4ZGNB

Structure cdc123 complexed with the c-terminal domain of eif2gamma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
103
Chain Sequence
LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle protein 123
publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 15
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgnB00
2QMUA 1VQOB 1GAQA 2BN4A 2YWEA 3QFTA 4ZCMA 4M2LA 1S72B 2YWHA 5GV8A 4ZCLA 3CMEB 1D1NA 1GAWA 3WY9A 1WDTA 3W2GA 1QFJA 1W34A 1KD1D 4PGOA 1FRQA 2PIAA 4R71A 3W5UA 1J9ZA 3G6EB 3WNDA 4RD0A 2BPOA 4EH1A 4HE6A 1K73D 2OK7A 3QFCA 4K1XA 4P3YA 2XNJA 3QSYA 3FJOA 5TV2A 5DSZA 3AVUA 2RC5A 3CCJB 1DDIA 3WBKA 1TVCA 1KC8D 1EFCA 1U2RA 1DDGA 1YJWB 1JA1A 1H85A 5HXBA 2VZLA 4TN1A 1B2RA 3B82A 2HCJB 1KRHA 1XB2A 4ZGQB 4ACBA 1CNEA 1EFTA 2DY1A 1EP1B 2BF4A 3OJXA 4RJLA 2YWFA 1BJKA 4BPRA 3AVTA 2PLFA 2BM1A 3WXMA 2VNJA 2QA4B 1F60A 1QG0A 4HE5A 3ZBTA 3WYAA 1CNFA 5FA6A 4LBVA 4B44A 4FWTA 4P6VF 5H5JA 2VNKA 3B8HA 1KK3A 2ZITA 2BSAA 5GV7A 2CNDA 2QTZA 3CB4A 3CCUB 2QN6A 4ZGNB 4Y9UA 1FNMA 1NDHA 1BX1A 1IJFA 2B5OA 3I56B 1D2EA 1EP2B 2B7CA 4TMVA 4LC0A 1NJID 1EXMA 4G5GA 2OTLB 1H42A 1EFUA 2QEXB 2BV3A 2EFGA 4G1VA 3QE2A 3U6BA 1OGJA 2E1RA 3JQPA 2DCUA 1VQ8B 3LO8A 4N3GA 1R5BA 3G71B 1GVHA 1ZUNB 4IW3B 1YIJB 1FDRA 1W35A 3LVBA 1OB2A 3VMFA 4RD3A 3P26A 1IJEA 4YAFA 1CQXA 1W2BB 1M90D 2C77A 4AC9A 2X3UA 1KK2A 2VNIA 2D74A 4ZCIA 3CRZA 1Q82D 1BX0A 3E20A 5THXA 2VYQA 1AIPA 1ZM2A 4MYTA 4AF7A 2VNHA 1ZM9A 1QFYA 4FK8A 2YWGA 4M1KA 4FN5A 2RC6A 4YAUA 3W2FA 4TMZA 3CMAB 1ELOA 3OZWA 3U6KA 2DERA 3W2IA 3CXCB 4PC2A 1FNDA 1GO2A 3ZZ0A 1VQKB 4RD4A 2BM0A 4C0SA 2CRVA 1VQMB 1N8RD 1VQ9B 1TUIA 1K8AD 4YAOA 1QX4A 4J0QA 4NCNA 1VQLB 1M1KD 4DQLA 3ZC3A 1I7PA 1QH0A 4Y9RA 1W87A 3FPKA 4B4DA 3VNVA 3CCRB 3CC2B 1JB9A 4B43A 1KTVA 1KK0A 4ZV4A 4LBYA 3CCEB 1K9MD 5JBQA 1GR1A 3QFRA 4DQKA 1FRNA 1OB5A 4LBZA 3AVWA 2HDNB 2OK8A 4YHBA 2AHOA 3ZZUA 2BGJA 4G1BA 3CCMB 4M53A 4TMTA 2EIXA 3CCQB 3AVYA 1FNCA 5TY0A 1DARA 1R5NA 3QFSA 3G4SB 1QUFA 3OJWA 3MCAA 1HA3A 1Q7YD 1VQ6B 1BQEA 3AGPA 3CD6B 4TMWA 1DG1G 3P27A 1KQSB 3VO1A 1SM4A 4RCYA 3OW2B 4YAWA 1KJZA 3I1FA 3ZZTA 2DEUA 2DETA 2J7KA 4RD1A 1N0UA 4B47A 1OGIA 4N3NA 4YALA 3JQQA 4U9UA 1FNBA 2XNCA 1KK1A 2B7BA 1UMKA 4PC3A 2BVNA 1QGYA 4B3XA 1E62A 4RD6A 1TLLA 4TMXA 1G7TA 1VQNB 3WNBA 3AVVA 3J81k 3B78A 4ACAA 4Y7CA 1QGAA 3PENA 4RD2A 2NPFA 2QDXA 4PC6A 3V76A 1SKQA 3WNCA 1VQ4B 1F20A 2R6HA 3AVXA 3VO2A 2C78A 2OTJB 3W2HA 3ES9A 4B48A 3I55B 1QUEA 4PC1A 5AN9A 4NBSA 1E64A 3CC7B 2GPJA 2XEXA 4UAJA 1YJ9B 1QGZA 1D8TA 5H59A 3ZBUA 4C43A 1YI2B 3CC4B 3VNUA 3MMPA 3CCLB 1QVGB 2HMAA 1XE1A 5TR9A 3CW2A 1ZM4A 1R5OA 1VQ5B 1G7SA 1ZM3A 1Q86D 1G7RA 3AGQA 1YJNB 1VQ7B 5EMNA 3U2QA 1JA0A 1QVFB 4WQMA 3CPWB 4QFMA 1EWYA 2BMWA 3CCVB 1E63A 3WBJA 2BGIA 4H9GA 2QTLA 3MHPA 4QHYA 3W5VA 3CCSB 2FX3A 1JNYA 2PMDA 1VQPB 1S0UA 3JQRA 1Q81D 1A8PA 1G7CA 1EP3B 2GQFA 4RCZA 3W2EA 4PC7A 1TTTA 5KSWB 4M4SA 1IB0A 3E1YE 4LBWA 3W5HA 3OZUA 4F7DA 1B23P 1N0VC 3SJZA 1AMOA 4Q7JB 3OZVA 4M0LA 1GJRA 1JJ2B 1YITB 1QFZA 4MYUA 1YHQB 4AF6A
chains in the Genus database with same CATH superfamily
