4ZH1D

Complement factor h in complex with the gm1 glycan
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
b'FGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Complement Factor H and Simian Virus 40 bind the GM1 ganglioside in distinct conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 126
sequence length 126
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4zh1D01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4zh1D02
4J38B 1G4FA 2A55A 3TVJA 1E5GA 1ELVA 1HFIA 3IU3I 2BZMA 1ZJKA 3KXVA 4C16A 1VVCA 1PPQA 1TPGA 4JHSA 1O9AA 2UWNA 3CALA 1C1ZA 4AYEA 2XWBF 4IGDA 3ZD1A 5HYTB 4A5WB 1H04P 1CKLA 1H2QP 1SS2A 1NWVA 2V8EA 3INBC 4PZ5A 2KRIA 2IZ3A 4KKDA 4F4OC 3MQLA 4LOTA 3KZJA 1U5MA 1OK2A 2W80A 3L89M 2XRBA 3GXEA 4AYIA 2W81A 5FO8C 2EC3A 1FBRA 1OJVA 1TPNA 1Z92B 2EHFA 1LY2A 2RKYA 1H03P 2CG6A 3NFPI 1HCCA 3GOVA 2ERJA 4K12A 2RLPA 1TPMA 1OK9A 3OP8A 2G7IA 1VVDA 1QO6A 2LOJA 1MD8A 1H2PP 2CG7A 3ZRZA 1QUBA 1HFHA 5HYPA 3OEDC 2MCYA 3R62A 1OK1A 3T5OA 3O8EB 2JGWA 2MCZA 4MUCA 3ZD2A 2QY0A 1MD7A 2XRDA 1Q3XA 4ONTD 4CSYA 3EJHA 5I0QB 5HYUB 4AYMA 2WIIC 3IX0A 4ZH1D 3OXUD 4DJZA 2XQWC 1E88A 2RL0A 4LOSA 1GKGA 2XWJI 1OJYA 3ERBA 4YNXA 2IZ4A 5HZPB 4FXGG 2JGXA 2CKUA 2RKZA 5JPMG 1GKNA 1OJWA 4AYDA 2KMSA 1SRZA 2JRAA 1GHQB 1QGBA 2RLQA 2YBYA 4WJG2 4B2RA 2O39C 2YRAA 1E8BA 3RJ3D 2B5ID 1G4GA 3SW0X 1GPZA 3M7PA 4B2SA 1OK3A 1UOTP
chains in the Genus database with same CATH superfamily
4J38B 1G4FA 2A55A 3TVJA 1E5GA 1ELVA 1HFIA 3IU3I 2BZMA 5DN5A 1ZJKA 3KXVA 4C16A 1VVCA 1PPQA 1TPGA 4JHSA 1O9AA 2UWNA 2Y8TA 1C1ZA 3CALA 4AYEA 3WSYA 2XWBF 4IGDA 3ZD1A 5HYTB 4A5WB 1H04P 1CKLA 1H2QP 1SS2A 1NWVA 2V8EA 3F6KA 3INBC 4PZ5A 2KRIA 4APLA 4BWCA 2IZ3A 4KKDA 4F4OC 3MQLA 4LOTA 3KZJA 1U5MA 1OK2A 2W80A 3L89M 2XRBA 3GXEA 4AYIA 2W81A 5FO8C 2EC3A 1FBRA 1OJVA 1TPNA 1Z92B 2EHFA 1LY2A 2RKYA 1H03P 1RLHA 2CG6A 3NFPI 1HCCA 3GOVA 2Y8SA 2ERJA 4K12A 2RLPA 1TPMA 5DN4A 1OK9A 3OP8A 4N7EA 2G7IA 3NJAA 1VVDA 1QO6A 2LOJA 1MD8A 1H2PP 2CG7A 2X2ZA 3ZLDA 3ZRZA 1QUBA 