4ZG1A

Crystal structure of a nanobody raised against kdm5b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSTFGIRTMGWYRQAPGKQRDLVAIISSGGSTDYADSVKGRFTISRDNAKNTVYLQMDSLKPEDTAIYYCNARVGITMLAHWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and binding properties of a cameloid nanobody raised against KDM5B.
pubmed doi rcsb
source organism Lama glama
molecule tags Protein binding
molecule keywords NB17
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zg1A00
1TCRB 1WISA 3ILPA 4KWUA 1MHPL 2XN9D 4FQQA 2VJXA 4B7LA 1KCLA 2EIZB 3PWNA 3N06B 2XWTB 1F4YH 2DMBA 2FSEB 1LEKB 4K9EC 4P2OD 3QWRD 2NW3A 1Q9WB 5KAQG 4QRTA 4U1MB 4X6CB 2EDOA 3MRPB 5HI5C 5GPRA 4PRID 2VDQL 4IIQA 4X0KA 3H6JA 5FAAA 3IDGA 3HZMA 5IV2B 5EOTA 3BZEB 2AV1B 4OLZL 1K6QL 5F9OL 5AD0A 5I1JH 1S7QA 5IFHH 2BXYA 3FN0H 2JCCB 2E7HA 3MBXL 4HMCA 5CFHA 4UBDC 2VUYA 4QF1B 3B2VH 4Y4HC 5HGBA 5EZLA 3LAFA 4ALAH 1JF1A 1A3RL 1FL6A 5JXEA 3ULSB 1MLBA 1VACB 2AJ3B 3BD5A 3BKMH 2MPAL 3N85H 4WO4C 4TVPH 1C1EH 4D0DA 4JZOA 2ZJSL 4U1HB 4UQ3B 4IBLT 2BJMH 3VGEA 2VLME 2VTFA 4ZPVB 1EV2E 1EVUA 4X5XA 1RU9L 1U8KB 5H94A 5B39G 3UZEA 4KROC 4NZDA 1PEWA 4XHJC 3Q6GH 3GSNH 3BPOB 4CN1A 1UWGH 3RKPA 4Z7WF 3WD5H 4U1JA 4PRBB 3D2UD 4JRYA 4B41A 3VD9A 1A6TA 5HD8C 3RBSA 4OZGB 2X89D 3TLRA 3DX9A 1LVEA 1XZ0B 1OD7A 4JQIL 1NFDB 4X6EA 4GMTL 1F4AA 2C4FT 2PR4L 3E0GA 1NDGB 1SEQL 4HH9A 3D85D 4WNQA 1SEBA 5C8JB 3DGCR 3SDCB 3DVIA 4BK5A 3EDJA 4YHLH 4NT6A 3EZJB 4FFYH 2VR5A 4OI7A 4KRMB 2R29L 4S1DD 4X99A 2DQDH 2IANA 2HFFB 5T1LD 1X5JA 4P46A 4RGNB 2AK4E 4CW1A 3THMH 2WP3O 4HKJA 3SDXB 3VGHA 3LD8B 2LQRA 3CLEL 3QA3A 4BFIB 5E8NB 3K7UA 2EDJA 3SE9H 4L3EE 4APQA 1WITA 2W0FB 1T7YA 3QEGL 1CD1A 4XNXL 4JRXD 4CGTA 4DAGL 4DW2H 3DWTA 4G6KH 2HH0H 4X8JB 1MAKA 2VL4A 3FTGA 3UPCA 2LABA 2G75B 5C0GB 1TZHB 3RUGE 2Q3AA 1K85A 2ZUQB 3ZYZA 2ILLA 1CFVL 3CK0H 3W9DA 2VN4A 3MLTB 3QDJA 2GK0B 4OLUH 1I3GH 2BRRH 4HK0A 1G0XA 1WFTA 2F58H 1S7SB 4ZSOA 2E8YA 1UXWA 1K5NA 2ICEA 3WL9B 5HPOA 3PJSA 4PLKD 5A2KH 3NCFB 4X98B 3BPLC 3RP1A 2DLFH 3QRGL 3TVMD 1JPGA 3BUYB 3G6JB 2VL5B 2X42A 4J4PA 1OAUH 1CXLA 1H3PL 2FO4A 1KUMA 3MRJA 5EUOF 2Z31D 3NFSH 3VFNA 3OKEA 4ZFGL 3DRTA 2GAZA 1RJZA 5T3ZD 5KZCB 3BE1H 1S5IH 2QR0A 3PNWA 1QLRB 1VSCA 3Q0HA 5FUCE 3RL2A 1K8DB 3VFMB 4WI7A 5DD0L 5D72H 1F11A 3L7EB 3C2AL 4PJEB 1FAIL 5DRWB 5T1KB 3KYOA 5T1MB 4KY1L 3U4BL 5ILTH 3TP4A 5DHVB 1RZFH 2BNQE 4GAGL 1CF8L 2GK2A 1AXSA 3ZDYF 2DD8H 1DQLL 1YMHA 3A67L 1KXQE 3QUXC 3PDDA 3D18A 5BO1H 3L6FB 3BN3B 5IESL 2W9EH 2JIXA 3QEQB 1AI1L 3IDXL 1CLZH 4PJAB 1W8NA 1YN6A 2X10A 2BVEA 4Z7QF 1RU9H 1I4FB 2HP4A 3P4NA 2X4TA 3Q6GL 2EDLA 4OIBA 3BMWA 2RQ8A 3LD8C 4I0PB 4IJ3C 5TH2A 5FYJH 3GMPA 3LRSB 1NCAH 4Y5XC 4CADA 3MNWB 5IMLA 1Z9MA 2ADGA 5CMAA 4MQ7B 2FECL 1B88A 1LK3H 2NY5L 1I4FA 1CDUA 5J12C 3MRHA 3PWLA 2VC2L 3AUVA 5FYJE 5EO0A 2UYLA 4GMTH 4NWUH 5IB5A 2P7TB 3HUJA 1H9VA 1U8QA 5TPWH 25C8L 5ALCL 4CU8A 4PJCB 1T21B 5I18L 4MMZC 1ZHNB 2JE8A 3W81A 4M7KL 2ZCKH 1LO5B 3GKWL 5EORL 4PJHA 1KYOK 3W39B 4NO0B 4XXCC 3LY6A 3EUUA 2ZZUT 2H6PB 2IANE 3VG9C 1EH9A 5J1TC 4O58L 4GBXA 4QHLA 4XB7A 4D9QD 3L5WA 3VGGA 2DKMA 1EO8H 4P5TB 4HKZA 5TE4L 1EXUA 1JPTH 1OPGL 5JW4Q 5ICZA 4MNQB 3CX2A 2MQ0A 3QZWA 4JN2B 1SBBA 3EOTH 1FC2D 1S8DB 4UDTB 4F7CB 4RMWA 2VERN 1AGEA 1EFQA 1LP9B 4XBEL 4K94C 4WU7A 5FDYA 3ZKSD 3O6FC 3SKNB 5HGGS 1P4BH 4MX7B 4LCUA 1D5ZB 1P2CA 2BY0A 1A6VH 3QA3B 4BFIA 3LZFL 4PJXB 1L6XA 4PJBA 5F1IA 4F8QA 3MV8B 2FIRT 1ZHBA 1NMCC 1H0DB 3O9WB 3P30L 4APQB 4S1SH 3LN4B 4JLRA 4NN6B 3H7BB 4YIQB 2AK1L 2H3NB 1N0LA 4KROD 1QA9B 4MA1C 3KLHD 1KELL 1BBJB 5F7EH 3QUZB 2HA1A 4LARL 4QRUA 1A1OA 3PQYE 5ADPL 3O11A 2GT9B 2WIMA 1U8PB 3BKCL 5DJYA 4AEEA 3L3OA 4U6YA 2X44D 3L3DA 3BH9A 4X7TB 4ZUTB 2P47B 1NSNH 1JPFA 2OZ4L 3D69A 4XWGL 2OXHA 3MJ9L 3AMKA 4PLJD 5ERWB 4KAQL 1G7HA 2VR9A 2R8SH 1KPUB 3C08H 1JRHL 3TPUA 1FORH 1BD2D 3EO9H 5DR5L 2VLKB 4DKEL 3VRLF 4FN0A 5AUMB 1KSRA 1S9YB 4ZS7L 4TUKH 3EJYC 3CFEB 1VEMA 1YQ2A 3HE7C 3WHXB 2OBGA 1KF9B 2AJXH 1A6WH 2HG5B 1BOGA 5CHNA 4U3XA 5GSRA 3QFDB 2JCCE 3JV6B 3T4AB 2BHZA 3N50A 1BQSA 4C56A 1NAMH 5C08B 1T66D 5BRZA 4GBXB 3I85A 5ACZB 4YPGB 4ODSL 4L4TD 3DIFB 2PETA 3QWQB 3DRQB 1AH1A 4LSSH 2KZWA 1S7RB 1CTNA 3WUZA 4K7PH 4WUUD 5EZLB 3UJJH 5BVJB 4ZXBA 3IU4H 3SE8L 1AQKH 4WGVB 1ZA6A 3WIIL 5JHLH 2A38A 2JCCA 4XNQA 4TULL 4JJHA 2CKBH 3BP7B 5I8CB 1CFSB 1QSZA 5A1AA 3WNLA 5A16A 1D5BB 4IDJL 5AG9A 3ARRA 3FHAA 3C5JB 4S11A 3ZYIA 4EI5C 3T2QA 3CVHB 5F8QC 3GSRB 3KR3L 2IALA 4I5BA 3G5XB 3MNWA 4K8RH 5IMLB 2QSCL 3WFCL 2Q8AL 3M07A 4KHXL 3THML 1J8KA 3NGBB 2IPTL 2XKNA 5JUEL 1SMOA 3BZDA 2PYEB 5DHYB 3IXAB 3BO8A 5E8DL 4GAYA 3SJVD 4PJXA 4BQCA 4HGKC 1JP5A 1T6VN 4HJJL 1JYWA 1IEAB 2IAMA 3PIQA 2B39A 1QFHA 4BUGA 2APBA 3GB7B 3B9EA 2FH8A 3V5DB 2BRRL 5DS8A 1PGRB 1U36A 4XP5H 3RY5A 5GIRB 4UTAH 3RWJB 2H9GB 3MV9E 4K3GA 1AR1D 1BFOA 1AHWB 1JPSL 3HMWH 4OIIL 3RWDB 1HXYA 4P49A 5AYUL 1UENA 3SOBL 4Z76A 4L5FL 5HGAA 3RL2B 2VAAA 4MB4A 5IB4B 4KUCD 1AKJA 1KT2A 1LE9B 4XMKH 1OP5H 1T22A 1U8HB 5TF1H 1CE6B 5GGQL 4XNXH 5E5UB 1Z3GL 1V8HA 4OTXH 3CFDA 5F6HJ 1K2DB 5SWZE 5ICYA 3HE6A 1F8TL 3SCMD 4F3FB 5D2NC 2A6KA 3ARGB 3IJYA 4XP9H 1JFQH 