2C4UA 1E79A 3CMMA 2QMUA 3ZIAA 1VQOB 3A3GA 5HZBA 1GAQA 2Q6LA 2BN4A 3Q6QA 1N07A 2YWEA 2Q6IA 3QFTA 4ZCMA 1KMHA 2VBSA 1E3ZA 1I8DA 4M2LA 4YEJA 1S72B 2YWHA 5GV8A 4ZCLA 3CMEB 2JDIA 2CBXA 2GJPA 1WPCA 1GAWA 3WY9A 1D1NA 1WDTA 2X6XA 3W2GA 1MRZA 2Q6OA 3FKSA 2ZZQA 3OAAA 2X53S 4RDKA 1QFJA 1W34A 1KD1D 2XGJA 4Z4WA 4PGOA 1FRQA 2PIAA 3GQBA 2DYIA 4R71A 3W5UA 1J9ZA 3G6EB 3WNDA 4RD0A 2M5SA 5L46A 2QE7A 2WSSA 4NNJA 2BPOA 2V7UA 1NRKA 3OOCA 5DS0A 4EH1A 4HE6A 1K73D 2OK7A 3QFCA 4K1XA 4P6YA 4P3YA 2XNJA 3QSYA 3FJOA 4XN0A 5TV2A 2XZOA 5DSZA 2PE3A 3AVUA 2RC5A 3CCJB 1DDIA 3WBKA 2Q6KA 1E43A 3R6JA 2GREA 2OBTA 1TVCA 3A8JA 4P3IA 4DK0A 1KC8D 1EFCA 1U2RA 3ONYA 5FO0A 1DDGA 1YJWB 5HZAA 4YXWA 1JA1A 1H85A 3Q39A 5HXBA 4GQNA 2CC2A 2VZLA 2X85A 5E6TA 1WP6A 2D3NA 4TN1A 1B2RA 3B82A 3OE7A 2C5HA 2HCJB 1KRHA 2OBRA 2F1MA 1XB2A 4ZGQB 1CNEA 4ACBA 1EFTA 2DY1A 1EP1B 2BF4A 1NBMA 2VBVA 3OJXA 4JMQA 3ZUGA 1W0JA 3H94A 4RJLA 1VHEA 2YWFA 2ZZGA 2ZL6A 1XFOA 4WZKA 2CW5A 4AVZA 1BJKA 4OPSA 4BPRA 3AVTA 2PLFA 2BM1A 3WXMA 2VNJA 2QA4B 1F60A 1QG0A 4HE5A 3ZBTA 1CNFA 5FA6A 3WYAA 4LBVA 1WOOA 1VLOA 2V7XA 3VR6A 2X0KA 4B44A 4FXUA 4FWTA 4P6VF 2DOGA 4XKWA 5H5JA 2VNKA 2VJJA 3B8HA 1KK3A 4WWVA 2ZITA 2BSAA 3GIRA 5FO1A 5GV7A 3OPOA 1E3XA 1H8HA 1WSRA 2CNDA 2QTZA 3CB4A 3CCUB 2QN6A 4RLZA 4ZGNB 4OPOA 3Q38A 4ROXA 1VF7A 3A3BA 3LQEA 2ZZEA 3BY2A 5FIUA 4Y9UA 4XM3A 1FNMA 2ZBVA 1NDHA 1BX1A 2QGGA 1FX0A 4KKUA 4UZUA 1IJFA 2B5OA 3ASSA 3I56B 1OHHA 1UD3A 1D2EA 1MABA 1WOPA 3A1PA 4XQFA 1EP2B 2B7CA 4Z4TA 4TMVA 4LC0A 1NJID 1EXMA 1YLOA 3RY8A 4G5GA 2OTLB 1H42A 1EFUA 2QEXB 2BV3A 2EFGA 4DNRB 4G1VA 4B3GA 3QE2A 3U6BA 4XLEA 5J3OA 1OGJA 2E1RA 3JQPA 4Z4VA 2DCUA 4TT3A 4RDJA 3ZPNA 1VQ8B 2V7QA 1HVXA 1Y0YA 3LO8A 4N3GA 2DIEA 1R5BA 3G71B 1GVHA 1ZUNB 2OBSA 4IW3B 1VJSA 1YIJB 1FDRA 3OW7A 1W35A 3LVBA 4RPDA 5IYNA 1K28D 3SLNA 1RQRA 3SJPA 1S4MA 3VMFA 4RD3A 5F4OA 1OB2A 3P26A 1V0EA 3CPXA 1IJEA 5IYRA 4YAFA 1CQXA 3DDYA 4II3A 4XNFA 1W2BB 3PA1A 1H8EA 3OEEA 5F4JA 1M90D 2V31A 4Z4ZA 2GK7A 4RDLA 2C77A 1COWA 1IHMA 2WYRA 4AC9A 2X3UA 1KK2A 2VNIA 2D74A 4P26A 4ZCIA 4QVAA 5KNLA 2GJKA 3CRZA 4XOTA 2ZTGA 1Q82D 1BX0A 2ZL7A 2NV4A 1HZEA 1N08A 3E20A 3ASPA 2VYQA 5THXA 1AIPA 1ZM2A 3R6KA 2XNDA 4G7XA 4MYTA 4AF7A 2ZBUA 4G7WA 4XL9A 2Z6BD 4Z4UA 2VNHA 1ZM9A 3CP8A 1QFYA 4FK8A 2C4TA 2YWGA 3BCDA 4M1KA 4FN5A 3OFNA 2RC6A 4UZEA 4YAUA 3W2FA 4TMZA 3PUNA 3CMAB 1ELOA 3OZWA 2CF4A 3U6KA 5B6IA 2DERA 3W2IA 3CXCB 4HIZA 4PC2A 1FNDA 1GO2A 3ZZ0A 1VQKB 4CQJA 4RD4A 3JU4A 2BM0A 5J35A 4C0SA 2CRVA 4X8IA 1VQMB 3CP2A 1VLYA 3V7AA 1N8RD 3BNWA 4XLFA 1PJ7A 1VQ9B 3PA2A 2WZPP 1TUIA 4L8JA 1K8AD 4YAOA 1QX4A 4J0QA 4NCNA 1VQLB 4E0FA 1BPLA 2JN9A 4DQLA 1M1KD 5IYQA 4XKVA 3ZC3A 2ZTNA 3T56B 2V7VA 4Z1MA 4Z4YA 1I7PA 1QH0A 4Y9RA 1W87A 3FPKA 4KKTA 4B4DA 4X7CA 3VNVA 3CCRB 3CC2B 1JB9A 4QVJA 2HLDA 3KEWA 4PABA 4B43A 5LMZA 1KTVA 1KK0A 3OKXA 4P2NA 4ZV4A 3G05A 4LBYA 4X7EA 1EFRA 3CCEB 1K9MD 1UD6A 5JBQA 1GR1A 1Q9SA 3QFRA 2V4DA 1FRNA 4DQKA 1OB5A 4LBZA 3AVWA 2F43A 2HDNB 1UD5A 2OK8A 4TSFA 4XOPA 4YHBA 5CDFA 2WJVA 3OEHA 2AHOA 2VJIA 3ZZUA 4RPBA 4XMYA 4QV2A 2BGJA 4QUZA 4G1BA 1T6XA 3CCMB 1W0KA 2X6WA 4M53A 4TMTA 2EIXA 3BH4A 3CCQB 3AVYA 1FNCA 4OOSA 1NB0A 5TY0A 1DARA 1R5NA 3QFSA 3G4SB 4WZTA 4XD7A 1V0FA 3SEJA 1QUFA 3WQZA 3ISXA 4G6IA 2ZXHA 2GK6A 3OJWA 3PVDA 2VBUA 4XLCA 3MCAA 1HA3A 1Q7YD 1VQ6B 5A88A 2WZNA 1BQEA 3AGPA 3CD6B 4TMWA 1DG1G 3P27A 5A8AA 1SM4A 4RCYA 3VO1A 3OW2B 1KQSB 4X07A 2XOKA 4YAWA 1KJZA 3I1FA 5BSXA 3ZZTA 2DEUA 2DETA 2J7KA 3Q6RA 4RD1A 4X0CA 2CK3A 1N0UA 4II2A 4B47A 1E1RA 2V7WA 1OGIA 2JJ2A 4N3NA 4YALA 2XZLA 3JQQA 1FNBA 4U9UA 4P1VA 4UZFA 2XNCA 1KK1A 4WZEA 3ASQA 1P4MA 3ASTA 2B7BA 4P9SA 5TRDA 3GVLA 1UMKA 4PC3A 1PJ6A 2BVNA 4X7FA 2WPDA 2C2WA 1QGYA 4B3XA 2WR8A 1SKYB 1E62A 3OP1A 