1HFHA 5HYPA 3OEDC 4MSLA 2MCYA 3R62A 1OK1A 3CI0J 3T5OA 3O8EB 2JGWA 2MCZA 4MUCA 3ZD2A 2QY0A 3VWOA 1MD7A 2XRDA 1Q3XA 4ONTD 4CSYA 3WSXA 3ZLEA 3EJHA 5I0QB 5HYUB 4AYMA 2WIIC 3IX0A 4ZH1D 3OXUD 4DJZA 2XQWC 4PO7A 1E88A 2RL0A 4LOSA 1GKGA 2XWJI 1OJYA 3ERBA 4YNXA 2IZ4A 5HZPB 4FXGG 2JGXA 2ZYCA 2CKUA 2RKZA 5JPMG 1GKNA 1OJWA 3FGTA 4AYDA 2KMSA 1SRZA 2JRAA 1GHQB 1QGBA 2RLQA 2YBYA 3K3TA 4WJG2 4B2RA 2O39C 2YRAA 2I2LA 1E8BA 3RJ3D 2B5ID 1G4GA 3SW0X 1GPZA 3M7PA 4B2SA 1OK3A 2Y8RA 1UOTP 3FGRA 4YIZA
chains in the Genus database with same CATH topology
4J38B 1G4FA 2A55A 3TVJA 1E5GA 1ELVA 1HFIA 3IU3I 2BZMA 1ZJKA 3KXVA 4C16A 1VVCA 1PPQA 1TPGA 4JHSA 1O9AA 2UWNA 3CALA 1C1ZA 4AYEA 2XWBF 4IGDA 3ZD1A 5HYTB 4A5WB 1H04P 1CKLA 1H2QP 1SS2A 1NWVA 2V8EA 3INBC 4PZ5A 2KRIA 2IZ3A 4KKDA 4F4OC 3MQLA 4LOTA 3KZJA 1U5MA 1OK2A 2W80A 3L89M 2XRBA 3GXEA 4AYIA 2W81A 5FO8C 2EC3A 1FBRA 1OJVA 1TPNA 1Z92B 2EHFA 1LY2A 2RKYA 1H03P 2CG6A 3NFPI 1HCCA 3GOVA 2ERJA 4K12A 2RLPA 1TPMA 1OK9A 3OP8A 2G7IA 1VVDA 1QO6A 2LOJA 1MD8A 1H2PP 2CG7A 3ZRZA 1QUBA 1HFHA 5HYPA 3OEDC 2MCYA 3R62A 1OK1A 3T5OA 3O8EB 2JGWA 2MCZA 4MUCA 3ZD2A 2QY0A 1MD7A 2XRDA 1Q3XA 4ONTD 4CSYA 3EJHA 5I0QB 5HYUB 4AYMA 2WIIC 3IX0A 4ZH1D 3OXUD 4DJZA 2XQWC 1E88A 2RL0A 4LOSA 1GKGA 2XWJI 1OJYA 3ERBA 4YNXA 2IZ4A 5HZPB 4FXGG 2JGXA 2CKUA 2RKZA 5JPMG 1GKNA 1OJWA 4AYDA 2KMSA 1SRZA 2JRAA 1GHQB 1QGBA 2RLQA 2YBYA 4WJG2 4B2RA 2O39C 2YRAA 1E8BA 3RJ3D 2B5ID 1G4GA 3SW0X 1GPZA 3M7PA 4B2SA 1OK3A 1UOTP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J38 B;  1G4F A;  2A55 A;  3TVJ A;  1E5G A;  1ELV A;  1HFI A;  3IU3 I;  2BZM A;  1ZJK A;  3KXV A;  4C16 A;  1VVC A;  1PPQ A;  1TPG A;  4JHS A;  1O9A A;  2UWN A;  3CAL A;  1C1Z A;  4AYE A;  2XWB F;  4IGD A;  3ZD1 A;  5HYT B;  4A5W B;  1H04 P;  1CKL A;  1H2Q P;  1SS2 A;  1NWV A;  2V8E A;  3INB C;  4PZ5 A;  2KRI A;  2IZ3 A;  4KKD A;  4F4O C;  3MQL A;  4LOT A;  3KZJ A;  1U5M A;  1OK2 A;  2W80 A;  3L89 M;  2XRB A;  3GXE A;  4AYI A;  2W81 A;  5FO8 C;  2EC3 A;  1FBR A;  