3QISA 4IRZL 5D7LD 4B7IA 2VO5A 4HK0B 2ARWA 5B38B 5DQJB 5FXCH 2DD8L 4OCXH 1BGXL 3EOYG 4JFFB 3HNTH 3EO0A 5EOQH 2EIDA 2YPKA 1D5IL 1BBDH 2NY2D 3VFGH 1KV3A 1Z9OA 4NQEE 5EIIB 2DB8A 1HILB 3OKKA 1RZJL 3K4DA 3HZYA 5D9SB 5GSRB 1RUQH 3IGAB 1PAMA 5E1AA 1T2QL 3O8XD 1I7UB 4JDVB 4PGZA 5EU3B 4K7PL 3GSNL 4OV6F 4EKXA 3L3HB 1EFXD 2O5ZL 4KI5C 2H26A 5HI3C 5IV2A 3HC0B 4YFEA 4MJID 5EN2A 2E7LC 1MSPA 1DQLH 3CVHA 3SBWC 5F9JA 1ZT4B 1MPAL 1ORSB 3DV6B 2EICA 2R0KH 4F7PA 4PJAF 1LEKA 4MJ6A 1J1OL 3HPLA 1A6AA 4XNMA 2RHEA 4GRLA 3CGTA 4XP4H 4Y5YB 4U4BA 3SHSA 4NQVA 4WV1B 5KVFH 5I76A 5JDJA 1I8KB 4KK9D 1BLNB 1FJ1A 3ARDB 1KIQA 2BSRB 2FB4L 4NJAH 1RIUH 3RWIA 4ZODA 3DSFH 5JNYB 2L4OA 1CZ8L 3RHWK 3ESUF 5JZ7C 3VFPB 3FRPA 4QKXB 1SM3H 5SWZB 4PJHF 3ULUC 1KCRL 4PJBB 4Y88A 3RNKB 4MCYA 4L3CB 5F21B 2EEDA 2BCKA 4Z9KB 5F1OB 2R2EA 4DW2L 1IAII 3D85A 3ARFB 4WWID 1HEZB 3VWKA 2V5MA 3FQUA 5I66B 4KXZI 5DQJA 5T1LA 2EE3A 2IADA 3QP3A 2VDPL 1EAPB 3VWKC 3BP4A 2XWBB 4L4VA 5ICXA 1OQOA 4FQJL 4LHQB 1JN6A 3DYOA 4HBQA 3DLQR 1Z9LA 2VH5H 2HMIC 3QJHA 4RZCA 4P5TA 2VLKE 3CFDB 2WIIB 3D1MC 1ZANH 3MR9B 1MH5B 4XMKL 2DQIL 3HI5H 1GGIH 4XXCA 5FYLE 2ESVE 3V5HB 4XC1L 3G04B 4HEME 4I2XE 2PCPA 4R6UA 2F53E 5SWSA 4NDMA 4TSBL 1LEGB 5T3XL 2H2SD 3KYNA 5I16A 2R2BA 4OGYH 3WYRA 1FFOA 1A7NH 5IMKA 3LEYL 3LKPB 2J5LB 3NA9H 5CSGA 2CLRB 4PGEB 4M4RA 4LSUH 5HI4D 3V52H 3KPOB 1GC1H 1P7HL 3GMLA 4GKOA 4ODBD 1MWAH 1UB5B 4KPHH 3IF1B 4L9LC 5I1GH 3RNQB 4QRPB 3SCMC 2D31B 1E4JA 2ZCKL 3HC0A 4FFVD 3P9WB 4HHAA 3L9RA 1F3RB 43C9B 3RDTC 4DTGH 3L3HA 1CTOA 1ETZB 1QACA 3V7AG 1NL0L 4P57B 4G6MH 1VDGA 4OFPA 4XVUD 4OCRL 1DLFH 3SGJC 2YPLB 4UILL 3MFFA 1B0WA 5FUOH 5C7XH 1A3LH 1A7PH 5EIQA 3KPRD 4XNUH 2C4FU 3V6FB 2NX5B 1WEJL 1AR1C 1YEKH 4NC2B 2WAHA 5FYLL 3TBTB 4XVTL 5DC9B 2LTQB 3GM8A 5LWYL 1CDCA 3BKJL 1FBIH 2FD6H 3D39A 1GC1C 3P4MB 4JANA 4OAWB 3BDYH 3JXAA 2AV1A 1LMKA 4RAVA 5L6YH 3RIFK 3VH8B 1S7TA 4MSWB 3U0TB 4N9GB 1MCDA 3CX5J 1G7QB 3O6LL 5CJ8A 3GO1H 3RL1A 3O3DB 1NLDL 1MAML 1N6VA 2BY3A 3IB4A 1WF5A 3SDDC 3HZVA 1IC4H 2OP4H 3MACL 3P77B 2VIRA 1OOAA 3VXUB 2HJKB 5DWUH 3ALPA 5JW3H 3HNSH 4PRIE 4POYA 4MA1B 5DMKA 4CADB 1CYGA 1BJ1J 5FYLD 4ZO6A 4JPIB 3T8XA 4ORZC 3VDBA 4LARH 2HT2C 4NQTA 4I3RH 4ZSOB 1IEBA 5I75B 3WE6B 4P5KB 5IKCA 1BFOB 3VWKB 1MF2H 2OR7A 4WW2A 1AD9A 2XYCA 1S7XA 5CJOH 4AT6B 4IIQC 1UB5A 4KTDL 5CIPB 5SWQB 3QEUA 3MJGX 3QYCA 4N0UA 3SDCC 4EN3B 2NY3B 3OWEA 2ICES 3UBXI 4ZDHB 4HIXH 4PJ8A 4BZ2L 3BRFA 4BA8A 5I1JL 4L5FH 5IVXE 5KSAD 5T1DL 5HHQA 4IDLA 1HKLH 1GGBH 5DDHA 5IWLA 5CJQL 1ZLUH 5IBLD 3UC0L 2WBJD 4Y2DC 3OXRB 4P46B 3BWUC 3ARBC 5E2TL 2R2BB 4L9LB 2DJUA 3JV5A 4WI8A 5J3HD 2L7UA 5FA3A 5E1HB 4RAUA 4LSVH 4AQOA 1A2YB 5KVGH 3DVNB 4CDHA 5EBGA 4RMQA 3QEUB 3DPBA 2B4CH 4ZFOA 1GJIA 1P5UA 1LDPH 1VEOA 3RI5K 4U6XA 3NABH 2DLTA 3LH2L 4NOBA 4IEFB 3STLB 3U7YL 4WFHD 5E8OB 5GJSL 3B8SA 4ELKA 2H8PB 3VI3F 5H37H 2R8SL 5F88A 5IBTH 4WI3A 3E6FB 4XNYL 3WN5C 1A6TB 1IBGL 1TZGH 4XXDA 1EVTC 2EYRA 2X09A 3NH7H 5BO1L 5INCB 3HRZB 3HZVB 5TF1L 4JZOB 3QI9A 2Q6WA 3T65A 2Z93A 4HIHA 4Y8AA 4DK6A 3RNKA 4CVZB 4HV8A 5CBEB 1D9KA 1U6AL 2KDGA 1BFTA 1EJOH 1NC4D 4XAWL 4PY8J 1DBMH 1HHKA 3X3FH 4HWNA 1YEEH 4ZAKC 2A9NH 1MI5E 1BD2A 3N9GL 1G0DA 3QCVH 3KAAA 4NQCE 2IANB 1IILE 1PVHA 2V9RA 2RFXA 3CX5K 5DMIH 3DMMD 2GCYB 1U8QB 3HPLB 4QRTB 3P9LB 2WSKA 4DK3A 4AH2B 3HUJF 1CBVL 4NN5B 4OSUL 5E8PA 5IB3B 1FE8H 5ISZB 1I1AA 3BUTA 3MCLL 4X5WB 4Y4FD 3MRBB 2H26B 4XVJH 2FB4H 5GGVH 4P3CL 1RIUL 2R1WB 4QOKE 4P23C 4ZXBD 2AEPH 1AY1L 2AJUL 2AQ2A 2Y5TA 1FIGH 4XGZA 4FFZH 3HPJB 2GQHA 4Z77B 3FT2B 4PRNA 4UNVA 1MCOL 4YDVB 4TSAL 1TLKA 5IFJA 4OKDA 3S3JA 4QT5A 5CUSL 2C1OB 3QZWG 1HXMA 4K07A 3RGVB 1XIWC 5BS0E 3RZWA 1DANU 1JFQL 5HHME 3WKMH 3A6BH 3KS0J 4LSQH 1NGYB 1NDMB 1E6JH 3D3VB 3LKQA 1INDL 5CKAA 1FYTB 5TE7L 2V2XB 5EZOH 1EIBA 2FNBA 5IHUH 3U7WL 5BOPA 1NEZG 3G5VB 2CLVA 2HWZH 2M8XA 4PRPB 3KPLB 4CKVX 1CLOH 1YEHL 4KK5D 3SJVA 1TNNA 3KPSE 3HI5L 1U2HA 3INUH 3JSSA 2K7QA 3P4LA 2PCPB 1ACYL 1JMXA 3FONB 1UWEH 1RZJH 4HPOH 1AD0A 4LRNL 2R69H 1H15B 1QOKA 2BY2A 4LSVL 2AXFB 3E2HB 2ZUUA 3SQOH 3IDJA 3DETC 2B0SH 1X6LA 3GFUA 4NKMA 2YN3A 4ZYKB 4NBXB 4XX1G 4YXLL 1YNTB 3D39E 3ME0A 4AG4L 3EYQC 4WEMB 4QHUB 2P8MA 1FAKT 4IRZH 1XF1A 2X4SB 4WU5A 3IKCB 2C7UB 1WLHA 1AGBB 2NQCA 4HWZB 4FTVA 3GMOB 4C55A 4JFQA 4HFUH 5IFAL 5CEZL 4M7ZB 4L3CA 3IFOA 2IH1B 3DUUB 2D0HA 2ZUYA 3GI8H 3VXPA 1KEGH 3I9GL 1YUHA 4LCIH 5CHNB 1XGYL 1L9NA 1FPTH 2L0DA 3B3IB 3NIGF 3LQAH 1DQJA 1FZOB 5D5MB 5I8KH 1QQDB 1QYGL 4JPIA 4RMUA 4YFLF 2YBRB 3T2OA 3RTQA 1G6RH 1FO0L 5AAMA 2LV4A 4ZUWB 3EGSA 1MY7A 2E5EA 3V4PH 1M4KA 1MCKA 3G6DL 2BOBA 1GC1L 1CT8B 3DGGB 5E8PB 4PBVC 5ANME 3QNYA 3F5WA 4XPGH 3VD5A 2XG4A 1QSEE 4WO4D 1UGNA 3QIBD 5FHAH 1G84A 3TN0B 3CLFL 1R3KB 4J23A 1X5YA 3DECA 5A2LH 3MSPA 3B9KC 5J11B 5DLMH 3JV4A 4XH2A 1HH9A 2VZVA 2C26A 1P69B 3O6KL 2VABB 1MCNA 1FNFA 3WCYA 3UYPA 5HI5D 4LAQL 1QSFD 2L7JA 1CD0A 2DMKA 4L8DA 1JGUL 1WEJH 5F9WB 1U42A 1J0KA 4HLZG 2FO4B 3MLXL 2BX5A 3HCVB 5DRNA 1TXKA 1BM3L 1WCBA 3C9NA 4LASH 2AK1H 4LCCB 5JMRA 1R24B 2YN5A 5K9OB 1R3KA 5E2VH 3EBAA 4R7DA 5E8OA 1G7LA 3BPNC 3UTOA 1MCJA 4JKLA 5KSUB 3MPCA 3UPRA 2P4AB 