4ZG1A

Crystal structure of a nanobody raised against kdm5b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSTFGIRTMGWYRQAPGKQRDLVAIISSGGSTDYADSVKGRFTISRDNAKNTVYLQMDSLKPEDTAIYYCNARVGITMLAHWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NB17
publication title Structure and binding properties of a cameloid nanobody raised against KDM5B.
pubmed doi rcsb
source organism Lama glama
molecule tags Protein binding
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zg1A00
1DSFL 1P9MC 4NNPL 2DYPB 4ELMF 5SV3A 3ARQA 2HAZA 3QWOB 4JM2D 1DE4B 3KDMB 2P47B 3WEXA 2NX5B 4PJHF 5IFHL 1KJ2H 4WUUA 1NFIA 3DURA 5CWSA 4P2QD 3KPPB 4OF8A 1BZ7B 5A2KH 1F5WA 3BO8B 4GOSA 4QRUB 5EH1A 2ED7A 4DK6A 4Z77B 3RIFK 4ODXA 4ENEC 3BESR 4G8GB 4OUUA 3SE8L 1EH9A 3V6ZA 4YHOH 1JZ7A 1MFDH 1V3KA 2HG5B 3IDXH 4PJ5D 4P2RD 5FM5O 3WHE1 4XBEH 1KCLA 5TF1L 4PJIB 1U8QB 3V6OE 2QQLH 3WXVL 5BRZA 1YEKL 3S36H 1OB1B 4D2NA 3O0RL 2ZNXA 3DVGB 4BQ8A 2LAAA 3E6FA 4WEMB 4BZ2H 1WAAF 3W11D 5IVNA 4S1QH 4MSWA 1XT5A 4M5ZH 4HGMA 1R3IH 5BVPH 3FQNA 2X1OA 4GSDL 5ACZB 4GXVL 3CD4A 4GW5A 5CHNA 4WFEE 4RWYH 4WO4B 5DMGC 5ID0B 5ICYA 5LQBL 4Y4HA 4GLRI 1U3HA 4X9HA 3GDBA 4NYLB 1A6UH 3VRJA 1TZGL 5F3HB 4PB9L 4P3CH 1KPRA 5EU6D 1FZOB 3DX6A 3QNXA 3QIWB 3R0MA 1UM5L 3TWCH 3LSOB 3OPZH 4DFIA 1KT2B 3D6GA 1I7UA 1OARH 2ZCHH 1J87A 4LRIA 4OQTH 1ZGLB 1RPQA 2AW2A 2XKSA 4TPRH 1N8ZB 1JGUL 1EEUA 4MQ7B 3DROA 1RHHB 3CDYA 1BWMA 4DVRH 2VLJA 1Z2KA 3UO1H 5T3XL 1LK3H 4BH7B 4KFZC 4M1GL 3RWFB 2YRPA 4JFDE 4L4TE 3CFDB 3TN0A 5BO1H 1CBVH 1BOGA 5B38G 1FYHB 1ORSA 5KS9F 4FXLA 2DTSA 3GNMH 3K2UL 2C26A 4KC3B 3TBYA 4D0CB 5E2WH 3H6JA 1YEIH 2A9NH 1E6OL 3MACH 2F19H 4LRNH 1T6WA 1CTNA 4YEEA 3B9KC 2FJGB 4LIQE 5I0ZA 5JXEC 2X10A 5JPNB 1NUGA 4IRSC 1NCTA 4QTHB 5F71A 5IIEA 4MXQC 2GTWB 4P3WA 4LP4A 1N3NA 4S10A 3ARXA 3R1GH 3NTCH 1N64H 1QLRB 1A7BA 1CGSH 4WI3A 3KR3H 4URTB 1MAKA 4C59B 2XKNA 1R24B 3HNVH 4DKEH 4H20H 4EEEA 1F00I 5ESQB 1F6AA 3QRGL 3FT2A 1BQUA 4NQSB 4NRXB 5EC1A 3FB7B 4PD4K 4K8RH 1IM3B 4J8RB 3KPLB 1ZVYA 2AKRB 4ZTPL 1NC4B 5EU5A 4BFBD 1JPTL 1N6VA 4HFWA 4HJJL 1RK0A 3LRSA 5DMGD 3C08H 5MP6L 2IADA 5HHOD 2X9YA 3HMXA 5FUCC 4JPKL 3U7YH 4JY5L 3D39D 1S8DA 4YHIB 3STZB 5EIIB 3N50A 1NFDB 5DLMH 3QFJB 2BOBB 4I0KA 3KPRD 1WITA 2HLAB 5I1AB 4QWWD 3TNMA 1INEH 2PN5A 3QCTL 3O2DA 3KPSB 4I77H 1BVLB 4Y4HC 2Z31C 3DXAE 1U3HC 1I7ZA 1A9EB 2YD1A 4YQXH 5T5FL 4RQQA 3TIDB 3KYOA 4MDJA 3M8OL 2DN7A 4XPFH 2ESVE 1QFUL 1UACH 2YZ8A 3LEYL 3MRJB 3AUVA 5C0DA 3OHXB 1CCZA 2XIDA 3JBG7 3MXVH 5GHWL 4Y1AE 3D3VE 2UZYB 4UDTA 3ARFA 1ACYH 1IM9B 4LRIC 1T20A 5C0IA 4CDGC 1R3HA 2A1WH 4HJGB 4WY7L 4NKMA 4NJAH 1M05A 2JJTA 5SWQB 4MB4A 5JXED 4NKDA 2XG5A 4LF3B 1GOHA 3TN0C 1LO4L 2HN7B 3REWB 3UPRB 3BGMB 1D5MA 4DEPB 2P24A 4PJAA 3FOLA 5JORA 3WUWB 2YBRB 5SWSA 2IQAB 4KQ4H 3GSNL 2XNAA 1BLNA 4F80A 3MLWH 3DUSB 5BOPA 2NW3B 4RMQA 4K3DH 1BZ9B 1EHLL 3MJ7B 5IVXF 3OB0H 3BJLA 4JFQA 4ORZC 4EQ3A 2R56H 2VNCA 2G75B 4L4JA 5I1HH 3KPNA 3EFFB 1R3LB 3RWDB 3CPLA 3RDTB 4JO4L 5I8OH 5JW5A 3MODH 1MSPA 3B9EA 1DJSA 2ERJB 2W91A 3QEQB 4A6YL 4OM0H 1IVLA 1FNEA 2LU7A 5GRUH 5I71C 4KK8D 5ID1A 1JWMB 2L0DA 1U8IA 3BSZH 2NY0C 3K8KA 2AJZA 4NDMA 1M6OA 3V7AG 4D8PB 1A3RH 2VIRA 4GBXD 3FMGL 3UJIH 2RCSH 4NUJB 1NCDL 2MQ0A 2X7LA 3HZYB 4POUB 5FAAA 4HUUB 3KLAA 4BYHA 1J8HB 4G6MH 5KSBB 1KIPB 2VN7A 4ONOA 4U33A 3WE6B 1SEBB 2EIZA 3LS5L 2R23B 2YUWA 3GMOB 3DIFA 1QFWI 4Z0BH 2L4OA 3DSFL 5D71L 4QT5A 1OTUC 3WNNA 5DEZA 2FATH 3RHWK 3NACH 5FO9A 2Z31D 5ACMA 4RGOH 4MNGE 2BXYA 1JWSA 4CW1B 5F7UA 1K4DA 2FZ3B 4D0DB 3VD3A 3BGFB 3DWTA 3VI3E 4LLYB 5K93A 4QHKI 1PD6A 2J6EA 2K7QA 4Q6YA 1LEGB 3LS4L 4DKFH 5D9SB 4DGYH 2P45B 2AQ2A 4YHYC 4YK4C 1RZ7H 1A6VH 1G7LB 3BEWA 3O8XD 5E2UL 3VW3L 1RZJL 1FAIH 4TN9A 2A6JB 1OQOA 2JTDA 3DO7A 1B6DA 4D94A 3MPCA 3C60A 2NNAA 1NJ9B 1SJVA 4ZOEA 4BA8A 3GSNB 1MHCB 4KI5C 5EN2B 3ZDYE 3TN0D 2XWJB 4JRYD 4OFYD 3ARFC 2V5TA 2JIXA 1TJHL 1MRCL 4UTAL 1WEJH 4I1NB 2BSTB 4QRPB 1OQXA 5ESVB 4X7SL 4LPYA 4P57A 2OS7A 3UZQA 1YUHA 3CH8A 4HLZG 4BFIA 3HUJB 5GIRB 5FEBA 2IPUK 1KTLB 2JJTC 4Z7VA 3RTQA 2XPGB 3QHZH 3GI9L 3IXTA 3MRCA 3MJ8B 2H3NB 3L3DA 3ZZ1A 4PY7A 1OPGH 3CH1B 4POZD 5IMOA 3PNWA 3MLZH 1T66C 1QSFE 1G0XA 1JI2A 1T6VN 4MHHI 2NY0D 4BM7A 3HLAA 3L5IA 3JWDL 3MRMB 5J6HB 4GAFB 1ZT4A 4PJ7A 1IC4L 1BQHG 1PQZA 3MLPA 1NUDA 15C8H 3LZFL 3UROR 4NO0B 1HH9A 4AQOA 4AEHH 2C3VA 1MCWM 1F58L 1KN4H 2ZUXA 2X4RB 3MNZB 5DR5L 1MJJA 3OQ3B 4MCZB 1KIRA 5AUMB 3BAEL 3VWJD 4RAHA 1U8KA 5EUOB 4PGEB 3OKEA 5FM8A 3ZYJA 4F3FB 5JIIA 4WCYH 1OSPL 1UFUA 2NXYC 5JHDA 5LVEA 3TFKC 4U3XA 2G60L 2P4AB 2H32A 5A3ID 4PJDA 2PTTB 5DD5L 1P4IL 1UWEL 4RRPG 1FZMB 4G7VL 3I6KA 2FSEB 1H3PH 1GOFA 3BYTA 5D7JB 4UUJB 5IB3B 2NZ9C 1RUML 4JM2B 4PS4H 1JGEB 3QBTB 3MJGX 5E56A 3GMLB 1AO7A 3K8LA 1Q9OB 5BRZE 4P2QB 5AG9A 1V5JA 1HINH 2BVEA 2OR7A 3M17B 3MZTA 4JO1H 3VI4F 2NY3C 3GHBH 4ELKA 1FVCB 2HKHL 1GCFA 3DV4A 3IDNB 3F7PC 1ZA6A 5TJWK 4PGBB 4XXDA 2GFBB 3OR6A 4FZ8H 3BWAA 1BX2B 2PF6A 2Z93B 4LDEB 4XNUH 1MIMH 2MTPA 4PJ5B 5IF0A 1OSZB 4P4KB 4JDTH 1BHGA 5LGJB 1NMAL 1A4JA 4HKZB 3U7WH 4X6BB 5HDQL 1I3GL 1X3DA 4S0SD 2FEEI 3I85A 3PV6B 4KTDH 1IGTA 1A7OL 1EMTL 4L8BA 