1OJV A;  1TPN A;  1Z92 B;  2EHF A;  1LY2 A;  2RKY A;  1H03 P;  2CG6 A;  3NFP I;  1HCC A;  3GOV A;  2ERJ A;  4K12 A;  2RLP A;  1TPM A;  1OK9 A;  3OP8 A;  2G7I A;  1VVD A;  1QO6 A;  2LOJ A;  1MD8 A;  1H2P P;  2CG7 A;  3ZRZ A;  1QUB A;  1HFH A;  5HYP A;  3OED C;  2MCY A;  3R62 A;  1OK1 A;  3T5O A;  3O8E B;  2JGW A;  2MCZ A;  4MUC A;  3ZD2 A;  2QY0 A;  1MD7 A;  2XRD A;  1Q3X A;  4ONT D;  4CSY A;  3EJH A;  5I0Q B;  5HYU B;  4AYM A;  2WII C;  3IX0 A;  4ZH1 D;  3OXU D;  4DJZ A;  2XQW C;  1E88 A;  2RL0 A;  4LOS A;  1GKG A;  2XWJ I;  1OJY A;  3ERB A;  4YNX A;  2IZ4 A;  5HZP B;  4FXG G;  2JGX A;  2CKU A;  2RKZ A;  5JPM G;  1GKN A;  1OJW A;  4AYD A;  2KMS A;  1SRZ A;  2JRA A;  1GHQ B;  1QGB A;  2RLQ A;  2YBY A;  4WJG 2;  4B2R A;  2O39 C;  2YRA A;  1E8B A;  3RJ3 D;  2B5I D;  1G4G A;  3SW0 X;  1GPZ A;  3M7P A;  4B2S A;  1OK3 A;  1UOT P; 
#chains in the Genus database with same CATH topology
 4J38 B;  1G4F A;  2A55 A;  3TVJ A;  1E5G A;  1ELV A;  1HFI A;  3IU3 I;  2BZM A;  5DN5 A;  1ZJK A;  3KXV A;  4C16 A;  1VVC A;  1PPQ A;  1TPG A;  4JHS A;  1O9A A;  2UWN A;  2Y8T A;  1C1Z A;  3CAL A;  4AYE A;  3WSY A;  2XWB F;  4IGD A;  3ZD1 A;  5HYT B;  4A5W B;  1H04 P;  1CKL A;  1H2Q P;  1SS2 A;  1NWV A;  2V8E A;  3F6K A;  3INB C;  4PZ5 A;  2KRI A;  4APL A;  4BWC A;  2IZ3 A;  4KKD A;  4F4O C;  3MQL A;  4LOT A;  3KZJ A;  1U5M A;  1OK2 A;  2W80 A;  3L89 M;  2XRB A;  3GXE A;  4AYI A;  2W81 A;  5FO8 C;  2EC3 A;  1FBR A;  1OJV A;  1TPN A;  1Z92 B;  2EHF A;  1LY2 A;  2RKY A;  1H03 P;  1RLH A;  2CG6 A;  3NFP I;  1HCC A;  3GOV A;  2Y8S A;  2ERJ A;  4K12 A;  2RLP A;  1TPM A;  5DN4 A;  1OK9 A;  3OP8 A;  4N7E A;  2G7I A;  3NJA A;  1VVD A;  1QO6 A;  2LOJ A;  1MD8 A;  1H2P P;  2CG7 A;  2X2Z A;  3ZLD A;  3ZRZ A;  1QUB A;  1HFH A;  5HYP A;  3OED C;  4MSL A;  2MCY A;  3R62 A;  1OK1 A;  3CI0 J;  3T5O A;  3O8E B;  2JGW A;  2MCZ A;  4MUC A;  3ZD2 A;  2QY0 A;  3VWO A;  1MD7 A;  2XRD A;  1Q3X A;  4ONT D;  4CSY A;  3WSX A;  3ZLE A;  3EJH