1TVDA 3OL2A 2EDDA 4LNRB 4N0YL 5L6YL 3TN0D 4GRMA 4PG9B 4ZFOL 5BZWA 3HAEB 1PSKH 4XCEB 1MLCA 4QXWA 5HVHC 4RAUB 4XMPH 3O8XC 3HKFA 4G9FE 4L4TE 3KDMB 1MHCA 4OQTL 2CXGA 4QRRA 3VFPA 4L9LA 4AEIH 2VN7A 3QHFL 4J12A 4JLRB 3U30B 2ITDA 4OZGE 5KG9A 4I18B 4MA3A 1JNNH 3TT3H 3ULVD 5D7LB 1SJVA 3GZKA 3FN3A 1MOEA 5GGUA 1ZGLB 4XRCB 1T7VA 1N6UA 3C5ZB 1RZFL 4K94L 1CD8A 1J9CT 1T1YA 2D7TH 2IQ9L 3BEVB 2Q20A 4OT1L 5EC1B 5GISL 2XZAH 4HUVA 1NCTA 2IC2A 1J5OL 4UBDD 5HYJA 2X1PA 2HTKD 3IKCA 1KTLB 1M71A 3SGEI 1QHPA 1T0NA 2ADJB 1JWMA 1OARH 4P2OC 3O41A 4XI5C 3F7QA 4JFOA 4DZ8B 3EYFA 5D1XB 4W4OC 3QPXH 1J8HD 2P8PA 5C0IB 1SVCP 4YHML 3F6IA 2FGWH 3PV7A 5E2TH 1NLDH 1L0QA 4X6CE 4LSTH 5SV4A 2DWDA 4KU1A 5J1AB 1J0HA 1E4XH 1W0WB 1ZTXL 3FB8B 3OF6A 5DWUL 4OKVB 4WHDA 1CFTB 2AV7A 4KI5D 5BJTA 3MFGB 5HPMA 5EO9B 3QWRA 3VH8A 4Q9CA 1SJEA 4JVUA 3NABL 2NY6C 3BSZL 4OQ1A 3WXVL 1I85C 3D3VA 4Y5YA 2R0LH 4XNZB 1ZHNA 1ZA6B 3VFTB 3NAAH 1IVLA 1LO5A 4S2SA 1J7VR 1R3JA 3HUJB 5GGVY 3IDGB 4OSUH 3BVNB 4PJCA 3ULUF 1NCBL 3BKML 3KPRA 4KI1A 3D9AH 4PRDA 3BPCA 1CXEA 2P7TA 1MCQA 2YEZB 4JG1H 3QXAB 5MI0C 2AK4A 2XI9A 4MAYB 5DK0B 3S98A 5ESQA 3QPQC 3MFFB 3WSQH 4MS8C 2YSSA 3S3SA 3UZVB 3R0NA 3HPJA 5D93B 3R06A 5JW3L 1BOGB 2ARJQ 2E9IA 3FB6A 4GKZA 2ORBL 4F7TA 4DUVA 3W11D 4J8RB 1HXYB 1W72A 5ESAA 2C9AA 3TA3A 4HCRL 4HBCH 3TBSB 4JFFD 2JIXB 2AAVA 3WFDL 3MRRA 3RWJA 5K9JH 4HXAH 3O3AA 4XCCH 1IM9A 4XBGA 4D9RE 1BQLL 3LMJL 4YEFA 3K46A 3L3DB 4JKKA 3ZL4H 5FGCB 3BZFB 3CDGB 5BMFH 1J1XH 2N4IA 5INDB 1MI5A 1QPPA 5T1DH 4ZTOH 1CR9L 1KBGL 2BC4B 1MNUL 4D9QE 2PXYD 3HE6B 3OTTA 2R1XA 4P2QD 1YEGH 5SWSB 3B43A 1TTGA 5J6GB 4JPWL 2ZKHL 4HSQA 4OJFL 4OKVA 5HHVL 4YX2H 3EOAB 3AXLB 2V17L 5FV2A 5IEHA 3ZDYE 3VWJA 3MV9D 4EVNA 1DQDL 4CMHB 2VXSL 3SJVB 2FYYB 4H26A 4PTUA 1YNLH 2RJMA 3EJZD 1BF2A 3V0AC 1FYTA 2O5YL 4Z7NE 4HZAA 2OCFD 4WVRA 2BSTA 4HT1H 4LEOB 5CEXB 2VDPH 1JWMB 5IBTL 4J6RH 2R9HC 3TCLA 2EECA 3F8UB 3C60A 3V5DA 5C1MB 2PR4H 3QUZC 5D2NE 1H8OA 1DBBH 4YNYA 3STZB 4NKQB 2YUZA 4CVWA 4PTTB 5AAWA 2BJML 2F5BL 4PLOB 5LBSL 2B8OT 1DBKL 4NWTH 4WWKD 5BXFB 1T3FB 3VGFA 4QHMA 4LFHG 4M48L 4K7PY 2FEEL 3HMXL 4ZDHA 2HFFA 5I76B 1A3LL 4P9HC 1FNSH 1ZVSB 1ES0B 3OKOB 3BEWA 3BMVA 2IGFL 4O2EA 2EH8H 1P6AB 1GYAA 1HQ4A 1I1AB 2VDRH 1A3QA 3WO3B 4J1UB 4RFNB 3HC4L 2GJZB 1CIUA 3IJSB 4FQLH 3O3AB 4XBGB 4MNGE 1BWMA 1YA5A 3ZKNC 5I1LA 4N8CH 4NQDD 2A0LD 5DZLA 1L6ZA 1HQ4B 4EN3C 4MJ2A 5IMOB 1GSMA 4N1HB 4EQ3A 4CJ1A 1C5BL 4OZGA 2HAZA 3EFDL 1FN4B 1R24A 4V2CB 3QUYA 4M1DH 1DQJB 5D5MA 2R29H 3U0PB 3RPIB 5EU7C 3H7BA 4YIQA 2QSVA 5C9KA 2AABL 3P77A 3CVHH 1YN6B 1NGPH 4Y19D 1XGTB 2CJUL 5D9SA 3QEQA 2JK5B 4IRSA 2XTJB 5BQ7B 4J4PC 1RUKH 4WFGD 1BM3H 5L2JA 1MLBB 1VACA 4PD4J 1GZPB 4FQHA 4G8GB 4Y5VC 4KC3B 2VNCA 3QG6A 3MCKA 4ODTH 3QUMA 5IJVB 5MENB 2IPKA 3L3JB 4D3CH 5F7DA 2BVOA 4GKSB 3WMSA 4GLRI 1E6JL 3IJYB 5D1ZD 1S5HB 1F90L 1GCFA 5SX4I 1BHGA 3VDCA 1E27A 3MXVH 4JM2F 1T1WA 1FFNA 1YQVL 4QCIA 2ID5A 1OAUL 1U8MA 1KB9K 3OAUH 4MNQE 3UEZA 3DGGA 5HYSB 3KLAA 4DVRL 1F4XH 4GRWH 4NGHH 5IB4A 2FDBP 4XPFH 1JI2A 3MYJA 3CC5A 1HKFA 3PJSB 2VLJD 2VAAB 3O4LB 4I3SH 4AIZA 3TVMB 1DEDA 3GDBA 3H3PL 4QOKD 2NY3D 1CICA 4AG4H 5ALBH 5F72S 3BIKA 3FFCB 3M1BA 3HAEG 1J86A 3C2SA 2EDHA 1KTLA 1QUNA 3LOWA 1Q9KA 4FQ1L 3RNQA 4JJ5B 1B2WH 5FO9B 3SO3C 3B2UC 3QDJE 2Q1EA 2P5WB 3ET9F 3SDXF 5GS1A 5F1KC 3HUJE 3CLFH 2HFGL 4ODVL 5DHYA 1K4CA 2W9LA 2PTTB 5CJBA 4F7CA 4TNWK 1I8MA 4R96B 2XIDA 4IOFC 2KH2B 3TIDB 1UH3A 4GKZB 4KQ4L 1KLFA 4KZEL 5ETUB 3U9PH 3I3EA 5D7KD 1NFDF 3O9WD 4KJQD 5J06A 1LO0L 1RK0B 5TDPA 5KW9H 5DRXA 4LK4A 3S35X 3RVXC 3GK8L 5D8JH 4L8SC 4RFEA 4AH2A 2XOTA 2Y6SD 4PUBL 1IKFH 5T33L 3BSZH 4YDJA 4RGMC 3QAZB 5FKPB 4GS7B 3WS6C 1J88A 3T1FA 4PIRF 3TIEB 2Z91B 1P4IL 2DQJL 5T5NF 1O7SA 1Q0XL 4FXGA 4JRYB 1MIEH 5DD5L 3UMTA 5F97E 5EZJA 4X6FA 5L2JB 3RWHB 2XWJB 4IRSB 3S5LG 1C08A 4HUUB 1BAFH 5A2IH 3A6OA 1GIGH 2DM2A 2WWKO 4R26H 2NY4C 5HHXL 3T0AA 3ZDZF 1OF2B 5BRZD 3WKNA 1JK8B 4R3SB 4JO3L 3O4LE 2GFBB 4F2MA 4MD4A 2GITA 2HKHH 5TH2B 2B1AH 3PGFH 4JFFE 4ZFZA 3FRUB 1HH6B 3WHE0 4WWKB 1Y6NR 2Y25A 5D96B 5J6HA 1S9YA 2APXA 3I6LD 5C2BH 3L5XL 1KCKA 3IYLW 3MLYL 4K7FA 3ARDC 3MRGB 1F3DH 2FJHA 32C2A 1QSFA 1KFAH 1BIIB 4LQ1A 3IDYC 5E6IC 3EAKA 3LIZH 3LQZB 3CVIH 4JFZH 4I18C 1KLUB 4NUGL 1JGDB 5DJ8B 1J1XL 2GY7B 4Q74A 3FQWA 1MJUH 3HI1B 5DDHB 4OUOA 5HHPA 5IMMA 3OBAA 2FEDC 5AZEL 3MNVA 3IGAA 4QHMB 1H0DA 1I7ZB 1LEIA 1NCNA 4YR6B 2CK0H 1EHAA 2QQNH 3T3ME 2OQJB 3NFSL 3V5KB 3SQOL 1UWXK 3MUGB 4NCC1 2R23A 5MEOB 3MLRL 2K7PA 3EJYD 1BEYL 4WW2F 5I17A 1DBML 3UJJL 5C0CD 1OB1A 3MJ9H 2YD4A 4MYWB 4NO0D 5SX4H 3MV7D 4O02H 4PLJC 5D1QA 5GGRY 1TCMA 5DI8B 2V2TA 4G7YL 1UZ6E 4JDTH 4UIMA 4A2MA 3MO1A 4MXVE 2C5DC 4MS8D 4ZTOL 2HWZL 1CGVA 5T3XD 1KULA 1RZ7H 4NQCB 2EE9A 3T3PE 4PJDE 4NZTH 2BC4A 5DVLA 2VQTA 3GIZL 1T0PB 3AGVA 2P44B 1ZLVH 5GGTH 3BHBB 1U8OB 2BRQA 3AM8C 4M62H 3I2CH 5E8EA 3GSNA 4HJJH 4U1SA 3QUYC 2W9DH 35C8L 1WWCA 4G8GE 3V4PL 1GOHA 3GSWB 1QEWA 3QUKA 3T2NL 1AGCA 4BM7A 3RAJL 3MLZH 2XPGA 2ESVB 2D7NA 1QSFB 2Q3ZA 1CFVH 1S7XB 4AIXA 4HGWB 2AVGA 3UBXG 3O0RL 4KI5F 7CGTA 5HYFA 5LGJA 3MRQA 4IHOB 1CLYH 4XP1L 1MCPH 3GI8L 1Y0LB 4UT7H 