4ZHDA

Siderocalin-mediated recognition and cellular uptake of actinides
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
b'TSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin-mediated recognition, sensitization, and cellular uptake of actinides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/inhibitor
total genus 39
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4zhdA00
2NNDA 2AT5X 2QM9A 2WQ9A 3FENA 5IO7A 1LICA 3APUA 4TLJA 4UU2A 2XKLA 4TNNA 1GX8A 5AQ6A 5LJEA 3CQRA 1DZMA 1IFCA 1U17A 1ZNEA 2Q4NA 3S26A 2CM9A 5D45A 3FEKA 5HZ9A 2RCTA 1S7DA 4I3CA 1L6MA 2JU8A 4A60A 1I4UA 2LKKA 4QYNA 5BVTA 3KFHA 4YGZA 5LJCA 1EPBA 1B0OA 3OJYC 4QYPA 5LKFA 2OFMX 4LZUA 1HMTA 5LJDA 3AKMA 4BVMA 3P6GA 3APVA 3KFFA 1LFOA 2JU3A 2FS7A 1G74A 4ZHFA 1TXLA 5DPQA 1E5PA 1CJ5A 2JU7A 3FA7A 1GT1A 1LPJA 1MVGA 2Q9SA 1ZRYA 1HN2A 5D47A 3Q6LA 4LZVA 1FTPA 1QFTA 4GE1A 3ELXA 4ZHCA 4ZGUA 5HA0A 1A3YA 4NLIA 5D48A 2HMBA 4A1YA 2QO5A 5F6ZA 1VPRA 5D4AA 3B2JA 3K3LA 3APXA 1PEEA 2R56A 1E06A 4N7DA 4IAWA 1TOUA 3P6HA 3NX1A 4AZOA 1TOWA 1D2UA 1FDQA 5L8IA 3KQ0A 4ZR2A 5EDBA 2RCQA 1LF7A 2NNEA 5CE4A 2L5PA 1LKEA 1LIFA 2JOZA 2CZTA 3U0DA 4ZFXA 3F9DA 2YG2A 1BBPA 1QG5A 4K19A 1R0UA 3HWGA 4XMHA 3VG6A 1LIBA 2DM5A 3WBGA 1GM6A 2OZQA 4IB8A 5L8NA 1EXSA 4O9SA 1ZNDA 3NPOA 1ACDA 2CZUA 3G7XA 4ORWA 3VG5A 1KT4A 2ANSA 2G78A 3MVFA 3BLGA 2IFBA 3NQ9A 3L4RA 2L68A 5LJHA 4I3DA 2RQ0A 3TZSA 1T8VA 4ZHHA 2AMMX 3FR2A 4LKTA 1SXXA 1ERXA 4IB7A 5H8TA 1YWAA 1KZWA 3JSQA 3FA6A 1BSQA 2CBSA 3P6FA 3WJGA 1KQXA 1X8PA 4ODDA 5H9AA 5F58A 1ALBA 1SXUA 3BU9A 3DTQA 5B29A 1X89A 4QZUA 2HNXA 3BRNA 3FW5A 2QOSC 3ZUOA 1E00A 1X8OA 4IB9A 4OS3A 4D6AA 4AZPA 1BM5A 3APWA 5JR8A 1JJJA 1B56A 1ADLA 2MO5A 2LB6A 1GT4A 1QFVA 4IMNA 4ZH9A 5EEDA 1N0SA 3STNA 1SXYA 4XMFA 1BSOA 5H9KA 1YP6A 2P8GA 3NR3A 3FLLA 2A2UA 1AB0A 1KT3A 1QQSA 3HWEA 1OEKA 1GT5A 1AELA 4XMGA 3EM0A 2HLVA 