4ZGNB

Structure cdc123 complexed with the c-terminal domain of eif2gamma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
103
Chain Sequence
LPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle protein 123
publication title Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 15
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4zgnB00
1GR1A 4NBSA 1DDIA 5H5JA 1QGAA 2HDNB 3ZC3A 4LBWA 5KSWB 4LBZA 2OK8A 1D1NA 2J7KA 3ZZ0A 4ACAA 2C77A 3JQPA 1S0UA 2BV3A 4RD2A 2XNCA 1VQOB 4ACBA 1R5BA 1XB2A 4DQKA 2EIXA 1YIJB 2ZITA 2OTLB 1VQ7B 1JA0A 4TMVA 1G7CA 1VQMB 1J9ZA 2E1RA 1QFZA 2QMUA 1OB2A 4C43A 1JJ2B 2DETA 1Q86D 1N0UA 3ZBUA 4K1XA 4RCZA 1FNMA 3CCQB 2QTLA 3VNUA 4G5GA 3AVWA 4M2LA 3CPWB 5GV7A 3CB4A 1YJNB 1B2RA 3CCJB 3I56B 1OGIA 1UMKA 1CNEA 2CNDA 2RC6A 1KK0A 4G1BA 2BGIA 2NPFA 4Q7JB 1AMOA 4B44A 2BN4A 4YAOA 4WQMA 4B3XA 2BMWA 1A8PA 4TMZA 3AVVA 2BVNA 3CD6B 1BJKA 3WNCA 1KD1D 1N8RD 3P26A 3ZZUA 3WXMA 3ES9A 1FRQA 4AC9A 1G7RA 3U6KA 2YWFA 3U2QA 3VNVA 1EFTA 3MMPA 3B8HA 3QFRA 1KRHA 1KTVA 1BQEA 4RD3A 4TN1A 1KQSB 2YWGA 3AVTA 1EWYA 5JBQA 1OB5A 1EFUA 4M1KA 1VQKB 4RD1A 3G6EB 5EMNA 3I1FA 2VNKA 1GO2A 1BX0A 2VNIA 4ZGQB 1EXMA 4B47A 2HMAA 1NJID 2BF4A 1GAWA 4ZV4A 1VQ8B 4HE5A 4B4DA 1W87A 3WBJA 1W2BB 1XE1A 2R6HA 3QFCA 4YALA 1EFCA 3W5VA 3I55B 1F60A 4AF7A 4QHYA 3AVUA 3FJOA 1NDHA 3ZZTA 3G4SB 1KJZA 2QDXA 4N3GA 3E1YE 3CCVB 2RC5A 1K9MD 2DCUA 1KC8D 3U6BA 1QFJA 3CCEB 4ZCMA 1TLLA 4RCYA 3MCAA 3CCSB 4PC3A 3CMAB 3W2HA 3CW2A 4YAUA 1DG1G 3WNDA 3JQRA 3W2FA 4YHBA 4M4SA 5THXA 1FDRA 1B23P 3CCLB 4U9UA 4RD6A 1ZM2A 4B43A 1ELOA 3OJWA 4Y9RA 2D74A 3CCRB 1YI2B 4RJLA 5AN9A 3ZBTA 3QFTA 5TR9A 3W2IA 2XNJA 1IJEA 1QFYA 3CC7B 1FNBA 2EFGA 4ZCIA 1VQLB 1K73D 3P27A 1ZUNB 1BX1A 3MHPA 2YWEA 4PC7A 1QGYA 3OZWA 5GV8A 4J0QA 1DARA 4DQLA 1G7SA 2PLFA 4RD0A 2QEXB 2DY1A 4LBYA 3CXCB 2YWHA 5H59A 1VQNB 1VQ9B 1YJWB 3JQQA 4M53A 2GQFA 3B78A 5TV2A 1VQ6B 1QVGB 1R5OA 1TVCA 1KK3A 3WYAA 1H42A 3LVBA 2DERA 1SKQA 1H85A 2OK7A 4TMTA 4Y9UA 4IW3B 1HA3A 1FNCA 2AHOA 1FRNA 1Q82D 4H9GA 3B82A 1SM4A 4LC0A 3WNBA 1YJ9B 1AIPA 4RD4A 1VQPB 2C78A 1QX4A 4BPRA 3CC2B 4FK8A 3W2GA 2HCJB 4R71A 1CNFA 1W34A 4Y7CA 1S72B 2PIAA 1KK1A 1E62A 1EP1B 4C0SA 4MYTA 1OGJA 2CRVA 3QSYA 1GVHA 2OTJB 2X3UA 4YAFA 4AF6A 3CMEB 1ZM9A 5TY0A 2FX3A 3AVYA 1QUEA 1VQ5B 1DDGA 1QG0A 1VQ4B 1Q7YD 1FNDA 2BSAA 4NCNA 2B7CA 2DEUA 4MYUA 3LO8A 1JNYA 3G71B 5HXBA 2BGJA 1D2EA 3VO2A 5DSZA 4HE6A 1F20A 4FN5A 4YAWA 4TMWA 1I7PA 4PC2A 4ZGNB 2XEXA 3W5HA 3AGPA 4P3YA 3CCMB 2QA4B 2VNHA 2BM0A 4G1VA 3E20A 4F7DA 4ZCLA 3SJZA 3QFSA 1D8TA 1QGZA 3OJXA 3OZVA 1G7TA 4N3NA 3CCUB 4M0LA 3AGQA 1ZM3A 1YITB 1ZM4A 2VNJA 1CQXA 1IJFA 1E63A 3W5UA 1EP3B 3VMFA 1U2RA 2QTZA 3W2EA 4PC6A 4EH1A 1R5NA 3V76A 2B5OA 1N0VC 3PENA 3CRZA 2GPJA 3J81k 1EP2B 2BPOA 3FPKA 5FA6A 1QUFA 2QN6A 4B48A 1GJRA 3WBKA 1GAQA 2VZLA 1IB0A 1YHQB 4QFMA 4FWTA 4UAJA 3OW2B 4TMXA 1W35A 1QH0A 2PMDA 1QVFB 1E64A 1Q81D 3VO1A 1K8AD 3OZUA 2B7BA 4PGOA 1TTTA 2VYQA 1M90D 1TUIA 1WDTA 1JA1A 1KK2A 1M1KD 2BM1A 3QE2A 3AVXA 3CC4B 4P6VF 3WY9A 1JB9A 4LBVA 4PC1A
chains in the Genus database with same CATH superfamily
