4ZH1D

Complement factor h in complex with the gm1 glycan
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
FGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Complement Factor H and Simian Virus 40 bind the GM1 ganglioside in distinct conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 126
sequence length 126
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4zh1D01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4zh1D02
2YRAA 4AYMA 3OXUD 4ZH1D 2WIIC 3NFPI 5JPMG 2XWJI 3ERBA 2LOJA 1NWVA 1OK2A 2RL0A 3TVJA 1E5GA 3L89M 2BZMA 1HCCA 4ONTD 2RKYA 1H2QP 1VVCA 1Q3XA 1GKGA 3KXVA 2B5ID 2XWBF 4B2RA 1G4FA 1OK1A 1PPQA 2RKZA 1TPNA 4YNXA 1QGBA 2ERJA 3ZD2A 4C16A 5HYUB 1VVDA 3O8EB 1E8BA 1E88A 1QO6A 5I0QB 2XQWC 2RLQA 1C1ZA 2W80A 1MD8A 1H2PP 3SW0X 4CSYA 1TPGA 1HFIA 2KRIA 4PZ5A 5HYTB 1SRZA 4WJG2 1ELVA 5HZPB 4AYDA 4LOSA 3OP8A 1QUBA 3R62A 2G7IA 4KKDA 3EJHA 2XRBA 2KMSA 1OK3A 1GHQB 3KZJA 4J38B 1OJWA 2QY0A 4FXGG 1H04P 1GPZA 1GKNA 1LY2A 1OJYA 2IZ4A 2YBYA 4JHSA 3ZRZA 2MCZA 3INBC 2EHFA 2JRAA 5HYPA 2W81A 3OEDC 2CKUA 4B2SA 1TPMA 3IX0A 1UOTP 3MQLA 4DJZA 1O9AA 3T5OA 4MUCA 4F4OC 3M7PA 1OK9A 3GXEA 3IU3I 3GOVA 4AYIA 2EC3A 4AYEA 2MCYA 1FBRA 1Z92B 2IZ3A 1U5MA 1MD7A 2JGXA 2UWNA 1OJVA 3ZD1A 2XRDA 1CKLA 3RJ3D 1SS2A 4K12A 5FO8C 4LOTA 2V8EA 1HFHA 1G4GA 2O39C 4IGDA 1H03P 2CG7A 4A5WB 1ZJKA 2CG6A 2RLPA 2JGWA 3CALA 2A55A
chains in the Genus database with same CATH superfamily
2YRAA 4AYMA 3OXUD 4ZH1D 2WIIC 3NFPI 5JPMG 2XWJI 3ERBA 2LOJA 1NWVA 1OK2A 2RL0A 1RLHA 3TVJA 1E5GA 3L89M 2BZMA 1HCCA 4ONTD 3FGTA 3F6KA 2RKYA 1H2QP 1VVCA 2ZYCA 1Q3XA 1GKGA 3KXVA 2B5ID 3K3TA 2Y8TA 2XWBF 4B2RA 1G4FA 1OK1A 1PPQA 2RKZA 1TPNA 2Y8SA 4YNXA 1QGBA 2ERJA 5DN5A 3ZD2A 4C16A 5HYUB 1VVDA 3O8EB 1E8BA 1E88A 1QO6A 5I0QB 2XQWC 3WSYA 2RLQA 1C1ZA 5DN4A 2W80A 1MD8A 1H2PP 3SW0X 4CSYA 1TPGA 1HFIA 2KRIA 4PZ5A 5HYTB 1SRZA 4WJG2 1ELVA 5HZPB 4AYDA 4PO7A 4LOSA 3OP8A 1QUBA 3R62A 4BWCA 2G7IA 4KKDA 3EJHA 2XRBA 2KMSA 1OK3A 1GHQB 3KZJA 4J38B 1OJWA 2QY0A 4FXGG 