1AVGI 1KZXA 3WJCA 1B4MA 1JBHA 2KTDA 3PP6A 1EW3A 5F1EA 5HCEC 1YP7A 4QZTA 1EQDA 1GKAA 3D96A 4AZMA 4QAEA 2HYSA 5L8OA 3FIQA 4ZJ0A 3WVMA 4QGXA 3FELA 4YDAA 2WEXA 3JS1A 4IBAA 1KT5A 1CBRA 3B2KA 2G79A 5HZ8A 1KT6A 3WJBA 1QY1A 4Y0RA 4OS0A 1SY3A 2E4JA 5HTDA 3DSZA 3FA8A 4ORXA 5HAEA 5KIDA 4GRJA 1ZNKA 5D8JA 4ORUA 2L9CA 2WWPA 4GETA 2ALLX 2WEWA 4ZH6A 5FFHA 1CBQA 3CQNA 4OMWA 2G7BA 1FELA 3RZYA 1OEJA 1RLBE 4DQ3A 1P6PA 2AKQA 2LBVA 4ORYA 3B2HA 3HWDA 5IO5A 3P6CA 3FA9A 4M6SA 4MVLA 4TKHA 1QY0A 5HA1A 2LBAA 1EIIA 4DQ4A 1DFVA 1ML7A 2K62A 5K06A 1IKJA 2FRSA 5HWZA 1KT7A 1YWBA 2A3FX 4AZQA 4GH7A 4OMXA 1DF3A 2WQAE 5HZ6A 2CBRA 2WSJA 4EXZA 2WUTA 1E02A 3I17A 1T68X 2N93A 5LJKA 4I3BA 2AT8X 2HZQA 5LJGA 4PSQA 1DV9A 1UZ2X 2K23A 1IIUA 1A57A 4LKPA 3VG2A 1LNMA 3FW4A 3TGCA 1B8EA 2LFOA 2A2GA 1SY1A 5HZQA 2JN3A 2L67A 2RA6A 1TW4A 3CMPA 4IB6A 5EEEA 1G5WA 3FR5A 1ZNHA 4D6BA 1QY2A 3SAOA 3UEXA 4YKMA 1T0VA 4Y0QA 4CK4A 3KZAA 4A8ZA 1MUPA 2F73A 1OEEA 2ASNX 4R0BA 5KICA 1DC9A 2QO4A 2O62A 1EIOA 4YMYA 4XMDA 1HBPA 5F6BA 4QGWA 3CR6A 3O2YA 4AZRA 5KHPA 2NP1A 1GGLA 1FEMA 4M7MA 4TJZA 4QGVA 3CWKA 4GNYA 1I04A 1LIDA 1G85A 1JYDA 5EPQA 1NGLA 1RBPA 3NP1A 3O22A 5B27A 2POAA 4YBUA 2AH7X 1G7NA 4ZHGA 2QO6A 4ALBA 1QWDA 2FR2A 3T1DA 3ZUIA 3IFBA 4NYQA 4YCHA 1QABE 3FEPA 1BRQA 1PMPA 1ICNA 5H9LA 1S44A 4Y0PA 1VYGA 2AT3X 4ZHDA 3WJFA 3P6EA 1FE3A 2WR6A 3FMZA 1X8QA 2RD7C 4HPBA 4NLJA 1IKEA 3BU1A 2FLJA 2EU7X 4IAXA 1TVQA 4ORSA 1MX8A 4ARHA 3IA8A 1BRPA 1BEBA 4HPCA 5HTEA 1DZPA 4YFRA 3UEVA 3D95A 3WJDA 3UEUA 5EZ2A 2MM3A 2FWVA 1Z24A 3B2IA 4YCEA 4XMCA 2MJIA 4N7CA 2OVAA 5FENA 1OBPA 2ACOA 5BVQA 1JZUA 1KGLA 2X45A 2GJ5A 1U0XA 2AT6X 2W2FA 3EYCA 1SA8A 3GAQA 4A1HA 1UREA 2NNQA 3KFIA 2R74A 2A0AA 1GXAA 1MDCA 1O1VA 3CBCA 2AT0X 4RUNA 3P6DA 1CBSA 4YBPA 4ALOA 4UU3A 4AZNA 1X8UA 2GTFX 3BY0A 5HZ5A 4WBKA 3WJEA 1I06A 1GX9A 4TKBA 2Q2MA 1X8NA 1S2PA 2GC9A 1X71A 1OPAA 1D3SA 2OVDA 