1GR1A 3ASTA 4OP7A 4NBSA 1E1QA 1DDIA 2QE7A 5H5JA 3GVKA 1E3ZA 1QGAA 2HDNB 3ZC3A 3ZIAA 4LBWA 4P25A 5KSWB 2ZZFA 5LMZA 4LBZA 2OK8A 1D1NA 2J7KA 3ZZ0A 4ACAA 2C77A 3A3BA 3JQPA 4P12A 1N07A 1RQPA 4KKSA 4UZFA 4X7FA 5FL7A 1T6YA 4X8IA 4YXWA 1WPCA 3G05A 2CW5A 4QUZA 1WSRA 1NRKA 4XL9A 3ASSA 1S0UA 2BV3A 5FNZA 4RD2A 2XNCA 1VQOB 4ACBA 1R5BA 1WU8A 1XB2A 2ZZQA 4DQKA 2EIXA 4B3GA 2ZZGA 1YIJB 2ZITA 1NBMA 2ZTNA 1MRZA 2OTLB 1VQ7B 1JA0A 4TMVA 1G7CA 1VQMB 1J9ZA 2E1RA 2ZL6A 3SLDA 1Q9SA 1QFZA 1HVXA 2QMUA 2ZZEA 1OB2A 4C43A 5KNLA 4P22A 1JJ2B 3D26A 2DETA 4RLZA 1Q86D 1N0UA 4KKUA 3ZBUA 2V7WA 4K1XA 2CK3A 1MABA 1FNMA 4RCZA 4RPDA 1NB9A 3CCQB 1E1RA 2QTLA 3VNUA 4G5GA 4Z4RA 3AVWA 3WQZA 4M2LA 4WWVA 3CPWB 2F1MA 5GV7A 3CB4A 1YJNB 4XOTA 1B2RA 3CCJB 5DN6A 2I1LA 3I56B 1OGIA 1K28D 3ONYA 1UMKA 1CNEA 2CNDA 1N05A 4XM3A 2RC6A 3SLNA 2CC2A 1KK0A 1KMHA 4X0CA 4G1BA 2BGIA 2V4DA 3T51B 1KZLA 4XQFA 2NPFA 4Q7JB 2X53S 1AMOA 4B44A 4B3FX 1VF7A 4NNJA 2BN4A 4YAOA 4WQMA 2D9RA 1PJ6A 4B3XA 2BMWA 1A8PA 1T6ZA 2KVOA 4PAAA 4WZEA 5A89A 4TMZA 1UD3A 2BVNA 4WZTA 3CD6B 3AVVA 3OW7A 5HZBA 4PC1A 4YEJA 1BJKA 3BH4A 3WNCA 1W0JA 1KD1D 4RDJA 4XR6A 1N8RD 3P26A 2DOGA 3A3GA 3ZZUA 3WXMA 3ES9A 1FRQA 4AC9A 2OBRA 1G7RA 2F4NA 3U6KA 2YWFA 3U2QA 5F4MA 3VNVA 3A35A 5BSXA 1EFTA 3MMPA 3B8HA 3QFRA 3LQEA 2NV4A 4XLHA 3BY1A 1KRHA 1KTVA 5IYWA 3Q3AA 4JMQA 1UD4A 1BQEA 2X6YA 2ZXIA 4L8JA 4RD3A 3OPOA 1OHHA 5KW9A 4TN1A 1KQSB 2YWGA 1UD6A 3AVTA 1EFRA 2C5BA 1EWYA 5JBQA 2X6WA 1OB5A 1H8HA 1EFUA 1YLOA 4M1KA 4Z4ZA 2JIZA 1VQKB 4RD1A 1V0EA 4OPSA 3G6EB 3Q38A 5EMNA 4TSFA 3I1FA 1N08A 2VNKA 2V7VA 1GO2A 2XOKA 3OAAA 1BX0A 2VNIA 4ZGQB 1EXMA 2VBTA 4B47A 2WZNA 3R6JA 1N06A 2HMAA 3LQ6A 3OFNA 3OKXA 5A88A 2Q6LA 1NJID 2BF4A 3VR6A 1GAWA 2GREA 2HLDA 3OE7A 4ZV4A 1VQ8B 4HE5A 3CMMA 3HAGA 1WP6A 1FX0A 2ZL7A 3RY8A 4B4DA 1W87A 3A1PA 4DK1A 3WBJA 1W2BB 1XE1A 2R6HA 2V31A 3JU4A 1EFCA 3CTAA 3QFCA 4YALA 4X06A 2F43A 3W5VA 5IYQA 3I55B 2V7UA 1F60A 4AF7A 4QHYA 2M5SA 1I8DA 3AVUA 2WJVA 1NDHA 1SKYB 3FJOA 5FO1A 4DNRB 2VBSA 2C4TA 1E79A 3ZZTA 3G4SB 1KJZA 3SKBA 4TKOB 2QDXA 1HZEA 4N3GA 3GVLA 3E1YE 3KEWA 3CCVB 2RC5A 2WYRA 1K9MD 1WOSA 2DCUA 1PJ7A 1KC8D 2V7XA 3U6BA 2WPDA 4II2A 1V5VA 5CDFA 1VLOA 2ZL5A 1V0FA 3PA2A 1QFJA 1RQRA 2JN9A 4UZUA 4E0FA 3CCEB 4ZCMA 2X6XA 4P3IA 1NB0A 1TLLA 4QVJA 4RCYA 3T53B 3MCAA 2GK7A 3CCSB 1T5EA 4PC3A 3CMAB 3W2HA 3CW2A 4YAUA 1DG1G 3WNDA 3JQRA 1BMFA 2XNDA 4YELA 4XLAA 3W2FA 4YHBA 4M4SA 3BNWA 5THXA 2D3NA 2C5HA 1FDRA 1B23P 2E1BA 3FPPA 1E43A 3CCLB 5IYNA 4U9UA 4RD6A 1ZM2A 4B43A 3A8IA 4P9SA 1ELOA 3OJWA 4Y9RA 3ZPNA 2D74A 4KKTA 3CCRB 1YI2B 4RJLA 5AN9A 4XKWA 3V7AA 3ZBTA 3QFTA 3BC9A 5TR9A 4OOVA 3W2IA 2XNJA 1IJEA 1QFYA 3CC7B 2ZBUA 5IYPA 2ZTGA 1FNBA 2DYIA 2EFGA 4PABA 4ZCIA 1VQLB 2OYNA 1K73D 2P3MA 3CP2A 3P27A 1ZUNB 2D3LA 3PA1A 1BX1A 3MHPA 2YWEA 1PKVA 2V7QA 2FVGA 4PC7A 1QGYA 1BPLA 1UD2A 2V7TA 3OZWA 4X7DA 3OP1A 4J0QA 5GV8A 1DARA 4XNFA 4DQLA 1G7SA 4DK0A 2PLFA 4RD0A 3FKSA 2DY1A 2QEXB 4LBYA 3CXCB 4Z4WA 2YWHA 5H59A 5IYRA 1S4MA 1VQNB 2XZOA 1VQ9B 1YJWB 3JQQA 3ISXA 4M53A 2WR8A 1XFOA 3GSIA 3LNNA 2C4UA 2GQFA 3B78A 5TV2A 1VQ6B 1QVGB 1R5OA 1TVCA 2WZPP 1KK3A 1T6XA 3WYAA 1H42A 3A8JA 4DNTB 3LVBA 4XORA 2DERA 1SKQA 2VBUA 4AVZA 5TRDA 2C2WA 3H9NA 4WZKA 1H85A 3R6KA 4XKVA 3DDYA 2OK7A 4TMTA 4Y9UA 4Z4TA 5IK2A 1PJ5A 2LZJA 2R9VA 4IW3B 2GJKA 1HA3A 1FNCA 2AHOA 1FRNA 1Q82D 2Q6KA 4H9GA 2ZXHA 2X8KA 3B82A 1SM4A 4LC0A 3WNBA 4HIZA 3OEEA 3ASRA 1YJ9B 1AIPA 4II3A 4RD4A 1VQPB 2C78A 1QX4A 4BPRA 3CC2B 2W6IA 4FK8A 4OPVA 4X7CA 3W2GA 2X85A 4Z1MA 1IHMA 2HCJB 2Q6OA 4FXUA 4R71A 1CNFA 2XZPA 4GQNA 1W34A 4X07A 2XZLA 4QV2A 3PUNA 4G6IA 3PUMA 2JJ2A 4Y7CA 1S72B 4XD7A 2PIAA 1WOOA 3ASQA 1KK1A 2CF4A 1E62A 3OEHA 5E6TA 2CBXA 1EP1B 5DS0A 4C0SA 5J3OA 4MYTA 