5IG7A 5DJ6A 3NPZB 1JTTA 1MHEA 5MEND 4PGCB 2V9QA 2D7MA 4KQ3L 2AERT 3O8XA 1FHGA 4HF5L 1BVLB 2X40A 3QIBB 3BGMA 4ZPTB 5ISZA 2GUOB 2EH8L 1YDPA 1B4RA 1FDLL 3MXWH 1FFNB 5BVPL 4OBRA 5DFTA 3VGAC 4ODWB 3JTTB 3VFSB 2VDKL 5E6ZA 1KEML 1JF1B 2HLFC 1MVFA 3D0LB 4RMRA 2CUHA 4ONFL 2BVPB 1R3JB 1DLHB 3GBML 3MUZ1 5C6TL 5DJCA 4TVPD 3H0TB 2MCPL 1UKQA 1EUUA 4QHUA 1JV5A 5TJWK 3TA3D 5B8CA 1QBLH 3DRQA 3FFDB 2VSCA 2MHAB 3MA7B 3UX9B 1IAMA 4OCWL 1IQDB 1K4DA 4PJIB 4ZYKA 1H5BA 2YOCA 4RISH 4X6DE 5GZOD 3IS1X 1RUQL 5DQ9B 1JPGB 1IGCH 1CGYA 3ZO0A 2ICWI 4URTB 5F7FA 4LVHB 4PJHE 5K9KB 5FIEA 3MO1B 4Q0XH 1YMMD 1ZA3A 4ZAKB 3HMXH 1K5NB 3LKOA 3O41B 2NY2C 4JO1H 1MI5D 4DZ8A 3MV11 3MRMB 4NQSB 3DI2B 4Z7VE 3MGAA 4X7SH 1HEZA 5HYJB 1A9EA 2IH3A 1RUML 4DZBB 3D85B 1A02N 1QRKA 1M71B 3QDMD 1K8IB 4ISVB 4XWGH 3I50H 2NY1B 1CG9B 3L3OB 4U6YB 4NPYA 2GTZB 4IMLA 2ENSA 3RTQC 2A6IA 1KGCD 3QFJB 4NKOA 3C5ZA 3OHXA 1EZVX 5CWSB 2KQNA 3BGAA 1GOGA 5FM8A 1RFDH 1ITCA 1QRNA 1XT5A 1KENL 4JZJC 5F96L 4YDLB 1OP3K 1ZGLM 1VPOH 1NUGA 1TJHL 1RSFA 2CJUH 5HDBF 1CGTA 3V0VA 4IS6B 3D48R 3NTCH 3HTLX 2D7TL 1K8IA 4QCIB 3Q2CA 3FKUS 3C60C 5DURD 1DVFA 1SEQH 1MLCB 3WFBL 4TQEH 5T3ZL 3MLXH 3ES6A 3QQ4B 5J6HB 4DKFL 2MKWA 1VA9A 3PHQA 2RFXB 1WCBB 4I9WE 4WEBH 4WTZG 3RRQA 4B50A 3WNPA 5KANI 1XIWD 3T0XA 4E41D 1I3UA 4GSDL 1XF5B 3VWJC 4KQ3H 3ZTJG 1OF2A 2V6HA 4RRPG 4BH8B 1X5FA 2BVYA 2WM0A 4XC1H 3LQAC 3V5KA 1JWUA 3NCYP 1NAML 2H32B 2YPLD 1FNAA 3ABZA 3CPLB 1MHHB 5FYLH 1J1PL 1IKFL 5DRZA 5EBWA 3C09C 1KN2H 1IZKA 4CMMB 1NFKA 4LCCC 3B6SB 1FJ1B 4OZHB 4PP2B 1S7QB 1YN7B 1ZT7B 2XKUA 3ZKMC 4WDIA 1I7RB 4LRIC 4PJ5D 3NFNA 1U8NB 3D39D 2OTWA 3F6LA 1UJTA 3QUXB 2DLFL 4XCCL 3CSPA 3TBTA 1NGWB 3ARQA 3OKNA 3SE4A 5D7JD 5L8JB 2VH5L 1UWEL 3QEQD 1OSPH 4XAKE 3MBED 2XZQH 3JV0A 3OPZL 4NO2B 3V6FA 1JMZA 3SGKA 1T22B 1U8HA 5F3BB 5CMAB 3LV3A 2BMKB 4PJEF 2FSEA 4J8RA 5DYOB 2VR4A 6FABL 3FQNB 3IDIA 3P0YH 1ZK9A 5E4EB 2WLYA 4GAFB 4Z95L 3O3EA 2G2RB 4AQ1B 3NCCB 1XF2A 5DVOA 5FM5O 4TNVF 4X6BA 5KOMC 2H3NA 5IWLC 3IRPX 2DTMH 4K3EL 5BW7A 1UM6H 3QPXL 2ZUWA 2W0LA 1JK8A 4R3SA 2PYFA 5I15H 4GW4B 2NW2B 1YC8A 3H3PH 1UG9A 5ELIA 2CKNA 1P2CB 3G6JF 1ZLVK 3ZE0F 1RUMH 2GTZA 2MJWA 1ZTXH 3D6GA 4POUB 1AGCB 1AGBA 3G08A 3I6KA 4PJ7A 3KPOA 4EUPB 3RVVC 4WENB 4MA8H 3MUY1 2Y72A 3GSNB 4U1SB 4Y5YC 2P8MB 1RJLA 1CDYA 3PWVA 12E8L 2AJYH 3Q5OA 3WIIH 4ODVH 3BHBA 4MB5A 3VFRA 2FBOJ 4YHPB 5ACLA 2Z0BA 1L0YA 4PBXA 1J10A 3UYRL 4EN3D 3ZE1E 2CK0L 1CR9H 1I3RB 3RZCB 4OZIE 3TM6A 4O2CA 1GZQA 4J3OC 5CLWA 2M26A 1G9NH 3HNSL 5IROA 3TBYA 3L3KB 3WN5A 1BJMA 1LK2A 1MUJA 1T2QH 1UB6B 4KJPC 5EOCL 5DEGB 5I6XB 1F8TH 3WL9A 5D2NA 5ECJE 2GSGB 1BREA 4LHJB 3VFOA 1UKSA 1NGYA 5B21A 2XXMB 2EDYA 4N1EA 1YECL 4KUCF 1P9MC 5EPMA 5C09B 5EWIH 4QHKJ 4X4YB 1SYVB 3O6KH 3FT3B 3UO1H 3QO0A 5TGBB 5ACZA 5L0QC 1XGTA 4N0CC 4GRWE 2HT2D 4RMSA 1OAKL 2H2PC 4U7SA 1D9KD 4B0MM 1BVLA 1OT1A 5IM7B 1I1RA 1NC4A 4UDUB 3CFBB 1GGUA 4PB0L 1Q38A 3GSVB 2ZG1A 4XP6L 4OLVH 2JJSA 1LD9B 1E28A 4PJGF 2YA2A 4M7ZC 1B6UA 3SDCA 1WWWX 3L9RB 43C9A 3B9KD 2OMBA 1M7DA 1X5IA 1N59B 4M4PA 1KTRL 5F3BA 5EC2A 4RRPA 1CDIA 5HGDA 5DUPH 4FQPA 1N4XL 2XPGB 1WC7A 4G3YH 1HSAA 1ZEAH 1YMHB 3K2MC 5KSUA 1IAIH 1DN2A 3TT1H 1PLGH 4RWYH 4Z8FH 4KKCC 5DTFA 4OCXL 3V8OA 4Z7OF 4R4FH 1RQ5A 5CJXC 4ONGL 4GS7C 3JWDL 2GITB 4JREC 1DUZB 1F3JA 4J6RL 1H3UA 3SDDA 2CKBB 5I19H 3BGFC 1RZ7L 5I16B 3F58L 4PJBE 3MOBL 4PJGE 4HUUA 4OLYH 3DXAB 1EHXA 4K23L 3MR9A 3PWJB 3B9KB 2A9NL 4I8DA 4F7EB 3QFDA 5J11C 2B1HH 4MA7L 3BUYA 3BXNB 3JV4B 3C8KB 3QJFA 2DKUA 3QCVL 4LEOA 2VLRB 1N5YH 1Z9SA 1CQKA 1JN6B 4DUWA 2XFXB 1FZJB 1KC5L 4P3DA 3GRWA 1CN4A 2IPUG 2R0ZH 2DI9A 2VAJA 5CEZE 3RA7H 4YPJA 1EZVY 1N2RB 3QXTA 3ARGA 1EX0A 3IJHA 2BNRB 2H2PD 1OSZB 4ZO8A 5ICYB 3U7AA 3H8NA 4XPTL 2DQCH 4NQUA 3V0VB 5I1IL 1FE8L 3CZFB 2XWTA 5I6XC 4ODSH 1ERNA 5L7XH 4FXKA 1F58L 3IXTB 3UPAA 1ONQB 1CLYL 2W65B 1N5AB 2H6PA 3OZ9H 2YBRA 4W70A 4LBEB 4P2RE 3GSUB 5E00B 3L5JA 4H1LB 2X1WL 4Y1AE 2ADIB 4M6OL 4PY8I 3SE9L 2OL3B 4OZIB 2ZNWA 3S6CA 3VXSA 4L29B 4DN3H 3MLWH 3UDWC 1RI8A 1F3DJ 1EEQA 5CLTA 1S3KL 1UKTA 4WV1C 4PJ8B 4O5LL 3ROLA 4OZIF 3KDMA 3S88H 4JFXA 5I30H 4IMLB 1D5ZA 4KKCD 2EEBA 3MLVH 2FL5A 5B4MC 4I2XA 1ZLSH 4FTVD 2A77L 3GBNH 3WKML 3I50L 4WW2B 3UTQB 1MQKL 1P7KB 4MJIE 4H0HB 5F8RC 2F58L 4AT6A 3PWPA 2EXYD 1EGJL 4W6YB 3HC3H 4XCNA 4ERSH 3WO4B 5EA0H 1A7OH 2COQA 4XP1H 2NXYB 3R06B 5DC4B 4JN2A 1RURL 5I71B 3ZHKA 5BV7L 1PX4A 3S35H 1EEZA 5GGSB 3CU7A 2NXZB 3OAUL 1G7QA 5FKAA 5IQ9A 4OGXL 3RY4A 4DOHE 1MCHA 2DLIA 3NMEA 2HFEB 4Z78A 3B9DA 2Q8AH 1JHLH 2X9YA 3LRHA 3QIUC 3W82A 3LS5L 2J8OA 1DBJL 4N90D 1TDQA 2IFFL 2APWA 3HB3D 3QIUA 4ONHB 2R4RL 1HINH 3GIVB 1S7UA 4WO4B 3BKYH 1JZ6A 4R4FL 5IR1A 5GXBB 1NGZB 1PYWB 1DEEB 3VXQB 4A6YH 5E9DA 3G08B 3KXFE 4I48A 2QR0B 3PNWB 4TVPE 4ZO7A 5BJTB 3LHPL 4YWGL 3F5WB 1WT5C 4LLQB 1KB9J 2ZKHH 4OJFH 5C08A 1FNEA 2P5ED 3BGMB 3TO4A 3ISWA 1PKQA 1IQWL 3SDYL 1FIEA 2XXCB 1IGTB 2OI9C 3TO2A 1I9RL 5JW5B 2DM4A 1AGFA 1P1ZB 3WNNA 1HHIB 4GG6E 4R96A 4JO2L 2AQ1A 4JQVC 4U6VL 4BK4A 1KPUA 2K1MA 5E7BA 4LPUA 1CICC 3KXFD 3S96A 2P5WD 2K3TA 4QNPE 1IFHH 5MEQB 3M17B 4UMGA 3MRFB 2WQRA 5GRJL 2F53A 4OTXL 5SWSE 