A;  5I0Q B;  5HYU B;  4AYM A;  2WII C;  3IX0 A;  4ZH1 D;  3OXU D;  4DJZ A;  2XQW C;  4PO7 A;  1E88 A;  2RL0 A;  4LOS A;  1GKG A;  2XWJ I;  1OJY A;  3ERB A;  4YNX A;  2IZ4 A;  5HZP B;  4FXG G;  2JGX A;  2ZYC A;  2CKU A;  2RKZ A;  5JPM G;  1GKN A;  1OJW A;  3FGT A;  4AYD A;  2KMS A;  1SRZ A;  2JRA A;  1GHQ B;  1QGB A;  2RLQ A;  2YBY A;  3K3T A;  4WJG 2;  4B2R A;  2O39 C;  2YRA A;  2I2L A;  1E8B A;  3RJ3 D;  2B5I D;  1G4G A;  3SW0 X;  1GPZ A;  3M7P A;  4B2S A;  1OK3 A;  2Y8R A;  1UOT P;  3FGR A;  4YIZ A; 
#chains in the Genus database with same CATH homology
 4J38 B;  1G4F A;  2A55 A;  3TVJ A;  1E5G A;  1ELV A;  1HFI A;  3IU3 I;  2BZM A;  1ZJK A;  3KXV A;  4C16 A;  1VVC A;  1PPQ A;  1TPG A;  4JHS A;  1O9A A;  2UWN A;  3CAL A;  1C1Z A;  4AYE A;  2XWB F;  4IGD A;  3ZD1 A;  5HYT B;  4A5W B;  1H04 P;  1CKL A;  1H2Q P;  1SS2 A;  1NWV A;  2V8E A;  3INB C;  4PZ5 A;  2KRI A;  2IZ3 A;  4KKD A;  4F4O C;  3MQL A;  4LOT A;  3KZJ A;  1U5M A;  1OK2 A;  2W80 A;  3L89 M;  2XRB A;  3GXE A;  4AYI A;  2W81 A;  5FO8 C;  2EC3 A;  1FBR A;  1OJV A;  1TPN A;  1Z92 B;  2EHF A;  1LY2 A;  2RKY A;  1H03 P;  2CG6 A;  3NFP I;  1HCC A;  3GOV A;  2ERJ A;  4K12 A;  2RLP A;  1TPM A;  1OK9 A;  3OP8 A;  2G7I A;  1VVD A;  1QO6 A;  2LOJ A;  1MD8 A;  1H2P P;  2CG7 A;  3ZRZ A;  1QUB A;  1HFH A;  5HYP A;  3OED C;  2MCY A;  3R62 A;  1OK1 A;  3T5O A;  3O8E B;  2JGW A;  2MCZ A;  4MUC A;  3ZD2 A;  2QY0 A;  1MD7 A;  2XRD A;  1Q3X A;  4ONT D;  4CSY A;  3EJH A;  5I0Q B;  5HYU B;  4AYM A;  2WII C;  3IX0 A;  4ZH1 D;  3OXU D;  4DJZ A;  2XQW C;  1E88 A;  2RL0 A;  4LOS A;  1GKG A;  2XWJ I;  1OJY A;  3ERB A;  4YNX A;  2IZ4 A;  5HZP B;  4FXG G;  2JGX A;  2CKU A;  2RKZ A;  5JPM G;  1GKN A;  1OJW A;  4AYD A;  2KMS A;  1SRZ A;  2JRA A;  1GHQ B;  1QGB A;  2RLQ A;  2YBY A;  4WJG 2;  4B2R A;  2O39 C;  2YRA A;  1E8B A;  3RJ3 D;  2B5I D;  1G4G A;  3SW0 X;  1GPZ A;  3M7P A;  4B2S A;  1OK3 A;  1UOT P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...