3BCDA 5FO0A 1OGJA 2CRVA 3BCFA 5FIUA 3QSYA 1GVHA 4P6YA 4P26A 2OTJB 2X3UA 4YAFA 4AF6A 3CMEB 1ZM9A 5TY0A 2FX3A 3A8KA 3AVYA 3Q6QA 3NE5B 1VLYA 4XLEA 1QUEA 1WTHD 3CPXA 5F4JA 4UZEA 2X0KA 5HKKA 1VQ5B 1DDGA 1QG0A 1VQ4B 1BLIA 2VBVA 1FNDA 2BSAA 1Q7YD 4NCNA 2B7CA 2DEUA 4Z4YA 2PE3A 4MYUA 2F1LA 3Q6RA 3LO8A 1JNYA 4RPBA 3G71B 1Y0YA 5HXBA 2BGJA 1E3XA 1D2EA 3BY2A 3VO2A 2WJYA 5DSZA 4HE6A 1F20A 4FN5A 4YAWA 4TMWA 1I7PA 4PC2A 1COWA 1VHOA 4ZGNB 4RDKA 3ZUGA 2DIEA 2XEXA 3W5HA 4Z4VA 3AGPA 4P3YA 3CCMB 5J35A 2QA4B 2VNHA 2BM0A 2Q6IA 4G1VA 1P4MA 1WSVA 3E20A 4F7DA 4ZCLA 1OB0A 3SJZA 1Y0RA 3KL9A 3QFSA 1D8TA 1QGZA 1VJSA 5F4OA 3OJXA 3OZVA 1G7TA 5B6IA 4N3NA 3CCUB 4XN3A 3PVDA 4M0LA 3AGQA 1ZM3A 3OOCA 2W6JA 1YITB 1W0KA 1ZM4A 2VNJA 1CQXA 1WORA 1IJFA 4X7EA 3ASPA 4X05A 1E63A 3W5UA 1EP3B 3VMFA 5L46A 1U2RA 2QTZA 4OOXA 3T56B 3W2EA 4PC6A 4XLFA 4EH1A 1R5NA 3V76A 2B5OA 1N0VC 3PENA 2GK6A 2WSSA 4XOPA 3SEJA 3CRZA 1I18A 2OBSA 2GPJA 4G7WA 1EP2B 3J81k 2BPOA 3FPKA 5FA6A 1QUFA 2VJJA 2QGGA 2QN6A 4B48A 1GJRA 1GAQA 3WBKA 2VZLA 1IB0A 1YHQB 4RDLA 4RM0A 4QFMA 4FWTA 4UAJA 4ASUA 3OW2B 3Q39A 4TMXA 1W35A 1QH0A 2PMDA 1QVFB 1VHEA 1UD8A 5BSYA 1E64A 2ZBVA 3CESA 1UD5A 4XN0A 1Q81D 4Z4UA 3H94A 1XQBA 4XONA 4XMYA 3VO1A 4Z4SA 1K8AD 3BQJA 2JJ1A 3OZUA 2B7BA 4G7XA 4PGOA 2JDIA 2OBTA 3GVJA 3CP8A 2XGJA 1TTTA 3ONUA 2VYQA 1M90D 2GJPA 4WZLA 2GJRA 1TUIA 3SJPA 1W9XA 5HZAA 4CQJA 1WDTA 4XLCA 1JA1A 1KK2A 4QVAA 1M1KD 1YX2A 1H8EA 4P2NA 2BM1A 3QE2A 3AVXA 4ROXA 3CC4B 4OOSA 4OPOA 4TT3A 3GQBA 4P6VF 4P1VA 3WY9A 5A8AA 1JB9A 4LBVA 3GIRA 2VJIA 2Z6BD 1WOPA
chains in the Genus database with same CATH topology
1GR1A 4NBSA 1DDIA 5H5JA 1QGAA 2HDNB 3ZC3A 4LBWA 5KSWB 4LBZA 2OK8A 1D1NA 2J7KA 3ZZ0A 4ACAA 2C77A 3JQPA 1S0UA 2BV3A 4RD2A 2XNCA 1VQOB 4ACBA 1R5BA 1XB2A 4DQKA 2EIXA 1YIJB 2ZITA 2OTLB 1VQ7B 1JA0A 4TMVA 1G7CA 1VQMB 1J9ZA 2E1RA 1QFZA 2QMUA 1OB2A 4C43A 1JJ2B 2DETA 1Q86D 1N0UA 3ZBUA 4K1XA 4RCZA 1FNMA 3CCQB 2QTLA 3VNUA 4G5GA 3AVWA 4M2LA 3CPWB 5GV7A 3CB4A 1YJNB 1B2RA 3CCJB 3I56B 1OGIA 1UMKA 1CNEA 2CNDA 2RC6A 1KK0A 4G1BA 2BGIA 2NPFA 4Q7JB 1AMOA 4B44A 2BN4A 4YAOA 4WQMA 4B3XA 2BMWA 1A8PA 4TMZA 3AVVA 2BVNA 3CD6B 1BJKA 3WNCA 1KD1D 1N8RD 3P26A 3ZZUA 3WXMA 3ES9A 1FRQA 4AC9A 1G7RA 3U6KA 2YWFA 3U2QA 3VNVA 1EFTA 3MMPA 3B8HA 3QFRA 1KRHA 1KTVA 1BQEA 4RD3A 4TN1A 1KQSB 2YWGA 3AVTA 1EWYA 5JBQA 1OB5A 1EFUA 4M1KA 1VQKB 4RD1A 3G6EB 5EMNA 3I1FA 2VNKA 1GO2A 1BX0A 2VNIA 4ZGQB 1EXMA 4B47A 2HMAA 1NJID 2BF4A 1GAWA 4ZV4A 1VQ8B 4HE5A 4B4DA 1W87A 3WBJA 1W2BB 1XE1A 2R6HA 3QFCA 4YALA 1EFCA 3W5VA 3I55B 1F60A 4AF7A 4QHYA 3AVUA 3FJOA 1NDHA 3ZZTA 3G4SB 1KJZA 2QDXA 4N3GA 3E1YE 3CCVB 2RC5A 1K9MD 2DCUA 1KC8D 3U6BA 1QFJA 3CCEB 4ZCMA 1TLLA 4RCYA 3MCAA 3CCSB 4PC3A 3CMAB 3W2HA 3CW2A 4YAUA 1DG1G 3WNDA 3JQRA 3W2FA 4YHBA 4M4SA 5THXA 1FDRA 1B23P 3CCLB 4U9UA 4RD6A 1ZM2A 4B43A 1ELOA 3OJWA 4Y9RA 2D74A 3CCRB 1YI2B 4RJLA 5AN9A 3ZBTA 3QFTA 5TR9A 3W2IA 2XNJA 1IJEA 1QFYA 3CC7B 1FNBA 2EFGA 4ZCIA 1VQLB 1K73D 3P27A 1ZUNB 1BX1A 3MHPA 2YWEA 4PC7A 1QGYA 3OZWA 5GV8A 4J0QA 1DARA 4DQLA 1G7SA 2PLFA 4RD0A 2QEXB 2DY1A 4LBYA 3CXCB 2YWHA 5H59A 1VQNB 1VQ9B 1YJWB 3JQQA 4M53A 2GQFA 3B78A 5TV2A 1VQ6B 1QVGB 1R5OA 1TVCA 1KK3A 3WYAA 1H42A 3LVBA 2DERA 1SKQA 1H85A 2OK7A 4TMTA 4Y9UA 4IW3B 1HA3A 1FNCA 2AHOA 1FRNA 1Q82D 4H9GA 3B82A 1SM4A 4LC0A 3WNBA 1YJ9B 1AIPA 4RD4A 1VQPB 2C78A 1QX4A 4BPRA 3CC2B 4FK8A 3W2GA 2HCJB 4R71A 1CNFA 1W34A 4Y7CA 1S72B 