HXAL 2ITDA 1C5CH 5BQ7B 2NLJA 4PJIB 4XNMA 3EOAB 4I0PD 2H6PB 4XCCH 1J0HA 4XP9H 1AO7A 2RCSH 3S3SA 1IAMA 4GW5B 1KBGL 3IDIB 4PRAB 3CLFH 2Q86B 4Y19E 4GQ9L 2QHRH 3C8DA 3DSNA 1SVCP 5IVZA 3VGHA 1K3ZA 3X14B 5GGTH 2Z35B 3LMJH 3SDXF 2VC2L 1WBXA 1XIWC 2VDMH 5M94B 5SX5K 1F58H 3FMGL 1IARB 4MLSA 1A4JA 3FQRA 3FO9A 3ULVF 1AGDA 3D39D 5HD8C 5BVPH 2HA1A 4LEXL 4R0LC 4W4OA 1NH6A 4Q2ZB 3R0NA 1N6QL 3AVEA 1RZ7L 4D0BB 5CINH 3QI9A 4KJYB 4L8SA 3VA2C 1Z9MA 3KJ4B 3IKCA 4O02L 5JOFA 2IQ9L 3UJTL 2X2YA 2EDKA 3U0PB 1N3NA 1KIQB 4HS3A 1JTTA 4YBHA 5DD3L 4M93B 4U7SA 2C7UB 2NMSA 3P9MB 4NZRL 3JV4A 3C9NA 1K8DB 2BVPA 4Z7UF 1NFIA 4Q9RL 4R90H 2UVFA 2AJXL 1J1XH 1HH9A 5IG7B 3OJMB 3UMTA 3BT2H 4NZJA 1FG9C 3TBWB 4Z0BL 3PWNB 4KKAD 4GRMA 3OAUH 1CTNA 5I15L 2XFXA 4KROD 2DQUH 4DFIA 1M71A 4UQ3B 1S9YA 2OTWB 4GW4B 2L4OA 1YQ2A 5TDOA 2MQCA 2IBBA 1DVFB 3TVMC 4NO3B 4YX2L 3TP4A 3MRGB 4R3SB 3BEVA 1X4YA 2PTVA 4CW1B 5BRZD 1H8SA 3OQ3B 4NHUA 5IMOA 4UV4L 1BD2D 4F3FB 4Y5YB 4WWKB 2YMXL 1G7MA 1K8IA 4N68A 4ESKA 4JFDE 4M62L 1S7VA 4YNYA 3G5XB 3QUYA 3VXUE 2GJJA 3NH7L 3C60B 2CLZB 3TT1L 3P9LB 3MLWH 4JM4H 3BWAB 1ZEAH 4NUGL 5IFJB 1G9MH 5B3JF 1DDHA 3WCYA 4Q6IB 2HLAA 3DX8A 3QHZH 1N0XH 4RGNE 4MD5B 3AUVA 4ODUA 2V9RA 4EQ3A 4ZXBD 4MNQA 2HFFA 4LLAA 5BMFL 2IAMB 4QY8A 1QFUH 2FBOJ 4KK6D 1Q38A 3GRWL 3KYNA 3CUPA 1PKQA 1XCTA 4ODBD 1I1AD 2WV3A 3WHE0 1SJXA 2Y23A 4KUZL 5ICZA 3FN3A 3B9KA 4X9IA 5EU4B 3O4OB 3I2CL 5HHME 3RWFA 5IMKB 3HNTL 1OPGH 1P4BL 4F2MB 5IHZA 2VXUL 5JQ6L 2YSSB 3VFSA 4LSPH 3SCMA 2VH5L 5F1SA 2J7LA 2YEZA 3SHSA 5D2LA 1KIPA 3ZTJG 1BQLL 4FQQA 4G6MH 3H3KA 1BM3H 4RFNB 5FM8A 3WFEH 3BH9B 4HWBL 1JBJA 1TPXB 2EDJA 4IBLT 1CDCA 4M00A 4NCC1 5E8EB 4C55A 2BCKB 4RAVA 5DJDB 2DLIA 3GSXA 5I74B 4HFWA 4KHXH 3SDDD 3H2WA 1I9IH 2P5EA 1PKQE 2D7QA 3MRMA 3CVIL 4WFGE 5DDHA 1Q9WA 4AH2A 1NPUA 5C0CE 3RY6A 5HY9B 4RIRB 3QWOB 4ZXBB 4TSBH 1BBJA 5DJAA 4EN3B 3MRNB 3VXTA 3OG4B 1HIML 1CD9B 4BQ9A 3QI9C 5JXED 3S5LA 4N8CL 5DEZA 4GQ9H 2V17L 3U4AA 2VITB 5J3HC 3WHXB 4FQ1H 1WGOA 1KV3A 3VWKC 