1UEMA 3C60C 5KSAB 1JYXA 5E2VL 1TXKA 1YN6B 3TT1H 5T1LD 5JZ7D 2GQHA 2XA8L 2DQIL 5MEND 1KB5A 1A1OA 3HMWH 2VLLA 5EUKB 3ZE0F 3DMMA 4KUCF 4PR5A 1JRHL 3MYJA 2VLJE 4DTGH 4YX2H 1JK8B 1WWWX 2FX8H 4X7CC 4X7TB 3RTQC 1ZLWH 3ZTJG 2DTML 5ISZA 1FFPB 2AJYH 5BCAA 1KFAH 1BEYL 4N0RA 5I1KH 4YNYA 1TCRA 5JPMA 1FJ1B 4XI5D 4KDTA 4QHNB 4JCMA 2Y06L 3PHQA 1EERB 4S2SB 4IHOA 4GAYB 5T1MA 1FYTA 2DL9A 3E0GA 4WEUD 1I8IA 3BPOB 2YWYA 4FABL 1T5XB 3HRPA 3TFKD 4Q58C 4YHNA 5FGCB 2H9GA 4MX7A 3H9ZA 1DBMH 4HGWA 3X3FH 2V17H 4P5MA 1BD2A 4M00A 1OTTD 1D5XA 4LGRB 3MCLL 2HT2C 1ZAGA 4PJHA 5FIEA 5HI5C 1KPVB 5CEXA 3RGVD 3WNKA 5CP3H 5B39A 1QBML 2COQA 4LKCA 4Z7WA 1EIBA 2VC2L 1GGTA 5JMOC 1DN0B 1S7SA 3LHPL 1MUJB 1CDGA 4G9FD 1T1ZB 5DURB 4M7LH 1JPFA 1WZLA 2NY3D 7CGTA 3WDHA 1KCUL 2MOVA 4PLJD 4X6CB 2CKBA 2YRZA 1CTOA 4L4VB 3N1FC 1J05B 2ICEB 1F13A 3LQAC 3QUZA 5HYJE 2YD9A 4RISH 3U0WH 4QGYA 2YC1B 5IW1B 3G5VB 4KJPD 1OLZA 4YHMH 5DUML 2VXSH 1SHMA 2MQCA 4IIQA 4PJXB 2OR9H 4XMLH 2CIIA 3ES6A 3UC0H 4AH2B 4AIZA 4BUGA 3DVNB 5HXMA 4ISVB 4U6HA 1AIFB 3FFCA 3HRZB 4FTVA 1ZT7B 4ZD3H 1KBGL 4GRWE 2NTFA 1P7KB 3L6FB 2A74B 1S7RA 2R0ZH 4JY4B 4OD2B 2ZKHH 5KBNC 1IC7L 5ADOH 3MGOA 4JB9L 4NZUL 4MAYA 5F8RC 4NN6C 5B8CB 1R3KA 4QO1A 3NIDF 1IQDB 1BBDH 1Q94B 1WCBB 4L1HA 4XCFH 3MRIA 3E1F1 5HHOB 3FO1B 4S0TD 3NCJH 4OCWL 4PJBB 5CD3B 4Z78B 1FLRL 5KG9B 3C5ZA 3D39B 2FJFB 1GGBH 3W0WA 4KI5E 4NBZB 4PGZA 1WZMA 4MJ6A 1MI5D 1QEWB 4UTBL 1ZE3C 1RURH 3MV9A 2BNUA 2W9LA 4UV4H 3DMMC 4CN1A 1I7RA 2OL3A 5BS0E 5J13B 3X14B 5DFWH 4TSCL 5EB9A 4G8EA 1H5BC 3OG4B 4FZEL 3OAZH 5T1KA 1RI8A 3H7BA 1G9NL 3VFUA 5SWSE 2BVPA 3QEUA 4J2XA 3VWKD 2EEAA 3QI9D 4QOKB 3ULUD 4Z5RA 4KDTC 3FOMB 3C2AL 3QDJA 4N9GB 1IL1A 2AXGA 3S35X 2FIKB 4IMLA 4JFYB 5JDSA 3UZEA 4XH2A 3WIHL 2X2YA 4JFPA 1K6QL 1I3RB 1U92A 5HHVH 4LPUA 1MCDA 2GUOB 5HD8D 1FIGH 1AKJA 3VXOB 2CJUH 2X4UA 1U91B 1RZ8A 4Y2DD 2CK0H 4APQA 2HA1A 4JZNB 1KEMH 4KZDH 2VISA 4JFFB 3RU8L 4ONGL 4OKVA 3O9WD 2UVFA 5JOEA 1F11B 5JW3L 4AL8H 1A6ZB 1DBKL 1AD9B 5ENWB 2EO9A 2BY1A 4JLRA 1R5WA 3WDIA 4NQXB 2F54A 5L2KA 1MJ7H 4HMDA 4Y8AA 1D5IL 1KENL 2P42B 3PP3K 4M8QB 4PP1C 3FT4B 2XRAH 1HHJB 3RAJL 4BH8B 1QP1A 1E28B 4R8WL 8CGTA 1HIMH 2J5LC 1B0GA 5F7DB 1NDMB 4OZHA 2ADGA 1QHPA 3QUZC 2X9XA 1I9IH 3L5XH 5C0FA 3GRWA 1P53A 3GMMA 5IT2H 1TQBB 4LCIL 3VFGL 3SDCA 4FQQA 4CGTA 1P1ZA 1WIUA 4GBXB 2FJHA 2VQTA 1I1FB 1RUKL 4F7PB 1I7TB 2VL5A 3VH8A 1JZ5A 1QLFA 1VCAA 5EZIH 4YXHH 4HX1B 5JUEL 1B0RB 1I1YA 3UTSD 4OCXH 1NSNL 4UIMB 3BN9C 2Z8SA 2ATPA 1YNKL 1EEYA 5DJAB 5FYJE 5F9AC 5I15H 1VEPA 3K4ZA 3S5LA 2MWCA 5D2NB 3Q6FA 1S9WB 4QRTA 2R2EA 3MBEA 2W65A 4G5ZH 2WUBH 4MAYC 2Z8VC 4HDIB 3QAZB 5HHMD 1MIEH 1PEWA 1UM4L 3DMMD 4J3TA 4I48B 2QQQA 2IAND 3ZKMC 1JF6A 1W2KT 1P7QA 2HJFA 1LMKA 2F74B 3BKYL 3C5ZC 4HAGA 2L7JA 4MXWH 3L7FB 5EFIA 4HUVA 5FHAH 3MRLA 3HC4H 2XQBL 3D69B 5H94B 2DQDH 5E8NA 2APXA 3GMQB 3BXNA 3MA7B 3NZHH 4HWEL 2P8MB 1B90A 4JFED 3LVEA 1KTRL 3TNNB 2RHEA 3QCUH 3O8XB 3LQZA 5LCVH 1PJ9A 3MBXH 1NEUA 1T22B 3S4SB 3TCLA 3V52L 1DBAL 4DCQB 1T80A 3L3IA 2DM4A 2JJUA 2Y23A 3W39B 2HVKB 2B0SL 3SKOB 3CUPA 1E4KC 4M4RA 4MB3A 4LGSB 4AJ0A 1T7ZA 2YPKA 4JRYB 4ZOBA 3I6LE 5FKAB 1FNHA 2YXFA 5ADPH 1MEXH 5EO0B 5C0AD 5F72S 1I75A 3BWUC 3CC5B 3PGFL 5HHNA 1YY9C 4J3VA 5ICZA 4OJFH 4FQXB 4PJ7E 1A47A 5BV7L 2B7DT 1TZHA 1ZSDB 2D7TH 4APQC 3WKMH 2IPTH 2VZ3A 2AXJA 1T1XB 3GB7A 4Z7OE 1CYGA 2AJXH 5MHSD 2GY5A 3QWRA 3GSUB 4FQJL 5DFVC 4W70A 4Z7QE 4TSAH 2X70B 3K80A 4Y5XB 3DX8A 2VXVH 3GKWL 1E27B 4JN2A 2OTPA 4NPYB 3RWEA 1G7IB 3B2UD 4LLMA 1A7PL 1QRND 5JHDE 1HKLH 3LQMA 3NIFF 3SGDH 1UM6L 4HH9A 1CIUA 4J3SA 4PJDE 2AABH 5IBUG 1V8HA 5I16A 5CEZD 2DLEA 1C5CH 2Y5TA 4U7MA 5HI4D 4EUPA 5FA4B 3UJTH 2V5SA 1JNLH 4KVCH 4ZODA 5F96H 3KYAA 1GGCH 5SWZE 4HG4J 1JYNA 3V0WH 1CR9H 1S7WB 3IU3A 5GJSL 4O02L 5DQDL 4F7CA 1AO7E 4YGAB 3OXRA 4PPTA 4NM8H 5DD6B 3D0LA 3P9MB 5DJXB 3VWJB 5BQ7B 3SDCC 1KIUA 5KJRL 3T0DA 3I9GL 1YEHL 3RZCD 1YJDL 3O3AB 3V4PL 4GW1B 2YPVH 5EBLB 1HSAA 4WHDA 5IBTL 1MCWW 4P3DA 5DRXA 1XGUA 3HNTL 1HHHB 2R1XA 1T7WA 3ILQC 5GGUB 2YD7A 1SYSA 4PLKD 2AQ1A 1U58A 5FYJU 1VA9A 3CDGA 4RBPH 2X41A 1PYWB 3DSNA 3MBEC 1YEGH 1QSED 1D3CA 5AWNL 4XPTH 3P4OB 1G1YA 5IEKA 3G04A 4J7RA 1B2WL 5IP4A 3MXWL 4ZDHB 3QA3B 1BJMA 3AVEA 3D0VA 1OM3H 3U6RB 2XZCL 2YD8A 2P49B 3ROOA 4JKPH 4PRHB 4Q9RH 1WZ1L 1BIIA 3LY6A 4IOFD 3T77B 4O5LH 4YO0A 3G5ZA 5FO7B 5BV7B 5I18L 1XGPA 2J6EL 5EOCL 2EDLA 4NM4H 4L8SA 3B9VA 3LAFA 3LEVL 4LU5L 2B5IB 4QXGH 2A9MH 1JWUA 4N0UB 1EAPA 5CBEA 3I02A 3T3PF 5IB1A 1HHIB 4XP5H 5FYKH 1YEEL 4ERSL 5DFVD 5C07A 43CAB 4QRRA 2VYRE 5MENB 3DX7B 4LNRA 5E1HB 1FYTE 5KVGH 2CH8A 1H9VA 2ZOLA 3LKPA 5CSGA 1TVBB 3ALXA 2R2BA 5ECJE 4F37K 2AEPH 5E8OA 2XKUA 1OT2A 3K2MC 4E9LA 4PJHE 1N5YH 4LSQH 4HUKB 3QIBD 4PBWD 5I1JH 2F5BL 4JJHA 3Q3GB 5DMKA 4LAQL 3W5NA 4Z7WE 3RBGA 1MCRA 2GK0B 2C5DC 4LLQA 1T03L 2WANA 3VXTB 1UB5A 4X4YB 3QQ4B 1KTKE 4U1LA 5GRWA 2EIEA 2KZ1B 2XZAH 1NAMH 1K9TA 3O41A 1CZ8L 5F7HA 4KROD 1L6XA 4M7ZC 4YUEL 2CIKA 3RGVB 4JAMA 4HUWB 3A6OA 4H1LH 1T1YA 1NAKH 3WLWC 3L3HB 3L9RB 4L9LC 3ULUL 3VXRE 2ZUWA 4XMKL 2HFGL 3EAKA 4NZTL 2ITDA 3VFSB 1F4YL 2Q8AL 1YZZA 4LEOA 4G9FB 1JIBA 1AI1L 1UXSA 