4ZGNB

Structure cdc123 complexed with the c-terminal domain of eif2gamma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
103
Chain Sequence
LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords Cell division cycle protein 123
total genus 15
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgnB00
3QE2A 3CCJB 4G1VA 3CMEB 1D1NA 1YJNB 4RD2A 2BGIA 5GV7A 4DQKA 4RJLA 5TY0A 3OZWA 3W5VA 1JA0A 1N8RD 1VQ5B 1BX0A 3AVTA 1ELOA 1GO2A 1E64A 1JJ2B 3AVVA 1A8PA 1U2RA 3I56B 1ZUNB 4P6VF 1KQSB 1GJRA 1OB2A 1VQ9B 4G1BA 1GR1A 1S0UA 1GAWA 4Y9RA 2BGJA 5FA6A 1B2RA 3G6EB 4B43A 1CNFA 3AGQA 2J7KA 5H59A 1TLLA 2PMDA 2EFGA 3AVYA 2QTZA 3CCSB 2VZLA 4HE6A 4RD6A 4PC7A 4TMZA 4ZGNB 1KTVA 1AIPA 3U2QA 2EIXA 2DY1A 1JNYA 2YWFA 1EFUA 2DERA 1QFJA 3E1YE 4ZGQB 1R5NA 2OK7A 1N0UA 4AC9A 1H42A 4C43A 4IW3B 5TR9A 1QG0A 4B48A 4YAOA 1KJZA 1CNEA 2GPJA 1VQLB 1K8AD 4UAJA 4G5GA 3CC7B 4TMXA 1R5OA 4LBZA 1W35A 1G7RA 4N3GA 4ZCMA 2OK8A 1QGZA 3G71B 1Q82D 4Y7CA 2DEUA 1KK2A 2HDNB 2QDXA 1VQPB 2VNKA 4J0QA 4M4SA 1D8TA 1EWYA 2X3UA 1Q7YD 3CCVB 1EP3B 4AF6A 3MCAA 1IJFA 1KRHA 3W2GA 4TMWA 3ZZTA 3QFTA 4QHYA 4LBYA 1G7CA 3VO1A 3JQQA 2DETA 1EP2B 2VYQA 1QVGB 3WNCA 1AMOA 1NJID 4DQLA 4Q7JB 3AVXA 3VMFA 4MYTA 2BV3A 1FNDA 2YWGA 1TVCA 1M90D 1S72B 3JQPA 1KK1A 1VQ4B 2HCJB 2NPFA 4ACBA 4M2LA 1OB5A 3ZZUA 3CB4A 2BVNA 4B44A 4Y9UA 3WXMA 4BPRA 1VQ8B 1E63A 2OTLB 2DCUA 4LBWA 3FJOA 4FWTA 4ZV4A 1H85A 1FNBA 4N3NA 3W2FA 1W87A 3OW2B 2VNHA 1SKQA 3ZBUA 2R6HA 2CRVA 1HA3A 4ZCLA 1QH0A 3J81k 1R5BA 1SM4A 3CC4B 4PC2A 1YJ9B 3V76A 5EMNA 1NDHA 1FNCA 3QFSA 2BPOA 3CW2A 2BM0A 1IB0A 1YITB 2ZITA 1K9MD 2FX3A 3ZC3A 1K73D 3WYAA 2XNJA 1KC8D 3WBJA 1Q86D 1VQKB 4P3YA 4EH1A 4FN5A 1I7PA 3U6BA 4B3XA 1ZM4A 4YAUA 3CC2B 3ZBTA 2PLFA 1EFTA 1FNMA 3CCLB 2OTJB 2QA4B 3W2EA 3QSYA 1BJKA 4F7DA 1OGIA 4K1XA 1JA1A 4YALA 3CRZA 3VNVA 4RD3A 2B5OA 1BX1A 3CCUB 3B82A 4B4DA 3CCRB 2D74A 4RD1A 1E62A 2GQFA 2PIAA 4TMTA 2XNCA 2B7BA 4NCNA 1QFYA 2VNJA 3I1FA 4PC3A 1N0VC 3W2IA 5KSWB 3P26A 2BM1A 4YAFA 1F20A 1QUEA 1EXMA 4YAWA 3AGPA 1DG1G 4U9UA 1KD1D 1DDIA 3VNUA 3CXCB 1GVHA 3AVWA 2QTLA 4YHBA 1JB9A 2RC6A 4NBSA 3MMPA 3VO2A 1XB2A 1CQXA 4WQMA 1B23P 3OZVA 3WBKA 1W34A 1QVFB 2XEXA 3JQRA 1G7TA 1D2EA 4RD4A 1TUIA 1UMKA 2AHOA 3LVBA 3PENA 3W5HA 3CD6B 3CCEB 4RD0A 2YWHA 1QUFA 5JBQA 4RCZA 2QMUA 3ZZ0A 1YI2B 4R71A 2B7CA 3OJWA 2YWEA 4ACAA 3W5UA 1VQNB 2RC5A 2C78A 2QEXB 5HXBA 5GV8A 2C77A 1KK3A 3WY9A 4M53A 3AVUA 4LC0A 1QFZA 3G4SB 1VQOB 4B47A 4QFMA 3OJXA 1OGJA 4LBVA 3ES9A 1YIJB 3MHPA 1QX4A 2HMAA 1FRNA 4M1KA 3B8HA 4PGOA 3WNBA 3P27A 3FPKA 3QFRA 3OZUA 3LO8A 5DSZA 1M1KD 3QFCA 2VNIA 1W2BB 1XE1A 1FDRA 5H5JA 1QGYA 2QN6A 2BSAA 1FRQA 4TN1A 1G7SA 1VQ7B 4M0LA 1ZM2A 1GAQA 3SJZA 5TV2A 4HE5A 4TMVA 1QGAA 1DARA 1Q81D 1VQ6B 4FK8A 4AF7A 3CPWB 3CMAB 1VQMB 3E20A 1YJWB 4C0SA 3U6KA 3CCMB 4RCYA 5AN9A 3CCQB 3WNDA 2BMWA 1KK0A 1DDGA 4PC6A 5THXA 1BQEA 4ZCIA 2CNDA 2E1RA 1F60A 1ZM9A 3W2HA 2BN4A 1EFCA 1TTTA 1IJEA 1J9ZA 4H9GA 2BF4A 1ZM3A 3B78A 4MYUA 3I55B 4PC1A 1YHQB 1EP1B 1WDTA
chains in the Genus database with same CATH superfamily