1H04P 1GPZA 1GKNA 1LY2A 1OJYA 2IZ4A 2YBYA 4JHSA 3ZRZA 3CI0J 2MCZA 3INBC 2EHFA 2I2LA 2JRAA 5HYPA 2W81A 3OEDC 2CKUA 4YIZA 4B2SA 1TPMA 3IX0A 1UOTP 3MQLA 4DJZA 1O9AA 3T5OA 3ZLEA 4MUCA 3ZLDA 3NJAA 4F4OC 4N7EA 3M7PA 1OK9A 3GXEA 3IU3I 3GOVA 4AYIA 2EC3A 2X2ZA 2MCYA 4AYEA 4APLA 1FBRA 4MSLA 1Z92B 2IZ3A 1U5MA 1MD7A 3VWOA 2JGXA 2UWNA 1OJVA 3ZD1A 2XRDA 1CKLA 3RJ3D 1SS2A 4K12A 5FO8C 4LOTA 2V8EA 1HFHA 1G4GA 3WSXA 2O39C 4IGDA 1H03P 2CG7A 4A5WB 1ZJKA 2CG6A 2RLPA 2JGWA 3CALA 3FGRA 2A55A 2Y8RA
chains in the Genus database with same CATH topology
2YRAA 4AYMA 3OXUD 4ZH1D 2WIIC 3NFPI 5JPMG 2XWJI 3ERBA 2LOJA 1NWVA 1OK2A 2RL0A 3TVJA 1E5GA 3L89M 2BZMA 1HCCA 4ONTD 2RKYA 1H2QP 1VVCA 1Q3XA 1GKGA 3KXVA 2B5ID 2XWBF 4B2RA 1G4FA 1OK1A 1PPQA 2RKZA 1TPNA 4YNXA 1QGBA 2ERJA 3ZD2A 4C16A 5HYUB 1VVDA 3O8EB 1E8BA 1E88A 1QO6A 5I0QB 2XQWC 2RLQA 1C1ZA 2W80A 1MD8A 1H2PP 3SW0X 4CSYA 1TPGA 1HFIA 2KRIA 4PZ5A 5HYTB 1SRZA 4WJG2 1ELVA 5HZPB 4AYDA 4LOSA 3OP8A 1QUBA 3R62A 2G7IA 4KKDA 3EJHA 2XRBA 2KMSA 1OK3A 1GHQB 3KZJA 4J38B 1OJWA 2QY0A 4FXGG 1H04P 1GPZA 1GKNA 1LY2A 1OJYA 2IZ4A 2YBYA 4JHSA 3ZRZA 2MCZA 3INBC 2EHFA 2JRAA 5HYPA 2W81A 3OEDC 2CKUA 4B2SA 1TPMA 3IX0A 1UOTP 3MQLA 4DJZA 1O9AA 3T5OA 4MUCA 4F4OC 3M7PA 1OK9A 3GXEA 3IU3I 3GOVA 4AYIA 2EC3A 4AYEA 2MCYA 1FBRA 1Z92B 2IZ3A 1U5MA 1MD7A 2JGXA 2UWNA 1OJVA 3ZD1A 2XRDA 1CKLA 3RJ3D 1SS2A 4K12A 5FO8C 4LOTA 2V8EA 1HFHA 1G4GA 2O39C 4IGDA 1H03P 2CG7A 4A5WB 1ZJKA 2CG6A 2RLPA 2JGWA 3CALA 2A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRA A;  4AYM A;  3OXU D;  4ZH1 D;  2WII C;  3NFP I;  5JPM G;  2XWJ I;  3ERB A;  2LOJ A;  1NWV A;  1OK2 A;  2RL0 A;  3TVJ A;  1E5G A;  3L89 M;  2BZM A;  1HCC A;  4ONT D;  2RKY A;  1H2Q P;  1VVC A;  1Q3X A;  1GKG A;  3KXV A;  2B5I D;  2XWB F;  4B2R A;  1G4F A;  1OK1 A;  1PPQ A;  2RKZ A;  1TPN A;  4YNX A;  1QGB A;  2ERJ A;  3ZD2 A;  4C16 A;  5HYU B;  1VVD A;  3O8E B;  1E8B A;  1E88 A;  1QO6 A;  5I0Q B;  2XQW C;  2RLQ A;  1C1Z A;  2W80 A;  1MD8 A;  1H2P P;  3SW0 X;  