4RD6A 4XR6A 1TLLA 4TMXA 1G7TA 1VQNB 1PJ5A 3WNBA 3AVVA 3J81k 3B78A 3GVJA 1E1QA 4X05A 1RQPA 4ACAA 1QGAA 3PENA 4RD2A 4Y7CA 4Z4RA 2NPFA 2I1LA 2QDXA 4PC6A 3SLDA 2X6YA 5FNZA 1YX2A 3V76A 1SKQA 4WZLA 3WNCA 4Z4SA 1VQ4B 1F20A 2R6HA 3AVXA 2F1LA 5BSYA 3VO2A 2D9RA 3BY1A 2C78A 4OOXA 2OTJB 2LZJA 3W2HA 3ES9A 2V7TA 4B48A 1NB9A 3I55B 1QUEA 4PC1A 5AN9A 4NBSA 4DK1A 3A8KA 1E64A 1N06A 3CC7B 2GJRA 2GPJA 4P22A 1KZLA 2XEXA 2E1BA 4UAJA 4YELA 4XLHA 4XLAA 1YJ9B 3BQJA 1D8TA 1QGZA 5H59A 3ZBUA 2JIZA 3ASRA 3NE5B 1PKVA 1Y0RA 3A35A 4X7DA 4C43A 5KW9A 3HAGA 1YI2B 3CC4B 3VNUA 2P3MA 1W9XA 3MMPA 5DN6A 5IYPA 3CCLB 1QVGB 1BMFA 2HMAA 3SKBA 3GVKA 1XE1A 5TR9A 3CW2A 1ZM4A 2W6IA 4X06A 1R5OA 2X8KA 1VQ5B 1G7SA 1WOSA 1T5EA 2VBTA 3ONUA 2XZPA 4XN3A 2FVGA 1ZM3A 1WSVA 1WU8A 4P12A 1Q86D 2D3LA 1WORA 1G7RA 3AGQA 1YJNB 4OPVA 3PUMA 3LQ6A 1VQ7B 5EMNA 2F4NA 1JA0A 4XORA 3U2QA 3T51B 1QVFB 4WQMA 3CPWB 3Q3AA 3LNNA 4QFMA 1OB0A 1EWYA 1T6ZA 2BMWA 3CCVB 1E63A 2ZZFA 2C5BA 2OYNA 3WBJA 2BGIA 4H9GA 3D26A 2QTLA 3MHPA 4QHYA 3W5VA 3CCSB 2FX3A 5A89A 1JNYA 3CTAA 2JJ1A 2PMDA 2WJYA 3FPPA 2W6JA 4DNTB 4P25A 1UD2A 3T53B 1VQPB 1XQBA 1S0UA 3JQRA 5FL7A 4ASUA 1Q81D 5IYWA 1T6YA 3BCFA 1BLIA 1A8PA 5F4MA 1G7CA 1EP3B 2GQFA 4RCZA 3GSIA 3W2EA 4PC7A 1V5VA 1TTTA 5KSWB 4M4SA 1IB0A 1I18A 3E1YE 4LBWA 3KL9A 4KKSA 3OZUA 1WTHD 1UD4A 1N05A 3W5HA 3CESA 4B3FX 4F7DA 1B23P 1N0VC 3H9NA 3SJZA 5HKKA 1AMOA 2ZXIA 4PAAA 4OOVA 4Q7JB 2R9VA 3OZVA 4M0LA 3BC9A 1GJRA 5IK2A 1UD8A 4RM0A 1YITB 1JJ2B 2KVOA 4TKOB 1QFZA 4MYUA 1VHOA 2ZL5A 4XONA 3A8IA 1YHQB 4AF6A 4OP7A
chains in the Genus database with same CATH topology
2QMUA 1VQOB 1GAQA 2BN4A 2YWEA 3QFTA 4ZCMA 4M2LA 1S72B 2YWHA 5GV8A 4ZCLA 3CMEB 1D1NA 1GAWA 3WY9A 1WDTA 3W2GA 1QFJA 1W34A 1KD1D 4PGOA 1FRQA 2PIAA 4R71A 3W5UA 1J9ZA 3G6EB 3WNDA 4RD0A 2BPOA 4EH1A 4HE6A 1K73D 2OK7A 3QFCA 4K1XA 4P3YA 2XNJA 3QSYA 3FJOA 5TV2A 5DSZA 3AVUA 2RC5A 3CCJB 1DDIA 3WBKA 1TVCA 1KC8D 1EFCA 1U2RA 1DDGA 1YJWB 1JA1A 1H85A 5HXBA 2VZLA 4TN1A 1B2RA 3B82A 2HCJB 1KRHA 1XB2A 4ZGQB 4ACBA 1CNEA 1EFTA 2DY1A 1EP1B 2BF4A 3OJXA 4RJLA 2YWFA 1BJKA 4BPRA 3AVTA 2PLFA 2BM1A 3WXMA 2VNJA 2QA4B 1F60A 1QG0A 4HE5A 3ZBTA 3WYAA 1CNFA 5FA6A 4LBVA 4B44A 4FWTA 4P6VF 5H5JA 2VNKA 3B8HA 1KK3A 2ZITA 2BSAA 5GV7A 2CNDA 2QTZA 3CB4A 3CCUB 2QN6A 4ZGNB 4Y9UA 1FNMA 1NDHA 1BX1A 1IJFA 2B5OA 3I56B 1D2EA 1EP2B 2B7CA 4TMVA 4LC0A 1NJID 1EXMA 4G5GA 2OTLB 1H42A 1EFUA 2QEXB 2BV3A 2EFGA 4G1VA 3QE2A 3U6BA 1OGJA 2E1RA 3JQPA 2DCUA 1VQ8B 3LO8A 4N3GA 1R5BA 3G71B 1GVHA 1ZUNB 4IW3B 1YIJB 1FDRA 1W35A 3LVBA 1OB2A 3VMFA 4RD3A 3P26A 1IJEA 4YAFA 1CQXA 1W2BB 1M90D 2C77A 4AC9A 2X3UA 1KK2A 2VNIA 2D74A 4ZCIA 3CRZA 1Q82D 1BX0A 3E20A 5THXA 2VYQA 1AIPA 1ZM2A 4MYTA 4AF7A 2VNHA 1ZM9A 1QFYA 4FK8A 2YWGA 4M1KA 4FN5A 2RC6A 4YAUA 3W2FA 4TMZA 3CMAB 1ELOA 3OZWA 3U6KA 2DERA 3W2IA 3CXCB 4PC2A 1FNDA 1GO2A 3ZZ0A 1VQKB 4RD4A 2BM0A 4C0SA 2CRVA 1VQMB 1N8RD 1VQ9B 1TUIA 1K8AD 4YAOA 1QX4A 4J0QA 4NCNA 1VQLB 1M1KD 4DQLA 3ZC3A 1I7PA 1QH0A 4Y9RA 1W87A 3FPKA 4B4DA 3VNVA 3CCRB 3CC2B 1JB9A 4B43A 1KTVA 1KK0A 4ZV4A 4LBYA 3CCEB 1K9MD 5JBQA 1GR1A 3QFRA 4DQKA 1FRNA 1OB5A 4LBZA 3AVWA 2HDNB 2OK8A 4YHBA 2AHOA 3ZZUA 2BGJA 4G1BA 3CCMB 4M53A 4TMTA 2EIXA 3CCQB 3AVYA 1FNCA 5TY0A 1DARA 1R5NA 3QFSA 3G4SB 1QUFA 3OJWA 3MCAA 1HA3A 1Q7YD 1VQ6B 1BQEA 3AGPA 3CD6B 4TMWA 1DG1G 3P27A 1KQSB 3VO1A 1SM4A 4RCYA 3OW2B 4YAWA 1KJZA 3I1FA 3ZZTA 2DEUA 2DETA 2J7KA 4RD1A 1N0UA 