1SY0A 4I9SA 3B2LA 4KIIA 2ACPX 3EMMA 4ES7A 3CBSA 3C76X 3PH5A 1AQBA 4HPDA 5FAZA 1SXWA 1A2DA 1PBOA 1I05A 1A18A 3HWFA 1CRBA 1ZNGA 4YDBA 3WXQA 1KQWA 4BOEA 3AKNA 3BX7A 3PECA 4EFGA 1MX7A 3TGAA 1DZJA 1O8VA 3PH6A 5LKEA 4WFVA 3VG4A 1U18A 1FENA 3VG3A 4AYHA 1BLRA 4YKOA 4WFUA 5EDCA 1OBUA 5HBSA 1KOIA 3STMX 5C0NA 4YFQA 1EUOA 1EPAA 1IFBA 2BLGA 2KT4B 3ZQ3A 1YIVA 5H9NA 2A13A 2FTBA 4NNSA 5LJBA 4YH0A 2X46A 5HCCC 3U03A 3TF6A 3KFGA 1NP1A 4YFPA 2Q2PA 3ELZA 4YGGA 3BS2A 3C77X 4TQ2A 1YUPA 1BSYA 3PEDA 4BQUA 4GNWA 3MBTA 1KXOA 1ICMA 3D97A 1ERBA 2AL0X 3EBWA 5DG4A 1GT3A 2FS6A 4NNTA 1HMRA 3C78X 4NP1A 3F8AA 3U9PC 5IO6A 3BDRA 1DZKA 3NADA 1JYJA 2OVEA 3FR4A 1ZNLA 3BSZE 4ZCBA 2PY1A 4AW8A 3NX2A 1H91A 2W2BA 4RUUA 3I0AA 4TKJA 4NYRA 4HPAA 1PM1X 4IMOA 4HFOA 3PPTA 4XMEA 5F7GA 4GKCA 3BX8A 3RSWA 2FR3A 3UEWA 5BVSA 2OFRX 4ORRA 2XSTA 1JV4A 1VYFA 1XCAA 1BWYA 1GKAB 1HQPA 3NQ3A 4I9RA 4EDEA 1IW2A 1LIEA 2R73A 3QKGA 3VG7A 1OBQA 4EEJA 1EALA 1CBIA 3TGBA 1NP4A 2HZRA 1BJ7A 1O1UA 3EBKA 2CM4A 1JJXA 1HBQA 1YWCA 1HMSA 1YWDA 1XKIA 4Y0SA 4MVKA 4OS8A 2Q39A 4YGHA 4MVIA 3STKA 5HCDC 1OPBA 2FT9A 1SY2A 2W2AA 3HK1A 3O19A
chains in the Genus database with same CATH superfamily
1OSPO 3RE6A 2NNDA 2AT5X 2QM9A 2WQ9A 3FENA 4I60A 5IO7A 1LICA 3APUA 4TLJA 4UU2A 2XKLA 4TNNA 3VHMA 4QNIA 1N9YA 1GX8A 4Z2PA 5AQ6A 5LJEA 3CQRA 1DZMA 1IFCA 2IZJA 1AVEA 1U17A 1ZNEA 2Q4NA 5JD2A 4MEEA 2CM9A 3CKFA 3FEKA 4IABA 5D45A 3S26A 1UYNX 2ZAGA 5HZ9A 2RCTA 1S7DA 4I3CA 1L6MA 2JU8A 4A60A 1I4UA 2HKDA 1VYOA 2GH7A 2LKKA 2WPUA 4QYNA 1NBXA 3KFHA 5BVTA 4YGZA 4BX7B 3SZHA 1EPBA 1B0OA 3OJYC 4QYPA 5LKFA 2OFMX 4LZUA 1HMTA 5LJDA 3AKMA 1SWFA 4LQZA 4BVMA 3P6GA 3APVA 3KFFA 1LFOA 2JU3A 2FS7A 1G74A 2AVIA 4ZHFA 1TXLA 3PQUA 5DPQA 1SMPI 1MK5A 1E5PA 2UYWA 1CJ5A 1HY2A 2JU7A 2OFAA 2RTCB 3FA7A 1GT1A 1LPJA 1WBIA 1MVGA 2Q9SA 1ZRYA 1HN2A 2X8FA 5D47A 3Q6LA 4LZVA 1FTPA 3RDQA 3NBXX 