3QE2A 3CCJB 4G1VA 2V7UA 3CMEB 5FO0A 1D1NA 1E1QA 4RDJA 1YJNB 4XQFA 5A89A 2ZTNA 5J35A 1P4MA 2GK7A 4RD2A 2WSSA 3GVLA 4E0FA 1UD8A 2BGIA 5GV7A 5J3OA 2ZBUA 5DS0A 4DQKA 4RJLA 5TY0A 2VBUA 4X7DA 3ONYA 3OZWA 1WSRA 4WZEA 1JA0A 2M5SA 3W5VA 2X8KA 3Q38A 1N8RD 1VQ5B 4RDKA 4OOVA 1BX0A 3AVTA 1ELOA 1HVXA 5KNLA 2R9VA 1GO2A 1E64A 4TT3A 1JJ2B 3AVVA 4XOPA 1A8PA 1U2RA 3OE7A 4XL9A 3I56B 1ZUNB 4P6VF 1N08A 1KQSB 3PUMA 1VHOA 1UD5A 2F1MA 2V7TA 1GJRA 1I8DA 3GVKA 1H8HA 1OB2A 3CTAA 1VQ9B 4G1BA 1GR1A 1S0UA 2ZTGA 4P9SA 1GAWA 4KKSA 1WSVA 4Y9RA 1K28D 2BGJA 2PE3A 5FA6A 1E3XA 1B2RA 3G6EB 4GQNA 4B43A 1CNFA 3AGQA 4XD7A 2J7KA 2CF4A 1XQBA 4P22A 2GJRA 1TLLA 2PMDA 5H59A 2W6IA 4G6IA 2EFGA 1BMFA 1PKVA 1IHMA 3AVYA 3LNNA 2QTZA 4DNRB 3CCSB 2VZLA 4DNTB 2JIZA 2JDIA 4HE6A 4PC7A 4RD6A 4TMZA 5B6IA 4CQJA 4ZGNB 4RPBA 4P6YA 1KTVA 1OHHA 3NE5B 1AIPA 3U2QA 3JU4A 1SKYB 2EIXA 3A8KA 4PABA 2VBVA 4AVZA 2DY1A 3BC9A 1JNYA 3ISXA 2JJ1A 1NRKA 2YWFA 4TSFA 1EFUA 2WJVA 2DERA 1QFJA 3E1YE 4QV2A 4ZGQB 5FIUA 1R5NA 2OK7A 1N0UA 4AC9A 4X0CA 4XLFA 1H42A 4C43A 4IW3B 5TR9A 1QG0A 2ZZQA 4B48A 4YAOA 1WTHD 1KJZA 1UD3A 1CNEA 4PAAA 2GPJA 1BPLA 1VQLB 5HZAA 2XOKA 1K8AD 4OP7A 4UAJA 4G5GA 3CC7B 4TMXA 1R5OA 4LBZA 2GREA 2QGGA 4II3A 5A88A 5IYQA 1W35A 1W0KA 1G7RA 4OOXA 4N3GA 4ZCMA 2OK8A 4P3IA 1QGZA 3G71B 1WPCA 2DIEA 1Q82D 4Y7CA 3OW7A 2WJYA 2DEUA 1KK2A 2HDNB 5BSXA 2QDXA 3BH4A 1VJSA 1VQPB 2VNKA 2F4NA 4XKWA 1VF7A 3LQEA 3ZIAA 4J0QA 1S4MA 4M4SA 1D8TA 1EWYA 2CK3A 2X3UA 4X7CA 4XORA 2C2WA 4XM3A 3CCVB 1Q7YD 4P1VA 1EP3B 2W6JA 4AF6A 3MCAA 3R6JA 4P25A 1IJFA 1FX0A 1KRHA 3W2GA 4XN3A 3CESA 4TMWA 4X07A 3ZZTA 1EP1B 4UZEA 3QFTA 4QHYA 4LBYA 1G7CA 2WPDA 3VO1A 1V5VA 1UD6A 3JQQA 2DETA 2X85A 1EP2B 2VYQA 1QVGB 2X6WA 1RQPA 4UZFA 4II2A 1WOPA 3WNCA 1AMOA 1NJID 4DQLA 4Q7JB 3AVXA 3VMFA 4MYTA 3SLNA 2BV3A 1FNDA 1RQRA 2YWGA 1TVCA 2ZBVA 1M90D 3BCDA 2P3MA 1S72B 3JQPA 1HZEA 1KK1A 1VQ4B 1EFRA 2HCJB 4P26A 2NPFA 3A3GA 4M2LA 2WYRA 2ZZEA 4ACBA 4G7WA 1OB5A 4QUZA 3ZZUA 3CB4A 4P2NA 2BVNA 4B44A 3CMMA 1MRZA 4Y9UA 4KKTA 3WXMA 1H8EA 5L46A 4BPRA 1VQ8B 4QVJA 3OFNA 3LQ6A 4RPDA 1E63A 2OTLB 2DCUA 2F43A 4LBWA 3FJOA 2XGJA 1MABA 2GJPA 3A1PA 4OPSA 4OPOA 2Z6BD 2XZOA 4FWTA 1V0EA 1W9XA 3Q6RA 4ZV4A 1H85A 3OAAA 2XZLA 1FNBA 4ASUA 4N3NA 3W2FA 2WZNA 1W87A 3OW2B 2VNHA 3ZPNA 1SKQA 4YELA 2F1LA 4QVAA 3ZBUA 2R6HA 5DN6A 2CRVA 1HA3A 4ZCLA 1BLIA 1QH0A 4HIZA 3T56B 3J81k 2D3LA 4DK1A 2KVOA 2VJIA 2CW5A 3ASQA 1R5BA 1SM4A 2CBXA 4Z4UA 3CC4B 2CC2A 4G7XA 4PC2A 4Z4RA 1YX2A 1YJ9B 3V76A 5EMNA 3BCFA 4DK0A 1NDHA 3VR6A 1XFOA 1COWA 1FNCA 3QFSA 2BPOA 3CW2A 1PJ5A 2BM0A 2C5HA 1IB0A 2XZPA 1YITB 2ZITA 1K9MD 2FX3A 2X6YA 3ZC3A 1K73D 3FPPA 3WYAA 2VJJA 4XLHA 4RDLA 2XNJA 4XONA 4OPVA 5F4MA 3OOCA 4RM0A 1KMHA 1VHEA 2V7VA 1KC8D 5A8AA 1T5EA 4P12A 5FNZA 3WBJA 1Q86D 1VQKB 5IYRA 2C4TA 4XLCA 4P3YA 3SLDA 4EH1A 4FN5A 5IYNA 1I7PA 3U6BA 3ZUGA 1ZM4A 3GQBA 4NNJA 4B3XA 4YAUA 2WZPP 3ZBTA 3CC2B 2PLFA 3SKBA 1EFTA 1FNMA 3CCLB 2Q6OA 3BQJA 2OTJB 2DYIA 3BY1A 2QA4B 1VLOA 4B3GA 3W2EA 3QSYA 1BJKA 3PA2A 4F7DA 2VBSA 1T6XA 4WWVA 1OGIA 4K1XA 1W0JA 1JA1A 4YALA 3CRZA 2VBTA 4RLZA 3VNVA 4RD3A 2B5OA 3OP1A 1N07A 1BX1A 3CCUB 3B82A 1T6ZA 3BY2A 4B4DA 3CCRB 2D74A 4RD1A 4Z1MA 2ZZGA 4Z4ZA 5IK2A 1E62A 4X8IA 2GQFA 2PIAA 4TMTA 4X06A 3SEJA 5BSYA 2XNCA 2B7BA 4NCNA 1QFYA 2VNJA 3I1FA 4PC3A 1N0VC 3W2IA 3T53B 5KSWB 5IYWA 1PJ7A 4ROXA 2LZJA 3P26A 2BM1A 3A3BA 4Z4WA 4YAFA 1F20A 2V7QA 5E6TA 1QUEA 1EXMA 3SJPA 4YAWA 3AGPA 1DG1G 4U9UA 4XN0A 1KD1D 1DDIA 3VNUA 3V7AA 3CXCB 1GVHA 3AVWA 2OBSA 2QTLA 4YHBA 2ZL7A 1JB9A 2RC6A 4NBSA 3MMPA 2I1LA 3VO2A 1XB2A 1CQXA 3G05A 4WQMA 1B23P 2XNDA 3OZVA 4OOSA 3WBKA 1W34A 1QVFB 5F4JA 2OYNA 3PA1A 2XEXA 3GSIA 4L8JA 3JQRA 1E79A 1G7TA 3A8IA 1D2EA 3T51B 4RD4A 1TUIA 1UMKA 2AHOA 3LVBA 3OKXA 3PENA 3W5HA 