4B47A 1OGIA 4N3NA 4YALA 3JQQA 4U9UA 1FNBA 2XNCA 1KK1A 2B7BA 1UMKA 4PC3A 2BVNA 1QGYA 4B3XA 1E62A 4RD6A 1TLLA 4TMXA 1G7TA 1VQNB 3WNBA 3AVVA 3J81k 3B78A 4ACAA 4Y7CA 1QGAA 3PENA 4RD2A 2NPFA 2QDXA 4PC6A 3V76A 1SKQA 3WNCA 1VQ4B 1F20A 2R6HA 3AVXA 3VO2A 2C78A 2OTJB 3W2HA 3ES9A 4B48A 3I55B 1QUEA 4PC1A 5AN9A 4NBSA 1E64A 3CC7B 2GPJA 2XEXA 4UAJA 1YJ9B 1QGZA 1D8TA 5H59A 3ZBUA 4C43A 1YI2B 3CC4B 3VNUA 3MMPA 3CCLB 1QVGB 2HMAA 1XE1A 5TR9A 3CW2A 1ZM4A 1R5OA 1VQ5B 1G7SA 1ZM3A 1Q86D 1G7RA 3AGQA 1YJNB 1VQ7B 5EMNA 3U2QA 1JA0A 1QVFB 4WQMA 3CPWB 4QFMA 1EWYA 2BMWA 3CCVB 1E63A 3WBJA 2BGIA 4H9GA 2QTLA 3MHPA 4QHYA 3W5VA 3CCSB 2FX3A 1JNYA 2PMDA 1VQPB 1S0UA 3JQRA 1Q81D 1A8PA 1G7CA 1EP3B 2GQFA 4RCZA 3W2EA 4PC7A 1TTTA 5KSWB 4M4SA 1IB0A 3E1YE 4LBWA 3W5HA 3OZUA 4F7DA 1B23P 1N0VC 3SJZA 1AMOA 4Q7JB 3OZVA 4M0LA 1GJRA 1JJ2B 1YITB 1QFZA 4MYUA 1YHQB 4AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMU A;  1VQO B;  1GAQ A;  2BN4 A;  2YWE A;  3QFT A;  4ZCM A;  4M2L A;  1S72 B;  2YWH A;  5GV8 A;  4ZCL A;  3CME B;  1D1N A;  1GAW A;  3WY9 A;  1WDT A;  3W2G A;  1QFJ A;  1W34 A;  1KD1 D;  4PGO A;  1FRQ A;  2PIA A;  4R71 A;  3W5U A;  1J9Z A;  3G6E B;  3WND A;  4RD0 A;  2BPO A;  4EH1 A;  4HE6 A;  1K73 D;  2OK7 A;  3QFC A;  4K1X A;  4P3Y A;  2XNJ A;  3QSY A;  3FJO A;  5TV2 A;  5DSZ A;  3AVU A;  2RC5 A;  3CCJ B;  1DDI A;  3WBK A;  1TVC A;  1KC8 D;  1EFC A;  1U2R A;  1DDG A;  1YJW B;  1JA1 A;  1H85 A;  5HXB A;  2VZL A;  4TN1 A;  1B2R A;  3B82 A;  2HCJ B;  1KRH A;  1XB2 A;  4ZGQ B;  4ACB A;  1CNE A;  1EFT A;  2DY1 A;  1EP1 B;  2BF4 A;  3OJX A;  4RJL A;  2YWF A;  1BJK A;  4BPR A;  3AVT A;  2PLF A;  2BM1 A;  3WXM A;  2VNJ A;  2QA4 B;  1F60 A;  1QG0 A;  4HE5 A;  3ZBT A;  3WYA A;  1CNF A;  5FA6 A;  4LBV A;  4B44 A;  4FWT A;  4P6V F;  5H5J A;  2VNK A;  3B8H A;  1KK3 A;  2ZIT A;  2BSA A;  5GV7 A;  2CND A;  2QTZ A;  3CB4 A;  3CCU B;  2QN6 A;  4ZGN B;  4Y9U A;  1FNM A;  1NDH A;  1BX1 A;  1IJF A;  2B5O A;  3I56 B;  1D2E A;  1EP2 B;  2B7C A;  4TMV A;  4LC0 A;  1NJI D;  1EXM A;  4G5G A;  2OTL B;  1H42 A;  1EFU A;  2QEX B;  2BV3 A;  2EFG A;  4G1V A;  3QE2 A;  3U6B A;  1OGJ A;  2E1R A;  3JQP A;  2DCU A;  1VQ8 B;  3LO8 A;  4N3G A;  1R5B A;  3G71 B;  1GVH A;  1ZUN B;  4IW3 B;  1YIJ B;  1FDR A;  1W35 A;  3LVB A;  1OB2 A;  3VMF A;  4RD3 A;  3P26 A;  1IJE A;  4YAF A;  1CQX A;  1W2B B;  1M90 D;  2C77 A;  4AC9 A;  2X3U A;  1KK2 A;  2VNI A;  2D74 A;  4ZCI A;  3CRZ A;  1Q82 D;  1BX0 A;  3E20 A;  5THX A;  2VYQ A;  1AIP A;  1ZM2 A;  4MYT A;  4AF7 A;  2VNH A;  1ZM9 A;  1QFY A;  4FK8 A;  2YWG A;  4M1K A;  4FN5 A;  2RC6 A;  4YAU A;  3W2F A;  4TMZ A;  3CMA B;  1ELO A;  3OZW A;  3U6K A;  2DER A;  3W2I A;  3CXC B;  4PC2 A;  1FND A;  1GO2 A;  3ZZ0 A;  1VQK B;  4RD4 A;  2BM0 A;  4C0S A;  2CRV A;  1VQM B;  1N8R D;  1VQ9 B;  1TUI A;  1K8A D;  4YAO A;  1QX4 A;  4J0Q A;  4NCN A;  1VQL B;  1M1K D;  4DQL A;  3ZC3 A;  1I7P A;  1QH0 A;  4Y9R A;  1W87 A;  3FPK A;  4B4D A;  3VNV A;  3CCR B;  3CC2 B;  1JB9 A;  4B43 A;  1KTV A;  1KK0 A;  4ZV4 A;  4LBY A;  3CCE B;  1K9M D;  5JBQ A;  1GR1 A;  3QFR A;  4DQK A;  1FRN A;  1OB5 A;  4LBZ A;  3AVW A;  2HDN B;  2OK8 A;  4YHB A;  2AHO A;  3ZZU A;  2BGJ A;  4G1B A;  3CCM B;  4M53 A;  4TMT A;  2EIX A;  3CCQ B;  3AVY A;  1FNC A;  5TY0 A;  1DAR A;  1R5N A;  3QFS A;  3G4S B;  1QUF A;  3OJW A;  3MCA A;  1HA3 A;  