2PIAA 1KK1A 1E62A 1EP1B 4C0SA 4MYTA 1OGJA 2CRVA 3QSYA 1GVHA 2OTJB 2X3UA 4YAFA 4AF6A 3CMEB 1ZM9A 5TY0A 2FX3A 3AVYA 1QUEA 1VQ5B 1DDGA 1QG0A 1VQ4B 1Q7YD 1FNDA 2BSAA 4NCNA 2B7CA 2DEUA 4MYUA 3LO8A 1JNYA 3G71B 5HXBA 2BGJA 1D2EA 3VO2A 5DSZA 4HE6A 1F20A 4FN5A 4YAWA 4TMWA 1I7PA 4PC2A 4ZGNB 2XEXA 3W5HA 3AGPA 4P3YA 3CCMB 2QA4B 2VNHA 2BM0A 4G1VA 3E20A 4F7DA 4ZCLA 3SJZA 3QFSA 1D8TA 1QGZA 3OJXA 3OZVA 1G7TA 4N3NA 3CCUB 4M0LA 3AGQA 1ZM3A 1YITB 1ZM4A 2VNJA 1CQXA 1IJFA 1E63A 3W5UA 1EP3B 3VMFA 1U2RA 2QTZA 3W2EA 4PC6A 4EH1A 1R5NA 3V76A 2B5OA 1N0VC 3PENA 3CRZA 2GPJA 3J81k 1EP2B 2BPOA 3FPKA 5FA6A 1QUFA 2QN6A 4B48A 1GJRA 3WBKA 1GAQA 2VZLA 1IB0A 1YHQB 4QFMA 4FWTA 4UAJA 3OW2B 4TMXA 1W35A 1QH0A 2PMDA 1QVFB 1E64A 1Q81D 3VO1A 1K8AD 3OZUA 2B7BA 4PGOA 1TTTA 2VYQA 1M90D 1TUIA 1WDTA 1JA1A 1KK2A 1M1KD 2BM1A 3QE2A 3AVXA 3CC4B 4P6VF 3WY9A 1JB9A 4LBVA 4PC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GR1 A;  4NBS A;  1DDI A;  5H5J A;  1QGA A;  2HDN B;  3ZC3 A;  4LBW A;  5KSW B;  4LBZ A;  2OK8 A;  1D1N A;  2J7K A;  3ZZ0 A;  4ACA A;  2C77 A;  3JQP A;  1S0U A;  2BV3 A;  4RD2 A;  2XNC A;  1VQO B;  4ACB A;  1R5B A;  1XB2 A;  4DQK A;  2EIX A;  1YIJ B;  2ZIT A;  2OTL B;  1VQ7 B;  1JA0 A;  4TMV A;  1G7C A;  1VQM B;  1J9Z A;  2E1R A;  1QFZ A;  2QMU A;  1OB2 A;  4C43 A;  1JJ2 B;  2DET A;  1Q86 D;  1N0U A;  3ZBU A;  4K1X A;  4RCZ A;  1FNM A;  3CCQ B;  2QTL A;  3VNU A;  4G5G A;  3AVW A;  4M2L A;  3CPW B;  5GV7 A;  3CB4 A;  1YJN B;  1B2R A;  3CCJ B;  3I56 B;  1OGI A;  1UMK A;  1CNE A;  2CND A;  2RC6 A;  1KK0 A;  4G1B A;  2BGI A;  2NPF A;  4Q7J B;  1AMO A;  4B44 A;  2BN4 A;  4YAO A;  4WQM A;  4B3X A;  2BMW A;  1A8P A;  4TMZ A;  3AVV A;  2BVN A;  3CD6 B;  1BJK A;  3WNC A;  1KD1 D;  1N8R D;  3P26 A;  3ZZU A;  3WXM A;  3ES9 A;  1FRQ A;  4AC9 A;  1G7R A;  3U6K A;  2YWF A;  3U2Q A;  3VNV A;  1EFT A;  3MMP A;  3B8H A;  3QFR A;  1KRH A;  1KTV A;  1BQE A;  4RD3 A;  4TN1 A;  1KQS B;  2YWG A;  3AVT A;  1EWY A;  5JBQ A;  1OB5 A;  1EFU A;  4M1K A;  1VQK B;  4RD1 A;  3G6E B;  5EMN A;  3I1F A;  2VNK A;  1GO2 A;  1BX0 A;  2VNI A;  4ZGQ B;  1EXM A;  4B47 A;  2HMA A;  1NJI D;  2BF4 A;  1GAW A;  4ZV4 A;  1VQ8 B;  4HE5 A;  4B4D A;  1W87 A;  3WBJ A;  1W2B B;  1XE1 A;  2R6H A;  3QFC A;  4YAL A;  1EFC A;  3W5V A;  3I55 B;  1F60 A;  4AF7 A;  4QHY A;  3AVU A;  3FJO A;  1NDH A;  3ZZT A;  3G4S B;  1KJZ A;  2QDX A;  4N3G A;  3E1Y E;  3CCV B;  2RC5 A;  1K9M D;  2DCU A;  1KC8 D;  3U6B A;  1QFJ A;  3CCE B;  4ZCM A;  1TLL A;  4RCY A;  3MCA A;  3CCS B;  4PC3 A;  3CMA B;  3W2H A;  3CW2 A;  4YAU A;  1DG1 G;  3WND A;  3JQR A;  3W2F A;  4YHB A;  4M4S A;  5THX A;  1FDR A;  1B23 P;  3CCL B;  4U9U A;  4RD6 A;  1ZM2 A;  4B43 A;  1ELO A;  3OJW A;  4Y9R A;  2D74 A;  3CCR B;  1YI2 B;  4RJL A;  5AN9 A;  3ZBT A;  3QFT A;  5TR9 A;  3W2I A;  2XNJ A;  1IJE A;  1QFY A;  3CC7 B;  1FNB A;  2EFG A;  4ZCI A;  1VQL B;  1K73 D;  3P27 A;  1ZUN B;  1BX1 A;  3MHP A;  2YWE A;  4PC7 A;  1QGY A;  3OZW A;  5GV8 A;  4J0Q A;  1DAR A;  4DQL A;  1G7S A;  2PLF A;  4RD0 A;  2QEX B;  2DY1 A;  4LBY A;  3CXC B;  2YWH A;  5H59 A;  1VQN B;  1VQ9 B;  1YJW B;  3JQQ A;  4M53 A;  2GQF A;  3B78 A;  5TV2 A;  1VQ6 B;  1QVG B;  1R5O A;  1TVC A;  1KK3 A;  3WYA A;  1H42 A;  3LVB A;  2DER A;  1SKQ A;  1H85 A;  2OK7 A;  4TMT A;  4Y9U A;  4IW3 B;  1HA3 A;  1FNC A;  2AHO A;  1FRN A;  