3CD6B 3CCEB 4RD0A 2WR8A 2YWHA 1QUFA 5JBQA 2HLDA 4RCZA 2QMUA 3RY8A 4JMQA 4KKUA 3ZZ0A 1YI2B 1NB0A 2GJKA 4WZTA 3PUNA 2ZL6A 4R71A 2B7CA 3OJWA 4XLEA 2D9RA 2JN9A 2YWEA 2GK6A 4X05A 3PVDA 5FL7A 1PJ6A 4ACAA 2X0KA 3W5UA 1VQNB 4Z4SA 2Q6LA 2RC5A 2QE7A 4YEJA 3H94A 4WZLA 2C78A 2QEXB 1N05A 5HXBA 5GV8A 3CP8A 1E3ZA 3GIRA 2C77A 1KK3A 2C4UA 4Z4TA 3WY9A 4M53A 3BNWA 3AVUA 4LC0A 1OB0A 1QFZA 3G4SB 3H9NA 1WORA 1VQOB 3ONUA 1V0FA 4B3FX 3CPXA 2NV4A 3KEWA 4B47A 4QFMA 3OJXA 1OGJA 4X7EA 2V7WA 4LBVA 3Q6QA 3ES9A 1YLOA 4X7FA 3D26A 3MHPA 1NBMA 1YIJB 1QX4A 2HMAA 2JJ2A 1FRNA 4Z4YA 1T6YA 4M1KA 3B8HA 4XNFA 1WP6A 4PGOA 3WNBA 3P27A 3FPKA 2OBTA 2ZZFA 5IYPA 3OPOA 3QFRA 3OZUA 1UD2A 3LO8A 2E1BA 1KZLA 5DSZA 3A35A 1M1KD 2FVGA 3QFCA 2VNIA 1W2BB 3ASRA 1XE1A 5HKKA 2C5BA 2X6XA 1FDRA 1NB9A 2DOGA 5H5JA 1QGYA 1E1RA 3A8JA 2OBRA 2QN6A 2BSAA 3ASSA 5HZBA 1Q9SA 5CDFA 1N06A 3HAGA 1FRQA 4TN1A 1G7SA 5KW9A 2ZXHA 1VQ7B 2D3NA 4YXWA 4M0LA 1ZM2A 1GAQA 3SJZA 2ZXIA 4XKVA 5TV2A 4HE5A 4TMVA 1QGAA 1VLYA 1DARA 1Q81D 1VQ6B 3OEEA 1UD4A 4FK8A 4WZKA 4AF7A 3CPWB 3ASTA 3Q3AA 3CMAB 1VQMB 3E20A 1YJWB 4C0SA 2V7XA 3U6KA 4FXUA 3CP2A 1WU8A 3CCMB 5TRDA 3DDYA 4RCYA 5AN9A 3CCQB 3GVJA 4XMYA 4XLAA 3WNDA 2BMWA 2ZL5A 1KK0A 3KL9A 1DDGA 4PC6A 5THXA 1BQEA 1Y0RA 4UZUA 4ZCIA 4XR6A 5FO1A 4XOTA 2Q6KA 5F4OA 2CNDA 2E1RA 1F60A 5LMZA 3WQZA 1ZM9A 1I18A 3W2HA 2BN4A 1EFCA 3FKSA 1TTTA 3OEHA 2V31A 3R6KA 1IJEA 1J9ZA 4H9GA 2BF4A 1ZM3A 4Z4VA 1WOOA 3B78A 4MYUA 3I55B 4PC1A 1Y0YA 1WOSA 2Q6IA 4TKOB 2V4DA 1YHQB 3Q39A 1E43A 1WDTA 3ASPA 2X53S
chains in the Genus database with same CATH topology
3QE2A 3CCJB 4G1VA 3CMEB 1D1NA 1YJNB 4RD2A 2BGIA 5GV7A 4DQKA 4RJLA 5TY0A 3OZWA 3W5VA 1JA0A 1N8RD 1VQ5B 1BX0A 3AVTA 1ELOA 1GO2A 1E64A 1JJ2B 3AVVA 1A8PA 1U2RA 3I56B 1ZUNB 4P6VF 1KQSB 1GJRA 1OB2A 1VQ9B 4G1BA 1GR1A 1S0UA 1GAWA 4Y9RA 2BGJA 5FA6A 1B2RA 3G6EB 4B43A 1CNFA 3AGQA 2J7KA 5H59A 1TLLA 2PMDA 2EFGA 3AVYA 2QTZA 3CCSB 2VZLA 4HE6A 4RD6A 4PC7A 4TMZA 4ZGNB 1KTVA 1AIPA 3U2QA 2EIXA 2DY1A 1JNYA 2YWFA 1EFUA 2DERA 1QFJA 3E1YE 4ZGQB 1R5NA 2OK7A 1N0UA 4AC9A 1H42A 4C43A 4IW3B 5TR9A 1QG0A 4B48A 4YAOA 1KJZA 1CNEA 2GPJA 1VQLB 1K8AD 4UAJA 4G5GA 3CC7B 4TMXA 1R5OA 4LBZA 1W35A 1G7RA 4N3GA 4ZCMA 2OK8A 1QGZA 3G71B 1Q82D 4Y7CA 2DEUA 1KK2A 2HDNB 2QDXA 1VQPB 2VNKA 4J0QA 4M4SA 1D8TA 1EWYA 2X3UA 1Q7YD 3CCVB 1EP3B 4AF6A 3MCAA 1IJFA 1KRHA 3W2GA 4TMWA 3ZZTA 3QFTA 4QHYA 4LBYA 1G7CA 3VO1A 3JQQA 2DETA 1EP2B 2VYQA 1QVGB 3WNCA 1AMOA 1NJID 4DQLA 4Q7JB 3AVXA 3VMFA 4MYTA 2BV3A 1FNDA 2YWGA 1TVCA 1M90D 1S72B 3JQPA 1KK1A 1VQ4B 2HCJB 2NPFA 4ACBA 4M2LA 1OB5A 3ZZUA 3CB4A 2BVNA 4B44A 4Y9UA 3WXMA 4BPRA 1VQ8B 1E63A 2OTLB 2DCUA 4LBWA 3FJOA 4FWTA 4ZV4A 1H85A 1FNBA 4N3NA 3W2FA 1W87A 3OW2B 2VNHA 1SKQA 3ZBUA 2R6HA 2CRVA 1HA3A 4ZCLA 1QH0A 3J81k 1R5BA 1SM4A 3CC4B 4PC2A 1YJ9B 3V76A 5EMNA 1NDHA 1FNCA 3QFSA 2BPOA 3CW2A 2BM0A 1IB0A 1YITB 2ZITA 1K9MD 2FX3A 3ZC3A 1K73D 3WYAA 2XNJA 1KC8D 3WBJA 1Q86D 1VQKB 4P3YA 4EH1A 4FN5A 1I7PA 3U6BA 4B3XA 1ZM4A 4YAUA 3CC2B 3ZBTA 2PLFA 1EFTA 1FNMA 3CCLB 2OTJB 2QA4B 3W2EA 3QSYA 1BJKA 4F7DA 1OGIA 4K1XA 1JA1A 4YALA 3CRZA 3VNVA 4RD3A 2B5OA 1BX1A 3CCUB 3B82A 4B4DA 3CCRB 2D74A 4RD1A 1E62A 2GQFA 2PIAA 4TMTA 2XNCA 2B7BA 4NCNA 1QFYA 2VNJA 3I1FA 4PC3A 1N0VC 3W2IA 5KSWB 3P26A 2BM1A 4YAFA 1F20A 1QUEA 1EXMA 4YAWA 3AGPA 1DG1G 4U9UA 1KD1D 1DDIA 3VNUA 3CXCB 1GVHA 3AVWA 2QTLA 4YHBA 1JB9A 2RC6A 4NBSA 3MMPA 3VO2A 1XB2A 1CQXA 