2Z4HA 1JMZA 1QFTA 3AUMO 4GE1A 3ELXA 4ZHCA 4ZGUA 5FQ7E 5HA0A 2FHNX 2FKJA 1A3YA 4NLIA 5D48A 4U9CA 5B10O 3RE5A 2HMBA 2X32A 2QCBA 4A1YA 4BCSA 2QO5A 5F6ZA 1VPRA 5D4AA 3B2JA 3SLTA 2I5ZO 3K3LA 3APXA 1PEEA 2OY8A 4I95A 2R56A 1E06A 4N7DA 4IAWA 1TOUA 3P6HA 4KC8A 3NX1A 4Z27A 2IZGB 1TOWA 1D2UA 4AZOA 1FDQA 5L8IA 3KQ0A 4ZR2A 5EDBA 2RCQA 2ZAIA 1LF7A 2NNEA 5CE4A 1BWYA 4O3YA 2L5PA 1LKEA 4INNA 1LIFA 2JOZA 2CZTA 3ZW0A 3U0DA 4ZFXA 3F9DA 2YG2A 4GUZA 2CAMA 1BBPA 1QG5A 4O49A 4K19A 1R0UA 3HWGA 4XMHA 3VG6A 1LIBA 2DM5A 3VE1A 3WBGA 1GM6A 2OZQA 3NQKA 1PBYA 4IB8A 2IZFB 5L8NA 1EXSA 4O9SA 1ZNDA 3NPOA 1SRJA 1MOYA 4U46A 3OBLA 3AEHA 1ACDA 2CZUA 3G7XA 4ORWA 2X4MA 5CHKA 1KT4A 2ANSA 2G78A 3VG5A 4EKVA 1K3BA 3MVFA 3OE3A 2IZDB 2Y3FA 3BLGA 4L1NA 2IFBA 4BX5B 3NQ9A 3L4RA 2L68A 3H3IA 5LJHA 4I3DA 3WZPA 2RQ0A 1SLFB 3TZSA 1T8VA 4ZHHA 2AMMX 3FR2A 4LKTA 1SXXA 1ERXA 4IB7A 5H8TA 1YWAA 3PQSA 3JSQA 3FA6A 2OL8O 1KZWA 1BSQA 2CBSA 5IXGA 2AF5A 3P6FA 5B3MO 3WJGA 4QRLA 1KQXA 1X8PA 4ODDA 5H9AA 2IZHB 4GU8A 4NV8A 5F58A 1ALBA 1SXUA 3X00A 3BU9A 3DTQA 3N91A 3VE2A 1X89A 1VWCB 5B29A 4QZUA 4OKAA 1GX3A 2HNXA 1EI5A 3BRNA 3FW5A 4CPFA 2QOSC 3HOLA 3ZUOA 1E00A 1X8OA 4IB9A 4OS3A 4BBOA 5LJCA 4D6AA 4AZPA 1BM5A 1KL3A 3APWA 2A5CA 4KT5A 1RXJA 2OY5O 5JR8A 4OELA 1JJJA 2OL6O 1B56A 4B55A 1ADLA 2MO5A 1VWGB 2LB6A 1N4JA 3MG5A 4GD9A 1GT4A 3HPEA 4FGIB 1JJUA 1QFVA 2X55A 4HWMA 4IMNA 2RTLA 2OY7A 5AJCA 2DJFA 3RDUA 3S60A 4Z6JA 4CV7A 4ZH9A 5EEDA 4CPHB 2OL7A 1N0SA 3STNA 1SXYA 4XMFA 1BSOA 5H9KA 1YP6A 2P8GA 3WYPA 3NR3A 1LELA 2A2UA 3FLLA 2GTLN 1AB0A 1KT3A 4MVEA 1N9MA 1QQSA 1OEKA 1GT5A 3HWEA 1AELA 2DJGA 4XMGA 3EM0A 3SZJA 2HLVA 1AVGI 3SLOA 1KZXA 3WJCA 1B4MA 4CDEA 1JBHA 5IRAA 2KTDA 3PP6A 3VU1A 1FJ1E 1RAVA 1EW3A 1VWMB 5F1EA 5HCEC 1YP7A 3QQ2A 5K67A 4QZTA 4O4OA 1EQDA 1GKAA 3D96A 5IRUA 3WZOA 4AZMA 4GGZA 4QAEA 2RTDB 4ID2A 1Y55X 2KW1A 2BSZA 2HYSA 1SWHA 5L8OA 3FIQA 