1Q82 D;  4H9G A;  3B82 A;  1SM4 A;  4LC0 A;  3WNB A;  1YJ9 B;  1AIP A;  4RD4 A;  1VQP B;  2C78 A;  1QX4 A;  4BPR A;  3CC2 B;  4FK8 A;  3W2G A;  2HCJ B;  4R71 A;  1CNF A;  1W34 A;  4Y7C A;  1S72 B;  2PIA A;  1KK1 A;  1E62 A;  1EP1 B;  4C0S A;  4MYT A;  1OGJ A;  2CRV A;  3QSY A;  1GVH A;  2OTJ B;  2X3U A;  4YAF A;  4AF6 A;  3CME B;  1ZM9 A;  5TY0 A;  2FX3 A;  3AVY A;  1QUE A;  1VQ5 B;  1DDG A;  1QG0 A;  1VQ4 B;  1Q7Y D;  1FND A;  2BSA A;  4NCN A;  2B7C A;  2DEU A;  4MYU A;  3LO8 A;  1JNY A;  3G71 B;  5HXB A;  2BGJ A;  1D2E A;  3VO2 A;  5DSZ A;  4HE6 A;  1F20 A;  4FN5 A;  4YAW A;  4TMW A;  1I7P A;  4PC2 A;  4ZGN B;  2XEX A;  3W5H A;  3AGP A;  4P3Y A;  3CCM B;  2QA4 B;  2VNH A;  2BM0 A;  4G1V A;  3E20 A;  4F7D A;  4ZCL A;  3SJZ A;  3QFS A;  1D8T A;  1QGZ A;  3OJX A;  3OZV A;  1G7T A;  4N3N A;  3CCU B;  4M0L A;  3AGQ A;  1ZM3 A;  1YIT B;  1ZM4 A;  2VNJ A;  1CQX A;  1IJF A;  1E63 A;  3W5U A;  1EP3 B;  3VMF A;  1U2R A;  2QTZ A;  3W2E A;  4PC6 A;  4EH1 A;  1R5N A;  3V76 A;  2B5O A;  1N0V C;  3PEN A;  3CRZ A;  2GPJ A;  3J81 k;  1EP2 B;  2BPO A;  3FPK A;  5FA6 A;  1QUF A;  2QN6 A;  4B48 A;  1GJR A;  3WBK A;  1GAQ A;  2VZL A;  1IB0 A;  1YHQ B;  4QFM A;  4FWT A;  4UAJ A;  3OW2 B;  4TMX A;  1W35 A;  1QH0 A;  2PMD A;  1QVF B;  1E64 A;  1Q81 D;  3VO1 A;  1K8A D;  3OZU A;  2B7B A;  4PGO A;  1TTT A;  2VYQ A;  1M90 D;  1TUI A;  1WDT A;  1JA1 A;  1KK2 A;  1M1K D;  2BM1 A;  3QE2 A;  3AVX A;  3CC4 B;  4P6V F;  3WY9 A;  1JB9 A;  4LBV A;  4PC1 A; 
#chains in the Genus database with same CATH topology
 1GR1 A;  3AST A;  4OP7 A;  4NBS A;  1E1Q A;  1DDI A;  2QE7 A;  5H5J A;  3GVK A;  1E3Z A;  1QGA A;  2HDN B;  3ZC3 A;  3ZIA A;  4LBW A;  4P25 A;  5KSW B;  2ZZF A;  5LMZ A;  4LBZ A;  2OK8 A;  1D1N A;  2J7K A;  3ZZ0 A;  4ACA A;  2C77 A;  3A3B A;  3JQP A;  4P12 A;  1N07 A;  1RQP A;  4KKS A;  4UZF A;  4X7F A;  5FL7 A;  1T6Y A;  4X8I A;  4YXW A;  1WPC A;  3G05 A;  2CW5 A;  4QUZ A;  1WSR A;  1NRK A;  4XL9 A;  3ASS A;  1S0U A;  2BV3 A;  5FNZ A;  4RD2 A;  2XNC A;  1VQO B;  4ACB A;  1R5B A;  1WU8 A;  1XB2 A;  2ZZQ A;  4DQK A;  2EIX A;  4B3G A;  2ZZG A;  1YIJ B;  2ZIT A;  1NBM A;  2ZTN A;  1MRZ A;  2OTL B;  1VQ7 B;  1JA0 A;  4TMV A;  1G7C A;  1VQM B;  1J9Z A;  2E1R A;  2ZL6 A;  3SLD A;  1Q9S A;  1QFZ A;  1HVX A;  2QMU A;  2ZZE A;  1OB2 A;  4C43 A;  5KNL A;  4P22 A;  1JJ2 B;  3D26 A;  2DET A;  4RLZ A;  1Q86 D;  1N0U A;  4KKU A;  3ZBU A;  2V7W A;  4K1X A;  2CK3 A;  1MAB A;  1FNM A;  4RCZ A;  4RPD A;  1NB9 A;  3CCQ B;  1E1R A;  2QTL A;  3VNU A;  4G5G A;  4Z4R A;  3AVW A;  3WQZ A;  4M2L A;  4WWV A;  3CPW B;  2F1M A;  5GV7 A;  3CB4 A;  1YJN B;  4XOT A;  1B2R A;  3CCJ B;  5DN6 A;  2I1L A;  3I56 B;  1OGI A;  1K28 D;  3ONY A;  1UMK A;  1CNE A;  2CND A;  1N05 A;  4XM3 A;  2RC6 A;  3SLN A;  2CC2 A;  1KK0 A;  1KMH A;  4X0C A;  4G1B A;  2BGI A;  2V4D A;  3T51 B;  1KZL A;  4XQF A;  2NPF A;  4Q7J B;  2X53 S;  1AMO A;  4B44 A;  4B3F X;  1VF7 A;  4NNJ A;  2BN4 A;  4YAO A;  4WQM A;  2D9R A;  1PJ6 A;  4B3X A;  2BMW A;  1A8P A;  1T6Z A;  2KVO A;  4PAA A;  4WZE A;  5A89 A;  4TMZ A;  1UD3 A;  2BVN A;  4WZT A;  3CD6 B;  3AVV A;  3OW7 A;  5HZB A;  4PC1 A;  4YEJ A;  1BJK A;  3BH4 A;  3WNC A;  1W0J A;  1KD1 D;  4RDJ A;  4XR6 A;  1N8R D;  3P26 A;  2DOG A;  3A3G A;  3ZZU A;  3WXM A;  3ES9 A;  1FRQ A;  4AC9 A;  2OBR A;  1G7R A;  