4CSY A;  1TPG A;  1HFI A;  2KRI A;  4PZ5 A;  5HYT B;  1SRZ A;  4WJG 2;  1ELV A;  5HZP B;  4AYD A;  4LOS A;  3OP8 A;  1QUB A;  3R62 A;  2G7I A;  4KKD A;  3EJH A;  2XRB A;  2KMS A;  1OK3 A;  1GHQ B;  3KZJ A;  4J38 B;  1OJW A;  2QY0 A;  4FXG G;  1H04 P;  1GPZ A;  1GKN A;  1LY2 A;  1OJY A;  2IZ4 A;  2YBY A;  4JHS A;  3ZRZ A;  2MCZ A;  3INB C;  2EHF A;  2JRA A;  5HYP A;  2W81 A;  3OED C;  2CKU A;  4B2S A;  1TPM A;  3IX0 A;  1UOT P;  3MQL A;  4DJZ A;  1O9A A;  3T5O A;  4MUC A;  4F4O C;  3M7P A;  1OK9 A;  3GXE A;  3IU3 I;  3GOV A;  4AYI A;  2EC3 A;  4AYE A;  2MCY A;  1FBR A;  1Z92 B;  2IZ3 A;  1U5M A;  1MD7 A;  2JGX A;  2UWN A;  1OJV A;  3ZD1 A;  2XRD A;  1CKL A;  3RJ3 D;  1SS2 A;  4K12 A;  5FO8 C;  4LOT A;  2V8E A;  1HFH A;  1G4G A;  2O39 C;  4IGD A;  1H03 P;  2CG7 A;  4A5W B;  1ZJK A;  2CG6 A;  2RLP A;  2JGW A;  3CAL A;  2A55 A; 
#chains in the Genus database with same CATH topology
 2YRA A;  4AYM A;  3OXU D;  4ZH1 D;  2WII C;  3NFP I;  5JPM G;  2XWJ I;  3ERB A;  2LOJ A;  1NWV A;  1OK2 A;  2RL0 A;  1RLH A;  3TVJ A;  1E5G A;  3L89 M;  2BZM A;  1HCC A;  4ONT D;  3FGT A;  3F6K A;  2RKY A;  1H2Q P;  1VVC A;  2ZYC A;  1Q3X A;  1GKG A;  3KXV A;  2B5I D;  3K3T A;  2Y8T A;  2XWB F;  4B2R A;  1G4F A;  1OK1 A;  1PPQ A;  2RKZ A;  1TPN A;  2Y8S A;  4YNX A;  1QGB A;  2ERJ A;  5DN5 A;  3ZD2 A;  4C16 A;  5HYU B;  1VVD A;  3O8E B;  1E8B A;  1E88 A;  1QO6 A;  5I0Q B;  2XQW C;  3WSY A;  2RLQ A;  1C1Z A;  5DN4 A;  2W80 A;  1MD8 A;  1H2P P;  3SW0 X;  4CSY A;  1TPG A;  1HFI A;  2KRI A;  4PZ5 A;  5HYT B;  1SRZ A;  4WJG 2;  1ELV A;  5HZP B;  4AYD A;  4PO7 A;  4LOS A;  3OP8 A;  1QUB A;  3R62 A;  4BWC A;  2G7I A;  4KKD A;  3EJH A;  2XRB A;  2KMS A;  1OK3 A;  1GHQ B;  3KZJ A;  4J38 B;  1OJW A;  2QY0 A;  4FXG G;  1H04 P;  1GPZ A;  1GKN A;  1LY2 A;  1OJY A;  2IZ4 A;  2YBY A;  4JHS A;  3ZRZ A;  3CI0 J;  2MCZ A;  3INB C;  2EHF A;  2I2L A;  2JRA A;  5HYP A;  2W81 A;  3OED C;  2CKU A;  4YIZ A;  4B2S A;  1TPM A;  3IX0 A;  1UOT