1Q7Y D;  1VQ6 B;  1BQE A;  3AGP A;  3CD6 B;  4TMW A;  1DG1 G;  3P27 A;  1KQS B;  3VO1 A;  1SM4 A;  4RCY A;  3OW2 B;  4YAW A;  1KJZ A;  3I1F A;  3ZZT A;  2DEU A;  2DET A;  2J7K A;  4RD1 A;  1N0U A;  4B47 A;  1OGI A;  4N3N A;  4YAL A;  3JQQ A;  4U9U A;  1FNB A;  2XNC A;  1KK1 A;  2B7B A;  1UMK A;  4PC3 A;  2BVN A;  1QGY A;  4B3X A;  1E62 A;  4RD6 A;  1TLL A;  4TMX A;  1G7T A;  1VQN B;  3WNB A;  3AVV A;  3J81 k;  3B78 A;  4ACA A;  4Y7C A;  1QGA A;  3PEN A;  4RD2 A;  2NPF A;  2QDX A;  4PC6 A;  3V76 A;  1SKQ A;  3WNC A;  1VQ4 B;  1F20 A;  2R6H A;  3AVX A;  3VO2 A;  2C78 A;  2OTJ B;  3W2H A;  3ES9 A;  4B48 A;  3I55 B;  1QUE A;  4PC1 A;  5AN9 A;  4NBS A;  1E64 A;  3CC7 B;  2GPJ A;  2XEX A;  4UAJ A;  1YJ9 B;  1QGZ A;  1D8T A;  5H59 A;  3ZBU A;  4C43 A;  1YI2 B;  3CC4 B;  3VNU A;  3MMP A;  3CCL B;  1QVG B;  2HMA A;  1XE1 A;  5TR9 A;  3CW2 A;  1ZM4 A;  1R5O A;  1VQ5 B;  1G7S A;  1ZM3 A;  1Q86 D;  1G7R A;  3AGQ A;  1YJN B;  1VQ7 B;  5EMN A;  3U2Q A;  1JA0 A;  1QVF B;  4WQM A;  3CPW B;  4QFM A;  1EWY A;  2BMW A;  3CCV B;  1E63 A;  3WBJ A;  2BGI A;  4H9G A;  2QTL A;  3MHP A;  4QHY A;  3W5V A;  3CCS B;  2FX3 A;  1JNY A;  2PMD A;  1VQP B;  1S0U A;  3JQR A;  1Q81 D;  1A8P A;  1G7C A;  1EP3 B;  2GQF A;  4RCZ A;  3W2E A;  4PC7 A;  1TTT A;  5KSW B;  4M4S A;  1IB0 A;  3E1Y E;  4LBW A;  3W5H A;  3OZU A;  4F7D A;  1B23 P;  1N0V C;  3SJZ A;  1AMO A;  4Q7J B;  3OZV A;  4M0L A;  1GJR A;  1JJ2 B;  1YIT B;  1QFZ A;  4MYU A;  1YHQ B;  4AF6 A; 
#chains in the Genus database with same CATH topology
 2C4U A;  1E79 A;  3CMM A;  2QMU A;  3ZIA A;  1VQO B;  3A3G A;  5HZB A;  1GAQ A;  2Q6L A;  2BN4 A;  3Q6Q A;  1N07 A;  2YWE A;  2Q6I A;  3QFT A;  4ZCM A;  1KMH A;  2VBS A;  1E3Z A;  1I8D A;  4M2L A;  4YEJ A;  1S72 B;  2YWH A;  5GV8 A;  4ZCL A;  3CME B;  2JDI A;  2CBX A;  2GJP A;  1WPC A;  1GAW A;  3WY9 A;  1D1N A;  1WDT A;  2X6X A;  3W2G A;  1MRZ A;  2Q6O A;  3FKS A;  2ZZQ A;  3OAA A;  2X53 S;  4RDK A;  1QFJ A;  1W34 A;  1KD1 D;  2XGJ A;  4Z4W A;  4PGO A;  1FRQ A;  2PIA A;  3GQB A;  2DYI A;  4R71 A;  3W5U A;  1J9Z A;  3G6E B;  3WND A;  4RD0 A;  2M5S A;  5L46 A;  2QE7 A;  2WSS A;  4NNJ A;  2BPO A;  2V7U A;  1NRK A;  3OOC A;  5DS0 A;  4EH1 A;  4HE6 A;  1K73 D;  2OK7 A;  3QFC A;  4K1X A;  4P6Y A;  4P3Y A;  2XNJ A;  3QSY A;  3FJO A;  4XN0 A;  5TV2 A;  2XZO A;  5DSZ A;  2PE3 A;  3AVU A;  2RC5 A;  3CCJ B;  1DDI A;  3WBK A;  2Q6K A;  1E43 A;  3R6J A;  2GRE A;  2OBT A;  1TVC A;  3A8J A;  4P3I A;  4DK0 A;  1KC8 D;  1EFC A;  1U2R A;  3ONY A;  5FO0 A;  1DDG A;  1YJW B;  5HZA A;  4YXW A;  1JA1 A;  1H85 A;  3Q39 A;  5HXB A;  4GQN A;  2CC2 A;  2VZL A;  2X85 A;  5E6T A;  1WP6 A;  2D3N A;  4TN1 A;  1B2R A;  3B82 A;  3OE7 A;  2C5H A;  2HCJ B;  1KRH A;  2OBR A;  2F1M A;  1XB2 A;  4ZGQ B;  1CNE A;  4ACB A;  1EFT A;  2DY1 A;  1EP1 B;  2BF4 A;  1NBM A;  2VBV A;  3OJX A;  4JMQ A;  3ZUG A;  1W0J A;  3H94 A;  4RJL A;  1VHE A;  2YWF A;  2ZZG A;  2ZL6 A;  1XFO A;  4WZK A;  2CW5 A;  4AVZ A;  1BJK A;  4OPS A;  4BPR A;  3AVT A;  2PLF A;  2BM1 A;  3WXM A;  2VNJ A;  2QA4 B;  1F60 A;  1QG0 A;  4HE5 A;  3ZBT A;  1CNF A;  5FA6 A;  3WYA A;  4LBV A;  1WOO A;  1VLO A;  2V7X A;  3VR6 A;  2X0K A;  4B44 A;  4FXU A;  4FWT A;  4P6V F;  2DOG A;  4XKW A;  5H5J A;  2VNK A;  2VJJ A;  3B8H A;  1KK3 A;  4WWV A;  2ZIT A;  2BSA A;  3GIR A;  5FO1 