4FBVA 4DNEA 4ZJ0A 3WVMA 4QGXA 2IZBA 1SWRA 3FELA 4YDAA 2RTRB 5L3YA 1SWUA 1SREA 2WEXA 3JS1A 4IBAA 4I6SA 1KT5A 1CBRA 3B2KA 2G79A 2VFBA 1KT6A 4GZVA 3WJBA 5HZ8A 1QY1A 4Y0RA 3ZWEA 4OS0A 1SY3A 2E4JA 3PK2A 5HTDA 3DSZA 1NDJA 1VWIB 2YMSA 3VG2A 3FA8A 4ORXA 5B5FA 5HAEA 5KIDA 4GRJA 1ZNKA 4U8UM 2OY1O 2M4LA 4ORUA 5D8JA 1VWAB 2L9CA 2WWPA 4GETA 2ALLX 2WEWA 4ZH6A 5FFHA 2OF8A 4PJ2A 1CBQA 3CQNA 4OMWA 4BX6B 3KVNA 2G7BA 2VFCA 1FELA 1SLDB 3RZYA 1OEJA 1RLBE 4U8UO 4DQ3A 4C5PA 1P6PA 2AKQA 2LBVA 4ORYA 3B2HA 4O4SA 5AEOA 3HWDA 1W6FA 2X8TA 5IO5A 1LCVA 1LCWA 3P6CA 3FA9A 4M6SA 4BX7A 2IZIA 4MVLA 4TKHA 1QY0A 5HA1A 5CSEA 3ZZVA 2LBAA 2OFBA 3FYFA 1EIIA 2IZEB 4DQ4A 1DFVA 1ML7A 2K62A 2JW1A 5K06A 1IKJA 2FRSA 5HWZA 1KT7A 1YWBA 2A3FX 4AZQA 1VWPB 4FBOA 3SLJA 4GH7A 4OMXA 1DF3A 1MM9A 1VWEB 2GTLO 2WQAE 2CBRA 3LHNA 5HZ6A 1W5RA 2WSJA 4EXZA 2WUTA 1E02A 3I17A 1T68X 3RBYA 2N93A 5LJKA 4ML7B 4I3BA 2AT8X 2HZQA 5LJGA 2KD2A 4PSQA 1RXKA 1DV9A 1UZ2X 2RTOB 2K23A 1IIUA 1A57A 2IZLB 1Y9TA 1LNMA 3FW4A 4LKPA 4FQBB 4O4UA 5AJBA 4NV7A 1B8EA 2LFOA 3TGCA 1VWLB 5FQ8E 2A2GA 5B2AO 1SY1A 2F01A 1SWEA 5HZQA 2JN3A 2L67A 1SRHA 2RA6A 1TW4A 3CMPA 4IB6A 5EEEA 1G5WA 1VWNB 3RWXA 3VPJE 3FR5A 1STRB 1VWRB 1ZNHA 4D6BA 1QY2A 3SAOA 1KL5A 2OVSA 3GE2A 4YKMA 3UEXA 1T0VA 4Y0QA 2LA7A 1SWKA 3WYQA 4CK4A 3KZAA 4A8ZA 1MUPA 4GJVA 2F73A 4QQ1A 1OEEA 2A5BA 2PI3O 1N43A 1SLEB 2ASNX 2IZCB 4R0BA 5KICA 1DC9A 3OD9A 2QO4A 2O62A 1EIOA 1VWFB 4YMYA 4XMDA 1N7YA 1HBPA 3E3CA 4QGWA 5F6BA 3CR6A 3O2YA 4AZRA 5KHPA 2NP1A 5K68A 1GGLA 1NQMA 1FEMA 4M7MA 2C1SA 4TJZA 4QGVA 3CWKA 4GNYA 1I04A 1LIDA 1G85A 1JYDA 4U8UN 1NGLA 5EPQA 1RBPA 3NP1A 3O22A 5B27A 3ZI8A 5IRWA 4BX5A 2POAA 4YBUA 1SWLA 4U3QA 1HQQA 1K24A 1G7NA 2AH7X 4BGFA 3SZIA 4ZHGA 2QO6A 2OF9A 4ALBA 2FGSA 1SWNA 1SWOA 1QWDA 2FR2A 3T1DA 3ZUIA 1DF8A 2RTBB 3IFBA 4NYQA 1VWOB 4MIRA 1QABE 4YCHA 3FEPA 1BRQA 1PMPA 1ICNA 2KTSA 1S44A 