4WQMA 1B23P 3OZVA 3WBKA 1W34A 1QVFB 2XEXA 3JQRA 1G7TA 1D2EA 4RD4A 1TUIA 1UMKA 2AHOA 3LVBA 3PENA 3W5HA 3CD6B 3CCEB 4RD0A 2YWHA 1QUFA 5JBQA 4RCZA 2QMUA 3ZZ0A 1YI2B 4R71A 2B7CA 3OJWA 2YWEA 4ACAA 3W5UA 1VQNB 2RC5A 2C78A 2QEXB 5HXBA 5GV8A 2C77A 1KK3A 3WY9A 4M53A 3AVUA 4LC0A 1QFZA 3G4SB 1VQOB 4B47A 4QFMA 3OJXA 1OGJA 4LBVA 3ES9A 1YIJB 3MHPA 1QX4A 2HMAA 1FRNA 4M1KA 3B8HA 4PGOA 3WNBA 3P27A 3FPKA 3QFRA 3OZUA 3LO8A 5DSZA 1M1KD 3QFCA 2VNIA 1W2BB 1XE1A 1FDRA 5H5JA 1QGYA 2QN6A 2BSAA 1FRQA 4TN1A 1G7SA 1VQ7B 4M0LA 1ZM2A 1GAQA 3SJZA 5TV2A 4HE5A 4TMVA 1QGAA 1DARA 1Q81D 1VQ6B 4FK8A 4AF7A 3CPWB 3CMAB 1VQMB 3E20A 1YJWB 4C0SA 3U6KA 3CCMB 4RCYA 5AN9A 3CCQB 3WNDA 2BMWA 1KK0A 1DDGA 4PC6A 5THXA 1BQEA 4ZCIA 2CNDA 2E1RA 1F60A 1ZM9A 3W2HA 2BN4A 1EFCA 1TTTA 1IJEA 1J9ZA 4H9GA 2BF4A 1ZM3A 3B78A 4MYUA 3I55B 4PC1A 1YHQB 1EP1B 1WDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QE2 A;  3CCJ B;  4G1V A;  3CME B;  1D1N A;  1YJN B;  4RD2 A;  2BGI A;  5GV7 A;  4DQK A;  4RJL A;  5TY0 A;  3OZW A;  3W5V A;  1JA0 A;  1N8R D;  1VQ5 B;  1BX0 A;  3AVT A;  1ELO A;  1GO2 A;  1E64 A;  1JJ2 B;  3AVV A;  1A8P A;  1U2R A;  3I56 B;  1ZUN B;  4P6V F;  1KQS B;  1GJR A;  1OB2 A;  1VQ9 B;  4G1B A;  1GR1 A;  1S0U A;  1GAW A;  4Y9R A;  2BGJ A;  5FA6 A;  1B2R A;  3G6E B;  4B43 A;  1CNF A;  3AGQ A;  2J7K A;  5H59 A;  1TLL A;  2PMD A;  2EFG A;  3AVY A;  2QTZ A;  3CCS B;  2VZL A;  4HE6 A;  4RD6 A;  4PC7 A;  4TMZ A;  4ZGN B;  1KTV A;  1AIP A;  3U2Q A;  2EIX A;  2DY1 A;  1JNY A;  2YWF A;  1EFU A;  2DER A;  1QFJ A;  3E1Y E;  4ZGQ B;  1R5N A;  2OK7 A;  1N0U A;  4AC9 A;  1H42 A;  4C43 A;  4IW3 B;  5TR9 A;  1QG0 A;  4B48 A;  4YAO A;  1KJZ A;  1CNE A;  2GPJ A;  1VQL B;  1K8A D;  4UAJ A;  4G5G A;  3CC7 B;  4TMX A;  1R5O A;  4LBZ A;  1W35 A;  1G7R A;  4N3G A;  4ZCM A;  2OK8 A;  1QGZ A;  3G71 B;  1Q82 D;  4Y7C A;  2DEU A;  1KK2 A;  2HDN B;  2QDX A;  1VQP B;  2VNK A;  4J0Q A;  4M4S A;  1D8T A;  1EWY A;  2X3U A;  1Q7Y D;  3CCV B;  1EP3 B;  4AF6 A;  3MCA A;  1IJF A;  1KRH A;  3W2G A;  4TMW A;  3ZZT A;  3QFT A;  4QHY A;  4LBY A;  1G7C A;  3VO1 A;  3JQQ A;  2DET A;  1EP2 B;  2VYQ A;  1QVG B;  3WNC A;  1AMO A;  1NJI D;  4DQL A;  4Q7J B;  3AVX A;  3VMF A;  4MYT A;  2BV3 A;  1FND A;  2YWG A;  1TVC A;  1M90 D;  1S72 B;  3JQP A;  1KK1 A;  1VQ4 B;  2HCJ B;  2NPF A;  4ACB A;  4M2L A;  1OB5 A;  3ZZU A;  3CB4 A;  2BVN A;  4B44 A;  4Y9U A;  3WXM A;  4BPR A;  1VQ8 B;  1E63 A;  2OTL B;  2DCU A;  4LBW A;  3FJO A;  4FWT A;  4ZV4 A;  1H85 A;  1FNB A;  4N3N A;  3W2F A;  1W87 A;  3OW2 B;  2VNH A;  1SKQ A;  3ZBU A;  2R6H A;  2CRV A;  1HA3 A;  4ZCL A;  1QH0 A;  3J81 k;  1R5B A;  1SM4 A;  3CC4 B;  4PC2 A;  1YJ9 B;  3V76 A;  5EMN A;  1NDH A;  1FNC A;  3QFS A;  2BPO A;  3CW2 A;  2BM0 A;  1IB0 A;  1YIT B;  2ZIT A;  1K9M D;  2FX3 A;  3ZC3 A;  1K73 D;  3WYA A;  2XNJ A;  1KC8 D;  3WBJ A;  1Q86 D;  1VQK B;  4P3Y A;  4EH1 A;  4FN5 A;  1I7P A;  3U6B A;  4B3X A;  1ZM4 A;  4YAU A;  3CC2 B;  3ZBT A;  2PLF A;  1EFT A;  1FNM A;  3CCL B;  2OTJ B;  2QA4 B;  3W2E A;  3QSY A;  1BJK A;  4F7D A;  1OGI A;  4K1X A;  1JA1 A;  4YAL A;  3CRZ A;  3VNV A;  4RD3 A;  2B5O A;  1BX1 A;  3CCU B;  3B82 A;  4B4D A;  3CCR B;  2D74 A;  4RD1 A;  1E62 A;  2GQF A;  2PIA A;  4TMT A;  2XNC A;  2B7B A;  4NCN A;  1QFY A;  2VNJ A;  3I1F A;  4PC3 A;  1N0V C;  3W2I A;  5KSW B;  3P26 A;  2BM1 