4XC3H 1ORQB 3IDGA 5DZLA 3FFCE 2LTQC 4FTVE 4WFED 2R2HB 2HRLA 3GHEH 3MNWA 4JHBA 4OQTA 4RAVA 5FUOL 1EA9C 1HXYA 4XAWH 1YEDA 2DWEA 4R97B 2XQYG 3I6GA 1BMGA 4NP4L 1MNUL 4B50A 4XNYH 1PVHA 1CG9B 1CICD 3LQAL 3SKUD 4HIIA 4KKLC 3W0WE 3WN5A 4MVBC 1A64A 3VDBA 4JN1L 4J3UA 3PE9A 4FQ1H 4X6CF 4G6AD 3MV9E 3T2OA 5L8KB 5F9DC 2F58H 3BRGC 5EU3B 2X6MA 4JHWL 4LAJH 3KJ4B 1TNMA 5SV4A 3DETC 2XTJC 5KS9E 1EFXD 1OL0A 2A73B 1VGEH 3HZVA 3JTSA 4AK1A 4PJXF 1UVQA 4HXAH 4PG2A 5MERA 3SCMA 3SE4A 1J1OH 4E5XB 1KLFA 1NCBH 3QDJE 1U93A 1VGKB 2BNQA 5F89B 1MI5B 3NFNA 2EDNA 3L3OB 1G6RB 2OTWA 1O7VA 1MCIA 1PKOA 4RMRA 1T5WB 3LD8C 3GBML 3LKRB 1BFOA 1Q1JH 1K4CB 4PTUB 3PABB 4M7KH 4I3SL 1IAIH 4DUXA 2HVJB 1D5ZB 5D96B 5FCUH 4F7MA 2MJWA 1C08B 1GGIH 2Q8BH 2P46B 3VWKB 3QSKB 3QI9B 3WJJC 4P59L 1HWHB 1IGFL 3O2VH 5J3HC 4Y19B 1PZUB 4YHKL 1KXTB 2XFXA 1UB6A 4KJQC 3LN4B 5INCA 2DQJH 5L2KE 4NRYB 4P46D 4NC2B 2VKXA 2DMCA 3LDBC 1CK0L 4MA3B 4YPJA 4GMSH 4JG0H 4Y2DB 3TA3A 1D9KA 1I9JL 3EYSL 4MS8C 3CK0L 4OZHE 3LOWA 2GT9A 5HYIA 3IJYA 1EK3A 1T1WA 1XGTA 3O9WB 2E27L 2EDEA 5K9JL 4MCYB 1G7HA 5FF6A 2ITCA 1GC1L 3IFOA 4HMCA 1U8LB 4OLUL 1D6VH 1QA9B 1VFAB 1XH3B 4YDVB 5GPRA 1P2CA 3KYMB 3DJ9A 4MJID 3T0VA 3OF6D 1HHKB 2Z4QB 2VTFA 5I8KL 4ZXBC 2GJ6D 4XMPH 1JHLL 3DXAD 2FX7L 1AXSA 2QR0A 1DDHB 5HGAB 1ACZA 4H8WH 3BDYL 5DRWB 2NLJB 4MD0B 2AAVA 4ZS7L 4PJ8C 3VD5A 2NW2A 2VLMD 5IVOA 4X7DC 3QO1A 3DGGB 5EULV 3JVGA 2WQ8A 3H9SE 3STLA 3SDAD 3D3VD 3DETD 3WN5C 2XTJD 3N0PB 3UTSB 1OGTA 1CD1B 2ATKA 4WRLA 5EOQL 1NCAL 1F4AA 5E9DA 5CEZL 1XR9B 3BZEB 5DC9B 4X9BA 1WFUA 1DL7L 4Z18A 5JR1L 3BQUA 4IJ3B 1I9RH 1I1AA 3O11A 5IHBA 5JMRA 1REIA 2R8SL 4L8DA 4LPCA 2IANB 2VDRH 2OK0L 4XNXH 3GBNL 4HXBH 1LP9B 5CINL 3WV0A 4PG2C 4M3KB 3SCMC 3SE4C 3OL2A 1QG3A 1C5BL 1E4XH 4RFOL 2W0LA 1CF8L 4FQCL 4OF3A 4PV9A 3QZWB 3QXWA 4KK6D 1NL0H 5FHBL 4ZFGH 5IVXE 2BCKB 3KGRA 5D2LA 2EICA 5E4EC 1UKTA 5AZEH 1XF2A 4XP1L 4UT9H 4OIAA 4G6JH 4KJQD 5FO8B 1JYVA 3SGJA 1P6AB 4HWNA 1IEBA 1BWWA 2DIAA 2B39A 1F4HA 3EYVA 1CLCA 3VXUB 1HZHH 2ICWI 4PY8I 1NBQA 3DV6A 4HWUA 4WIQA 1VESA 1L4IA 1MFEH 2E7BA 2O61A 3GJFK 3JTTB 2BNRB 1LO3L 2ZSWB 1FLTX 4LLUA 2ADFH 1EGJA 2OTUA 3C6LD 1IC1A 4B53A 3V95A 1BECA 4PRBA 5HY9A 5JIHA 3M1BA 4KQ3H 4IDJH 5CJOL 3WFBL 1JUFA 3NH7L 1XCQB 4KRLB 3KYNA 3MOAL 5IKCA 2A83B 5LXGL 1UA6H 1D9KC 3RVWC 3TA3C 1FCCA 5FGRA 4DAGH 2DQFB 2QLVB 2DJUA 4LSPH 4ZXBD 3FB5A 4G6KL 4P2OA 2FBJH 3RWHA 4Y4FD 1QQDB 4CADB 3IETB 1QRNB 4PRAB 1EUTA 3MREB 3HG1D 2E5EA 3FL7A 3T0EA 4GG6F 4PJ8D 3WIIH 1VSCA 3GGWB 4ODHH 1G7JB 3RA7L 3VD9A 1QHOA 1VACB 1JMXA 1GIGH 3U0PA 3IS0X 4G8FB 5C08B 2X4QA 5DDHB 3LV3A 3W5MA 1SJEA 3CX5K 3OKOA 2PTVA 1X5XA 4ZUSA 4U2ZA 4LOUC 5L9DH 4AEIL 3BEVB 2NY5L 1DSFH 1S7VA 4NNPH 3RZCB 1MRDH 3B2VL 4ZPVA 5HHXL 3JVGC 1T7YA 1IZKA 4KUZL 5IFHH 1A6PA 3L5WB 5C0GB 5GRJL 4K7FB 2DQTL 4HKXA 2E9WA 3D25A 1JGDA 3BQUC 4YLQT 5KANG 1IQWL 3CZFA 1OGAD 1I1AC 1S7TA 3ZE1F 2HKFL 1QSEB 4NWUH 1JPGB 2AXHA 3SE8H 1WGOA 4IMKA 3S96B 4ZTOL 1N0LA 4LCUA 3DUUB 1ETZA 5TF1H 4GKNB 1OWWA 4GO6B 3A6CL 1NC2D 4X80L 3H8NA 5D7LD 1ONQA 1NMBL 3WXVH 1YEKH 1N59B 3FB8B 3GSOB 4PJ9C 4QRRE 5DHYB 3O0RH 3CFJB 3KYKL 4NO3A 3EYQD 1I8KA 4MZ2A 1ZHLA 4FHBD 5DWUL 4NT6B 3W9EB 4OF7A 1CGVA 4GSDH 5EBMB 1S5IL 3SGJC 4GXVH 5KAQF 4RFEA 2HH0L 5TH2A 3RVUD 1JN6A 2D31B 2DJSA 3SGDI 5LQBH 4A2LA 1CFNA 3L3GB 3TVMC 3RVWD 4QXTB 1KUMA 5K9OB 1TZGH 3GJFB 5IGXL 4O58L 4LHUA 4PB9H 1X6LA 5C09D 4JRXE 4ODBD 4Y2OA 1UM5H 1GZQA 4PJFB 3FCTA 5E2JA 2KQMA 4F7EA 4G6FD 4HSQA 5SX5K 3FJTA 2CK2A 4U1JA 1SM3H 3MRHB 1JHKL 1AD0B 3FQTB 4P2OC 1INQA 5T3XH 3QIBB 2EC8A 3VI4E 4OF6A 4PRNB 4W68A 1VFMA 4M1GH 1IEAB 2RFXA 1Z9MA 3SJVD 1RZIA 3P73B 4LOUD 3T0EC 4DZBB 1JHTA 4LIQL 3K2UH 3BD4A 2GTZB 1A22B 1FG9C 1CFSA 1JV5B 2E6QA 2ZUTA 3WDJA 2BP3A 3PIQA 1E6OH 3X11A 4P23B 4JJ5B 1BQHB 5F9WB 1AQDB 4HK0A 3VXNA 2NR6D 2ENYA 3RZWA 4G80B 2VR9A 3KXFD 1KCSL 3EOAA 4LSSL 2PXYB 1QO3B 5D7IA 4L3AA 3HPJA 2WINB 4QF1B 1NPUA 4HZAA 2ZG1A 4PJ9D 4K3EL 4KDVA 3OKNA 1FIEA 4X98B 3MLVL 5HSFA 1AGFB 2FEEL 3PQYD 1MJ8L 1FNGB 5DRZA 1UWGL 3VMPA 4IMKC 1CICB 1YPZF 2JF1A 4L3EA 4U4BA 2C3WA 4CU6A 2B4CH 4ZTPH 2DS4A 4QCIB 3U9UB 3DYOA 3VJ6A 1JPTH 3HFML 4FNLL 3WD5L 4HWBA 1DQML 1D6EA 2X4SA 3NZ8A 3M45A 4PYGA 5CP3A 5MP6H 3ZMRA 1CFBA 5KVFL 1DQDL 2BNQE 4WHTA 3RI5F 3TVMD 2VLKD 2UYLB 2DICA 4JPKH 4JY5H 4KXZH 1UCBL 4N90D 3I75A 4PBVC 2WLYA 3MOQA 2FO4B 1T7XA 2FBOJ 2YEZB 4JFDB 4L4TB 3Q2CA 2BVOB 2DWDB 3QCTH 1EFXB 1QPPA 3ZHLA 2HT3C 3ZKSD 3VDAA 4L8CB 1NDGA 4LCWD 5T5FH 2NY1C 5HYQB 2Q6WB 3M8OH 3NN8B 2WM0A 1QFUH 4HF5L 4TOYL 3LEYH 2P44B 1BJ8A 2AP2A 1T3FA 3O4OB 3HZKA 3QWQB 1U8JA 5FV2A 4XPHL 5GHWH 4UMGA 4U1NA 1ZWIB 5HYJD 4JY6A 4QLRA 4WY7H 2EYTB 1LQSR 1KF9B 2N56A 5HPOA 4XTRD 3KPOB 4Q0XL 4R4BB 1EFQA 2NY6B 1RUAL 4P49A 3SDDD 1K8IB 2FX9L 3SDYL 2NTSP 2QQNL 1ZA3A 3NAAL 5MEQA 1LO4H 3O6LL 5HJ3B 1A6AA 3LKNA 3FRPG 2GSGB 5KSUA 1KELL 4P46B 3OXSB 3GSNH 5IG7B 2UUDK 3ARZA 3W9DA 4FQLL 4CU7A 3OKKA 2I60L 3M07A 4Y5VB 5C0NC 2DI7A 2WBJA 1OAKL 3NIDE 2VXTH 5DTFB 2VZSA 1U41A 4N0FA 3WL9A 4WW1A 3PWNB 2NY2D 2CLVA 5I6XB 3WNLA 4OFIA 1UZ8A 1DVFA 4JO4H 4GMTL 4YPGA 4A6YH 4UOW1 2AVGA 2BZDA 5E9DE 4QRQA 3FMGH 