4ON1A 4Y0PA 5H9LA 1VYGA 4GK9A 1VWKB 2AT3X 2MHDA 4JHQA 3P6EA 3WJFA 4ZHDA 5BYPA 1RSTB 1FE3A 4CDCA 3P02A 2WR6A 1KL4A 3FMZA 3RDSA 1X8QA 2RD7C 2RTKA 4HPBA 4NLJA 1IKEA 4L3RA 3JQOA 3BU1A 4Z28A 2FLJA 2EU7X 2RTAA 4IAXA 1TVQA 4ORSA 1MX8A 4ARHA 3IA8A 1BRPA 1BEBA 2JMBA 4GDZA 4HPCA 5HTEA 1STPA 1SRIA 4CDDA 1DZPA 4YFRA 3UEVA 1E2TA 3D95A 3WJDA 1VWBB 3UEUA 5EZ2A 2MM3A 2FWVA 1Z24A 1SWQA 4MISA 1Y52X 3B2IA 1VWQB 4WHIA 2F09A 2ZSCA 4YCEA 1PTSA 1UYOX 2MF6A 4XMCA 2MJIA 1SWBA 4N7CA 4CPHA 1VWHB 2OVAA 3EW2A 3RDOA 5FENA 1AVDA 1IJ8A 4JO6A 1OBPA 1SWGA 2ACOA 5BVQA 3T2WA 2X45A 2RTNB 2GJ5A 1JZUA 1KGLA 1U0XA 2AT6X 3D9WA 4OEMA 2W2FA 1JQPA 3EYCA 5F2BA 1SA8A 1STSB 2RTMA 1Y0GA 3GAQA 4A1HA 1UREA 2NNQA 3RY2A 3KFIA 2A0AA 2G8CO 2R74A 1GXAA 1MDCA 1NQNA 1NC9A 3WZQA 1SWTA 1SLGB 1O1VA 3CBCA 1I9HA 3S5XA 2Y3EA 2AT0X 1SWAA 2A8GA 3EW1A 4Y5DA 4COTA 4KC7A 4RUNA 3P6DA 2RTFB 1CBSA 4YBPA 4ALOA 4UU3A 4AZNA 1X8UA 3Q34A 2GTFX 3BY0A 5HZ5A 4WBKA 3WJEA 2RTIB 1I06A 3ZW0B 1GX9A 2BC3A 4TKBA 1LCZA 4O4XA 3F6ZB 2Q2MA 1X8NA 1S2PA 2GC9A 1X71A 1I78A 1OPAA 1D3SA 2GTLM 2IZKA 2OVDA 3LTWA 3T6FA 1LDOA 1SY0A 4I9SA 3B2LA 4KIIA 2ACPX 3EMMA 3ZW2A 4ES7A 3CBSA 3C76X 3PH5A 1KFFA 1AQBA 3EC5A 4HPDA 5FAZA 1SXWA 3VGWA 1A2DA 3HTYA 1PBOA 1I05A 1A18A 3HWFA 1SWJA 1W4TA 2C4IA 2BS6A 3P24A 4KCAA 1CRBA 1ZNGA 4YDBA 4ZGFA 3WXQA 1KQWA 1LDQA 4BOEA 3AKNA 3BX7A 3PECA 4EFGA 4EQAC 1MX7A 4GGRA 4BX6A 4O3XB 3TGAA 1DZJA 3V8UA 1O8VA 1VWDB 3RDXA 2VDFA 4YVBA 3PH6A 4JGLA 5LKEA 4O3ZA 2RTQB 4WFVA 3VG4A 5B11O 1U18A 1FENA 3VG3A 4AYHA 5FQ6E 4DCBA 1BLRA 1SWSA 3WZNA 1VWJB 1LUQA 4WFUA 4YKOA 5EDCA 1OBUA 5HBSA 1KOIA 1JJXA 3STMX 5C0NA 3RKGA 4YFQA 4CPEA 1EUOA 1EPAA 1IFBA 2BLGA 2RTEB 2FKGA 2KT4B 3VHIA 3ZQ3A 1YIVA 4JNJA 2A13A 5H9NA 3RY1A 2FTBA 4NNSA 3ZW1B 4YH0A 4GGTA 4CSBA 5LJBA 2X46A 4Z2VA 5HCCC 4O3WA 3MM0A 3TF6A 2RN4A 1JMXA 1MEPA 3U03A 2RTJA 3KFGA 1NP1A 4CPIA 2X8SA 4YFPA 