4TSCH 3QO0B 2AXGB 4OCSH 5TE6L 4HWZA 2FL5B 3CMOH 2CXKA 1QSEA 1ZT1A 5JOFB 2A1WH 1ED3B 4L29A 3EO1B 1QVOA 5JPMB 4GAYB 2OL3A 3A6CL 4QRRD 2B2XH 4OV5A 3MJ9A 5JA8B 4OLEA 4PJ5E 1HHKB 3X3GH 5BZDB 4EUPG 3VD4A 3ARBD 1F11B 1YNKH 1T5XA 1H8NA 4DN3L 2YA0A 4LGSB 3L3KA 4GQ9L 2X05A 5CP7A 4Y1AA 1ZSDB 2GIYA 1BWWA 3QI9B 3OJVC 1CFTA 4LHUB 2ICWB 5TE4H 5GISH 4GKNA 5C0RH 5JDSA 3ULUE 1BZ9A 4OD2B 3CXHJ 1Z0NA 5CEYB 3GMRA 5E2UL 1N2RA 1A9EB 2IH3B 2IG2L 4KKAC 1I1YA 3VXNA 4YHPA 2BNRA 5CBAA 1DN0A 3C5ZD 2PN5A 2NYYC 3DX6A 3RWGA 4ZFFB 1T03L 5FK9B 3TNNB 3NCYS 4LLMB 4P2QE 1UT9A 5DJ0B 1T0NB 3MJ7B 2XG5A 2BHYA 3GRWL 1AR2A 4HIIB 5IEHB 1MCIA 5B22A 5BQ7A 2VISA 3UTZB 1HIMH 3CUPA 1GGYA 3OGCB 5CJXA 4G9FA 4WFEE 3AS3A 3ROOB 3LPWA 5EU6E 1MCPL 4WI5A 3QUXD 2I9TA 3OKDA 1NMBL 2YPLE 4NQVB 4JM2B 2CIKB 3QCUL 2X7LB 3SE8H 4G42A 1UM6L 1BLNA 5GHWH 3VD3A 1OW0C 4ODHL 4OZFA 4QTIH 4YHIA 1KTKE 3D3VD 5EUKB 1VFMA 4MXWH 5DK3A 1QKZL 4OB5H 1HYSC 4MAYC 3DUSA 1OT2A 3MMEA 3MRPA 3SGEH 2HLAA 2Y23A 35C8H 1J5OH 2X70B 4PJFA 3TC9A 2DWEB 4W68A 5FGRA 4OI8A 1D6VH 3BH8B 4JFYB 2J8HA 4CUCA 2BNQD 3V6ZB 1O5DT 5D7SL 1OSPL 4J1UA 3F7RA 3ESVF 3S4SB 1YC7A 4B5EA 3OQ3B 5L9DH 3TJHC 1M7DB 3LZFH 3OKOA 3MCLH 2AJXL 4JQVA 4YUEL 1PKQE 4NO3B 3B2VL 4FQJH 3CSYA 1IKNC 3GMQB 1FLTX 3BXNA 3U9UB 2AEQL 4C83B 4X83A 4XPAH 2NX5D 4PJ7F 1U8KA 1CL7L 1A0QL 4LCWE 3SGKC 2AK4B 4YZFE 1GGCH 4U2YA 5I8EB 2YD3A 3SKNA 1DEEA 3T0EA 1YEEL 3MCG1 1YYMH 3P4MA 4JANB 5E95B 4KI5E 2DRUA 5E94A 1SMAA 1NL0H 4KK9C 1P53A 3O2WL 4ODXA 1U8OA 4OZFG 5TF0A 3A67H 1FGVL 2R4SH 1R0AH 2UV3A 5FF6B 4UT9H 2EYSA 1RULL 3WN5B 3TYFB 1SY6A 2GAZB 5MERA 3GMRB 4ZFOB 3BZ4B 4TVSa 4EBQH 4Y4FC 2PF6A 1B6DA 4ELME 5CZXC 1PG7X 5HYQB 4P2RD 1RK0A 4M93C 2KL6A 4X9IA 1ZS8B 4TNVK 1FFRA 5C09D 2VDLH 3CCHB 3MV9A 2EXWD 5HVWA 1TZIB 4XCNB 5F96H 2QL1A 5LGJB 1A14L 2AJSL 4HKXB 3T3PF 3CMGA 3PWPB 2X9WA 1T89A 2LAGB 3H9SD 4QXTB 2Y4SA 1XGQA 5E5RB 2OYPA 4K71C 4QY8A 3UTQA 1XCQA 5F93C 3U82B 5I1KH 2H9GA 3OKLA 3IFOB 2R39A 4U7KA 1KNOB 5KSBF 4N0UB 4HJGA 4F33A 3BIAX 4NFBA 2WWMC 4OM0H 4RNRB 2H1PH 3P4OB 2Z92A 4OIIH 4JGMA 2H32H 1DFBL 2J4WH 5BV7C 1F2XK 5LGHH 1B0RB 4JFHD 4P48A 1KIPB 4K55A 4KHTH 1P5VA 1FPTL 4BFEA 5JW5A 3MRBA 3I02B 4QXGH 2V7HA 5L2KB 1UM4L 4NRXA 4OZFH 3MUHL 3NFPA 3RU8L 5HY9B 3VFWA 1EEYB 1VERA 3QDAA 5H2BB 3HC4H 5I30L 5ID1A 4QWWD 3C6LC 2UWEE 3S36L 5BZWB 1ZLSL 1U92A 4YO0A 3FMGH 7FABL 4LNRA 5D72L 1JV5B 5F7DB 2V7NB 3IAPA 4YDLC 3DYPA 2CUIA 4OGAD 2KPNA 1Z5LA 2DIBA 5T1MA 4YUEH 1DUYA 2ZWLT 4NQDB 4KRNA 4MD0A 4M43L 4K8RC 4MQXD 3SDCD 3VXRB 3T0EB 5JR1L 2B5IC 4OZ4B 1KBGH 3CDFA 5I8EA 4Z78B 3JWDC 1L7TL 2C1OA 3CXDH 1BVKA 4U1HA 3U9UA 5FYKE 1E0OB 2XN9E 2EH7L 5HDBE 4NJ9L 1G7JB 1A4JB 2I24N 3PWPE 3IDUA 4GRLC 4OCNC 1W72H 4WTZA 1JYXA 4NNYA 4NHCL 4Y4KD 2J5LC 4JFYA 3MV8D 4CVUA 3O45B 5DJDB 3SDDD 4F7PB 3OR6B 4X0KB 4V1DB 4NN5C 2Q7YB 1ORQB 5TDNB 4GXVH 5EC2B 3B83A 1Q9OA 3G9AB 3U30C 5CP3A 1QEWB 2CD0A 4U1IB 3RUGB 4PGDB 5CP7B 4MZ3A 3W0WB 3M8OL 4YAQA 3AB0C 3MX0A 4TSBH 1I1FA 1OWWA 1F58H 1A8JH 4XPHL 2EDBA 4OLWL 1T4KA 3G6AA 1FZOA 4JO4L 4NM8H 4D9LL 2GFBA 1IGJB 5DJXB 4F2MB 4CW1B 4ZTPH 5HYEA 5I0ZA 4AEHH 3CVHL 2VLJA 1J0ZA 4BSWB 1OL0A 2Q8BH 2WBKA 1HWHB 3I3DA 1MREL 4GRWB 1PG7H 3KYKL 3FCTB 4P2OB 1NEZB 3MROB 1JPTL 5GRJH 1NCCH 4C54A 1F5WA 4L9DA 4UNUA 1LP9A 2XQBH 3O0RH 1R3IH 3GJFA 2MKLC 1S8DA 4LEXH 2OJEA 4JM2D 2AXJA 2XFXA 3AS2A 1NC2D 1V7ML 1VFAA 4H25B 5EBMB 1EXUB 3HG1E 5CINH 4PRAB 5JDSB 5FCUL 2IF7A 4NFDA 5L88H 3FQTB 1WBXA 4Q58C 1GGIL 1UM4H 1DQML 3CZJA 4PRHE 2D0FA 2YZ1A 2LU7A 5HI4C 3WBDA 4YC2C 1FDLH 3CH1A 5B8CC 3G5YB 4MXQD 3HS0A 5ETUA 5HBBA 1Q94B 2DLHA 2R1XB 3C09B 4XVJL 3MZTA 2RB8A 4H20L 2EIBA 3WS3A 1QRNB 2NZIA 2NY0B 4K3JH 5CGMA 4CDGC 4IRJB 4MD0B 4ODHH 4OM1H 3FQXA 1DUYB 4Y16C 5TE7H 5B3NA 1NUDA 2ATKA 4N8VG 1RJLB 4QO1A 3KLHC 5DTFB 4OV5B 4WJ5B 3RVUD 3SGJA 4IRSC 1QFUH 1JTOA 1BFVH 2IQ9H 5I1GL 3D0LA 1BZ7A 4E9LA 5KVMC 3DV6A 2VDNL 4JFDA 5TDNA 5C0NC 1IEAA 1ITBB 1NUFA 1XGUA 4DZBA 2NW2A 4IM8A 4NYLA 2WINA 2D4FA 3IXAA 4PLKC 4ZUWA 3T09A 4NN6C 4TOYL 3ULUH 1W72B 5ESAB 12E8H 2AJYL 5IVXF 3SJVE 3TA3B 1DLFL 3GUTA 4OLXL 5JOPD 1IGML 3DJ9A 2BNRE 1WK0A 2MTPA 2VXUH 1EO7A 4I4WB 1WZ1H 1R5WB 4HGMA 3WO4C 3UTTD 1CFQB 1ADQL 3U6RB 2J8UA 4MLIA 2A73A 5GS0C 1P9MA 2X70A 4FS0A 2YD1A 5EOCJ 5TGBA 4UT6L 3TO4D 1NGZA 1PYWA 2W1NA 3VXQA 4AYFA 3BKJH 2HVKA 1D6VL 3RWHA 3FJTA 4I48B 1A7RH 3GIVA 4R4NC 1MCEA 3IFNL 5F7UA 4NUGH 4FQIL 5IOPB 5IJVA 1OP3H 4F58L 1M6OA 2OMNA 3ALWA 4ONHA 1J0IA 3BGFB 1RUPH 2EXYC 3IXTA 1MNUH 2Q87A 4PTTA 3G6DH 1PQZA 1VEPA 5JXEC 3NTCL 2BNUA 1KCVH 3T4YA 2BVUA 3V4UH 5JHDB 3NZHH 4H25A 2P42B 4GW1B 5EBMA 5A43C 3CFCH 3TYFA 5FOBB 5HD8D 2ZUVA 5E2UH 5D7JC 4JFOB 4PRPA 1A6UL 3X17A 4ACPA 5D1XA 4OLVL 3SY0B 2V2XA 4L4VE 1N5YL 1S3KH 1J8HE 4UV7H 4YHZL 5HYSG 3DROB 3GSQA 2VQUA 2EE6A 3WDHA 1E6OL 1OB1B 1XGRA 2G75A 2GJZA 1P7KA 3MUGA 3N85L 5F6IC 4P4KA 4Z7NF 3I6GA 4O51B 5GRYA 4Z7UE 2BVQA 1ZGLA 3M1BB 2DBLL 2PYED 3BIKB 3FFCA 1B0GB 2VLJB 2OP4L 3MACH 2Z8VC 3ARED 1QA9A 1FYHB 3QQ3A 4NSKB 5JOEA 5CJQH 3JWNC 3DURB 3BDXA 3G5ZA 5EO1B 3MV9B 4Y5XA 5FHBH 1I8LA 3EO1A 5HHPB 3FQNA 3E1F1 3IDIB 2QSQA 4JQXC 4L8CA 3TESA 4Y2OA 