4XNMA 5EZJB 1NCDH 3DXAB 5CJQH 5BS0D 4O2FB 2IPKA 4HBCL 4I0PA 5FOJA 3UTQB 4WI8A 1J1XL 1XGRA 3LS5H 2FNBA 3C5SB 4X6FA 4ZAKD 2YA1A 5BJTB 4P9ML 3UX9B 5E8PB 4YR6A 5DT1L 5D71H 3DSFH 1ERNA 4P4RB 2UWEF 3RNKA 4X5XA 4H0IA 3FN9A 1LEKB 3D3VB 4HKBA 4K9EL 5HYFA 4KTYA 2X9WA 2HT3D 3D9AL 4KV5F 1R3JB 2PO6B 2P8LB 4XVJL 5F7YC 3QEGH 2Q76A 4OT1L 4CUCA 1JTTA 1LE5B 2IAMA 4WFFE 3QNZB 3IDIB 5LBSL 4F2MB 5D6DA 4JVPA 5CLTA 3LS4H 2JCCA 4YDLC 1DQQA 3OGCB 2EDYA 2HLFC 4Z95L 2VJXA 3MSPA 4K7PX 5J6GB 4Z76B 3RVVD 3WFCL 1YNTA 2DDQL 4TSBL 2APVA 4X4XA 5E2UH 3VW3H 3C5JA 4MQXD 1RZJH 2E7LA 3RWIB 4PJEB 5F7WC 3HE6A 2J88L 8FABB 3S35L 5IK3B 5IHZB 3F8UB 3BPNC 3SKMB 1T21B 1TJHH 1MRCH 2JJVA 1N7ML 5B22A 1CGXA 5K9QG 4X7SH 4YXLL 1N2RB 1J5OL 2VN4A 5IVZA 3G6AA 4TUJA 3U4BL 4K94C 3GI9H 2BXZA 4KY1L 3RX5A 1SJHB 3T0EE 2W0FB 5GZOD 2DJ4A 3VMOA 1KEGL 2X5PA 3Q6GL 1HSBB 3NCYS 5TDNA 2XICA 4JREC 1DUYA 3EZ8A 2WBJC 3DYPA 3JWDH 2B8OT 3SO3C 5H37G 2ID5A 4XPGH 2ZWLT 1IC4H 3ALWA 2HJKA 4Y4FB 4MNGB 3LZFH 1D5BB 1NEZA 2O5YL 1DVFC 3E2HC 1UQSA 3LMJL 2WWKO 3AAZB 3MTRA 1F58H 1IMHC 3T8XA 4NSKB 5CGYC 1MQ8A 4LKXB 5HVFB 3BAEH 1TMCB 2J2ZA 3TBVB 3VXSD 3BD3A 1HHGB 2XV6B 4RWHA 1HXMB 1OSPH 5DO2D 3IB4A 4P0DA 4MJ5A 2G60H 4HKJB 1FVEB 4I0PC 1LNUA 5DD5H 1P4IH 2ZJSH 1UWEH 1UXWA 1E4XI 4MA7L 2Z8WC 4G7VH 3VGDA 2E9IA 4PG9A 1FL5A 5DEGB 5IR1B 1RUMH 4OGYL 1Q9KA 1XR8A 3O6ML 1XF5B 3QUXB 5F7LB 5GGVY 1X7QA 2GITB 1AR2A 4XAKE 2ZSVB 1AHWC 4UU9B 5BW7A 2YMXL 5A2FA 2BMKA 4QHMB 4ZSOA 3RUGF 5CBAB 2HKHH 5MI0C 4R2GC 2IAMC 4RMTA 1OGAB 1WBZB 3ILPA 3F5WA 3DRTB 4CMMB 1A6WL 5D6DC 2W59A 4OAWA 1Q0XL 4LPTA 4MWFB 2V9TA 5C6TL 3C6SA 2VWEC 1KYOK 1NMAH 2C4FT 4X9FA 2A6KA 5HDQH 4YDJB 1I3GH 2J4WL 43C9B 1NC2B 2EH7H 1U0QA 3JV6A 1QSFB 3KWWB 1MLCB 2YD5A 3MLRL 4MLIA 4Q7DA 2E7LC 2WP3O 1WQVT 3NIFE 1NCNA 3ARDB 1FVDA 1SY6L 4KVNL 2AK4A 3HE6C 1NUNB 5E2VH 5KVDL 1BGXL 1ND0A 5SWZD 5D1ZD 4LCYA 3VFTA 4EXKA 4X8JA 5L88L 4GW4A 5F88B 2DQIH 3MRKA 3PDOB 4OZGA 5I30L 2E7CA 5CWSB 1JRHH 1NFIB 4JZJA 4QHLA 1JTPA 4TNWK 3CLEL 5GS1A 1SYVA 4FFVC 1S5HA 3EW3B 2DTMH 4NO5A 3HI1A 4FQIL 4GQPH 4N1EA 5I75B 1UWXK 4XP9L 2NY7L 2EH8L 1BEYH 2HWZL 4OUUB 1KB9K 5DJCA 4ZFOL 3MFFA 5I73B 2Y06H 4G6FB 4BJLA 5MEOA 2DB8A 4OLWL 1RY7B 5BRZB 3FN0L 4FABH 4OBSA 1RJYA 1U8NB 2X05A 2IH3B 3GUTA 4F57L 2A6DA 3QIUA 3VGGA 2VH5L 3IFPB 3BPLC 4JFXA 3SJVB 3K3QA 2FHFA 4X0KA 1RZKL 5D7IE 3WCYA 1YNLL 5I8EA 4EBQL 1JGLL 2VC2H 5ICYB 3IGAA 3QDMA 5DHVB 5DZNA 5IBUB 1WISA 3D87B 1KCUH 1E4JA 5DD1L 4DN4L 1B3JA 3DX6B 4L3EE 2G5BA 4Y89A 2IALB 1AGDA 4YAQA 1CD0A 1ZEAL 2BSRA 1JI1A 3KXFB 3QEHA 2J8UA 3U48A 1XZ0B 3EUUA 4L3CA 5DUMH 3V5KA 5GSVA 4HQQL 3MV8A 3VXQA 5BW7C 3CDCA 1YN7A 1G7MB 4CAGA 2VLJB 4QNPF 4FA8A 2X42A 3GSQB 2HFFA 1T2XA 4AIXA 1C7SA 2YPLE 1KBGH 2FYYA 1NAMA 3BKJL 5DF0A 3WBDA 5C9JB 4MD4A 4D3CL 3IDYC 2XQYK 1IC7H 3MGAA 4JB9H 1CWVA 4PRPD 5CJXA 1EO7A 2R9HC 3W82A 1WUNT 4H1LA 3ARUA 1NLDL 5DJDA 4OCWH 1HYSD 4R96A 3VGEA 2ICWJ 1FLRH 4PY8J 4FFVD 5DJ6A 4ZFOB 1JMZA 2ADIB 3VXMD 4KKCC 4NZRL 1ZLUK 4UQ2A 1RAMA 4HIHA 2P8PA 3A0OA 2BSSB 1MRFL 2I07A 5F70A 3NGBC 2YUVA 1ZLVK 1FE8H 5GS1C 4B7IA 1CDUA 4TSCH 4AMKL 3VXRD 4BELD 3VFVB 4FZEH 2E7HA 3HAEH 1FH5L 3G6JF 3OX8A 5DD0L 5J1AA 1H8NA 3QPQC 1AP2B 1F2QA 4WW2C 2VXUL 3OKDB 3G6DL 5HYJB 2VB5A 4XCNB 3WIHH 1K6QH 1MAJA 4HFWB 3LRSB 5L0QC 3EJJX 2FO1A 5B3NA 3SDDB 3HNSL 3OKLB 3TO4C 1QBLL 1GYAA 2YS4A 3THML 1S8DB 3CFKB 1AGCB 1NGXA 3RU8H 1K2DA 4I4WA 3O4LA 1PG7L 3BP5B 3MRRB 1CDCA 2W9DL 5JW3H 4Y4KA 1QTYT 1WTLA 2BRQA 3MUY1 1JJUA 3PWPA 5I74C 1S7XA 5GGRA 3GFUA 1I7ZB 3LN5B 1MHHA 4RQQB 4MNHA 4XB7A 3KYOB 1D5IH 1KENH 5F6HI 3L3KB 3MA9L 3WS3B 3RAJH 3QUML 3BRFA 3OTTA 1A3QA 3IVKA 4R8WH 3BDBA 5HHPA 1AFVL 3ZL4L 2ILLA 3BI9X 1N4XL 2VZTA 5I1LA 2CD0A 5EU7E 3Q0HA 4LCIH 5C0IB 1R3HB 3RX7A 3VFGH 4XZUA 5JOFB 3BFOA 3ARGA 4Y5YA 2V2TA 4N0CC 1RUKH 4J3OC 5KN5A 1WWAX 1G0DA 5BS0B 3WUWG 2A6IA 4YEFA 3EHBC 5C70A 5JUEH 1NSNH 1X5JA 3KHQA 4JPVL 4TNVK 3U79A 1YNKH 1N5AA 4NJ9L 4ZS6D 3T2NL 1RZGB 3UTOA 1FZKA 1MCSA 4Y0GA 5TGBB 3FOLB 2VWEE 5IOPA 5SWSB 2BVYA 1OAUL 2ZUQB 5CJXC 5I2IB 4NFDA 1DP0A 4O00A 1NQBA 1AXIB 2QADB 1UM4H 5DA0B 5D7SL 3EO9L 4U1GB 4HWZB 2W0KA 3FO2B 5A16A 4L29B 5I76A 1GGUA 3BKYH 4HWBL 4YWGL 4ETYA 4R3SA 1PG7W 2XQBH 3CPLB 1KXVC 2CDFA 2CO6B 3GIZH 5D1XC 2W38A 5FYLD 4X5WA 4PP2A 4OKDA 3VFPA 3TZVC 4HWEH 4UBDC 4TUOB 5DEFB 4ZYKA 1KCKA 4NDMB 1JTOA 4GS7C 2OLDA 5DK2B 3B8YA 2VIRB 2EE6A 5C0CD 5E94B 4TTDD 2DM2A 3V52H 1DBAH 3MRFA 4NQED 1HK6A 2I25N 1HCVA 2BOCB 3TO4D 2B0SH 4OLVL 1F45A 2FH8A 5DJ2B 2P5WA 5D93C 1C7TA 4OZFG 3PHOB 3B6SB 3CVHA 4QT5B 1WWCA 1X4YA 4RGND 2NYYD 4JKWA 3RL1B 3PGFH 3RPIA 3U30C 1CFTB 1DEEB 3TV3L 2EECA 2YD6A 3QUMB 5IW6A 3TPUB 5BV7H 2EXYC 1KLGA 1JWSB 1YMME 3H9SD 4NKIL 5DJ0B 2PW1A 2YSSA 1Q8MA 2DYPA 1FC1A 3U2SB 3QWOA 4GAGH 5EORL 1QR1A 1JVKA 4Y4KC 2NX5A 1A21A 5JIPA 4OSUH 1A7PH 2E6PA 4XCCL 1CXHA 1MWAL 4I18B 4DWHA 1UM6H 3BEWB 3RIAF 4N0CD 2HRPL 3BZ4B 1MREL 4G8GA 3BP4B 3WHE0 2UWEA 2NNAB 4ZUTB 5GJSH 4O02H 5DQDH 3T3MF 3SQOL 2VDML 4PJIA 3VXSB 1U8QA 5KJRH 2DQUL 1YJDH 3V4PH 3ARGC 4Y5YC 4ZSOE 4F15B 1YUHB 3PWVB 5IBTH 4BFIB 5C0BA 1KGCE 1X5YA 1YA5A 3N1PC 3JZ7A 5HHQB 1FGNL 