2YD2A 1RJLA 4NNPH 4MQXD 3JVGA 2HTKD 1QA9A 1R0AL 4PJHA 3RVTC 4JGJA 4NO5A 3L6FA 5EBMA 1S7SB 2QQNH 5LAXB 1EJ6A 4RISH 2XQBL 2FX8H 4P3WA 1FCCA 3VFTB 4LSTL 2YSSA 3A6BH 4U33A 3VFSB 1OOAA 2JJSC 3O4LD 5IMKA 3RWFB 4BZ1H 4LMQE 3GB7A 4YGVB 1FNGB 1IBGH 5ICZB 2EO9A 4FN0A 3LKOA 5FDYA 1AXSB 5JORB 1JWUB 3FAXA 3DVIA 4EEEA 5GGSY 3MLUH 5GXBB 3P4NB 4K94L 1D9KD 3I9GH 4LF3A 1HSBB 1J1XL 3CXDH 4LLYA 2ZUTA 5KSVB 4UIKH 5C0EB 4GT7A 5BW7C 1A64A 1X5ZA 5HGBA 1EPFA 2ZUQB 3VXPA 2GJ6A 1DL7H 1ZA3B 4W70A 2ZG3A 4X7EC 1J0YA 1CE6A 2OQJA 4LKXB 2F58H 1WF5A 4OZHB 2CRIA 3GMPB 3PP3K 5I17B 5ID1A 2V7NB 1QLFB 3GSRB 5CBEB 5LXGH 2Y06H 1WJ3A 2Q76A 4WWKA 3TNMB 3V6OE 3KJ6H 4WHTB 1ZA3A 3IXTA 1H3TA 4MCYB 5HGBB 4Y19D 2BMKA 3VA6A 3P0YH 2V5MA 4P4KB 1L7IL 2PETA 4HT1H 4B5EA 3W0WE 3O4LB 3TBYB 4BM7A 2YA0A 2WWKT 3K2MC 4PJ5E 4Z7WB 3EBAA 4BELD 2GCYB 3UJIL 1CU4L 3DUUA 3NAAH 4NP4L 2OI9C 4P2RB 3MRRB 2W0KA 1U92A 3IJYA 4JZNB 4NO0B 4HIJB 3LKOB 3KYKL 4H26B 3VXRD 2HLFC 2YK1L 1FO0B 4JFOA 2DQHH 3WDIA 2X1QA 1LO0H 1BIIB 1BVLA 2G9HA 1JPTL 4YO0B 2YD7A 4R96A 3MZGB 2EH7H 4KAQH 5ELIA 5JPNB 1JMXA 1O5DT 2QSCL 2WZPD 4GKOA 1QEWA 1ED3B 2CDEB 4XVJL 3U36A 3MCKB 1E6JL 1MCDA 2EDOA 3GSQA 5C0GA 5KS9B 1DQJB 4S1QL 3RVWC 4K23H 2ID5A 2W92A 4X6DA 3S5LB 5IROA 3U9UA 2N4IA 2HYMA 3P0GB 1R5VA 1T0NA 2OXHA 3ROOB 1JNLH 1FIGL 1AGDB 1ORSA 1TZGL 1J0KA 1ZT1A 4DN3L 2ADJA 4OQTA 2XPGB 5HY9A 1HINL 4R7DB 4AH2B 1IGTB 3TPUB 4S1SL 1OGTA 4JJHA 4Y0GA 2MKLC 3AXLA 3S35L 4Z7VE 4RAVB 2X4RA 4OKVA 3SDXE 2YS4A 2PO6A 3MNZB 3P3YA 3ARFC 3EUUA 5L6YH 5HYQB 4LSPL 3FMGH 2VIRB 3PXJA 1JUFA 4LU5H 1OSPH 3WNLA 3EIFA 1KIUA 4P3CL 4OUUA 2NXZB 3TESA 3OKMB 1YY8A 4MQXC 5FGRA 3V5HA 3VFUB 5CHNA 1G7PA 3NPZB 4MQSB 4LLWA 4YFLI 3MNWA 4FQIL 3G04B 1NFKA 5DUPL 3IDJA 5HVHB 2LU7A 4HS6A 4HZLA 4YHNA 4FQCH 4L29B 4LVEA 2B0SL 3BXNB 3FZUC 1PKQB 1XCTB 2VWEE 3FO2B 4LEOA 1FRGL 1CLOH 3HPLA 3MJGX 4N8VA 1Q9LA 1U42A 5JXEA 2D0HA 4OD1L 3LKPA 4X9FA 2Q6WA 4YBLC 5AYUH 4WGWB 3GRWA 5C07A 4UI2A 4XBEL 4P23C 4F7CA 2AEPH 4L3EA 3W0WA 4XP6L 