A;  4YAF A;  1F20 A;  1QUE A;  1EXM A;  4YAW A;  3AGP A;  1DG1 G;  4U9U A;  1KD1 D;  1DDI A;  3VNU A;  3CXC B;  1GVH A;  3AVW A;  2QTL A;  4YHB A;  1JB9 A;  2RC6 A;  4NBS A;  3MMP A;  3VO2 A;  1XB2 A;  1CQX A;  4WQM A;  1B23 P;  3OZV A;  3WBK A;  1W34 A;  1QVF B;  2XEX A;  3JQR A;  1G7T A;  1D2E A;  4RD4 A;  1TUI A;  1UMK A;  2AHO A;  3LVB A;  3PEN A;  3W5H A;  3CD6 B;  3CCE B;  4RD0 A;  2YWH A;  1QUF A;  5JBQ A;  4RCZ A;  2QMU A;  3ZZ0 A;  1YI2 B;  4R71 A;  2B7C A;  3OJW A;  2YWE A;  4ACA A;  3W5U A;  1VQN B;  2RC5 A;  2C78 A;  2QEX B;  5HXB A;  5GV8 A;  2C77 A;  1KK3 A;  3WY9 A;  4M53 A;  3AVU A;  4LC0 A;  1QFZ A;  3G4S B;  1VQO B;  4B47 A;  4QFM A;  3OJX A;  1OGJ A;  4LBV A;  3ES9 A;  1YIJ B;  3MHP A;  1QX4 A;  2HMA A;  1FRN A;  4M1K A;  3B8H A;  4PGO A;  3WNB A;  3P27 A;  3FPK A;  3QFR A;  3OZU A;  3LO8 A;  5DSZ A;  1M1K D;  3QFC A;  2VNI A;  1W2B B;  1XE1 A;  1FDR A;  5H5J A;  1QGY A;  2QN6 A;  2BSA A;  1FRQ A;  4TN1 A;  1G7S A;  1VQ7 B;  4M0L A;  1ZM2 A;  1GAQ A;  3SJZ A;  5TV2 A;  4HE5 A;  4TMV A;  1QGA A;  1DAR A;  1Q81 D;  1VQ6 B;  4FK8 A;  4AF7 A;  3CPW B;  3CMA B;  1VQM B;  3E20 A;  1YJW B;  4C0S A;  3U6K A;  3CCM B;  4RCY A;  5AN9 A;  3CCQ B;  3WND A;  2BMW A;  1KK0 A;  1DDG A;  4PC6 A;  5THX A;  1BQE A;  4ZCI A;  2CND A;  2E1R A;  1F60 A;  1ZM9 A;  3W2H A;  2BN4 A;  1EFC A;  1TTT A;  1IJE A;  1J9Z A;  4H9G A;  2BF4 A;  1ZM3 A;  3B78 A;  4MYU A;  3I55 B;  4PC1 A;  1YHQ B;  1EP1 B;  1WDT A; 
#chains in the Genus database with same CATH topology
 3QE2 A;  3CCJ B;  4G1V A;  2V7U A;  3CME B;  5FO0 A;  1D1N A;  1E1Q A;  4RDJ A;  1YJN B;  4XQF A;  5A89 A;  2ZTN A;  5J35 A;  1P4M A;  2GK7 A;  4RD2 A;  2WSS A;  3GVL A;  4E0F A;  1UD8 A;  2BGI A;  5GV7 A;  5J3O A;  2ZBU A;  5DS0 A;  4DQK A;  4RJL A;  5TY0 A;  2VBU A;  4X7D A;  3ONY A;  3OZW A;  1WSR A;  4WZE A;  1JA0 A;  2M5S A;  3W5V A;  2X8K A;  3Q38 A;  1N8R D;  1VQ5 B;  4RDK A;  4OOV A;  1BX0 A;  3AVT A;  1ELO A;  1HVX A;  5KNL A;  2R9V A;  1GO2 A;  1E64 A;  4TT3 A;  1JJ2 B;  3AVV A;  4XOP A;  1A8P A;  1U2R A;  3OE7 A;  4XL9 A;  3I56 B;  1ZUN B;  4P6V F;  1N08 A;  1KQS B;  3PUM A;  1VHO A;  1UD5 A;  2F1M A;  2V7T A;  1GJR A;  1I8D A;  3GVK A;  1H8H A;  1OB2 A;  3CTA A;  1VQ9 B;  4G1B A;  1GR1 A;  1S0U A;  2ZTG A;  4P9S A;  1GAW A;  4KKS A;  1WSV A;  4Y9R A;  1K28 D;  2BGJ A;  2PE3 A;  5FA6 A;  1E3X A;  1B2R A;  3G6E B;  4GQN A;  4B43 A;  1CNF A;  3AGQ A;  4XD7 A;  2J7K A;  2CF4 A;  1XQB A;  4P22 A;  2GJR A;  1TLL A;  2PMD A;  5H59 A;  2W6I A;  4G6I A;  2EFG A;  1BMF A;  1PKV A;  1IHM A;  3AVY A;  3LNN A;  2QTZ A;  4DNR B;  3CCS B;  2VZL A;  4DNT B;  2JIZ A;  2JDI A;  4HE6 A;  4PC7 A;  4RD6 A;  4TMZ A;  5B6I A;  4CQJ A;  4ZGN B;  4RPB A;  4P6Y A;  1KTV A;  1OHH A;  3NE5 B;  1AIP A;  3U2Q A;  3JU4 A;  1SKY B;  2EIX A;  3A8K A;  4PAB A;  2VBV A;  4AVZ A;  2DY1 A;  3BC9 A;  1JNY A;  3ISX A;  2JJ1 A;  1NRK A;  2YWF A;  4TSF A;  1EFU A;  2WJV A;  2DER A;  1QFJ A;  3E1Y E;  4QV2 A;  4ZGQ B;  5FIU A;  1R5N A;  2OK7 A;  1N0U A;  4AC9 A;  4X0C A;  4XLF A;  1H42 A;  4C43 A;  4IW3 B;  5TR9 A;  1QG0 A;  2ZZQ A;  4B48 A;  4YAO A;  1WTH D;  1KJZ A;  1UD3 A;  1CNE A;  4PAA A;  2GPJ A;  1BPL A;  1VQL B;  5HZA A;  2XOK A;  1K8A D;  4OP7 A;  4UAJ A;  4G5G A;  3CC7 B;  4TMX A;  1R5O A;  4LBZ A;  2GRE A;  2QGG A;  4II3 