3F6LA 3IXTB 3PP4L 5C2BL 1I85A 3MRCB 1H3UA 5D1XD 1FSKB 4WO4A 4YC2C 5IMOB 5I17B 1QPXA 5ID0A 3V5HB 5AWNH 3QNYA 4GRMA 3TZVD 4NYLA 3AC0A 2H41A 1B2WH 3MXWH 5F3HA 2VDPL 2NXZC 2XYCA 1S7QA 2CRYA 1ZT4B 2AK4E 3ZLQC 1INDL 4PJ7B 3I3BA 1FZOA 1RU9L 1DFBL 3LSOA 1HH9B 1KT2A 5EO9B 4HG4K 4KK5C 3WYRA 5J12C 1MJJB 1MFCL 1ZGLA 1EUUA 3TH3T 2EKSA 5KW9L 2YKLL 3TJHD 4H8WC 5I18H 1N8ZA 2J6EH 2EZ0C 1GZPB 5TDPA 1RHHA 1NANI 5CS7A 5JHDB 1AGBA 3SDXB 4FN0A 4XCEB 4K71B 4BH7A 4H26B 3LEVH 5TDOB 1A6TA 1TETL 4LU5H 5F3BA 3RWFA 3CFDA 5EPMB 1IBGL 5DXWA 1YEEH 4ERSH 2VDKH 1IFHL 3BIKA 1MWAB 5FCSH 5D1ZB 5SWZB 2R39A 4D0CA 1CLOL 4N5EC 4JKMA 3QQ9D 3T65B 1VFOA 4G42B 2FJGA 5JHLL 4WFHD 3KJ6H 3KLSA 4BQBA 4QTHA 1GAFL 3CDFA 2GTWA 4ELKB 1JZ2A 3CSBA 1ITCA 3SGKA 1ZA6B 1FG2A 3BUTA 1SMOA 5FYKE 2F5BH 1QLRA 3ULSB 4LAQH 1R24A 2Q20A 1A4JB 3QDME 3OKYA 5ESQA 3ZE1E 1T03H 2CXKA 3ARVA 3I84A 4KDWA 4NQSA 5GS0C 1VFUA 2YUZA 4NRXA 4Q9QL 2DLTA 1CXIA 1MJUL 3CXHJ 4L8BB 1CZ8H 1IM3A 4KRPB 3DRQB 3QYCA 3WFHA 2WIIB 4YUEH 1NC4A 4PJGB 5DD3H 3ECBB 2CRIA 4PGDB 3ULUH 3RUGA 3X3GL 4XMKH 2HFGH 4PR5B 1F4YH 1NCWL 3D5OF 3EJYC 2Q8AH 4OLXL 1AI1H 3U9PL 2OXGA 4YHIA 3STZA 4MXVF 2GCYB 1Z9OA 3QFJA 5IESL 2BOBA 1I85C 2EDBA 5FUOH 2GSIB 2HLAA 5I1AA 2MKLC 1TCRB 1IAOB 4WO4C 4BSJA 5JPMB 3KPSA 2OR8A 4NP4H 1MNUH 1BVLA 3SE3A 5CEYA 2Y9RT 1VADA 3AY4A 1A9EA 4JRXD 4RMWA 5T1MB 3LKOB 5DQ9B 3TIDA 3LQAH 1QNZH 1YDPB 2EZ0D 4XGZB 1I8IB 3VGAB 1JRHI 3CAFA 4V2BA 4HGWB 4P5MB 2DQCL 3MCG1 1VPOH 4JN1H 5EO1B 4PJHB 4UINL 1S9YB 1IM9A 3VFRB 1EEQA 1F8TL 2SEBB 4HJGA 2D4FA 4PRPB 1R6VA 4JHWH 1MLBB 4LKCB 4EN3A 2QBWA 4U7KA 1FPTL 5SWQA 1UG9A 3KS0H 4WFGE 4OZIF 3RY5A 4LF3A 4MB5A 4PIRF 2HN7A 2YD4A 3REWA 3BGMA 2HTKC 3VXMB 3JV4A 1FL3B 2IQAA 5TQ2L 3K1DA 3JWNC 4F9LC 3DUSA 3PWLB 1L0XA 2XN9A 1GHFL 2NW3A 3GBMH 3KPQB 1OAXL 4I13B 2NCMA 1B88A 4IIQB 4W81A 3VXRB 1WJ3A 3MMEB 3S9DB 3EFFA 1R3LA 3RWDA 4I3SH 3EDKA 3G08B 4AIZB 3AB0B 3MX0A 1BBJB 3SGKC 3QEQA 4FTVB 1DUZA 4WTZG 4XVUD 2NTFB 1JWMA 4P59H 1IGFH 4KUCD 1S7RB 4YHKH 2ZPKL 1ZMYA 3PWPE 5FYLL 5CLWA 5J9PB 1VFBA 4HUUA 1CK0H 4RIRB 5KSBA 4GKZA 1KIPA 2CXGA 4YFLI 5EG6C 1BQSA 3WE6A 1A1NB 1I9JH 1SEBA 2LU4A 2R23A 3EYSH 3IT8D 2RGSA 3GMOA 3U1SL 5IB4B 3CK0H 3MC0A 2YA0A 3LB6C 3ZE2E 4E41A 4H88L 1R5VA 2E27H 2JELH 5K9JH 4MJ6B 2F5AL 1BFVL 4MNQA 3ARRA 2FIRT 4LSUL 5GGSB 3UTTD 4OLUH 2BNUB 1Q38A 4PTTA 1MCKA 2H1PL 2OL3B 4M6ML 3QJFB 3NPSB 1ZV5A 4OIBA 3SO5A 4CW1A 4G8EB 4K8RD 3WS6C 4D0DA 4DOHB 5KS9B 4LLYA 5I8KH 5T1KB 4JHAL 1EJOL 3QIWD 3UBXI 3UTZB 1LEGA 2FX7H 5C92A 2D7OA 1J9CT 4XPAL 5D9SA 1XF3A 3SE3C 4Z5RB 3QDJB 1IL1B 5DK3A 4ZS7H 3AY4C 2R1WB 2KH2B 5JDSB 4GRWF 1M1SA 5E4IA 1HNFA 3FT3B 1U3JA 3S88L 2A6JA 5JIKA 1GJIA 1X44A 3HB3C 1NJ9A 1NCAH 1MHCA 3B5TA 3GSNA 3MLXL 5B4MD 5I1GL 3OAUL 4O2EB 2MFNA 4J12A 5JR1H 4RX4D 2BSTA 3T0XA 4QRPA 5ESVA 4KI5F 1E0OB 2Z92B 1KV3A 2R8SH 1Z5LB 1FN4B 5GIRA 3PDGA 1R5WB 1IGJB 2OK0H 4MD5B 4GKSA 5L2KB 2XPGA 3GBNH 4A6YA 4ZMAT 5CINH 4C4KO 2YWZA 1Q0YL 3MJ8A 4DEPC 5LWYL 2OBGA 1C5BH 3CH1A 2JB6B 2Z35B 3MYZA 4RFOH 5GSRB 4FQCH 1CF8H 1B0GB 1T4KA 4OZHB 5FHBH 3R06A 4E42B 2CSPA 4HGKC 2V2XB 3KHOA 4PJAF 4LPWA 5CMAB 1PEZA 4M6NL 3EOYG 4Q74A 3MRMA 2EE9A 5J6HA 3AXLA 5B21A 5C0CB 1QSVA 5IQ9B 2GHWB 3VH8B 5J56B 3GSWB 1I1YB 3RDTC 4NO0A 2CDGB 3VCLB 4ZNEA 4RDQF 3MNZA 1CVRA 4BK5A 2NX5E 3MRBB 4MCZA 3S5LB 3Q6FB 4NN5B 1LO3H 5EUOA 4F3FA 4LSRL 2FEDD 5DVOA 2G2RA 4RGNB 4AT6B 4I3RL 5CJOH 3EO0A 3WFBH 3DTXA 2QV2A 5AD0A 3NH7H 2PTTA 4J6RH 1P7QB 4DVBA 2Y36H 4G8GE 3MOAH 2UWEE 1F4WL 3H9SB 2FSEA 5GS3A 1UJ3A 3QFJD 4G6KH 4JM2A 3B5HA 1JGEA 4PJIE 3GMLA 2CMRL 5DC4B 3RWGA 1Q9OA 3UYPA 2DI9A 3QDGE 4P2QA 4HUNB 3M17A 3PV7A 4OQ1A 4WFFD 5C0BE 3RA7H 4NHUB 2ZP0T 4FP8L 1JPST 4AENA 3TCLB 3WMSA 3IDNA 5CJBA 4PGBA 3E6HB 3KLHD 1F2XK 2BC4B 1TPXB 2GFBA 1BX2A 2Z93A 2OI9C 5JW4Q 3P4NA 3CUPB 4PJ5A 4P2RA 5T5NF 5CCKL 4HLZH 3P4MB 2C7UB 5DS8B 4X6BA 4AEIH 3BOVA 1ZANL 2NY5H 5IVXB 1MELA 3B2VH 5HHXH 32C2B 3PV6A 1SBSL 4YZFF 4KUZH 3VMNA 5GRJH 2DQTH 1ZVSB 1YYLL 5EU4B 1KLUB 1QLEL 1WBXA 4HC1L 1A3LL 4JN2B 5E08L 1IQWH 4U1SA 3ZKXB 2MHAB 4LLMB 2HKFH 5F9OL 3V6FB 4K7PL 5JO5B 1JK8A 2V2WB 2X1WL 3WO3B 2Y6SD 1JYWA 2FHBA 3IFNL 5EIVA 2IMMA 1A7RL 3A6CH 5EU6A 4X80H 4EUPB 3BMVA 4XHQA 3K4AA 1NMBH 3RDTD 4TVPD 4Z7VF 3KYKH 3QEQD 4QHNA 2J8OA 4M7ZB 3IU3B 3OJDB 1TTUA 5C3LD 4GAYA 2W0PA 5DWUH 5J11C 3D0LB 5CD5D 3D1MC 1S5IH 4M1DL 2A77L 1T5XA 1XGYL 2HH0H 1HSAB 2DKUA 3FO0L 4P3DB 1XGUB 1J8HD 1CD8A 3SE9H 2R1XB 5FOBB 5KAQG 5K59F 2LTQB 5C0JB 4ZNCD 2M26A 5IGXH 4O58H 5T3ZE 1H3VA 1JP5A 1LK2A 3FZUC 4Z7QF 1Z0MA 1DN0A 5IEKB 1T1ZA 4EI6B 1U8OB 1CDIA 1QKZH 3L3JB 3DI2B 1XIWD 4I2XA 4JDZB 1KG0B 1M4KA 3VFWB 1WC7B 3S3PA 1JHKH 4L4VA 1T89A 1J05A 2ICEA 4PJDF 2APWA 4JM2C 5HYSG 5F6HJ 1IGYB 2YC1A 4XCYB 3G5VA 1BIIB 1DLFL 2QTEA 5ICXA 1DBJL 1RZJC 3RUGE 4I5BA 5E95B 5IHUL 1XGPB 4LIQH 4EXPX 5IFJB 2FD6L 1F90L 4AH2A 1OWRM 1C16B 4L8SB 4ISVA 1FQ9C 4CVZB 1AIFA 3HRZA 1ZT7A 1JWUB 3I02B 3L6FA 4YH6A 2A74A 2VAAB 4OD2A 1KJ2B 1I1RA 1W0VB 3KPSE 3ZTNL 4QRRB 4Z7UA 5T3XE 5B8CA 3QXTA 5DRNB 1SMAA 3UEZA 1V05A 4CMHB 4OV5A 3WO4B 2W60B 1LGVA 1Q94A 3ZTJH 5HHOA 3MACL 3FO1A 2ZOLB 1KCSH 4LSSH 6CGTA 