2F4N A;  3U6K A;  2YWF A;  3U2Q A;  5F4M A;  3VNV A;  3A35 A;  5BSX A;  1EFT A;  3MMP A;  3B8H A;  3QFR A;  3LQE A;  2NV4 A;  4XLH A;  3BY1 A;  1KRH A;  1KTV A;  5IYW A;  3Q3A A;  4JMQ A;  1UD4 A;  1BQE A;  2X6Y A;  2ZXI A;  4L8J A;  4RD3 A;  3OPO A;  1OHH A;  5KW9 A;  4TN1 A;  1KQS B;  2YWG A;  1UD6 A;  3AVT A;  1EFR A;  2C5B A;  1EWY A;  5JBQ A;  2X6W A;  1OB5 A;  1H8H A;  1EFU A;  1YLO A;  4M1K A;  4Z4Z A;  2JIZ A;  1VQK B;  4RD1 A;  1V0E A;  4OPS A;  3G6E B;  3Q38 A;  5EMN A;  4TSF A;  3I1F A;  1N08 A;  2VNK A;  2V7V A;  1GO2 A;  2XOK A;  3OAA A;  1BX0 A;  2VNI A;  4ZGQ B;  1EXM A;  2VBT A;  4B47 A;  2WZN A;  3R6J A;  1N06 A;  2HMA A;  3LQ6 A;  3OFN A;  3OKX A;  5A88 A;  2Q6L A;  1NJI D;  2BF4 A;  3VR6 A;  1GAW A;  2GRE A;  2HLD A;  3OE7 A;  4ZV4 A;  1VQ8 B;  4HE5 A;  3CMM A;  3HAG A;  1WP6 A;  1FX0 A;  2ZL7 A;  3RY8 A;  4B4D A;  1W87 A;  3A1P A;  4DK1 A;  3WBJ A;  1W2B B;  1XE1 A;  2R6H A;  2V31 A;  3JU4 A;  1EFC A;  3CTA A;  3QFC A;  4YAL A;  4X06 A;  2F43 A;  3W5V A;  5IYQ A;  3I55 B;  2V7U A;  1F60 A;  4AF7 A;  4QHY A;  2M5S A;  1I8D A;  3AVU A;  2WJV A;  1NDH A;  1SKY B;  3FJO A;  5FO1 A;  4DNR B;  2VBS A;  2C4T A;  1E79 A;  3ZZT A;  3G4S B;  1KJZ A;  3SKB A;  4TKO B;  2QDX A;  1HZE A;  4N3G A;  3GVL A;  3E1Y E;  3KEW A;  3CCV B;  2RC5 A;  2WYR A;  1K9M D;  1WOS A;  2DCU A;  1PJ7 A;  1KC8 D;  2V7X A;  3U6B A;  2WPD A;  4II2 A;  1V5V A;  5CDF A;  1VLO A;  2ZL5 A;  1V0F A;  3PA2 A;  1QFJ A;  1RQR A;  2JN9 A;  4UZU A;  4E0F A;  3CCE B;  4ZCM A;  2X6X A;  4P3I A;  1NB0 A;  1TLL A;  4QVJ A;  4RCY A;  3T53 B;  3MCA A;  2GK7 A;  3CCS B;  1T5E A;  4PC3 A;  3CMA B;  3W2H A;  3CW2 A;  4YAU A;  1DG1 G;  3WND A;  3JQR A;  1BMF A;  2XND A;  4YEL A;  4XLA A;  3W2F A;  4YHB A;  4M4S A;  3BNW A;  5THX A;  2D3N A;  2C5H A;  1FDR A;  1B23 P;  2E1B A;  3FPP A;  1E43 A;  3CCL B;  5IYN A;  4U9U A;  4RD6 A;  1ZM2 A;  4B43 A;  3A8I A;  4P9S A;  1ELO A;  3OJW A;  4Y9R A;  3ZPN A;  2D74 A;  4KKT A;  3CCR B;  1YI2 B;  4RJL A;  5AN9 A;  4XKW A;  3V7A A;  3ZBT A;  3QFT A;  3BC9 A;  5TR9 A;  4OOV A;  3W2I A;  2XNJ A;  1IJE A;  1QFY A;  3CC7 B;  2ZBU A;  5IYP A;  2ZTG A;  1FNB A;  2DYI A;  2EFG A;  4PAB A;  4ZCI A;  1VQL B;  2OYN A;  1K73 D;  2P3M A;  3CP2 A;  3P27 A;  1ZUN B;  2D3L A;  3PA1 A;  1BX1 A;  3MHP A;  2YWE A;  1PKV A;  2V7Q A;  2FVG A;  4PC7 A;  1QGY A;  1BPL A;  1UD2 A;  2V7T A;  3OZW A;  4X7D A;  3OP1 A;  4J0Q A;  5GV8 A;  1DAR A;  4XNF A;  4DQL A;  1G7S A;  4DK0 A;  2PLF A;  4RD0 A;  3FKS A;  2DY1 A;  2QEX B;  4LBY A;  3CXC B;  4Z4W A;  2YWH A;  5H59 A;  5IYR A;  1S4M A;  1VQN B;  2XZO A;  1VQ9 B;  1YJW B;  3JQQ A;  3ISX A;  4M53 A;  2WR8 A;  1XFO A;  3GSI A;  3LNN A;  2C4U A;  2GQF A;  3B78 A;  5TV2 A;  1VQ6 B;  1QVG B;  1R5O A;  1TVC A;  2WZP P;  1KK3 A;  1T6X A;  3WYA A;  1H42 A;  3A8J A;  4DNT B;  3LVB A;  4XOR A;  2DER A;  1SKQ A;  2VBU A;  4AVZ A;  5TRD A;  2C2W A;  3H9N A;  4WZK A;  1H85 A;  3R6K A;  4XKV A;  3DDY A;  2OK7 A;  4TMT A;  4Y9U A;  4Z4T A;  5IK2 A;  1PJ5 A;  2LZJ A;  2R9V A;  4IW3 B;  2GJK A;  1HA3 A;  1FNC A;  2AHO A;  1FRN A;  1Q82 D;  2Q6K A;  4H9G A;  2ZXH A;  2X8K A;  3B82 A;  1SM4 A;  4LC0 A;  3WNB A;  4HIZ A;  3OEE A;  3ASR A;  1YJ9 B;  1AIP A;  4II3 A;  4RD4 A;  1VQP B;  2C78 A;  1QX4 A;  4BPR A;  3CC2 B;  2W6I A;  4FK8 A;  4OPV A;  4X7C