A;  5GV7 A;  3OPO A;  1E3X A;  1H8H A;  1WSR A;  2CND A;  2QTZ A;  3CB4 A;  3CCU B;  2QN6 A;  4RLZ A;  4ZGN B;  4OPO A;  3Q38 A;  4ROX A;  1VF7 A;  3A3B A;  3LQE A;  2ZZE A;  3BY2 A;  5FIU A;  4Y9U A;  4XM3 A;  1FNM A;  2ZBV A;  1NDH A;  1BX1 A;  2QGG A;  1FX0 A;  4KKU A;  4UZU A;  1IJF A;  2B5O A;  3ASS A;  3I56 B;  1OHH A;  1UD3 A;  1D2E A;  1MAB A;  1WOP A;  3A1P A;  4XQF A;  1EP2 B;  2B7C A;  4Z4T A;  4TMV A;  4LC0 A;  1NJI D;  1EXM A;  1YLO A;  3RY8 A;  4G5G A;  2OTL B;  1H42 A;  1EFU A;  2QEX B;  2BV3 A;  2EFG A;  4DNR B;  4G1V A;  4B3G A;  3QE2 A;  3U6B A;  4XLE A;  5J3O A;  1OGJ A;  2E1R A;  3JQP A;  4Z4V A;  2DCU A;  4TT3 A;  4RDJ A;  3ZPN A;  1VQ8 B;  2V7Q A;  1HVX A;  1Y0Y A;  3LO8 A;  4N3G A;  2DIE A;  1R5B A;  3G71 B;  1GVH A;  1ZUN B;  2OBS A;  4IW3 B;  1VJS A;  1YIJ B;  1FDR A;  3OW7 A;  1W35 A;  3LVB A;  4RPD A;  5IYN A;  1K28 D;  3SLN A;  1RQR A;  3SJP A;  1S4M A;  3VMF A;  4RD3 A;  5F4O A;  1OB2 A;  3P26 A;  1V0E A;  3CPX A;  1IJE A;  5IYR A;  4YAF A;  1CQX A;  3DDY A;  4II3 A;  4XNF A;  1W2B B;  3PA1 A;  1H8E A;  3OEE A;  5F4J A;  1M90 D;  2V31 A;  4Z4Z A;  2GK7 A;  4RDL A;  2C77 A;  1COW A;  1IHM A;  2WYR A;  4AC9 A;  2X3U A;  1KK2 A;  2VNI A;  2D74 A;  4P26 A;  4ZCI A;  4QVA A;  5KNL A;  2GJK A;  3CRZ A;  4XOT A;  2ZTG A;  1Q82 D;  1BX0 A;  2ZL7 A;  2NV4 A;  1HZE A;  1N08 A;  3E20 A;  3ASP A;  2VYQ A;  5THX A;  1AIP A;  1ZM2 A;  3R6K A;  2XND A;  4G7X A;  4MYT A;  4AF7 A;  2ZBU A;  4G7W A;  4XL9 A;  2Z6B D;  4Z4U A;  2VNH A;  1ZM9 A;  3CP8 A;  1QFY A;  4FK8 A;  2C4T A;  2YWG A;  3BCD A;  4M1K A;  4FN5 A;  3OFN A;  2RC6 A;  4UZE A;  4YAU A;  3W2F A;  4TMZ A;  3PUN A;  3CMA B;  1ELO A;  3OZW A;  2CF4 A;  3U6K A;  5B6I A;  2DER A;  3W2I A;  3CXC B;  4HIZ A;  4PC2 A;  1FND A;  1GO2 A;  3ZZ0 A;  1VQK B;  4CQJ A;  4RD4 A;  3JU4 A;  2BM0 A;  5J35 A;  4C0S A;  2CRV A;  4X8I A;  1VQM B;  3CP2 A;  1VLY A;  3V7A A;  1N8R D;  3BNW A;  4XLF A;  1PJ7 A;  1VQ9 B;  3PA2 A;  2WZP P;  1TUI A;  4L8J A;  1K8A D;  4YAO A;  1QX4 A;  4J0Q A;  4NCN A;  1VQL B;  4E0F A;  1BPL A;  2JN9 A;  4DQL A;  1M1K D;  5IYQ A;  4XKV A;  3ZC3 A;  2ZTN A;  3T56 B;  2V7V A;  4Z1M A;  4Z4Y A;  1I7P A;  1QH0 A;  4Y9R A;  1W87 A;  3FPK A;  4KKT A;  4B4D A;  4X7C A;  3VNV A;  3CCR B;  3CC2 B;  1JB9 A;  4QVJ A;  2HLD A;  3KEW A;  4PAB A;  4B43 A;  5LMZ A;  1KTV A;  1KK0 A;  3OKX A;  4P2N A;  4ZV4 A;  3G05 A;  4LBY A;  4X7E A;  1EFR A;  3CCE B;  1K9M D;  1UD6 A;  5JBQ A;  1GR1 A;  1Q9S A;  3QFR A;  2V4D A;  1FRN A;  4DQK A;  1OB5 A;  4LBZ A;  3AVW A;  2F43 A;  2HDN B;  1UD5 A;  2OK8 A;  4TSF A;  4XOP A;  4YHB A;  5CDF A;  2WJV A;  3OEH A;  2AHO A;  2VJI A;  3ZZU A;  4RPB A;  4XMY A;  4QV2 A;  2BGJ A;  4QUZ A;  4G1B A;  1T6X A;  3CCM B;  1W0K A;  2X6W A;  4M53 A;  4TMT A;  2EIX A;  3BH4 A;  3CCQ B;  3AVY A;  1FNC A;  4OOS A;  1NB0 A;  5TY0 A;  1DAR A;  1R5N A;  3QFS A;  3G4S B;  4WZT A;  4XD7 A;  1V0F A;  3SEJ A;  1QUF A;  3WQZ A;  3ISX A;  4G6I A;  2ZXH A;  2GK6 A;  3OJW A;  3PVD A;  2VBU A;  4XLC A;  3MCA A;  1HA3 A;  1Q7Y D;  1VQ6 B;  5A88 A;  2WZN A;  1BQE A;  3AGP A;  3CD6 B;  4TMW A;  1DG1 G;  3P27 A;  5A8A A;  1SM4 A;  4RCY A;  3VO1 A;  3OW2 B;  1KQS B;  4X07 A;  2XOK A;  4YAW A;  1KJZ A;  3I1F A;  5BSX A;  3ZZT A;  2DEU A;  2DET A;  2J7K A;  3Q6R A;  4RD1 A;  4X0C A;  2CK3 A;  