5E6YA 4MX7A 2FR4A 5F89B 4XCFL 4NO2A 1WT5A 4O5LH 4NQXB 5JORA 5FGCE 1EDQA 2NYYD 3C6SA 3MJ8B 2A0LC 1NFDA 4X6EB 1S78C 2FX8L 3WJLC 2VDOL 4YHLL 4HIEA 4O02L 3QUXA 5K9QG 3DX9B 3VXTA 4KGJA 2BVOB 4OD3L 1BQHA 4X6DA 2IQAB 4DGIH 3MCKB 5DT1H 3EOBA 4IMKA 1TTUA 1A7OL 4QRSA 1WWAX 5CGYD 1XCTA 3JWOC 1JZ8A 1PQZB 3DXAA 3O3DA 1M7IB 4OIAA 2Y7QB 2GSIA 3AC0A 1AJ7L 2HT3D 3WFZA 5L0QB 1F3JB 1X6NA 3HRPA 2FH6A 3MNVB 2VUOA 3K74B 1T2XA 3MGTA 5ADPH 2OJZH 3EHBC 2V5TA 1SJEB 1UM5H 3CFKB 3VFSA 2GTWA 2UYLB 4MWFA 2QQKL 3JUZA 4E42A 1NPUA 5J1SC 2YD6A 4OFDA 5M95B 3DVNA 1CE6A 2GUOA 3DUSB 3MMEB 5ID1B 4KTEH 1NAMB 4PRHA 2BSED 1JRHH 4RX4A 3LRSA 4ZTPL 3T04D 1OGTB 3QFJD 3D87B 4KK8C 4GG6A 2EZ0C 5GGTL 1QBAA 1A6UH 1YMMA 3LN4A 4RMTA 1I8MB 1KJVB 2OK0L 2OTPA 4NZUL 4M62L 2AABH 2X4NB 1TIUA 4OFVA 4PJ9A 3VGDA 4UU9B 4JGJA 4KXZH 4R7NA 5E03A 1WICA 4YNYB 4KJQC 1GVIA 2C3VB 1VCAA 3FT4A 4LL9A 1HE7A 4LMQE 4LHUD 4XRCA 3WXVH 2ZNXA 2AI0L 3PP4L 2NXZC 4JY6B 3TWCH 1XH3A 2Q76A 2Z91A 1E4WL 2XNAA 1BX2A 1ZA3B 5F1NB 2ZOLB 1CXFA 4AEHL 3H9SA 4LLWB 4E5XA 3LS4H 4WGWB 2R69L 1MAMH 1YNKL 5DFVC 1HIML 4I77L 4QRQA 2OTUA 2B0SL 5HHXH 1W2KT 2HH0L 2ZOKB 1ZSDA 1WZMA 1N4XH 1P4LA 3VH8G 3ULVL 3HAEA 3VFRB 1QFWL 4G6JL 4P5MA 5I18H 1B3JA 3QUML 1IC7H 5LXGH 1QFOA 1AIFA 4PJGA 4KJYB 2LAAA 3QUMB 4QTIL 5DHXB 2M1KA 4GKSA 1GZPA 4FQHB 4G8GA 4TUOB 3VXOA 3P11H 1YPZA 4E41A 2W59A 3K81A 4MNGB 2PW2A 4LU5H 5IIEA 3OB0K 3STBA 4ZOEA 5D4QA 3FT2A 3MBEB 2EXWC 4Y4KB 1ND0B 5IFJB 4WWKC 4QHNA 1XCTB 1KJ3H 2YKLL 3RWFB 4NNPH 3SDDB 4JKWA 1XF5A 2YPLA 5FYKD 2DTSA 3A6CH 1O0VA 3TO2B 3HI1A 3DVGA 3ZLQC 3DBXB 2B1AL 3PGFL 4HD9A 5BW7C 1IAOB 3KWWB 1A7PL 4IHOA 2NXYC 2WINB 5KZCD 4IJ3B 1XGUB 1A21A 4XPGL 5KW9L 4MXQC 4Q9QL 4POZD 1AQDA 4LIQE 3MREB 3LH2H 4GXUM 5FYKU 3QO1A 4BELD 3PQYB 4YGVB 5I1CL 3NFNB 3TO4C 1FNHA 1HWGB 2VXVH 4M61A 1DBKH 5ACMA 1WUNT 1A5FH 1YNLL 1Q72L 5DRZB 2I9TB 5DA4A 1G6RB 1KELH 4M6OH 4RGNE 5IMKB 3CPLA 1FL5A 2CIKA 3DUHA 4H1LA 3MV8A 4RIRB 2ZJSH 3NOIA 1JZ2A 4K94H 4LSPH 2XACC 2BVQB 4NIKB 4P9ML 5EU5B 3STZA 4FXKB 2GJ6E 3RZCD 2ZSVB 5FUZH 1L4IA 3MRJB 3WIFA 4QRPD 3OB0H 1F45A 3OV6A 5LBSH 3EYSH 4NCC2 1HH9B 4NWUL 5C0IA 5C92A 5IUSA 2OL3H 3OKYA 5IT2H 1PZ5A 3QG7H 3VCLB 4HC1L 4I3RL 1XR9B 3ULVE 1CWVA 1SVZA 1QFUL 1LO4L 4IOFD 2YK1H 3SPVB 5E08H 3TPUB 4JDZA 1MF2L 5E6ID 4U6HB 3DHMA 5CEYA 4P9HH 4EDWL 4RFEB 4KMTL 4UTBH 5CZXD 5E24E 1TZHA 4AL8H 2R2EB 4M6AA 1XAUA 3VWJB 5J6GA 15C8H 5CGTA 4OGXH 3RVTC 1DVFC 3PL6B 5L8LB 4P3CH 3V4UL 4ZNCD 3NCJH 1EHNA 4GXUN 4Z76B 4KHTL 2ZP0T 3BRDA 5IF0A 4N0CD 4BQBA 4HUKB 5DUML 3N9GH 2NY4D 5C07A 5TQ0L 4Y4FB 4DAGH 3IS0X 4JHAL 3FT4B 1N8ZB 4DCQA 3JTTA 1RJYB 3DETD 4D8PA 1OSZA 2DM7A 3OAYK 2GW5A 1CGSL 2CIIB 1YDPB 1QLEH 2P46B 4XHQA 3MRFA 5F44A 2BSTB 4RFOH 2WBJB 3MRRB 5IFHL 4PRNB 5IVNA 4FQXC 4XTRD 1P1ZA 2AJZA 4LHUG 3TZVB 3MTRA 4LLYB 4LCCA 3FB6B 5JXED 1NMAH 5DRNB 4NKDA 4AMKL 4MNQA 3F7VA 5DJAA 3NH7L 4PS4H 4PRHB 1MFBL 1VB9A 4RQQB 1MCOH 1DP0A 4L8DB 1I1CA 3BZ4A 1AHWC 3SKUD 3QNXA 1DJSA 4WI6A 5DD0H 5BVPH 4ORGB 4DGVH 3S8WA 3R1GL 1KPRA 4JRYD 4KRPC 1VENA 1AQKL 4U33A 4F9PC 3LVEA 4KDWA 4KAQH 1ZMYA 1U8NA 4OLUL 3CDGA 1I9IH 2PNDA 3VU2A 4L3EA 4OAWA 1FCCA 3CD4A 2P1YA 2HTLC 4CNIB 5JPNB 2QQKH 6CGTA 3MRLA 2GSGA 1FO0B 5EBWB 4X80H 1MWAL 1UEYA 3MYZA 3UTTA 5HGDB 3V4VH 5HXMA 1IM9B 1DBAH 4PG2C 4LKXB 3IAQA 1LO3L 1N59A 2MPAH 4KHXH 4YX2L 3GK8H 5KBNC 2IAND 3PP3K 1FH5L 1OY3B 1Q9LA 1R5WA 1X5ZA 2HFGH 2Y5TB 4O2CB 3BP6B 4P46D 2RBLA 4NQDE 2VXSH 4I4WA 3H9SB 4LLWA 4E5XB 1SJHB 3OXSB 4DKDC 1IL1A 1U3YA 3U2SA 4APQD 4FFZL 1B0RA 4QYOA 4ELKB 4KKLD 2ADJA 1UFUA 1SY6H 4XC3L 1I75A 4TULH 4X9FA 4ENEC 1CS6A 1OHQA 1IM3B 4H0IA 1PY9A 3ARGD 4FMKA 1DVFB 3PL6C 5FYKL 4S0TD 1WTLA 1DBBL 4QHKI 4LGRB 3UBXB 3I75A 1OAXL 2P8LB 5CEZH 3ZMRA 2W60A 3BEWB 1VADA 3GSWA 1R3IL 2JKXA 4K3DH 5E2JA 4QWWC 3TH2T 4ZS6C 5E8EB 3TVMA 3ZDXE 1T1XA 2VDML 4J4PD 4GW5B 1OTUD 2C3HA 1ROWA 5D7IA 4OF8A 1ZHKB 4J3VA 3VXSD 2OSLB 1CU4H 3HS0B 4KZDL 4D2NA 4WW2C 2IBBA 3CZFA 4LCUB 2E7BA 4RISL 2J6EH 1OQXA 1MELA 1V3MA 3KPSB 3S97C 1J1PH 3QUMH 5LXGL 5F7LB 1XGRB 4DKAA 3GSQB 4P99A 3BDBA 1JWSB 3DX8B 4X4XB 5GQBA 4Z6AT 4UZGA 3P9MB 1PLGL 3WEXA 3PWPD 5GS0H 4GQPH 3PP4H 4LU5L 4XWOD 4OZHA 4PP2A 3RJQB 4MQTB 3QB7C 3JBG7 3VFUB 4DGIL 5D1QC 5F9AC 5I75C 5GRUL 3VI4E 4F9PA 3F62A 4NUJB 5HI3D 4XPBH 1FFQA 4U1GC 4M8QB 1MWAA 4FQCH 4Y1AB 3V79C 4W6XB 3MOBH 1AE6H 3PDGA 5MP6H 2VZ3A 1XF3A 4R4BA 2A6DA 3R1GH 3WIHL 4TN9A 4JHWL 1FV1A 5HGHA 2XKSA 1F4WL 2XA8H 4GH7B 5IW6B 2HG5A 4OZHE 2I5YL 1TMCB 4D9LH 2G5BA 1TQBB 1FN4A 1FNLA 3BZFA 3U0WH 2D7OA 3NIGE 1N6QL 1NGXB 2VRAA 5IK3A 2R0ZL 3FOMB 5ILTL 3FO1A 4U1IA 4YDJB 3RUGA 1RY7B 3OX8B 4NHUA 4GAGH 1D5IH 3ARZA 3GI9H 5M94B 3DXAD 3LEVH 2BOBB 1MQKH 1DSFH 2AJVL 3FN9A 4O9HL 5C70A 2Z31A 4KRPD 1FORL 4FQIH 1Q1JH 3L95B 3KWWA 5IK3B 2Z4QA 5C08D 4HG4J 1UYWL 4ZPTA 2Z8RA 4KTEL 4U0RB 1B90A 5D70L 5ESVA 1IC5L 3AM8A 4Z7VA 4S1SL 2D7PA 2W91A 4IOIA 5DLML 4HMEA 1RZ8A 2A6JA 5IW6A 5J7CC 3VG9B 4DQOH 1RURH 1IMHC 1CFNA 4M48H 4HIJB 3S35L 2HJFB 5IM7A 4KKAD 2FGZA 4LRIA 3K2UL 1LWRA 2PXYC 4LLQA 4X8XA 5J8OA 2E6PA 5E2WL 3EZ8A 3VXMB 3KPSD 3JTSA 4OGAC 2XZAL 3RI5F 1I9EA 4JFQB 2ZUTA 4GMSH 4CMHC 