1S78C 3D39A 4WHYH 2FJFA 3EO1B 3W11C 1SBBA 2GJZB 5KSAC 4U3CA 3V0AC 2ARJA 3KPRA 1G9EA 5DYOB 2H26B 2AI0H 1BREA 1RJZB 1QEWA 2IGFL 3JWDC 4K3EH 3MLVH 3KR3L 4PRID 1MJ8H 3X14A 3HNVL 3ARED 4JRXB 1UWGH 3B5GA 3AS2A 3HC0A 3H0TA 4Y16B 1UB5B 4U1LB 4FNLH 3HFMH 5GGQL 1F3DH 3WD5H 3TP4A 1DQMH 2EYSB 4WV1B 4K8RL 5KVFH 1DQDH 4XHJD 3FOMA 2BDNL 4N9GA 1UCBH 2X09A 4OZ4A 2FIKA 2XN9E 4UQ3B 4JFYA 1NGYB 4WNQB 5C71A 1I3RA 3TYGL 1BIHA 1S7UB 1S3KL 3BPOC 2GUOA 3VXOA 2ITDB 1U91A 4B41A 4LEOB 5JXEA 3GMNB 3OBAA 4BQ9A 3IDGB 4YBHA 4FG6C 4ZO6A 1ZT1A 3MNWB 1JE6A 3O3EA 1C5DB 2PCPB 1F11A 1HXYB 3V0VB 4HF5H 5D7JD 2B1AL 3V4UL 4TOYH 4NFCA 1A6ZA 1AD9A 5ENWA 4KRNA 4KKBD 1UH2A 4NQXA 4XPHH 3HA0A 4V1DD 5TE6L 1IZJA 4M8QA 2OQJB 4Y7MA 1HHJA 4HIIB 4Z7WF 3WN5B 4V2CB 4E41E 5F7DA 1NDMA 1T89C 4Q0XH 3SKNB 4IOIA 1X5HA 4LGPB 4MNQE 3QXAA 1OVZA 2FX9H 2D0FA 2QQNH 5J4MA 3L5JA 3NAAH 3U0TA 4P4KD 4QNPE 4UAOB 3O6LH 3BH8B 3DOSA 2AJ3B 2W92A 1RULH 2HT4C 4GBXA 3UBXA 3GSRB 1KELH 4F7PA 1I1FA 4YHPB 3VE0B 2YPLD 4HX1A 4DUWA 1LILA 1OP3K 4UIMA 3TGXA 2I60H 1S78D 3JTSB 4M03A 4JQXA 5DJAA 4NQCD 5KSAD 2VDLL 2MPAL 3QHTC 5D2NA 5TQ0L 2BNQB 2BSED 5B8CC 5C8JA 1CT8B 1C12A 1HCFX 2X1XR 4P5TD 2OTWB 2XOTA 3MV7E 3UTTB 2C3GA 4EOWL 4GMTH 2Z31A 3HAEA 2F74A 2WV3A 1BFOB 4OCLC 4YGVB 1KIQB 3BISA 3H2WA 3L7FA 2VUYA 3MROA 5F1NB 4IRJD 5H94A 4JPIA 3GMQA 4QWWC 4HBCH 2H8PB 3WIHA 3MA7A 2C3XA 1KOAA 4QRPE 1J1XH 4RSVA 3P2TA 5J13C 3TNNA 1RUQL 4JG1L 1UB6B 4P9MH 5GZND 4OZIA 3O8XA 5DT1H 4U1KA 3S4SA 3G6JE 2Z0BA 4PRDB 4K9EH 4JFOB 3W39A 4YHLL 2HVKA 1Y0LB 2C3HA 4HIJB 2XZZA 4F8TA 4FG6D 4XVJH 4JRYA 4OFYA 2B1HL 1T1WB 1XGTB 4Z0BL 4OT1H 4XP6L 3GI8L 1G7HB 25C8L 2R0WL 3QDAA 4KU1A 4AG4L 2I9TA 2ITCB 2IJ0C 1MCHA 4OD3L 3QT2A 3O6FD 5LBSH 3P4LA 4ZG1A 2F9BT 4OCMC 1Y18B 4Z95H 1ZSDA 4YDKL 5DURD 1T1XA 2HJLB 3S8WA 4ODSL 4FQPA 4P2YA 4ZNEE 3F65A 5BZDB 1MVUB 5LKNA 3WFCH 4TSBH 4Y5XA 4RZCB 1E27A 5A2JH 4NNXA 4L4VD 3EOBA 5EUOE 2QR0B 3H9HB 4YXKL 3GJEA 4RMVA 5M95B 3BP6B 2HT4D 2C9AA 2O26U 1N7MH 1UH3A 3BE1L 5FA4A 5HPMB 4YXLH 3MJ9L 1OGTB 2ATKB 3FTGB 1ZVHA 3BGAA 3INUL 1J5OH 4D9QD 1S7WA 5I9QB 4KK8C 2RR3A 1ZHBA 3U4BH 4P2QE 3DHMA 1TQBC 3P9MA 5DJXA 3VWJA 4KY1H 2XXMB 4TVPL 1TZIB 3HE7D 4GBXC 1KEGH 4OZHF 4D9LL 4GW1A 2QQKL 5EBLA 3Q6GH 1TFHA 5GRVK 4MDIB 1GRWA 5GGUA 3QZWG 2QHLA 5D7KD 1F3JB 2QHRL 4JQXC 5IMLB 4PJ5E 2XWBB 1ROWA 4P2RE 1F4XL 1OAZL 5D2NC 5GS2D 1PYWA 4HCRL 2O5YH 3QAZC 1X6NA 1DANT 3KPMB 3LMJH 5L7XL 3FAWA 3NA4A 2AJVL 4ZDHA 3QA3A 1G9NC 2FHCA 4WGVB 3EYVB 3RVTD 3ZT7A 5DFTA 1KULA 1LEIB 3DV6B 1DQJB 3F6IA 3WFDL 5I8CB 5H2BA 1KN4L 4QOKD 1MPAL 4P2CG 2E3VA 4PYHA 3EDDA 4PFEA 4LLUB 5FO7A 4MA7H 3BDXA 4NKQB 5AAWA 3O8XC 1YC8A 1QVOB 4N9OB 5HY9B 4OGYH 3O6MH 4AYFA 5EU6E 5A43C 1JUFB 4L9DA 4OLZL 2WBKA 2D2OA 2APBA 1HHIA 5IJKA 4OGXL 4JFFD 2EDWA 43CAA 5T1LA 3BJ91 2P5ED 3P9WB 1DLHA 5MENA 3DX7A 3RWHB 4JFHD 5DHVH 3UTPD 1A6WH 1YMMD 2F53D 1HINL 5EBGA 2V9QA 1Q0XH 3EYOB 2RJMA 3ZDZF 5C6TH 2KL6A 1ED3B 3VFNB 2PR4L 3ZKQD 2J4WH 4KKAD 1A4KB 1QFHA 5CZXD 4Y5XC 1C1EL 5CZVH 3MLRH 4EIGB 4POZC 4TVSa 3MO1B 1SY6H 4KVNH 2GK0A 1YMHB 4U6XB 5KVDH 1BGXH 1S7VB 3VXTA 2XZQH 4PB0L 5L88H 3QQ4A 2FR4B 1V3LA 3WIFB 3F12B 4I2XE 2IBZX 5I30H 5E2TL 3T3ME 3BUYA 3CLEH 1W72L 4HKXB 3T0WA 3RGVA 2OJEB 3VWJC 1JGDB 4HUWA 3WNMA 4FQIH 1TIUA 3O45B 4XP9H 4ALAL 2NY7H 3KNBB 2EH8H 2HWZH 3VFSA 3VXPB 5J0BA 4WUKL 4G9FA 4JHZA 5A3IC 4OZFB 2EO1A 4XP4L 3TESA 1EGJH 1V3MA 3SOBL 1ETZB 2R2HA 3N85L 3Q5TA 1XIWB 5AYQA 4OLWH 1A1MB 4HT1L 1KFAL 3FN0H 5I1KL 1K3ZA 4Z7UE 4F57H 1WICA 4NO3B 5F93C 1MY7A 2VH5H 2Y07L 1I8KB 1ZHLB 2VL4A 5TPWL 4M93B 5HHOE 4M6AA 3CCHB 5GGRY 2ZCLL 2GEEA 5C86A 1RZKH 2PTUA 1YNLH 4EBQH 3PG2A 4KI1A 1JGLH 5FM5M 3MRQB 2R29H 1HDMB 3KPRE 1TITA 2RAMA 3FO9B 4DZ8B 3NBNA 4CJ1A 4PGCA 4NQVA 5KVEL 5DD1H 5EU3A 4DN4H 5BV7C 2PYEE 2MCG1 5I0DA 4U1IB 3NABL 4YBQD 1R5IB 3O3BA 2C1PA 1ZEAH 5LAXB 4AM0A 4FQXD 3PF2A 3BPCB 2AEWA 4X6DF 1B0WA 2VITB 1Q72L 5JXAL 4ZFZB 4M9PA 2VERN 4U1JB 5JNYA 5IJKC 4HQQH 1CE1L 2E8ZA 5JZ7C 4WI5A 5E24E 3V2AR 5F89A 1MI5A 4ODUA 4XBPA 1INQB 4O2CB 1G6RA 3TYFB 3IDUA 1T5WA 3LIZL 5IB5B 4JGJA 2RFXB 4JCLA 3P40A 4PRIB 4YHML 4CDHA 3BKJH 1WIOA 3AREB 4D0BB 5M94B 1ZS8A 4NKOB 4XB8A 1JHTB 1K4CA 2OR9L 4PTUA 4D3CH 2EC9T 2D7NA 3PABA 5FYKD 5DQJB 1W72B 2HVJA 2W9EL 1D5ZA 5M7QA 3H3BC 1C08A 1NLDH 3VWKA 3QI9A 4XI5C 1YJDC 2ZKHL 1XGQB 5FGSA 4U7SA 3B3IB 3IU4L 1KJMA 4WUUE 3LN4A 5I66B 4NZRH 3HCVA 1S9KC 5EZLB 4MA3A 1AR1D 2QSVA 3PDDA 5HGHB 4DUVA 3FRUB 3CVIL 4Y2DA 4FXGB 1GGBL 1J1PL 1OTTC 3HPJB 3WXWL 4AMKH 3O9WA 2HFEB 1EV2E 1SJXA 4KK9D 3RGVC 4MCYA 3DI3B 4NO2A 3SN6N 2H6PA 1U8LA 4Z0XB 4MXVE 1FH5H 5B38A 1QA9A 1VFAA 4PREA 4X5LA 2Q86A 4YDVA 1AXTL 4V1DB 3KYMA 4X4MA 4L3EB 1SVCP 5FUCE 2VXUH 1ZLUH 2GAZB 5JTWA 1HHKA 4OV6F 1FNFA 4PLJC 3OJVC 5KOVC 1KN2L 2ARJQ 5EWIL 3NZ8B 4R97C 4DW2L 3ZSTA 1DDHA 3VRLE 4XWOD 4WHTB 4PRHD 3HNSH 1ZLVH 2NLJA 4MD0A 1QBLH 3THMH 2L7UA 4KJPC 1QBBA 1PDKA 5FFLA 1PG7H 1A5FH 3CFEB 3CFCL 4DGIL 1G9ML 2YPLB 2W9DH 5INDA 1TQCB 1JF5A 5GJTL 3UTSA 4C56D 1CD1A 2FRGP 1HILA 3BZEA 4LVNB 3EYFB 4NQCB 5CZKA 2AEQL 3HZMA 1MAML 2IQ9L 3MA9H 4AL8L 3QUMH 4MQTB 3KJ4C 4P5TB 4OZIE 4POYA 2EKJA 