A;  5A88 A;  5IYQ A;  1W35 A;  1W0K A;  1G7R A;  4OOX A;  4N3G A;  4ZCM A;  2OK8 A;  4P3I A;  1QGZ A;  3G71 B;  1WPC A;  2DIE A;  1Q82 D;  4Y7C A;  3OW7 A;  2WJY A;  2DEU A;  1KK2 A;  2HDN B;  5BSX A;  2QDX A;  3BH4 A;  1VJS A;  1VQP B;  2VNK A;  2F4N A;  4XKW A;  1VF7 A;  3LQE A;  3ZIA A;  4J0Q A;  1S4M A;  4M4S A;  1D8T A;  1EWY A;  2CK3 A;  2X3U A;  4X7C A;  4XOR A;  2C2W A;  4XM3 A;  3CCV B;  1Q7Y D;  4P1V A;  1EP3 B;  2W6J A;  4AF6 A;  3MCA A;  3R6J A;  4P25 A;  1IJF A;  1FX0 A;  1KRH A;  3W2G A;  4XN3 A;  3CES A;  4TMW A;  4X07 A;  3ZZT A;  1EP1 B;  4UZE A;  3QFT A;  4QHY A;  4LBY A;  1G7C A;  2WPD A;  3VO1 A;  1V5V A;  1UD6 A;  3JQQ A;  2DET A;  2X85 A;  1EP2 B;  2VYQ A;  1QVG B;  2X6W A;  1RQP A;  4UZF A;  4II2 A;  1WOP A;  3WNC A;  1AMO A;  1NJI D;  4DQL A;  4Q7J B;  3AVX A;  3VMF A;  4MYT A;  3SLN A;  2BV3 A;  1FND A;  1RQR A;  2YWG A;  1TVC A;  2ZBV A;  1M90 D;  3BCD A;  2P3M A;  1S72 B;  3JQP A;  1HZE A;  1KK1 A;  1VQ4 B;  1EFR A;  2HCJ B;  4P26 A;  2NPF A;  3A3G A;  4M2L A;  2WYR A;  2ZZE A;  4ACB A;  4G7W A;  1OB5 A;  4QUZ A;  3ZZU A;  3CB4 A;  4P2N A;  2BVN A;  4B44 A;  3CMM A;  1MRZ A;  4Y9U A;  4KKT A;  3WXM A;  1H8E A;  5L46 A;  4BPR A;  1VQ8 B;  4QVJ A;  3OFN A;  3LQ6 A;  4RPD A;  1E63 A;  2OTL B;  2DCU A;  2F43 A;  4LBW A;  3FJO A;  2XGJ A;  1MAB A;  2GJP A;  3A1P A;  4OPS A;  4OPO A;  2Z6B D;  2XZO A;  4FWT A;  1V0E A;  1W9X A;  3Q6R A;  4ZV4 A;  1H85 A;  3OAA A;  2XZL A;  1FNB A;  4ASU A;  4N3N A;  3W2F A;  2WZN A;  1W87 A;  3OW2 B;  2VNH A;  3ZPN A;  1SKQ A;  4YEL A;  2F1L A;  4QVA A;  3ZBU A;  2R6H A;  5DN6 A;  2CRV A;  1HA3 A;  4ZCL A;  1BLI A;  1QH0 A;  4HIZ A;  3T56 B;  3J81 k;  2D3L A;  4DK1 A;  2KVO A;  2VJI A;  2CW5 A;  3ASQ A;  1R5B A;  1SM4 A;  2CBX A;  4Z4U A;  3CC4 B;  2CC2 A;  4G7X A;  4PC2 A;  4Z4R A;  1YX2 A;  1YJ9 B;  3V76 A;  5EMN A;  3BCF A;  4DK0 A;  1NDH A;  3VR6 A;  1XFO A;  1COW A;  1FNC A;  3QFS A;  2BPO A;  3CW2 A;  1PJ5 A;  2BM0 A;  2C5H A;  1IB0 A;  2XZP A;  1YIT B;  2ZIT A;  1K9M D;  2FX3 A;  2X6Y A;  3ZC3 A;  1K73 D;  3FPP A;  3WYA A;  2VJJ A;  4XLH A;  4RDL A;  2XNJ A;  4XON A;  4OPV A;  5F4M A;  3OOC A;  4RM0 A;  1KMH A;  1VHE A;  2V7V A;  1KC8 D;  5A8A A;  1T5E A;  4P12 A;  5FNZ A;  3WBJ A;  1Q86 D;  1VQK B;  5IYR A;  2C4T A;  4XLC A;  4P3Y A;  3SLD A;  4EH1 A;  4FN5 A;  5IYN A;  1I7P A;  3U6B A;  3ZUG A;  1ZM4 A;  3GQB A;  4NNJ A;  4B3X A;  4YAU A;  2WZP P;  3ZBT A;  3CC2 B;  2PLF A;  3SKB A;  1EFT A;  1FNM A;  3CCL B;  2Q6O A;  3BQJ A;  2OTJ B;  2DYI A;  3BY1 A;  2QA4 B;  1VLO A;  4B3G A;  3W2E A;  3QSY A;  1BJK A;  3PA2 A;  4F7D A;  2VBS A;  1T6X A;  4WWV A;  1OGI A;  4K1X A;  1W0J A;  1JA1 A;  4YAL A;  3CRZ A;  2VBT A;  4RLZ A;  3VNV A;  4RD3 A;  2B5O A;  3OP1 A;  1N07 A;  1BX1 A;  3CCU B;  3B82 A;  1T6Z A;  3BY2 A;  4B4D A;  3CCR B;  2D74 A;  4RD1 A;  4Z1M A;  2ZZG A;  4Z4Z A;  5IK2 A;  1E62 A;  4X8I A;  2GQF A;  2PIA A;  4TMT A;  4X06 A;  3SEJ A;  5BSY A;  2XNC A;  2B7B A;  4NCN A;  1QFY A;  2VNJ A;  3I1F A;  4PC3 A;  1N0V C;  3W2I A;  3T53 B;  5KSW B;  5IYW A;  1PJ7 A;  4ROX A;  2LZJ A;  3P26 A;  2BM1 A;  3A3B A;  4Z4W A;  4YAF A;  1F20 A;  2V7Q A;  5E6T A;  1QUE A;  1EXM A;  3SJP A;  4YAW A;  3AGP A;  1DG1 G;  4U9U A;  4XN0 A;  1KD1 D;  1DDI A;  3VNU A;  3V7A A;  3CXC B;  1GVH A;  3AVW A;  2OBS