1N0U A;  4II2 A;  4B47 A;  1E1R A;  2V7W A;  1OGI A;  2JJ2 A;  4N3N A;  4YAL A;  2XZL A;  3JQQ A;  1FNB A;  4U9U A;  4P1V A;  4UZF A;  2XNC A;  1KK1 A;  4WZE A;  3ASQ A;  1P4M A;  3AST A;  2B7B A;  4P9S A;  5TRD A;  3GVL A;  1UMK A;  4PC3 A;  1PJ6 A;  2BVN A;  4X7F A;  2WPD A;  2C2W A;  1QGY A;  4B3X A;  2WR8 A;  1SKY B;  1E62 A;  3OP1 A;  4RD6 A;  4XR6 A;  1TLL A;  4TMX A;  1G7T A;  1VQN B;  1PJ5 A;  3WNB A;  3AVV A;  3J81 k;  3B78 A;  3GVJ A;  1E1Q A;  4X05 A;  1RQP A;  4ACA A;  1QGA A;  3PEN A;  4RD2 A;  4Y7C A;  4Z4R A;  2NPF A;  2I1L A;  2QDX A;  4PC6 A;  3SLD A;  2X6Y A;  5FNZ A;  1YX2 A;  3V76 A;  1SKQ A;  4WZL A;  3WNC A;  4Z4S A;  1VQ4 B;  1F20 A;  2R6H A;  3AVX A;  2F1L A;  5BSY A;  3VO2 A;  2D9R A;  3BY1 A;  2C78 A;  4OOX A;  2OTJ B;  2LZJ A;  3W2H A;  3ES9 A;  2V7T A;  4B48 A;  1NB9 A;  3I55 B;  1QUE A;  4PC1 A;  5AN9 A;  4NBS A;  4DK1 A;  3A8K A;  1E64 A;  1N06 A;  3CC7 B;  2GJR A;  2GPJ A;  4P22 A;  1KZL A;  2XEX A;  2E1B A;  4UAJ A;  4YEL A;  4XLH A;  4XLA A;  1YJ9 B;  3BQJ A;  1D8T A;  1QGZ A;  5H59 A;  3ZBU A;  2JIZ A;  3ASR A;  3NE5 B;  1PKV A;  1Y0R A;  3A35 A;  4X7D A;  4C43 A;  5KW9 A;  3HAG A;  1YI2 B;  3CC4 B;  3VNU A;  2P3M A;  1W9X A;  3MMP A;  5DN6 A;  5IYP A;  3CCL B;  1QVG B;  1BMF A;  2HMA A;  3SKB A;  3GVK A;  1XE1 A;  5TR9 A;  3CW2 A;  1ZM4 A;  2W6I A;  4X06 A;  1R5O A;  2X8K A;  1VQ5 B;  1G7S A;  1WOS A;  1T5E A;  2VBT A;  3ONU A;  2XZP A;  4XN3 A;  2FVG A;  1ZM3 A;  1WSV A;  1WU8 A;  4P12 A;  1Q86 D;  2D3L A;  1WOR A;  1G7R A;  3AGQ A;  1YJN B;  4OPV A;  3PUM A;  3LQ6 A;  1VQ7 B;  5EMN A;  2F4N A;  1JA0 A;  4XOR A;  3U2Q A;  3T51 B;  1QVF B;  4WQM A;  3CPW B;  3Q3A A;  3LNN A;  4QFM A;  1OB0 A;  1EWY A;  1T6Z A;  2BMW A;  3CCV B;  1E63 A;  2ZZF A;  2C5B A;  2OYN A;  3WBJ A;  2BGI A;  4H9G A;  3D26 A;  2QTL A;  3MHP A;  4QHY A;  3W5V A;  3CCS B;  2FX3 A;  5A89 A;  1JNY A;  3CTA A;  2JJ1 A;  2PMD A;  2WJY A;  3FPP A;  2W6J A;  4DNT B;  4P25 A;  1UD2 A;  3T53 B;  1VQP B;  1XQB A;  1S0U A;  3JQR A;  5FL7 A;  4ASU A;  1Q81 D;  5IYW A;  1T6Y A;  3BCF A;  1BLI A;  1A8P A;  5F4M A;  1G7C A;  1EP3 B;  2GQF A;  4RCZ A;  3GSI A;  3W2E A;  4PC7 A;  1V5V A;  1TTT A;  5KSW B;  4M4S A;  1IB0 A;  1I18 A;  3E1Y E;  4LBW A;  3KL9 A;  4KKS A;  3OZU A;  1WTH D;  1UD4 A;  1N05 A;  3W5H A;  3CES A;  4B3F X;  4F7D A;  1B23 P;  1N0V C;  3H9N A;  3SJZ A;  5HKK A;  1AMO A;  2ZXI A;  4PAA A;  4OOV A;  4Q7J B;  2R9V A;  3OZV A;  4M0L A;  3BC9 A;  1GJR A;  5IK2 A;  1UD8 A;  4RM0 A;  1YIT B;  1JJ2 B;  2KVO A;  4TKO B;  1QFZ A;  4MYU A;  1VHO A;  2ZL5 A;  4XON A;  3A8I A;  1YHQ B;  4AF6 A;  4OP7 A; 
#chains in the Genus database with same CATH homology
 2QMU A;  1VQO B;  1GAQ A;  2BN4 A;  2YWE A;  3QFT A;  4ZCM A;  4M2L A;  1S72 B;  2YWH A;  5GV8 A;  4ZCL A;  3CME B;  1D1N A;  1GAW A;  3WY9 A;  1WDT A;  3W2G A;  1QFJ A;  1W34 A;  1KD1 D;  4PGO A;  1FRQ A;  2PIA A;  4R71 A;  3W5U A;  1J9Z A;  3G6E B;  3WND A;  4RD0 A;  2BPO A;  4EH1 A;  4HE6 A;  1K73 D;  2OK7 A;  3QFC A;  4K1X A;  4P3Y A;  2XNJ A;  3QSY A;  3FJO A;  5TV2 A;  5DSZ A;  3AVU A;  2RC5 A;  3CCJ B;  1DDI A;  3WBK A;  1TVC A;  1KC8 D;  1EFC A;  1U2R A;  1DDG A;  1YJW B;  1JA1 A;  1H85 A;  5HXB A;  2VZL A;  4TN1 A;  1B2R A;  3B82 A;  2HCJ B;  1KRH A;  1XB2 A;  4ZGQ B;  4ACB A;  1CNE A;  1EFT A;  2DY1 A;  1EP1 B;  2BF4 A;  3OJX A;  4RJL A;  2YWF A;  1BJK A;  4BPR A;  3AVT A;  2PLF A;  2BM1 A;  3WXM A;  2VNJ A;  2QA4 B;  1F60 A;  1QG0 A;  4HE5 A;  3ZBT A;  3WYA A;  1CNF A;  5FA6 A;  4LBV A;  4B44 A;  4FWT A;  4P6V F;  5H5J A;  2VNK A;  3B8H A;  1KK3 A;  2ZIT A;  2BSA A;  5GV7 A;  2CND A;  2QTZ A;  3CB4 A;  3CCU B;  2QN6 A;  4ZGN B;  4Y9U A;  1FNM A;  1NDH A;  1BX1 A;  1IJF A;  2B5O A;  3I56 B;  1D2E A;  1EP2 B;  2B7C A;  4TMV A;  4LC0 A;  1NJI D;  1EXM A;  4G5G A;  2OTL B;  1H42 A;  1EFU A;  2QEX B;  2BV3 A;  2EFG A;  4G1V A;  3QE2 A;  3U6B A;  1OGJ A;  2E1R A;  3JQP A;  2DCU A;  1VQ8 B;  3LO8 A;  4N3G A;  1R5B A;  3G71 B;  1GVH A;  1ZUN B;  4IW3 B;  1YIJ B;  1FDR A;  1W35 A;  3LVB A;  1OB2 A;  3VMF A;  4RD3 A;  3P26 A;  1IJE A;  4YAF A;  1CQX A;  1W2B B;  1M90 D;  2C77 A;  4AC9 A;  2X3U A;  1KK2 A;  2VNI A;  2D74 A;  4ZCI A;  3CRZ A;  1Q82 D;  1BX0 A;  3E20 A;  5THX A;  2VYQ A;  1AIP A;  1ZM2 A;  4MYT A;  4AF7 A;  2VNH A;  1ZM9 A;  1QFY A;  4FK8 A;  2YWG A;  4M1K A;  4FN5 A;  2RC6 A;  4YAU A;  3W2F A;  4TMZ A;  3CMA B;  1ELO A;  3OZW A;  3U6K A;  2DER A;  3W2I A;  3CXC B;  4PC2 A;  1FND A;  1GO2 A;  3ZZ0 A;  1VQK B;  4RD4 A;  2BM0 A;  4C0S A;  2CRV A;  1VQM B;  1N8R D;  1VQ9 B;  1TUI A;  1K8A D;  4YAO A;  1QX4 A;  4J0Q A;  4NCN A;  1VQL B;  1M1K D;  4DQL A;  3ZC3 A;  1I7P A;  1QH0 A;  4Y9R A;  1W87 A;  3FPK A;  4B4D A;  3VNV A;  3CCR B;  3CC2 B;  1JB9 A;  4B43 A;  1KTV A;  1KK0 A;  4ZV4 A;  4LBY A;  3CCE B;  1K9M D;  5JBQ A;  1GR1 A;  3QFR A;  4DQK A;  1FRN A;  1OB5 A;  4LBZ A;  3AVW A;  2HDN B;  2OK8 A;  4YHB A;  2AHO A;  3ZZU A;  2BGJ A;  4G1B A;  3CCM B;  4M53 A;  4TMT A;  2EIX A;  3CCQ B;  3AVY A;  1FNC A;  5TY0 A;  1DAR A;  1R5N A;  3QFS A;  3G4S B;  1QUF A;  3OJW A;  3MCA A;  1HA3 A;  1Q7Y D;  1VQ6 B;  1BQE A;  3AGP A;  3CD6 B;  4TMW A;  1DG1 G;  3P27 A;  1KQS B;  3VO1 A;  1SM4 A;  4RCY A;  3OW2 B;  4YAW A;  1KJZ A;  3I1F A;  3ZZT A;  2DEU A;  2DET A;  2J7K A;  4RD1 A;  1N0U A;  4B47 A;  1OGI A;  4N3N A;  4YAL A;  3JQQ A;  4U9U A;  1FNB A;  2XNC A;  1KK1 A;  2B7B A;  1UMK A;  4PC3 A;  2BVN A;  1QGY A;  4B3X A;  1E62 A;  4RD6 A;  1TLL A;  4TMX A;  1G7T A;  1VQN B;  3WNB A;  3AVV A;  3J81 k;  3B78 A;  4ACA A;  4Y7C A;  1QGA A;  3PEN A;  4RD2 A;  2NPF A;  2QDX A;  4PC6 A;  3V76 A;  1SKQ A;  3WNC A;  1VQ4 B;  1F20 A;  2R6H A;  3AVX A;  3VO2 A;  2C78 A;  2OTJ B;  3W2H A;  3ES9 A;  4B48 A;  3I55 B;  1QUE A;  4PC1 A;  5AN9 A;  4NBS A;  1E64 A;  3CC7 B;  2GPJ A;  2XEX A;  4UAJ A;  1YJ9 B;  1QGZ A;  1D8T A;  5H59 A;  3ZBU A;  4C43 A;  1YI2 B;  3CC4 B;  3VNU A;  3MMP A;  3CCL B;  1QVG B;  2HMA A;  1XE1 A;  5TR9 A;  3CW2 A;  1ZM4 A;  1R5O A;  1VQ5 B;  1G7S A;  1ZM3 A;  1Q86 D;  1G7R A;  3AGQ A;  1YJN B;  1VQ7 B;  5EMN A;  3U2Q A;  1JA0 A;  1QVF B;  4WQM A;  3CPW B;  4QFM A;  1EWY A;  2BMW A;  3CCV B;  1E63 A;  3WBJ A;  2BGI A;  4H9G A;  2QTL A;  3MHP A;  4QHY A;  3W5V A;  3CCS B;  2FX3 A;  1JNY A;  2PMD A;  1VQP B;  1S0U A;  3JQR A;  1Q81 D;  1A8P A;  1G7C A;  1EP3 B;  2GQF A;  4RCZ A;  3W2E A;  4PC7 A;  1TTT A;  5KSW B;  4M4S A;  1IB0 A;  3E1Y E;  4LBW A;  3W5H A;  3OZU A;  4F7D A;  1B23 P;  1N0V C;  3SJZ A;  1AMO A;  4Q7J B;  3OZV A;  4M0L A;  1GJR A;  1JJ2 B;  1YIT B;  1QFZ A;  4MYU A;  1YHQ B;  4AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...