1SWCA 2Q2PA 3ELZA 3BS2A 3C77X 4YGGA 1YUPA 1BSYA 4NW4A 4TQ2A 3PEDA 4BQUA 4GNWA 3MBTA 1KXOA 1ICMA 3D97A 1RSUB 1ERBA 2AL0X 3EBWA 3UAQA 5DG4A 4KH8A 1GT3A 2FS6A 1HXLA 1Y53X 1HMRA 3C78X 4NNTA 3F8AA 4NP1A 3HOEA 4BJ8A 3U9PC 5IO6A 2Z4IA 3BDRA 1DZKA 2RTPB 3NADA 4EDEA 1JYJA 2OVEA 5B5GA 3T2XA 3FR4A 1ZNLA 3BSZE 4ZCBA 2PY1A 4AW8A 2QMIA 3NX2A 1SWPA 4Y59A 1H91A 2W2BA 4RUUA 3I0AA 4TKJA 4NYRA 1HXZA 2IZAA 3MX7A 4GDAA 4HPAA 1PM1X 4IMOA 4HFOA 1JIWI 3D4RA 3PPTA 4XMEA 5F7GA 4GKCA 3BX8A 3RSWA 2FR3A 2RTHB 1WUBA 3ZW1A 3UEWA 5BVSA 4FBRA 2OFRX 4ORRA 2XSTA 1JV4A 1VYFA 1XCAA 1Y9LA 2I5VO 3FDCA 1GKAB 1HQPA 3FIDA 3NQ3A 2BHVA 2FHLA 1IW2A 1LIEA 2R73A 3QKGA 4GJSA 4I9RA 3SOTA 3T6LA 1OBQA 3VG7A 4EEJA 1CBIA 1EALA 2BT9A 1SWDA 3LV4A 3TGBA 1NP4A 1RXHA 2HZRA 1BJ7A 2C1QA 2JGSA 1O1UA 3CKGA 3EBKA 2CM4A 2MWHA 2RTGB 3PDFA 1HBQA 1YWCA 2OYBO 4Z2OA 1HMSA 1YWDA 1XKIA 4Y0SA 5CYBA 3S5VA 4MVKA 4OS8A 2Q39A 4YGHA 4IRWA 1SRFA 3VHHA 4MVIA 3STKA 2Y32A 2X34A 5HCDC 3RDMA 1OPBA 2FT9A 1SY2A 1SRGA 2W2AA 3HK1A 4CDFA 2X56A 2G5LA 2UZ2A 2QOMA 3WOVA 3O19A 2BS5A
chains in the Genus database with same CATH topology
2NNDA 2AT5X 2QM9A 2WQ9A 3FENA 5IO7A 1LICA 3APUA 4TLJA 4UU2A 2XKLA 4TNNA 4QNIA 1GX8A 5AQ6A 5LJEA 3CQRA 1DZMA 1IFCA 1U17A 1ZNEA 2Q4NA 3S26A 2CM9A 5D45A 3FEKA 4IABA 2ZAGA 5HZ9A 2RCTA 1S7DA 4I3CA 1L6MA 2JU8A 4A60A 1I4UA 2LKKA 4QYNA 5BVTA 3KFHA 4YGZA 5LJCA 1EPBA 1B0OA 3OJYC 4QYPA 5LKFA 2OFMX 4LZUA 1HMTA 5LJDA 3AKMA 4LQZA 4BVMA 3P6GA 3APVA 3KFFA 1LFOA 2JU3A 2FS7A 1G74A 4ZHFA 1TXLA 3PQUA 5DPQA 1SMPI 1E5PA 1CJ5A 2JU7A 3FA7A 1GT1A 1LPJA 1MVGA 2Q9SA 1ZRYA 1HN2A 2X8FA 5D47A 3Q6LA 4LZVA 1FTPA 3NBXX 2Z4HA 1QFTA 4GE1A 3ELXA 4ZHCA 4ZGUA 5FQ7E 5HA0A 1A3YA 4NLIA 5D48A 4U9CA 2HMBA 4A1YA 2QO5A 5F6ZA 1VPRA 5D4AA 3B2JA 3K3LA 3APXA 1PEEA 4I95A 2R56A 1E06A 4N7DA 4IAWA 1TOUA 3P6HA 4KC8A 3NX1A 4AZOA 1TOWA 1D2UA 1FDQA 5L8IA 3KQ0A 4ZR2A 5EDBA 