A;  3W2G A;  2X85 A;  4Z1M A;  1IHM A;  2HCJ B;  2Q6O A;  4FXU A;  4R71 A;  1CNF A;  2XZP A;  4GQN A;  1W34 A;  4X07 A;  2XZL A;  4QV2 A;  3PUN A;  4G6I A;  3PUM A;  2JJ2 A;  4Y7C A;  1S72 B;  4XD7 A;  2PIA A;  1WOO A;  3ASQ A;  1KK1 A;  2CF4 A;  1E62 A;  3OEH A;  5E6T A;  2CBX A;  1EP1 B;  5DS0 A;  4C0S A;  5J3O A;  4MYT A;  3BCD A;  5FO0 A;  1OGJ A;  2CRV A;  3BCF A;  5FIU A;  3QSY A;  1GVH A;  4P6Y A;  4P26 A;  2OTJ B;  2X3U A;  4YAF A;  4AF6 A;  3CME B;  1ZM9 A;  5TY0 A;  2FX3 A;  3A8K A;  3AVY A;  3Q6Q A;  3NE5 B;  1VLY A;  4XLE A;  1QUE A;  1WTH D;  3CPX A;  5F4J A;  4UZE A;  2X0K A;  5HKK A;  1VQ5 B;  1DDG A;  1QG0 A;  1VQ4 B;  1BLI A;  2VBV A;  1FND A;  2BSA A;  1Q7Y D;  4NCN A;  2B7C A;  2DEU A;  4Z4Y A;  2PE3 A;  4MYU A;  2F1L A;  3Q6R A;  3LO8 A;  1JNY A;  4RPB A;  3G71 B;  1Y0Y A;  5HXB A;  2BGJ A;  1E3X A;  1D2E A;  3BY2 A;  3VO2 A;  2WJY A;  5DSZ A;  4HE6 A;  1F20 A;  4FN5 A;  4YAW A;  4TMW A;  1I7P A;  4PC2 A;  1COW A;  1VHO A;  4ZGN B;  4RDK A;  3ZUG A;  2DIE A;  2XEX A;  3W5H A;  4Z4V A;  3AGP A;  4P3Y A;  3CCM B;  5J35 A;  2QA4 B;  2VNH A;  2BM0 A;  2Q6I A;  4G1V A;  1P4M A;  1WSV A;  3E20 A;  4F7D A;  4ZCL A;  1OB0 A;  3SJZ A;  1Y0R A;  3KL9 A;  3QFS A;  1D8T A;  1QGZ A;  1VJS A;  5F4O A;  3OJX A;  3OZV A;  1G7T A;  5B6I A;  4N3N A;  3CCU B;  4XN3 A;  3PVD A;  4M0L A;  3AGQ A;  1ZM3 A;  3OOC A;  2W6J A;  1YIT B;  1W0K A;  1ZM4 A;  2VNJ A;  1CQX A;  1WOR A;  1IJF A;  4X7E A;  3ASP A;  4X05 A;  1E63 A;  3W5U A;  1EP3 B;  3VMF A;  5L46 A;  1U2R A;  2QTZ A;  4OOX A;  3T56 B;  3W2E A;  4PC6 A;  4XLF A;  4EH1 A;  1R5N A;  3V76 A;  2B5O A;  1N0V C;  3PEN A;  2GK6 A;  2WSS A;  4XOP A;  3SEJ A;  3CRZ A;  1I18 A;  2OBS A;  2GPJ A;  4G7W A;  1EP2 B;  3J81 k;  2BPO A;  3FPK A;  5FA6 A;  1QUF A;  2VJJ A;  2QGG A;  2QN6 A;  4B48 A;  1GJR A;  1GAQ A;  3WBK A;  2VZL A;  1IB0 A;  1YHQ B;  4RDL A;  4RM0 A;  4QFM A;  4FWT A;  4UAJ A;  4ASU A;  3OW2 B;  3Q39 A;  4TMX A;  1W35 A;  1QH0 A;  2PMD A;  1QVF B;  1VHE A;  1UD8 A;  5BSY A;  1E64 A;  2ZBV A;  3CES A;  1UD5 A;  4XN0 A;  1Q81 D;  4Z4U A;  3H94 A;  1XQB A;  4XON A;  4XMY A;  3VO1 A;  4Z4S A;  1K8A D;  3BQJ A;  2JJ1 A;  3OZU A;  2B7B A;  4G7X A;  4PGO A;  2JDI A;  2OBT A;  3GVJ A;  3CP8 A;  2XGJ A;  1TTT A;  3ONU A;  2VYQ A;  1M90 D;  2GJP A;  4WZL A;  2GJR A;  1TUI A;  3SJP A;  1W9X A;  5HZA A;  4CQJ A;  1WDT A;  4XLC A;  1JA1 A;  1KK2 A;  4QVA A;  1M1K D;  1YX2 A;  1H8E A;  4P2N A;  2BM1 A;  3QE2 A;  3AVX A;  4ROX A;  3CC4 B;  4OOS A;  4OPO A;  4TT3 A;  3GQB A;  4P6V F;  4P1V A;  3WY9 A;  5A8A A;  1JB9 A;  4LBV A;  3GIR A;  2VJI A;  2Z6B D;  1WOP A; 
#chains in the Genus database with same CATH homology
 1GR1 A;  4NBS A;  1DDI A;  5H5J A;  1QGA A;  2HDN B;  3ZC3 A;  4LBW A;  5KSW B;  4LBZ A;  2OK8 A;  1D1N A;  2J7K A;  3ZZ0 A;  4ACA A;  2C77 A;  3JQP A;  1S0U A;  2BV3 A;  4RD2 A;  2XNC A;  1VQO B;  4ACB A;  1R5B A;  1XB2 A;  4DQK A;  2EIX A;  1YIJ B;  2ZIT A;  2OTL B;  1VQ7 B;  1JA0 A;  4TMV A;  1G7C A;  1VQM B;  1J9Z A;  2E1R A;  1QFZ A;  2QMU A;  1OB2 A;  4C43 A;  1JJ2 B;  2DET A;  1Q86 D;  1N0U A;  3ZBU A;  4K1X A;  4RCZ A;  1FNM A;  3CCQ B;  2QTL A;  3VNU A;  4G5G A;  3AVW A;  4M2L A;  3CPW B;  5GV7 A;  3CB4 A;  1YJN B;  1B2R A;  3CCJ B;  3I56 B;  1OGI A;  1UMK A;  1CNE A;  2CND A;  2RC6 A;  1KK0 A;  