3L7FA 2EYTA 3MV11 4JQIL 4MA8H 4U6VL 3RIAF 5EO1A 1R5WB 5FM4A 4L8CA 4FQLL 5JW5A 4WWID 1IC5L 4GAYB 3L3OB 3GMLA 3CDGB 5IEKB 1LD9A 3RUGE 5HDQL 4HH9A 3X11B 1BWWA 1XGRB 3GM8A 3TV3L 4G8IA 3QT2A 5CZXC 1NFDF 1K4CA 1NUGA 1H15B 4OM0L 3QDGB 3MRFB 5DTFA 2DJUA 5JW5B 1G0YR 5DFVD 4L8CB 1RK1A 2VDKH 3VJ6A 4G43B 2Z4QB 2VXTH 4AK1A 3UAJD 3PDGA 4LSTH 2IJ0C 3O6FD 4HKBB 4WO4C 4CU8A 3ELAT 3K8KA 2WP3T 3NTCH 4R7NA 4LDOB 1Y6KR 1IT9H 4JN2A 3N06B 3W9DA 3LB6D 1MHPH 3MZTA 2P5WE 3PWNA 3O3DB 1LP9A 4LARL 5L2KD 4LSVL 4RA0C 3OJDA 4JO1H 5CJOL 4HKXB 2I07A 2XI9A 3MCG1 5KN5A 2ERJC 1JIBA 1NFIB 2JE8A 4ZS7H 1ZGLM 2MKWA 1BFOB 1I1RA 5I0DA 1WIPA 4JZJC 5T1LB 2APXA 4HDIA 3NFPA 1CR9L 3V5HB 4S2SB 3TM6A 7FABH 2FBJL 3BP5A 1JUFB 2X1PA 3IFLL 4P57B 3SE3A 4PYHA 5D7JB 2RQ8A 1GOFA 5IFAL 4RZCA 3GSNA 1RUPL 4MZ3A 1ONQA 3KPNB 4QRPD 3NCMA 1HZHH 1X5HA 1H3XA 4K2UL 1NCCH 3B83A 1VGEL 3AXLB 4W4NA 1SEQH 5J0BA 1RUAL 2Y5TB 5T1MB 1I9JH 5ANMB 3BIKB 1QSZA 5GGTA 4P2OA 3HG1B 4W68A 3QFDB 4NRZB 1CCZA 2NY2B 1XR8B 4DVRH 1ORSB 5L9DL 1F3JB 4K23L 3OX8A 1FC1A 5CEZE 1JF1B 5E6IA 1QRND 2NY0B 4LLVA 2LAAA 3QUZD 1I3VA 4JO4H 4LDEB 2XKUA 3T3ME 3DGGA 1LE5A 4I77L 3O9WD 3KPMA 4FQXC 3WUWA 1BX2A 4Q74A 3GKZA 1HKLL 1KLGB 5D71L 3CU7A 4M6MH 4JQVA 2VQTA 4JDTL 3QCUH 4X6CE 3EJJX 3BH8B 2WIMA 2EDEA 3HUJF 2LU3A 5E6YA 3SGDH 3CLEL 1IC1A 5C0RH 1REIA 1ZA6B 1GGIL 4NN7C 4CJ1A 1PY4A 4MNGA 35C8L 4DTGH 5MERA 5I18L 3AM8C 1MNUH 4PJXF 4QRPB 3O9WA 4JRXE 4G8GE 4YHYC 5F7FA 3RVUD 2PYEE 4HKXA 5C0BE 4JAMA 4NC0B 2Z9TA 3D85B 4KI5D 1X5JA 4P2OC 1RJZA 1AO7E 5L8LB 5CLTA 5DJ8A 3UYRH 4LHQB 2ZUVA 3BYYA 3W82A 4HUVA 1NGXA 3OSKA 3TO2A 4U1LA 2P42B 5EORH 4XPFL 4PJEE 2Z4QA 3VJ6B 4M1GL 5IEHA 1U2CA 5FUCE 2H2SC 3BQUB 3JXAA 5T3ZE 3FFCD 2ZPKL 1S7QA 5DQ9A 3QXVA 1K4CB 4OGXL 1DUYB 4B7LA 4PLKD 4JN1H 2ZG1A 4PJDE 5DD5L 3RVVC 1XGRA 4ERSH 2IBGA 1QFWM 1KN2L 3CD4A 1LD9B 3S96A 3WLWD 5F8QC 2X4PA 2CDGA 4OKDA 3L3OA 5C0AE 2NW3A 4Z7WF 2R1XA 4LKXA 1MI5E 4F9LC 1SJHA 2ZP0T 1EAPB 4L4TA 2K9UA 3U2SA 2EYTB 3MA9L 1U8NB 5IROC 1BZ7A 3DRTA 