5FUZL 3VFMA 1U8JB 5J1TC 2XA3A 1JGVL 2IANA 4UT7L 1AFVH 3DLQR 3MUJA 1N4XH 1LP9A 4UDUB 5H8DA 5JW4R 1H5BA 1ZHNB 3SEPA 4IRJB 1UT9A 1DQTA 3MR9B 2AJSL 1FNSL 3E8UL 2BCKA 3FKUS 2I9LB 4WDIB 4W6XB 4JFEA 4JPVH 1EDQA 1OF2B 1DBBL 5MEQB 4NJ9H 2Z91A 3T2NH 5FO8A 5HVHB 3LKNB 2ZUSA 2XY1A 1CLZL 2D9CA 4MJ4A 1OAUH 3SBWA 3W9DB 2YRLA 5D96C 5D7SH 3EO9H 1T2QL 2WBJB 3VWKC 3QI9C 4UILL 1WZKA 3ULUC 3JTTA 3WL9B 2ZSWA 3QULA 4HWBH 2GK2A 5I19L 4YWGH 5C0AA 1UZ8B 2FL5A 3GO1L 1WSST 3MRNB 4HZLA 3O6FB 3MLSL 5HD8C 1XCQA 1H15A 4GAJL 4Y2DC 2A83A 1YY8A 2DQFA 4XNMB 3O9WC 3P9LB 4NRZB 2IMNA 4EJ1C 1QQDA 3MUHL 3IETA 4CADA 4C83B 3QR2A 2IPKB 1FV1B 3TIEB 3R8QA 1QRNA 4PRAA 4Q2ZB 1F97A 3BH9B 3QQNA 4OLVH 3JV5A 1WBYB 3GGWA 4X6FB 3T4YB 1G7JA 3HR5B 4NGHL 3PUCA 2X40A 5LCVL 3RL2B 4X5XB 1Z3GL 4G8FA 5GGTL 4L5FL 1YYML 3NIGE 5DDHA 3CMOL 1B6UA 5J8OA 1RMFL 4W4NA 4PJCA 3QJHB 4LLVA 3BEVA 4NKIH 1I4FB 2IAMB 3RZCA 4HS8L 3HE7B 1MF2L 2BY3A 4WU7B 4K94H 4WI6A 1JFQL 2OJZL 1KJ3L 3MRDB 3L5WA 3OR7B 4XCCH 5C0GA 4ESKA 2IPTL 1LO2H 4K7FA 3WHXB 4MMZC 3HN3A 2AJXL 3V5DB 1BVKB 3FQUA 4LDLB 4ODTL 1U95B 1YNTB 4IJ3C 3RJDA 2VXVL 2HRPH 4X4XB 5EOCJ 3C5JB 1LD9B 1MREH 5IEHB 4LQFH 1QSEA 1JPGA 1HQRB 4X6EA 1Z9SA 4NC0B 1IGML 2N7AA 2ZG2A 3S96A 3DUUA 2QKIB 3D48R 3BKML 5D70L 4GKNA 1A9BA 1C5CL 4XVSL 3SQOH 2VDMH 4KHXH 2DQUH 4RBPK 3GSOA 1N59A 3FB8A 3NCEB 3L5HA 4IOSD 3VG0L 4PJAE 1BJ1H 5DUBB 3CFJA 5MENE 1E4KA 3T4AB 1YC7A 4Y19D 5C2BH 5EBMA 1P5VA 3R4DA 1WIPA 1TCMA 5D2LF 1EJ6A 2X89D 3SBWC 1IGIL 1LE9A 3TJEL 3L3GA 1DUYB 2JK5A 1GC1C 4QXTA 5K9OA 4OCYL 2P5EB 4KWUA 5JQHC 1INDH 4ZUWA 3RJQB 1RU9H 4R4ND 2IF7A 1NEZB 4PJFA 1DFBH 1M71A 1YMMB 4U6TA 2F53B 4XWGL 1ADQL 2E6JA 4DKDC 1MFCH 3VFOA 3TLRA 4KH2A 5JDJA 1OM3L 4GRLD 2IWGA 5KW9H 3T1FB 2YKLH 3MRHA 5HGBB 3QDGD 2ICES 5J06A 4GUPA 3OJMB 1RIHL 3QIBA 2R4SL 1W0YT 2X4NA 3B2UC 1WLHA 1CQKA 1TETH 3K81A 4HLJA 5ITFB 1LNUB 4KJWD 2BJML 1IBGH 2WMPA 4R7DB 4G9FE 4H0GA 1MH5B 4NQDD 1IFHH 2NPLX 1A2YB 2FB4L 1Q9KB 1XR8B 5HI4C 4CBPA 1CLOH 3GSVA 4QXGL 1NLBL 2Y1VA 1JF1A 5JHLH 1HH6B 2IBZY 2BMKB 1BQHA 4JJ5A 1GAFH 4ZSOB 1FO0L 4YZFE 3RZCC 3QG6A 2DM3A 1YEFL 3U82B 4JQVA 3OAYH 4RA3A 4ONFL 3LKSB 4NNYA 3ME0A 1QO3A 5E7BA 5DZOA 3B43A 3IF1B 5C9KA 4PLKC 2A6KB 4QF1A 2VLRD 3KLDA 1BFSA 3HPLA 2KPNA 5I1JL 4Q9QH 2R2CA 1MJUH 1AGFA 3QO0B 3EJZD 2ZZUT 1FVDB 5F9JA 4RRPA 1FNGA 2AK4B 3KS0J 1CICA 1T83A 2A2QT 1ND0B 1T0MB 4QCIA 3U9UA 4Z7VE 4GW4B 4E0RB 3ZT5A 3VXUD 3D85B 3X3GH 3SHSA 1BAFL 3U36B 4JZJB 1NCWH 1OCWH 2VQ1A 4OLXH 2UYLA 3U9PH 3Q1SL 2FLBT 1SYVB 2AS5M 4IOFC 2BNRD 1S5HB 3QPXL 5KZCD 4GG6B 2ADJB 4NO5B 5IESH 2X4TA 3ZT6A 2XT1B 2VZOA 2YEZA 3R8BB 4I3GA 5K59E 1OAQL 2BVOA 4ZPTA 1OD7A 1U8PA 2DWDA 5DJCB 1EFXA 1FCGA 3FN3A 5T3ZD 3QUYD 4Z7NF 5EA0L 3PGDA 3K74B 3LN9A 1UC6A 5FM4A 2J12B 5MEOB 3L7EB 5GRZA 1ES0A 5HYQA 4HPYL 3BD5A 1RJYB 2O5ZL 3QIUB 2DQCH 3MCKB 4J1UB 1IRAY 1Q9WA 2UY6A 4J4PA 3UZVB 4UINH 1ZWIA 2IC2A 1HI6B 4NC1C 5K33A 1HYRC 5B3JE 4X0KB 3PL6D 1LO5B 3N1QC 2E9BA 2EYTA 4JZOB 4NBXB 1W0WB 4XBGB 3TEUA 1FO0B 4JO2L 1FPTH 3B9DA 5CJ5A 3MRPB 3IGAB 2NY5C 3QDMB 5I74B 2PYFA 3QIBC 5C08D 1K8IA 4WEBH 4RMSA 3QHFL 2HTLC 3ULVD 5HJ3A 3STBA 3TH4T 3UAJD 3CFBB 1BVZA 4MZ3A 2GSGA 3RY4A 4Q97A 1X5AA 4P46A 3S3SA 3MOBL 3OXSA 4L9LA 4M7LT 4QRSB 2G5BB 1AGDB 5IG7A 5TQ2H 4Y5VA 1PKQA 1GHFH 3BT2L 3RI5K 5E5RB 5GSVB 1OAXH 4KROC 5D5MF 1YN7B 1PSKL 3TO2B 5F9WC 4IDLA 4UOW0 3RX8A 4TULL 4NCC1 2DIJA 3PWJB 5F7EL 4JQVC 4JRWA 2PXYC 5FK9B 3UTSE 4MD4B 2ZPKH 4IS6A 4MJIA 1AY1L 3OF6A 5FYLH 2Q7NA 1IAIL 3HI5L 4OCNC 2GJ6A 1QSZA 5FECB 1YQVL 3DXAA 3IDJB 4O2FA 4KMLB 4H1LB 3QRFM 5D7IF 5DJDB 4HV8A 4R96B 3TBSB 3F7YB 3U1SH 5DHXB 5HHME 3C5SA 3JV0A 1JNHB 4FXKB 1CICC 1T83C 4X6DA 3LRHA 4H88H 5HYSB 1LP9E 1BFVH 2F5AH 4P4RA 1XCTA 4QHUA 4HIHB 3SDAA 3D3VA 4LSUH 3D2UD 4C56B 2FLRT 3MUZ1 5ISZE 4M02A 2H1PH 3K1KC 3TBWB 4M6MH 1R3JA 2P8LA 5DGRA 4YBLB 4G6AC 4EVNB 2GIYA 4JFEE 4OUOA 3IDMB 5D72L 5IQ7L 1QFOA 3QNZA 4JHAH 2DI8A 3O3DB 3DECA 1EJOH 2VABA 3OGCA 4XPAH 5CILL 4JO3L 5D93B 5J6GA 1L7TL 1BD2E 4Z76A 4M6OL 1NBZA 1J12A 4OBRA 5E6ID 4DN3L 2CRMA 3VRIA 5IMMB 4PJEA 4WWKD 2NY4D 1IE5A 3O4OC 3WJJA 5C0AE 5H35B 1NMCB 3MLXH 5I1GH 1AC0A 2HTLD 3OAUH 5ETUB 4J4PC 5IK3A 5IHZA 1NGXB 3K7UA 2WW8A 3EOTL 1T21A 2Q7YB 1G6RL 5BMFL 3C09B 2WBWB 3CSYA 1FFNB 1FP5A 2ZNWA 3BZDA 3GMPB 3PWUA 5A40E 2BVQA 5GGRB 4S1DD 3V79C 2ARWA 1QRNE 4P23D 4ZUVB 1SJHA 1CFQB 1Q0YH 2W0FA 1YPZB 3EDFA 3C6LA 5LWYH 4S1SL 5D1QB 3UPCA 4P46C 3IVKB 1HSBA 3JWOL 3BIAX 2PXYD 3I2CL 4XNXL 4OI9A 4Y5VC 1CGUA 4M6NH 5IJVB 5C0EB 3MV7D 1M7IA 1O0VA 3V9FA 2VDOL 4PJCE 4Y5YB 4HS3A 3RQ3A 4ZXBA 1IGCL 5C7XL 3FQXA 5CKAA 4QXUL 3ARTA 4Y4FA 5I6XC 5KN5B 4MNGA 1D5BA 5DI8A 5FKPA 4R0LB 4XXCC 4EQ2A 3HG1A 1A7NH 5IW3A 5IB2A 1CFVL 2OCFD 4NSKA 4PJ8A 4G6JL 3OKMA 1FZKB 1HEZB 4XNQA 1GGYA 4P9HL 3TBVA 1LDSA 1HHGA 3PJSB 2AXFB 3IFLL 4LSRH 2ZOKB 1E6JL 3J7HA 1H3XA 3QFDA 4I3RH 5E99L 3CX5J 1FVEA 1L7IL 4N8VB 5DJYA 3FONA 5JOPE 5I76B 1F4WH 3EYUL 4UV7L 5F6IB 2BVUA 3BRDA 4R3SB 1ZXQA 3I50L 5IR1A 4RGMB 1EXUB 2A0LD 3DBXA 4FFZL 4JFDD 4L4TD 5LJYH 1RK1B 5IBLC 3SDAC 1DR9A 5J12B 2CMRH 3BP7B 2CLRB 4FMKA 5K9KB 3VFPB 4ODWB 2ZSVA 4ZYKB 4UU9A 