A;  2QTL A;  4YHB A;  2ZL7 A;  1JB9 A;  2RC6 A;  4NBS A;  3MMP A;  2I1L A;  3VO2 A;  1XB2 A;  1CQX A;  3G05 A;  4WQM A;  1B23 P;  2XND A;  3OZV A;  4OOS A;  3WBK A;  1W34 A;  1QVF B;  5F4J A;  2OYN A;  3PA1 A;  2XEX A;  3GSI A;  4L8J A;  3JQR A;  1E79 A;  1G7T A;  3A8I A;  1D2E A;  3T51 B;  4RD4 A;  1TUI A;  1UMK A;  2AHO A;  3LVB A;  3OKX A;  3PEN A;  3W5H A;  3CD6 B;  3CCE B;  4RD0 A;  2WR8 A;  2YWH A;  1QUF A;  5JBQ A;  2HLD A;  4RCZ A;  2QMU A;  3RY8 A;  4JMQ A;  4KKU A;  3ZZ0 A;  1YI2 B;  1NB0 A;  2GJK A;  4WZT A;  3PUN A;  2ZL6 A;  4R71 A;  2B7C A;  3OJW A;  4XLE A;  2D9R A;  2JN9 A;  2YWE A;  2GK6 A;  4X05 A;  3PVD A;  5FL7 A;  1PJ6 A;  4ACA A;  2X0K A;  3W5U A;  1VQN B;  4Z4S A;  2Q6L A;  2RC5 A;  2QE7 A;  4YEJ A;  3H94 A;  4WZL A;  2C78 A;  2QEX B;  1N05 A;  5HXB A;  5GV8 A;  3CP8 A;  1E3Z A;  3GIR A;  2C77 A;  1KK3 A;  2C4U A;  4Z4T A;  3WY9 A;  4M53 A;  3BNW A;  3AVU A;  4LC0 A;  1OB0 A;  1QFZ A;  3G4S B;  3H9N A;  1WOR A;  1VQO B;  3ONU A;  1V0F A;  4B3F X;  3CPX A;  2NV4 A;  3KEW A;  4B47 A;  4QFM A;  3OJX A;  1OGJ A;  4X7E A;  2V7W A;  4LBV A;  3Q6Q A;  3ES9 A;  1YLO A;  4X7F A;  3D26 A;  3MHP A;  1NBM A;  1YIJ B;  1QX4 A;  2HMA A;  2JJ2 A;  1FRN A;  4Z4Y A;  1T6Y A;  4M1K A;  3B8H A;  4XNF A;  1WP6 A;  4PGO A;  3WNB A;  3P27 A;  3FPK A;  2OBT A;  2ZZF A;  5IYP A;  3OPO A;  3QFR A;  3OZU A;  1UD2 A;  3LO8 A;  2E1B A;  1KZL A;  5DSZ A;  3A35 A;  1M1K D;  2FVG A;  3QFC A;  2VNI A;  1W2B B;  3ASR A;  1XE1 A;  5HKK A;  2C5B A;  2X6X A;  1FDR A;  1NB9 A;  2DOG A;  5H5J A;  1QGY A;  1E1R A;  3A8J A;  2OBR A;  2QN6 A;  2BSA A;  3ASS A;  5HZB A;  1Q9S A;  5CDF A;  1N06 A;  3HAG A;  1FRQ A;  4TN1 A;  1G7S A;  5KW9 A;  2ZXH A;  1VQ7 B;  2D3N A;  4YXW A;  4M0L A;  1ZM2 A;  1GAQ A;  3SJZ A;  2ZXI A;  4XKV A;  5TV2 A;  4HE5 A;  4TMV A;  1QGA A;  1VLY A;  1DAR A;  1Q81 D;  1VQ6 B;  3OEE A;  1UD4 A;  4FK8 A;  4WZK A;  4AF7 A;  3CPW B;  3AST A;  3Q3A A;  3CMA B;  1VQM B;  3E20 A;  1YJW B;  4C0S A;  2V7X A;  3U6K A;  4FXU A;  3CP2 A;  1WU8 A;  3CCM B;  5TRD A;  3DDY A;  4RCY A;  5AN9 A;  3CCQ B;  3GVJ A;  4XMY A;  4XLA A;  3WND A;  2BMW A;  2ZL5 A;  1KK0 A;  3KL9 A;  1DDG A;  4PC6 A;  5THX A;  1BQE A;  1Y0R A;  4UZU A;  4ZCI A;  4XR6 A;  5FO1 A;  4XOT A;  2Q6K A;  5F4O A;  2CND A;  2E1R A;  1F60 A;  5LMZ A;  3WQZ A;  1ZM9 A;  1I18 A;  3W2H A;  2BN4 A;  1EFC A;  3FKS A;  1TTT A;  3OEH A;  2V31 A;  3R6K A;  1IJE A;  1J9Z A;  4H9G A;  2BF4 A;  1ZM3 A;  4Z4V A;  1WOO A;  3B78 A;  4MYU A;  3I55 B;  4PC1 A;  1Y0Y A;  1WOS A;  2Q6I A;  4TKO B;  2V4D A;  1YHQ B;  3Q39 A;  1E43 A;  1WDT A;  3ASP A;  2X53 S; 
#chains in the Genus database with same CATH homology
 3QE2 A;  3CCJ B;  4G1V A;  3CME B;  1D1N A;  1YJN B;  4RD2 A;  2BGI A;  5GV7 A;  4DQK A;  4RJL A;  5TY0 A;  3OZW A;  3W5V A;  1JA0 A;  1N8R D;  1VQ5 B;  1BX0 A;  3AVT A;  1ELO A;  1GO2 A;  1E64 A;  1JJ2 B;  3AVV A;  1A8P A;  1U2R A;  3I56 B;  1ZUN B;  4P6V F;  1KQS B;  1GJR A;  1OB2 A;  1VQ9 B;  4G1B A;  1GR1 A;  1S0U A;  1GAW A;  4Y9R A;  2BGJ A;  5FA6 A;  1B2R A;  3G6E B;  4B43 A;  1CNF A;  3AGQ A;  2J7K A;  5H59 A;  1TLL A;  2PMD A;  2EFG A;  3AVY A;  2QTZ A;  3CCS B;  2VZL A;  4HE6 A;  4RD6 A;  4PC7 A;  4TMZ A;  4ZGN B;  1KTV A;  1AIP A;  3U2Q A;  2EIX A;  2DY1 A;  1JNY A;  2YWF A;  1EFU A;  2DER A;  1QFJ A;  3E1Y E;  4ZGQ B;  1R5N A;  2OK7 A;  1N0U A;  4AC9 A;  1H42 A;  4C43 A;  4IW3 B;  5TR9 A;  1QG0 A;  4B48 A;  4YAO A;  1KJZ A;  1CNE A;  2GPJ A;  1VQL B;  1K8A D;  4UAJ A;  4G5G A;  3CC7 B;  4TMX A;  1R5O A;  4LBZ A;  1W35 A;  1G7R A;  4N3G A;  4ZCM A;  2OK8 A;  1QGZ A;  3G71 B;  1Q82 D;  4Y7C A;  2DEU A;  1KK2 A;  2HDN B;  2QDX A;  1VQP B;  2VNK A;  4J0Q A;  4M4S A;  1D8T A;  1EWY A;  2X3U A;  1Q7Y D;  3CCV B;  1EP3 B;  4AF6 A;  3MCA A;  1IJF A;  1KRH A;  3W2G A;  4TMW A;  3ZZT A;  3QFT A;  4QHY A;  4LBY A;  1G7C A;  3VO1 A;  3JQQ A;  2DET A;  1EP2 B;  2VYQ A;  1QVG B;  3WNC A;  1AMO A;  1NJI D;  4DQL A;  4Q7J B;  3AVX A;  3VMF A;  4MYT A;  2BV3 A;  1FND A;  2YWG A;  1TVC A;  1M90 D;  1S72 B;  3JQP A;  1KK1 A;  1VQ4 B;  2HCJ B;  2NPF A;  4ACB A;  4M2L A;  1OB5 A;  3ZZU A;  3CB4 A;  2BVN A;  4B44 A;  4Y9U A;  3WXM A;  4BPR A;  1VQ8 B;  1E63 A;  2OTL B;  2DCU A;  4LBW A;  3FJO A;  4FWT A;  4ZV4 A;  1H85 A;  1FNB A;  4N3N A;  3W2F A;  1W87 A;  3OW2 B;  2VNH A;  1SKQ A;  3ZBU A;  2R6H A;  2CRV A;  1HA3 A;  4ZCL A;  1QH0 A;  3J81 k;  1R5B A;  1SM4 A;  3CC4 B;  4PC2 A;  1YJ9 B;  3V76 A;  5EMN A;  1NDH A;  1FNC A;  3QFS A;  2BPO A;  3CW2 A;  2BM0 A;  1IB0 A;  1YIT B;  2ZIT A;  1K9M D;  2FX3 A;  3ZC3 A;  1K73 D;  3WYA A;  2XNJ A;  1KC8 D;  3WBJ A;  1Q86 D;  1VQK B;  4P3Y A;  4EH1 A;  4FN5 A;  1I7P A;  3U6B A;  4B3X A;  1ZM4 A;  4YAU A;  3CC2 B;  3ZBT A;  2PLF A;  1EFT A;  1FNM A;  3CCL B;  2OTJ B;  2QA4 B;  3W2E A;  3QSY A;  1BJK A;  4F7D A;  1OGI A;  4K1X A;  1JA1 A;  4YAL A;  3CRZ A;  3VNV A;  4RD3 A;  2B5O A;  1BX1 A;  3CCU B;  3B82 A;  4B4D A;  3CCR B;  2D74 A;  4RD1 A;  1E62 A;  2GQF A;  2PIA A;  4TMT A;  2XNC A;  2B7B A;  4NCN A;  1QFY A;  2VNJ A;  3I1F A;  4PC3 A;  1N0V C;  3W2I A;  5KSW B;  3P26 A;  2BM1 A;  4YAF A;  1F20 A;  1QUE A;  1EXM A;  4YAW A;  3AGP A;  1DG1 G;  4U9U A;  1KD1 D;  1DDI A;  3VNU A;  3CXC B;  1GVH A;  3AVW A;  2QTL A;  4YHB A;  1JB9 A;  2RC6 A;  4NBS A;  3MMP A;  3VO2 A;  1XB2 A;  1CQX A;  4WQM A;  1B23 P;  3OZV A;  3WBK A;  1W34 A;  1QVF B;  2XEX A;  3JQR A;  1G7T A;  1D2E A;  4RD4 A;  1TUI A;  1UMK A;  2AHO A;  3LVB A;  3PEN A;  3W5H A;  3CD6 B;  3CCE B;  4RD0 A;  2YWH A;  1QUF A;  5JBQ A;  4RCZ A;  2QMU A;  3ZZ0 A;  1YI2 B;  4R71 A;  2B7C A;  3OJW A;  2YWE A;  4ACA A;  3W5U A;  1VQN B;  2RC5 A;  2C78 A;  2QEX B;  5HXB A;  5GV8 A;  2C77 A;  1KK3 A;  3WY9 A;  4M53 A;  3AVU A;  4LC0 A;  1QFZ A;  3G4S B;  1VQO B;  4B47 A;  4QFM A;  3OJX A;  1OGJ A;  4LBV A;  3ES9 A;  1YIJ B;  3MHP A;  1QX4 A;  2HMA A;  1FRN A;  4M1K A;  3B8H A;  4PGO A;  3WNB A;  3P27 A;  3FPK A;  3QFR A;  3OZU A;  3LO8 A;  5DSZ A;  1M1K D;  3QFC A;  2VNI A;  1W2B B;  1XE1 A;  1FDR A;  5H5J A;  1QGY A;  2QN6 A;  2BSA A;  1FRQ A;  4TN1 A;  1G7S A;  1VQ7 B;  4M0L A;  1ZM2 A;  1GAQ A;  3SJZ A;  5TV2 A;  4HE5 A;  4TMV A;  1QGA A;  1DAR A;  1Q81 D;  1VQ6 B;  4FK8 A;  4AF7 A;  3CPW B;  3CMA B;  1VQM B;  3E20 A;  1YJW B;  4C0S A;  3U6K A;  3CCM B;  4RCY A;  5AN9 A;  3CCQ B;  3WND A;  2BMW A;  1KK0 A;  1DDG A;  4PC6 A;  5THX A;  1BQE A;  4ZCI A;  2CND A;  2E1R A;  1F60 A;  1ZM9 A;  3W2H A;  2BN4 A;  1EFC A;  1TTT A;  1IJE A;  1J9Z A;  4H9G A;  2BF4 A;  1ZM3 A;  3B78 A;  4MYU A;  3I55 B;  4PC1 A;  1YHQ B;  1EP1 B;  1WDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...