4PGEB 4HG4K 4L3CB 2JLLA 3WEXA 5I1KH 5C0JA 3TZVD 4JR9H 4FRWA 5IB1B 1HSBA 3GIVB 2OJZL 2HFEA 4P9HC 3GO1L 2VDKL 4KMLB 4HUUA 5C7XH 3ZZ1A 5IW6B 3KLHC 5FA3B 3OXSA 3PQYB 1Z0NA 4DAGL 2PO6C 5T3XD 2P47B 1HSAA 2QSVA 2HMID 4PS4H 1U3ZA 1EMTH 3CFEB 4UTAL 3OKMA 3FCTB 4DKFH 5CJOH 3QJHB 4FQLH 4PGCA 5L88H 1T83C 4MA1C 3P0VL 4NKMB 5A3IC 3G9VA 3OPZH 3L6FB 4H8WC 5EBMB 2UZYB 5GISL 1PX4A 3CFCH 3WKNA 4MD4A 1LK2B 3NCEB 3QDMD 4DUWA 4X4MA 2I9TB 4C58B 1A14H 3O4OC 1K9TA 4JHAL 5I66B 2VITA 3WHXA 1F4XL 5C0BD 3RHWK 5CAYB 1CICA 3OAYK 5DHXB 1CQYA 3BPOB 3ALWA 5L8KB 1JF5A 3PL6B 3UO1H 1KPUB 4BSJA 2D03H 3OMZA 4FQ2H 5JPMA 3HZVA 4HEPG 3T2OA 5FHAL 3O6LH 2XZZA 3HC4L 1KCLA 5JA9A 1Q9WB 3FKUS 2Q7YA 3HE6A 4CRPA 3QIBB 1SEQL 2EIZB 1RUAH 3SE4A 3UTSB 2EKSA 2ZZUT 3RGVC 2BNQD 2X7LA 4GLRI 4WW1B 5DZOA 5LCVL 3MJ8A 2G60H 3MCKA 1S7UA 2VO5A 4M5ZH 1BOYA 3DHMA 2ICES 3EOTH 3F5WB 4R96B 5GS1B 1JGLH 4Y4KA 2GUOB 1AD9B 1MIEL 5T5NF 3QDHA 5F6HJ 2XRAL 1HWHB 3JWDH 1A3QA 2IG2L 2WLZA 3ARQA 3CFJB 3UTTA 1EGJA 3E2HB 1KELL 1HOCB 2R2HB 3HNVL 1EHLL 3PWPA 1ZSDB 1IGCH 2W9EL 5CGYC 1TJIL 3CUPB 1Q0YL 5ACLA 4P2RA 5GGVY 1Z9SA 2CDFA 2PF6A 5C9JA 1MIMH 5IBTL 5HDBF 4LIQE 1RJCA 3HC0B 3OGCB 2VDLL 3HAEH 4N0FB 4O9HL 4BYHA 1QSEB 3QZWG 3QULB 1J9CT 1NUFA 4I9WD 3KPOB 3S4SA 4MWFB 4X7TB 3ZYIA 4NKOB 5EUKB 4NZDA 3QIBC 4NQTA 4JFDB 5GZND 2CKNA 1K8IB 2AW2A 1CE6B 1OAYL 1YYLL 4UUJA 5MEQB 5ISZD 3BEVB 4YHZL 3QUXC 2JELH 3IDGA 1AR1D 5ESVB 5FO8A 2B4CL 1CD0A 5DHVH 4ZUWA 4NQVA 1HH6B 2XG4A 3NACH 4X5WB 2AJUL 1XIWB 4N0CC 1NCAL 3ULUD 3ZDZF 2WNGA 2BC4B 4N5ED 3G08A 4AEHH 3QEQB 4XPHH 3SPVB 1CFTA 3L5WB 3W9EB 3MRQB 1XGYL 2PTTA 1JTPA 1SQ2N 3M17B 4XPFH 1MAMH 1MFNA 1MI5B 1A3RL 1NKOA 4HKZA 1XGQA 1B2WH 3VRIB 2IANE 5F93C 1KB5L 5J11B 4BQ6A 1JHKL 4KQ4H 2HAZA 1OQOA 5FCUL 3BGMB 3QIWD 4JFEE 3UTZB 2MTPA 1H3VA 3H9HB 1FGNL 1C12B 4O51B 5B3JE 4ZUVB 1QO3B 1TDQA 2BSRA 1FSKB 2GSGA 2ENSA 3JV6B 4GFTB 4PP1D 4KDWA 1IQDB 2JJTA 5K9KA 3KXFB 3FB5B 1L0QA 5GRXG 2BSTA 1HHJB 3DSFL 4GG8B 5IWLC 2P5EB 4UILH 4GAGH 3WLWC