3HS0B 4BSWA 3AS0A 2EYRA 2PO6C 3C9NB 4QHMA 4FP8H 4M1CC 1T2JA 1OGAA 1WBZA 4AIOA 3F58L 3DRTA 4KPHL 1P4LB 4FQHB 4MWFA 4J4PD 5CCKH 3L95B 1VKXB 2VDQL 3ARBD 1ZANH 43C9A 1NC2A 5D7LA 3PGCB 2JCCF 1J8KA 1QSFA 5T5NG 1MLCA 2PETA 4LLAA 1SBSH 3CXDH 2OP4L 4KK6C 2NY6D 5IW6B 3O3UN 5CIPB 4QTIL 5FGBA 4CVXA 2PW1B 1YYLH 2YSSB 4NN7B 1MRDL 1QLEH 4NC1E 2F54E 5F88A 3BZFA 4GXUN 2M8XA 4HC1H 3G5XA 1A3LH 2VZUA 4EI5D 1QR1B 5E08H 2VQUA 3PDOA 4KHTL 5F9OH 1R0AL 1NUFA 5H37H 5JA9A 4HIEB 1EZVX 4K7PH 2AK1L 2IH1A 4JPWH 2Y25A 1XF1A 3IFNH 2VSDA 5ESAB 5FB8B 5C09A 1A7RH 3LKQB 3NCYP 3C6LC 4NWUL 4UI2A 5DJ8B 2UWEB 1FFQA 3U4EB 2J3SA 3S37H 5ABDE 1EO8L 1OD9A 4HPOL 3P0GB 1UH4A 1H0DB 1M7DA 4GRLB 2QSTA 1CDHA 3FFDB 3B4NA 5FXCH 1S9XB 3QDGB 4M1DH 2A77H 5T3ZL 1XGYH 3BKCL 1U8NA 2IH3A 4U1MB 4CVXB 4XRCB 4Y4FC 2Z9TA 1EBAA 3FO0H 2D03H 4MQSB 5C0BB 4K2UH 5HGDA 3IFPA 4PLNC 3SJVA 3MNVB 3U46A 2ESVD 4K9EC 4NQDB 3RNQB 2YD3A 1RJLB 3C8KB 1U2CA 1MFNA 3K8MA 5IBLD 4Y1AD 3UP1A 2EDHA 1AGEB 5IUSA 5F1IA 3QNYB 1XAUA 4GRMB 3KVQA 5DHVA 2A38A 3RKDD 3AFLA 3CVHH 4G7YL 2PO6D 4BFEA 4OCRL 1MFAL 1S7QB 1I3UA 4M1CD 4R9HA 4K23L 1JNJA 2IALA 3H7LA 1F3DJ 1WTGT 2RBLA 3B9AA 3KXFA 3ULVL 4CN6A 1I8MB 1GPOL 1DLFH 1XZ0A 3QUXC 4KAQL 5MEPB 1DBJH 2R0LL 5IHUH 1SM3L 2EKSB 4O51A 1SY6A 3D18A 3V6BR 1XF4B 1G7MA 3MUGA 2VLRB 3MRGB 5TDPB 2OYPA 4UZGA 4PJ9A 2FD6H 1AGBB 1F90H 3GSQA 1GXEA 3IXAA 3S34H 3ZDZE 5HI3D 1A6TB 4N0YL 4RAUB 3ZKND 5F3BB 3PQYA 5C9JA 1P84K 1EVUA 4M5YH 5GS0H 3ZTNH 3P77B 3BIKB 4JDVB 3C8DA 4O9HL 3K46A 1RFDL 1RIVL 2Y7QA 3TVMA 2VLKA 4LLDA 3ARDC 1HOCB 3EYQC 5CP7A 4ZFOA 1EX0A 1OAYL 5KZCB 2AERT 5FGBC 2ADIA 4ENED 2C4FU 3EKCA 4F33B 3GMRA 1FG2B 5LGHL 4XVTL 5FV1L 2D7PA 1KTDB 3Q48A 2BSSA 4F7TB 2XG4A 2IGFH 3FQWA 3RVUC 2IEPA 2X1PA 3QUYB 4ZUUB 4LLWB 1K5NB 1U8HA 5DMJB 3X12B 4LCWA 3EDJA 2VXQH 3VFVA 4OZGF 2EEDA 3VGBA 5GGQH 5KANI 5I75C 4OFPA 1MHEB 1ZHKB 1AP2A 2BDNH 5I73C 3WFHB 1KCVH 2B4CL 4ZOAA 3OKDA 1PKQE 5HYJA 3PL6B 4XCNA 4U0RC 3TYGH 1S3KH 2VO5A 3RUGB 1I1CA 4WW2F 3PXJA 3QG7L 3FQRB 3SDDA 4PUBL 3H42L 3OKLA 2UZXB 3CFKA 5CSBA 1L0QA 3BHBA 1C8PA 4KJYB 1AGCA 2ZG3A 2AEIT 4MA1B 5E0QA 3MGTB 2QSCL 3BP5A 3MRRA 3C87A 4MJIE 2B1AH 3V4UH 2VZ1A 1X5IA 6FABL 5DSCA 5CEYB 2GJ6E 1HWGB 3QUXD 1VADB 2PUQT 3LN5A 2PYED 1G1CA 3QQ3A 3SGEI 4LARL 4WTWA 5TE6H 1MQKL 3DUHA 3IJHB 3L3KA 1ZOXA 2R1YB 3WS3A 3FB6B 5ANMB 2VLME 4WJ5A 4GG8B 3S3JA 4X6DE 2NR6C 5B39G 4ONHB 4LVOB 5SX4I 2XTJE 1NGZB 1QR4A 5JOFA 3MLUL 4N1HB 1QSFD 3P3YA 5E5UB 5C07E 3EGSB 4AQ1B 4LCCB 4EN3B 5BS0A 2J8UF 4BKLB 1JZ4A 2P7TB 3B9KD 4R6UA 1TVHA 4LPVA 3ARDD 4IRSD 3F7VB 4ZAKA 4MXQD 1RZGA 5FDWB 4NQTA 4I9WE 2VDLH 2MPAH 1G7QB 2VAJA 5TGBA 4ETQB 3JV4B 4FOMA 2W07A 5TQ0H 5I2IA 1KC5L 2FWOB 3D2UB 1HE7A 4EOWH 2XN9B 4WUUD 1L9MA 5FDYA 4PJEE 4HWZA 4P5KA 2AGJL 2VXTL 3FO2A 1Y6NR 5BVJB 1RVFL 4L29A 4XNZB 4LBEB 4DGVL 1OHQA 4WI2A 3OZ9L 1PX3A 1OP3H 1J0YA 3ROLB 2OM5A 5JQ6L 4OM1L 5D6CA 5L2JB 1BP3B 4Q6IB 4NIKB 1DUZB 5TE7L 4BUHA 4ZQKB 4TUOA 5DEFA 3V4VL 5DK2A 1RUQH 4JG1H 5E6IB 1LWRA 5E94A 1JGUH 5CJQL 1VFBB 4G43B 4UB0L 5BRZD 4JGUA 1IKFL 1DTUA 4WWKB 1KPUA 2BOCA 2NY4B 4ODVL 1N6QL 2DLIA 3VG9B 4GKZB 5CUSL 4N8PA 4YHLH 1RZKC 2EIBA 5DUPL 1CGYA 5DJ2A 1HQ4A 2B1HH 3PHOA 4HUXB 4E41B 1ZLSL 3B6SA 1R5VB 3CIQA 4Y88A 4XP6H 4MNQB 3GI8H 2R0WH 25C8H 4AG4H 5D5MA 3RL1A 3X13B 1CFTA 1DEEA 1NBVL 4OD3H 3GSXA 4XTRC 4PTTB 4Y4HD 3QUMA 5E00B 1U3HD 3TPUA 2E7MA 3N1MC 3SDDC 3BN3B 4YDKH 1CDJA 5D8JL 2I24N 3QEGL 4ODSH 1CU4L 5DJ0A 3HG1E 2X4OB 1BF8A 2V7HB 3U2SA 1GL4B 4YIQA 1NCUA 2P43B 2OI9B 4YXKH 4R90L 5LGKA 1XF3B 4QY8B 1PY9A 4Q9CA 4I18A 4NQUA 5BXFB 3MV7B 1FDLL 2OMNA 2NY2C 5I1DB 3QRGH 2KUTA 3NFPB 3BZ4A 2VLJD 3BE1H 1IAKA 3BP4A 1PX4A 4K3HA 4UT6L 3MJ9H 2CGRL 3RWCB 1CDBA 4HS6B 3TBTA 3INUH 3WJLA 4ZUTA 4G8IB 4X8XA 2O5XL 1NKRA 4WU5B 4H25B 3VXSA 4TVPH 3ARWA 4J3WA 3QUKA 5CAYB 4D9LH 2QQKH 1BM3L 4HJJH 3ZE2F 4D9RE 3PWVA 3AM8A 3CU7A 4HK3N 5HHQA 1OGAE 3JUYA 1NBYA 1RQ5A 4GKSB 5AG8A 3G6JB 2QHRH 4A6YB 5T1DL 4ZAKC 1FL6B 1F4XH 1OAZH 2DQEL 2CLZB 5I17A 2DM7A 2ZUQC 2XTLA 1T4KB 3R06B 4HCRH 3VH8G 5D7LE 3V5HA 2QADC 5L7XH 4UIKL 3IAPA 5J11B 5AEAA 4U1GC 2AJVH 1BOYA 3AXLB 4XPGL 3S5LG 5EBWA 2JKXA 4OZFH 4PV8B 1V7ML 5EO9A 4OTXL 3WFDH 1KYOJ 1MPAH 4JANB 1H8SA 4XPBL 3ARBB 1OTUD 4R26L 1GZPA 3RVVC 2G2RB 3SDXA 3RIAK 4XCEA 2G9HA 4MQXC 4H26A 5C09E 3EO0B 3DTXB 5TDOA 5AD0B 1PZ5A 1EEZA 3N9GL 4DVBB 5EPMA 4OLZH 3QCVL 2ZJSL 4OGXH 4EKXA 1MWAA 5SWZA 5D1ZA 1UJ3B 2HMIC 4OB5L 2JJSA 3GEWB 4BSVB 2LU3A 4EI5B 4DFHA 2WQRA 3RWGB 4LVHB 1TDQA 3T65A 1TJGL 4MHHG 4G42A 1WVZA 2Y4SA 3RPKA 1EHLH 2DBLL 2PR4H 3SJVE 4AENB 2BVTA 1EZVY 2RIKA 3U83A 3F62A 5GZOC 1KB9J 4RNRB 1NGWB 1SEQL 1C1EH 2VE6A 1Q9LB 1U8MB 1FFOB 3ULSA 1JL8A 2DD8L 3P4NB 4KI5D 4P2RB 1OT1A 4EDWL 3ARFD 4I18C 3SY0B 2VOTA 2EH7L 4PB0H 1FAKT 2Q3ZA 1AC6A 4OLEA 2AV7B 4LSDA 1V7NL 3ABZA 5E2TH 3OSKA 3DRQA 1W72H 3KXFE 2ESVB 3BIBX 2WIIA 3WJLC 4PJGA 3ECBA 2YZ1A 1KJVB 1WBXB 3A6BL 3LEXB 4YDIL 5E8EB 5SWSD 4PGDA 4U1SB 4ALAH 5K9QI 4Y1AB 5DO2C 1T66D 4EUPG 4WUKH 4F15C 1F3RB 2QADD 2OZ4L 3AM8C 2LE9A 1AHWA 4XP4H 4PJIF 2GCYA 3SKJL 3SOBH 3PQYE 4X83A 5HDBE 3N85H 5D2LE 2ICWA 5EU6B 2GSIA 4WHYG 4HT1H 1IAOA