4G1B A;  2BGI A;  2NPF A;  4Q7J B;  1AMO A;  4B44 A;  2BN4 A;  4YAO A;  4WQM A;  4B3X A;  2BMW A;  1A8P A;  4TMZ A;  3AVV A;  2BVN A;  3CD6 B;  1BJK A;  3WNC A;  1KD1 D;  1N8R D;  3P26 A;  3ZZU A;  3WXM A;  3ES9 A;  1FRQ A;  4AC9 A;  1G7R A;  3U6K A;  2YWF A;  3U2Q A;  3VNV A;  1EFT A;  3MMP A;  3B8H A;  3QFR A;  1KRH A;  1KTV A;  1BQE A;  4RD3 A;  4TN1 A;  1KQS B;  2YWG A;  3AVT A;  1EWY A;  5JBQ A;  1OB5 A;  1EFU A;  4M1K A;  1VQK B;  4RD1 A;  3G6E B;  5EMN A;  3I1F A;  2VNK A;  1GO2 A;  1BX0 A;  2VNI A;  4ZGQ B;  1EXM A;  4B47 A;  2HMA A;  1NJI D;  2BF4 A;  1GAW A;  4ZV4 A;  1VQ8 B;  4HE5 A;  4B4D A;  1W87 A;  3WBJ A;  1W2B B;  1XE1 A;  2R6H A;  3QFC A;  4YAL A;  1EFC A;  3W5V A;  3I55 B;  1F60 A;  4AF7 A;  4QHY A;  3AVU A;  3FJO A;  1NDH A;  3ZZT A;  3G4S B;  1KJZ A;  2QDX A;  4N3G A;  3E1Y E;  3CCV B;  2RC5 A;  1K9M D;  2DCU A;  1KC8 D;  3U6B A;  1QFJ A;  3CCE B;  4ZCM A;  1TLL A;  4RCY A;  3MCA A;  3CCS B;  4PC3 A;  3CMA B;  3W2H A;  3CW2 A;  4YAU A;  1DG1 G;  3WND A;  3JQR A;  3W2F A;  4YHB A;  4M4S A;  5THX A;  1FDR A;  1B23 P;  3CCL B;  4U9U A;  4RD6 A;  1ZM2 A;  4B43 A;  1ELO A;  3OJW A;  4Y9R A;  2D74 A;  3CCR B;  1YI2 B;  4RJL A;  5AN9 A;  3ZBT A;  3QFT A;  5TR9 A;  3W2I A;  2XNJ A;  1IJE A;  1QFY A;  3CC7 B;  1FNB A;  2EFG A;  4ZCI A;  1VQL B;  1K73 D;  3P27 A;  1ZUN B;  1BX1 A;  3MHP A;  2YWE A;  4PC7 A;  1QGY A;  3OZW A;  5GV8 A;  4J0Q A;  1DAR A;  4DQL A;  1G7S A;  2PLF A;  4RD0 A;  2QEX B;  2DY1 A;  4LBY A;  3CXC B;  2YWH A;  5H59 A;  1VQN B;  1VQ9 B;  1YJW B;  3JQQ A;  4M53 A;  2GQF A;  3B78 A;  5TV2 A;  1VQ6 B;  1QVG B;  1R5O A;  1TVC A;  1KK3 A;  3WYA A;  1H42 A;  3LVB A;  2DER A;  1SKQ A;  1H85 A;  2OK7 A;  4TMT A;  4Y9U A;  4IW3 B;  1HA3 A;  1FNC A;  2AHO A;  1FRN A;  1Q82 D;  4H9G A;  3B82 A;  1SM4 A;  4LC0 A;  3WNB A;  1YJ9 B;  1AIP A;  4RD4 A;  1VQP B;  2C78 A;  1QX4 A;  4BPR A;  3CC2 B;  4FK8 A;  3W2G A;  2HCJ B;  4R71 A;  1CNF A;  1W34 A;  4Y7C A;  1S72 B;  2PIA A;  1KK1 A;  1E62 A;  1EP1 B;  4C0S A;  4MYT A;  1OGJ A;  2CRV A;  3QSY A;  1GVH A;  2OTJ B;  2X3U A;  4YAF A;  4AF6 A;  3CME B;  1ZM9 A;  5TY0 A;  2FX3 A;  3AVY A;  1QUE A;  1VQ5 B;  1DDG A;  1QG0 A;  1VQ4 B;  1Q7Y D;  1FND A;  2BSA A;  4NCN A;  2B7C A;  2DEU A;  4MYU A;  3LO8 A;  1JNY A;  3G71 B;  5HXB A;  2BGJ A;  1D2E A;  3VO2 A;  5DSZ A;  4HE6 A;  1F20 A;  4FN5 A;  4YAW A;  4TMW A;  1I7P A;  4PC2 A;  4ZGN B;  2XEX A;  3W5H A;  3AGP A;  4P3Y A;  3CCM B;  2QA4 B;  2VNH A;  2BM0 A;  4G1V A;  3E20 A;  4F7D A;  4ZCL A;  3SJZ A;  3QFS A;  1D8T A;  1QGZ A;  3OJX A;  3OZV A;  1G7T A;  4N3N A;  3CCU B;  4M0L A;  3AGQ A;  1ZM3 A;  1YIT B;  1ZM4 A;  2VNJ A;  1CQX A;  1IJF A;  1E63 A;  3W5U A;  1EP3 B;  3VMF A;  1U2R A;  2QTZ A;  3W2E A;  4PC6 A;  4EH1 A;  1R5N A;  3V76 A;  2B5O A;  1N0V C;  3PEN A;  3CRZ A;  2GPJ A;  3J81 k;  1EP2 B;  2BPO A;  3FPK A;  5FA6 A;  1QUF A;  2QN6 A;  4B48 A;  1GJR A;  3WBK A;  1GAQ A;  2VZL A;  1IB0 A;  1YHQ B;  4QFM A;  4FWT A;  4UAJ A;  3OW2 B;  4TMX A;  1W35 A;  1QH0 A;  2PMD A;  1QVF B;  1E64 A;  1Q81 D;  3VO1 A;  1K8A D;  3OZU A;  2B7B A;  4PGO A;  1TTT A;  2VYQ A;  1M90 D;  1TUI A;  1WDT A;  1JA1 A;  1KK2 A;  1M1K D;  2BM1 A;  3QE2 A;  3AVX A;  3CC4 B;  4P6V F;  3WY9 A;  1JB9 A;  4LBV A;  4PC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...