P;  3MQL A;  4DJZ A;  1O9A A;  3T5O A;  3ZLE A;  4MUC A;  3ZLD A;  3NJA A;  4F4O C;  4N7E A;  3M7P A;  1OK9 A;  3GXE A;  3IU3 I;  3GOV A;  4AYI A;  2EC3 A;  2X2Z A;  2MCY A;  4AYE A;  4APL A;  1FBR A;  4MSL A;  1Z92 B;  2IZ3 A;  1U5M A;  1MD7 A;  3VWO A;  2JGX A;  2UWN A;  1OJV A;  3ZD1 A;  2XRD A;  1CKL A;  3RJ3 D;  1SS2 A;  4K12 A;  5FO8 C;  4LOT A;  2V8E A;  1HFH A;  1G4G A;  3WSX A;  2O39 C;  4IGD A;  1H03 P;  2CG7 A;  4A5W B;  1ZJK A;  2CG6 A;  2RLP A;  2JGW A;  3CAL A;  3FGR A;  2A55 A;  2Y8R A; 
#chains in the Genus database with same CATH homology
 2YRA A;  4AYM A;  3OXU D;  4ZH1 D;  2WII C;  3NFP I;  5JPM G;  2XWJ I;  3ERB A;  2LOJ A;  1NWV A;  1OK2 A;  2RL0 A;  3TVJ A;  1E5G A;  3L89 M;  2BZM A;  1HCC A;  4ONT D;  2RKY A;  1H2Q P;  1VVC A;  1Q3X A;  1GKG A;  3KXV A;  2B5I D;  2XWB F;  4B2R A;  1G4F A;  1OK1 A;  1PPQ A;  2RKZ A;  1TPN A;  4YNX A;  1QGB A;  2ERJ A;  3ZD2 A;  4C16 A;  5HYU B;  1VVD A;  3O8E B;  1E8B A;  1E88 A;  1QO6 A;  5I0Q B;  2XQW C;  2RLQ A;  1C1Z A;  2W80 A;  1MD8 A;  1H2P P;  3SW0 X;  4CSY A;  1TPG A;  1HFI A;  2KRI A;  4PZ5 A;  5HYT B;  1SRZ A;  4WJG 2;  1ELV A;  5HZP B;  4AYD A;  4LOS A;  3OP8 A;  1QUB A;  3R62 A;  2G7I A;  4KKD A;  3EJH A;  2XRB A;  2KMS A;  1OK3 A;  1GHQ B;  3KZJ A;  4J38 B;  1OJW A;  2QY0 A;  4FXG G;  1H04 P;  1GPZ A;  1GKN A;  1LY2 A;  1OJY A;  2IZ4 A;  2YBY A;  4JHS A;  3ZRZ A;  2MCZ A;  3INB C;  2EHF A;  2JRA A;  5HYP A;  2W81 A;  3OED C;  2CKU A;  4B2S A;  1TPM A;  3IX0 A;  1UOT P;  3MQL A;  4DJZ A;  1O9A A;  3T5O A;  4MUC A;  4F4O C;  3M7P A;  1OK9 A;  3GXE A;  3IU3 I;  3GOV A;  4AYI A;  2EC3 A;  4AYE A;  2MCY A;  1FBR A;  1Z92 B;  2IZ3 A;  1U5M A;  1MD7 A;  2JGX A;  2UWN A;  1OJV A;  3ZD1 A;  2XRD A;  1CKL A;  3RJ3 D;  1SS2 A;  4K12 A;  5FO8 C;  4LOT A;  2V8E A;  1HFH A;  1G4G A;  2O39 C;  4IGD A;  1H03 P;  2CG7 A;  4A5W B;  1ZJK A;  2CG6 A;  2RLP A;  2JGW A;  3CAL A;  2A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...