1BZ7B 5TE6H 3MRLB 1MCBA 1JGLL 3ZTNL 3FHQA 1X5AA 1ZLUK 2R4RH 1QSED 5AZ2L 4KVCL 2ADFL 3HI6L 3PHQB 4MJ5B 4R2GB 3O4LA 5DEGA 3FO2B 3UTSD 3EFDH 2B20A 3WS3B 2P45B 2HRPH 2PO6C 1K8DA 3QDGE 1NFIB 4X6CA 4Z5RA 3U1SH 1Y6KR 1EK3A 3QQ9D 1CLCA 4Y1AD 1NMCB 4LVHC 2AXFA 3FONA 3WFHA 4IMKC 5MERB 3PWNB 4CRPA 3W9EA 5H37G 1VFAB 1A7BA 2H45A 3G5VA 3ECBA 4Y4HB 2P48B 2AJUH 2AJZB 3KHOA 2BNRD 4D0BB 4W4OA 1QVOB 5EB9A 1WZ1L 5HHNA 5IEKA 2W0KA 3FFCE 5JHDE 2W60B 3RJDA 4G6KL 2OR9H 4HWBH 1HI6B 5DQDL 4PV9B 3BIBX 3HR5B 4BSVA 4J2XA 2J8UB 1TPXB 1GIGL 5C07B 1A7RL 4M5ZL 5GGUB 3KYMB 3TBSA 3WSQL 1RVFH 1QP1A 1UCBH 2ERJC 2SEBA 1U93B 4Y2DA 4G9FD 2A6JB 2G2RA 1NBQA 3V2AR 4F7TB 1I8KA 1SJHA 1Z0MA 4NRZB 4JFEE 3CCHA 3VGBA 2W65A 3LEYH 5LKNA 2BMKA 5CILL 3ZT7A 1IGIH 2Z4QB 1ZGLP 1MRCH 3T0EE 4P4KC 1KB5A 5SWZD 1ODAA 1XF4A 2W38A 4M02A 1S9WA 3CAFA 2FRGP 3EYSL 4PJCF 2Q7YA 3WJJC 2I60H 2UZYB 5C0AA 2WZPD 3RWCA 4C4KO 4XP5L 3C2AH 2OZ4H 1EAPA 1BF8A 2BNQA 3IU4L 3H3BC 3S9DB 1LE5A 4P3DB 1HNGA 3MNZB 1UACL 4ESKA 4PJAE 4JO1L 4AM0B 5FYJU 4Y16B 1CDJA 2YRZA 4KMTH 5JIKA 1TETH 3OAZH 4Y0GA 2DYPD 5F7NC 2XTLA 3MODL 4B53A 3ZKXC 3WFBH 5GRXG 1OAKH 1N26A 4EIZC 1UQSA 5FYJD 1NBVH 3ZTNH 2NY2B 4EI6B 3MNZA 4BFGA 2CK2A 1AXTH 2V7NA 4APQC 3PQYA 1DE4B 3KPMA 2F54B 2NLJB 4ZOBA 3WUWA 1I7TA 4C56D 1BZ9B 4OD2A 2QJDA 1J1OH 2XRAL 4EBQL 2PW1B 3ETBF 3O11B 3QHZH 2VWEE 5MEPB 5C0CE 1C5BH 2D03L 1FH5H 3OG6B 5CSZB 1VFOA 2AI0H 1NC2B 5BXFA 4JO3H 4QTHB 4K8RL 5DHVH 5I8OH 5AYUH 1DQQA 4Y5XB 4HMDA 1AXIB 4KUZL 4G8IA 2ITCB 3BAEH 3BESR 4M8VA 2VLRD 1HZHL 3RDTA 2G5RA 4EEEA 4NP4H 1B0GA 3QIWD 1R3HA 3I75B 4R0LB 2DJSA 2A6IB 2BP3A 3AB0B 3AFLA 3CUPB 1LDPL 3SCMA 3AVEA 3T2NH 4YHOL 4NM4H 5GJTH 1BEYH 3OGOE 3VDAA 4NUJA 1OAZL 5JLZA 1DQDH 1BFSA 1U3HD 4P23B 1FFPB 3G9VA 1YYML 1VFBB 2VSDA 4F57H 3QBTB 5CEXA 1FG2B 4FQ2L 4MVBC 1A4KB 5CAYB 5KSAC 5C9JA 5BV7B 5L2KE 3HC3L 1IL1B 5KTEH 4N5EC 4XCYA 4M1GH 4MHHG 1B9ZA 1PZ5B 4JCMA 4U1JB 4FA8A 5CD3A 2DS4A 3RGVC 2D7QA 5I15L 4EVNB 1S78D 1DBAL 1A9BA 3LEXA 4N5UA 4ETQB 1FNEB 4R2GC 5EU6A 3RL1B 3RU8H 1KB5H 4KKBC 4RGND 3TNMA 2EDXA 3VG0H 1A7NL 5AG8A 5EH1A 4EJ1C 5JQ6L 1QO3B 2YR3A 1S5HA 5EBLA 4E41E 1CVRA 3ULVH 4PJHB 5J13C 2XTJE 1EFXA 5E70A 1QFWM 1IC7L 1EPFA 2F54E 2QQQA 3PUCA 3CNKA 1JGDA 5DJ8A 1B2WL 3Q3GA 1NBZA 4RBPH 5ITBL 2DQHH 1DSFL 4H5SA 1KIRB 2HTLD 4Z7WB 1W8OA 1FRGL 4HPOL 1V7NH 3CH8A 4Y4KC 4PJ9B 1C7SA 3HE7A 4FQCL 1IC5H 4KDVA 1EEYA 5I74B 4EI5D 3N1PC 1N64L 4LLAA 3AAZA 3MODH 3O8XB 1IAOA 5J12B 5F7WC 5C0BD 4JHWH 1N7ML 2OR8A 1G1YA 2VITB 2B4CC 4GUPA 4WUUB 4KKBD 1NAMA 3L7FB 1MAJA 2JCCF 3MRQB 2Z31B 3C5JA 1I8IA 4XC3H 2DKSA 1QD0A 5T33H 3KS0H 3ARWA 4NQCD 4FQXD 3WDJA 4X7FC 3S34H 1CXIA 3MQIA 4G6FD 4O9HH 2DMCA 2EDRA 5HHOD 1RUAL 3TFKD 3GMLB 1REIA 3M8OH 5HHNB 5IEKB 4Y4HD 4L8SB 1DFBH 3LQAL 2DQGH 2DQDL 2CKBL 3BW9A 1T3FA 2GHWB 4HJ0C 4A6YL 4PJEA 2A6KB 1MJJA 3H3KA 4GLRH 1XMWA 5HTSA 3HLAA 1M7XA 2PO6B 3VFMA 4PLNC 4NN7C 3U46B 2Q86B 4HKBA 4MJIA 5SWSD 1PG7L 3V9FA 3WS6A 2DBJA 5C0DB 4R0LC 2A74B 2BY1A 2QV2A 4GFTB 4UINH 5CD3B 3FAXA 2HJLA 4HS8L 4JDZB 1TJGH 2IPTH 3SKJL 4ZMAT 5KS9F 2YUWA 3K1DA 1S7SA 1P4IH 2HVJA 5FV1L 2I07B 2H41A 3KNBB 4ONGH 3PL6D 3DO3A 5C6TH 5KSAB 3C6LA 1V7MH 3F12A 3BP5B 3MJ8A 2KUTA 1IFHL 1MCRA 3WNOA 4U1KB 4R90H 4YHNA 2CIIA 3RX7A 3FCTA 4P2OA 3UZQA 5FO9A 1EERB 1MVUB 4MDJA 4PJDA 1S7VB 1ZEAL 5IGXH 2OSLA 3S37H 5GS1C 2O61A 4XPHH 1JZ5A 3TA3C 1YPZE 2QQLH 4U0QB 4V2BA 4C83A 3VWKD 3LKPA 4H20H 3ZTJH 4LGPB 4RMVA 2FJGB 4PR5B 2Q8BL 2X2YA 1RZKH 4DN4H 2CO7B 3BD3A 5GHWL 4UAOB 3LSOA 2V5YA 3MRKB 4P5TD 5HHVH 4OF5A 2X4RA 1U8IA 5FB8A 1SHMA 4PUBH 1WAAA 4MWFB 1RZIB 5A16B 4ELMB 5C0FA 2OL3L 5FGBA 1HOCB 2XA3A 3SDAD 3ARVA 3E8UH 1DE4A 4KVNL 1BGXH 5EU3A 1FGVH 4ZAKA 4TOYH 1FZJA 3ULUL 1NC4B 4UDUA 4I0PA 5DD1H 4EI6A 5FUCC 1BD2B 1GGBL 3PV6A 4WEUD 1IT9L 1MHPH 4Y19B 1PEZA 4EDWH 4J7RA 4NZTL 3QIBC 2XN9A 2HRLA 2ZSVA 2Y06L 1C08B 3U46A 5D7KE 4PS4L 3L6FA 2ED9A 3PDOB 2X4PA 3EDDA 5HHMD 4AK1A 1KN2L 4N0FB 4WCYL 1NBVL 4X4YA 2VDLL 3NCJL 4HUMB 1YEKL 3T08A 3VXSE 2X1XR 3Q3GB 2CDEB 2EO9A 4HUXB 1M05A 3O3UN 2ZG2A 4M1CC 4BQ9A 1S7UB 5EORH 5FK9A 3QWOA 3H9YA 2NPLX 3VA2C 2ARJA 1YNTA 2ZUXA 2XRAH 3VXUE 3PXHA 1HSAB 3KLDA 1R0AL 1K2DA 3T77B 1FZMB 1OTTC 1FL3B 1YEDB 4U1LB 3QCTL 1X4ZA 5L88L 3BH9B 4X7TA 4NRXB 5EU6B 3K8KA 1I3VA 5DJYB 6FABH 3LKRB 2YS4A 1CFBA 3EGSB 1GXEA 1U8LB 2WUCH 4Z0BL 5CEZD 2Q76B 5HDOA 1EA9C 3B3IA 2FJGA 4NJAL 3PHSA 4PJ9C 3RIAF 4QXGL 3TJEH 3JZ7A 5EUOE 3VXPB 4AMKH 5E2VL 1LQSR 3LKQB 3PWUB 4PJAA 3L5HA 4XPAL 2XZCH 5F7YC 3HZYB 1ED3A 2VE6A 3IDYB 5KVGL 4NFCA 2OZ4A 5KJRL 1HCVA 5DO2D 3LHPH 4BQ6A 1OWRM 1T83A 5GS1B 1RJYA 5C0GA 2I60L 2J7LA 3IDNA 5J3HC 5D7IF 5DEFB 2XZQL 4KJPD 1C5DA 3BWAB 3OPZH 1LP9E 4WTWA 3TYGH 4RBPK 2DAVA 2VE6B 3FO0L 3BT2L 3QIWB 4JY5L 5D71L 1CICB 4HKJB 3SDXA 2J2ZA 4AIOA 1UXSB 4MDIB 3AREA 5FOBA 3PP3H 4C59B 5JR1H 1N5AA 3TNMB 1BZQK 4CJ0A 3QI9D 4ZUSA 1LK2B 3AXLA 3KLSA 4XPBL 5H35B 4FOMA 5T3ZE 5KS9B 3BPLB 1KPVA 3QNZB 4MCZA 2UZIH 1Q0YH 4LPTA 3C87A 1IGFH 1T80A 4JRXA 4ZOAA 2YEZA 1HNFA 3SO5A 4M7JH 2UUDH 4PG9A 4K3HA 1HHGB 4JAMA 2C4XA 2DDQL 5TFSL 2DI7A 4JVWA 2VXQL 3RGHA 3QDJD 1YN7A 4R7DB 1M05B 4ZS7H 1HK6A 5F7MC 1C5CH 2W9DL 1NBYB 3E2HC 5IOPA 1OVZA 3VRLE 1FFPA 3JWDH 4X4MA 5DD1L 3W2DH 4RA0C 3NCBB 3VXME 3WLBA 1QBLL 5BOZG 5DA0B 1KPRB 5JW4R 3PDOA 4HV8B 2NMSA 2HFEA 1I8IB 2Q6WB 2CDFA 1RHHA 3MRHB 3PWLB 4YPGA 1E4XL 4D0DB 3U4EB 5CKGA 4HQQL 3X14A 3LQMA 4Z7WE 5I1EH 5GZOC 3EDKA 3VW3H 5DJ2B 2FEEI 4UT7L 3G6AB 1OAYL 4X6DB 3KJ6H 3SGDI 4H8WC 4R2GD 3OKMA 1MHEB 3B9VA 4KZEH 1I1FB 1VPOL 2X4TB 4O00A 5FEBA 4EOWL 4I0CC 1GPOL 2F19H 5HJ3A 2EC9U 5DC0A 5DD3L 4JY4A 4ELMA 3EYUH 4ODUB 5GGRB 3S4SA 2MMXA 4GBXD 3L95A 5ITBH 4WUUE 1FG9C 3H42H 1D5XA 1MCLA 2DYPA 1WBZA 1NCCL 5I1LB 3BH8A 1LNUA 1R5VB 4Z7WA 5C0BE 4NHUB 2HKFL 2JJWA 1KJMA 5E99L 4PGEA 2BHUA 3X11A 1JUFA 3ZZ1A 3QRFM 4M1GL 4XAKD 4YEEA 3KJ4C 4M7LH 2A6DB 3UJIH 3HAEH 2QADD 1N7MH 2ADIA 4BKLA 3CU1A 2YD2A 4HS6A 3DRTB 4P4RA 1UCTA 3PE9A 4YE4H 2FCBA 1EO8L 4OLYL 1IAKA 1D6EB 4LLVA 3CH1B 3ARFD 2O61B 2DWDB 3KPTA 5ABDE 1NAKL 4H8WH 4CAGA 4PJDB 3FT3A 2YPKB 5CUSH 1JZ3A 4QF1A 1I1AD 2EYRB 3QI9C 4LOUD 5FA4B 1X3DA 4NQSA 2NY4B 2FX8H 4K9EH 3SY0A 5DI8A 4FRWA 4R97B 1AGEB 1TVBB 3RVWD 2BSSA 4XTRC 5AZ2H 3SKOB 3QHTC 1UJ3A 3HG1B 3LN5B 4JRXB 3BN9D 4Z7UA 5IVOA 3MOAL 5MEOA 5HYIA 5CINL 3VFWB 5BRZE 2ICWA 3HE6C 1L9MA 4GKNB 1X7QA 4J3TA 2WV3A 1KN4H 4WIQA 2VB5A 1MJJB 3TBWA 4NRZA 3TBVA 1OGAA 2ZOLA 1MJUL 1S7TB 4MSWA 4NZRL 1WIUA 4O4YH 3KPLA 5HHQB 4U6TA 3WHE1 3CSBA 1RFDL 4L8SA 1EO5A 4DQOL 3HA0A 5HVHB 3MLUL 1DLHA 3BW9B 5JOFA 2BK8A 3S5LA 2Z92B 4GRLB 1QNZH 4BSVB 1SEBB 4JB9L 1QG3A 4JG0H 4HJGB 2A73B 1A7QL 2FIKB 1GGTA 5EFIB 3VRIA 2OR9L 3VXMA 1D5XB 2DYPB 3QNYB 1CFQA 5I1IH 1EGJH 1XGQB 3EW3B 1V7NL 1IEBB 4ODUA 2KQMA 5L7XL 1G7PB 3FN0L 3MBXH 1C8PA 4UB0L 2O5XH 3T8XB 1U91B 2KZ1B 3WE6A 2LFGA 4PGBA 4X6BB 4DEPC 4WY7L 1IBGH 4IOIB 3MYJB 1AGFB 2E27H 1RULH 4W6WB 5FCUH 3KLAB 3ZKND 3MLWL 1Q9LB 1QR4A 2VZTA 1G9NL 2JB5L 5MHSD 1FZKB 2BNUB 4HLJA 4X9BA 5ESQB 1FL3A 1YEDA 3GKZA 1T1WB 3H42L 4TSCL 5J4MA 2ERJB 5DGRA 2A77H 1QLFA 3GBNL 4EI5A 3FO2A 4E41B 1KIRA 4N8CL 5E9DB 5I71C 1YEIH 2VLJE 3MGTB 1Z5LB 1JIBA 3H0TA 1K3IA 5DMGD 4S2SB 1H8SA 1EFXB 2W0PA 2BNQB 1LE5B 4PJFF 3Q5TA 3RTQD 2BVPA 1KLGB 1JF6A 2DQGL 3W11C 2NW3B 4KRPB 4HPYH 1FZKA 2N56A 4L8BB 5L2KD 1VGEH 4BUHA 2CMRH 5LVEA 1XF4B 3DOSA 3OKEB 4XPFL 4HAFA 1D3CA 4NNPL 1GAFH 4M6NH 3RVTD 1IRAY 3WNKA 3QIBA 4PJFE 5GGVL 5T1KD 1RVFL 1UCBL 4NC1C 4Y5VA 1TCRA 1R3LB 2EDTA 1KIPA 4HWEL 2ATPA 3EOTL 4X5LA 3C8HA 1ETZA 3QULB 3R0MA 1ZE3C 3HR6A 4L4TB 3REVA 1NJ9B 3RKDC 4D8PB 5F9DC 2FIKA 4P9HL 4M1CD 4X4ME 1VFBA 1F13A 2F5AH 3CXDL 3S5LB 7FABH 4YHIB 4DKEH 4HS6B 4UIKH 3RVXD 4HKXA 5D7LA 3WXWL 5ISZE 1IGJA 5DJXA 2EDNA 4DGYH 4Q9RL 3BJ91 1U3HB 5B3JE 3PL6A 5JHDD 1OGAB 5E4IA 1U8LA 4S1RL 3ZE2F 1BIHA 4WFFD 2Y06H 2EDQA 3BYYA 1V3KA 1HZHH 3HFMH 1U58B 1A7QH 2IAMD 2CH8A 1A64A 1IGCL 4FG6D 2ZCHH 2FJHB 3MRGA 4U1KA 4YHNB 4E42B 1TVBA 4JE4B 3LMJH 1LO2L 2QEJA 3ULUD 1J05A 2DQUH 3CFKA 4POZC 5I8CA 1UWGL 2O5YH 4M5YH 1NANI 2VDOH 3LKNB 2CGRH 4YZFF 1KTDA 2ZCLL 1NEUA 1HQRB 1D5MB 5D71H 4FQ2H 5AWNL 4LVNB 3ARUA 4YHKL 4M3KB 2Y1VA 5KTEL 1JHTA 4ETYA 5D2LE 2P24A 4QXUL 2FJFA 3UTSE 4ZG1A 5LAXA 5I19L 1PJ9A 1AKJD 4M03A 3TH4T 1WBYB 1BVZA 1YEGL 4KV5E 1R3HB 4R0LA 2LU4A 2W0FA 1WGOA 2B5IB 2DQEL 3U48A 2FX7H 3O2VL 1T7ZA 4Q7DA 4R9HA 4G43B 4I0PC 5DGQA 2APVA 4M7JL 4FZ8H 3BE1L 4PJ5B 4ZNEA 4PB0H 3U0PA 1FNSL 1G6RA 1T4KB 4JFFA 5I1HH 3PHOA 4ZAKD 3IFPB 1KENH 4MD5A 4QTHA 3BN9C 1CCZA 3FQWB 1HQRA 3BAEL 4HLZH 5FDWA 3S88L 4RDQG 4A6YA 2OJZL 1U92B 3QQ4A 1NCDL 2X4OB 1FLRL 4U6XB 1FC1A 5F9JB 4DUXA 3CVIL 3MREA 1CGSH 4YXKL 5CZVL 1RMFL 2CMRL 4RQQA 1A2YA 5C0EA 5IESH 2VZ1A 3GKWH 3OKMB 1AKJB 4YQXH 1I7UA 2E7LA 4QRUB 5CD5D 4L4VD 1OGAE 1ZXQA 4WI2A 1WWBX 3G5ZB 2AEQH 5KVEL 3U4EA 2OS7A 3OHXB 4LQFL 1MFAH 4KRLB 2IBGA 5JOPE 4U2ZA 4PRIB 1EAJA 1QKZH 4O51A 4OB5L 3VWJD 2V17H 5C71A 1OTSC 2VC2H 3TFKC 1YPZB 5L8KB 4U1NB 5I0DA 5EU4A 1FGNL 4MA7H 4OZ4A 1OAXH 3DX7B 3V0WH 1BQLH 1J8HB 5DHVA 2YXMA 1JJUA 2NTFB 3BO8B 3MV7B 1G0YR 5C3LD 3FQXB 4ZFFA 1F90H 1YZZA 3K4AA 2VOTA 4OI9A 2XKNB 3MV01 4TTDC 3C5SB 4KJYA 5KN5B 5B3JF 3X13A 3PF2A 3SOBH 2R2HB 4HK3J 1JVKA 4NKIH 1U3HC 3LKRA 3IVKB 1KN4L 5HYSA 1ZOXA 5CIPH 1GZQB 3T4YB 2Y36L 1LE9A 3NZ8B 1DDHA 1AI1H 5DJAB 5LCVH 2WIIA 4Z5RB 5JXAH 3T77A 4KK8D 3DO7A 4G80B 1Q0YL 1ZHKA 3SKOA 2R2HA 3ARDD 5F6HI 2D2OA 2NR6C 3TIDA 3MA9H 4PB9H 4XNQB 1LDSA 1QNZL 3LDBC 2N1KA 4PJDF 4LVEA 3OAZK 5BVJA 5DEFA 3EYUL 4JFEB 4OBSA 4P2RB 2IPUK 3MZGB 4EUPA 1KG0A 3BQUC 1T21A 2OI9B 3P4OA 1AO7D 3VE0A 2PXYA 2ZPKH 4Q9QH 3IT8D 4WFHE 4EI5B 4P2QA 5IB2A 5KAQF 1UZ6F 3RIAK 3NIDF 5TPWL 2RGSA 2HT4C 1INQA 5IKCB 3NZHL 3KJ4B 4QXTA 1OP5K 4WY7H 2DQEH 2CQVA 4P2YA 5D2LB 1OGTA 2VITA 4HIJA 3NACH 5IMMB 1CZ8H 4NBYB 4GQ9H 4JHZA 4YHMH 4LSPL 4QRRB 3O3EB 3OJMB 1B4JH 3WLWD 3QEHB 4YAQB 4I13B 3W0WA 4XBPA 3MXWL 1NGPL 3Q5YA 3C60D 1PKOA 3OJDA 3X12A 4RGOH 5HHOB 4JG0L 4U49A 5I2IA 4NBZB 1CK0H 4U1LA 1ZT4A 3D18B 1BECA 3D3VE 2EYSB 3IDMB 2DN7A 4GO6B 4MVBD 3FO1B 4HFWA 1LO4H 4GT7A 2QADB 3FOMA 2G5BB 1F6FB 4WWKA 2OTWB 4K3DL 2O93L 5MHSE 4JDVA 2NZ9D 2B2XL 4BH7B 4NNXB 3CSGA 2ENYA 2MQ3A 4HPYL 4JKPH 3KGRA 3NN8B 2F8XC 4ZXBC 4ZPVA 1M7IA 2WP3T 1P4BL 2JK5A 4YHOH 5GJTL 3KPPB 2AEWA 2NY5C 2XN9B 4QRSB