2RCQA 2ZAIA 1LF7A 2NNEA 5CE4A 1BWYA 4O3YA 2L5PA 1LKEA 4INNA 1LIFA 2JOZA 2CZTA 3ZW0A 3U0DA 4ZFXA 3F9DA 2YG2A 1BBPA 1QG5A 4O49A 4K19A 1R0UA 3HWGA 4XMHA 3VG6A 1LIBA 2DM5A 3VE1A 3WBGA 1GM6A 2OZQA 3NQKA 4IB8A 5L8NA 1EXSA 4O9SA 1ZNDA 3NPOA 3OBLA 1ACDA 2CZUA 3G7XA 4ORWA 3VG5A 1KT4A 2ANSA 2G78A 3MVFA 3OE3A 3BLGA 4L1NA 2IFBA 3NQ9A 3L4RA 2L68A 3H3IA 5LJHA 4I3DA 2RQ0A 3TZSA 1T8VA 4ZHHA 2AMMX 3FR2A 4LKTA 1SXXA 1ERXA 4IB7A 5H8TA 1YWAA 3PQSA 3JSQA 3FA6A 1KZWA 1BSQA 2CBSA 3P6FA 3WJGA 4QRLA 1KQXA 1X8PA 4ODDA 5H9AA 4GU8A 5F58A 1ALBA 1SXUA 3BU9A 3DTQA 3N91A 3VE2A 1X89A 5B29A 4QZUA 2HNXA 1EI5A 3BRNA 3FW5A 2QOSC 3HOLA 3ZUOA 1E00A 1X8OA 4IB9A 4OS3A 4D6AA 4AZPA 1BM5A 4KT5A 3APWA 5JR8A 1JJJA 1B56A 1ADLA 2MO5A 2LB6A 1GT4A 4FGIB 1QFVA 4IMNA 4HWMA 5AJCA 3S60A 4CV7A 4ZH9A 5EEDA 1N0SA 3STNA 1SXYA 4XMFA 1BSOA 5H9KA 1YP6A 2P8GA 3NR3A 3FLLA 2A2UA 2GTLN 1AB0A 1KT3A 4MVEA 1QQSA 3HWEA 1OEKA 1GT5A 1AELA 4XMGA 3EM0A 2HLVA 1AVGI 1KZXA 3WJCA 1B4MA 1JBHA 2KTDA 3PP6A 3VU1A 1EW3A 5F1EA 5HCEC 1YP7A 4QZTA 4O4OA 1EQDA 1GKAA 3D96A 4AZMA 4QAEA 4ID2A 2KW1A 2HYSA 5L8OA 3FIQA 4FBVA 4ZJ0A 3WVMA 4QGXA 3FELA 4YDAA 2WEXA 3JS1A 4IBAA 4I6SA 1KT5A 1CBRA 3B2KA 2G79A 5HZ8A 1KT6A 4GZVA 3WJBA 1QY1A 4Y0RA 3ZWEA 4OS0A 1SY3A 2E4JA 5HTDA 3DSZA 2YMSA 3FA8A 4ORXA 5HAEA 5KIDA 4GRJA 1ZNKA 4U8UM 5D8JA 2M4LA 4ORUA 2L9CA 2WWPA 4GETA 2ALLX 2WEWA 4ZH6A 5FFHA 4PJ2A 1CBQA 3CQNA 4OMWA 2G7BA 1FELA 3RZYA 1OEJA 1RLBE 4U8UO 4DQ3A 1P6PA 2AKQA 2LBVA 4ORYA 3B2HA 4O4SA 5AEOA 3HWDA 5IO5A 2X8TA 3P6CA 3FA9A 4M6SA 4MVLA 4TKHA 1QY0A 5HA1A 3ZZVA 2LBAA 3FYFA 1EIIA 4DQ4A 2K62A 1DFVA 1ML7A 2JW1A 5K06A 1IKJA 2FRSA 5HWZA 1KT7A 1YWBA 2A3FX 4AZQA 4FBOA 4GH7A 4OMXA 1DF3A 2WQAE 2GTLO 3LHNA 2CBRA 5HZ6A 2WSJA 4EXZA 2WUTA 1E02A 3I17A 1T68X 3RBYA 2N93A 5LJKA 4ML7B 4I3BA 2AT8X 2HZQA 5LJGA 2KD2A 4PSQA 1DV9A 1UZ2X 2K23A 1IIUA 1A57A 4LKPA 1Y9TA 1LNMA 3FW4A 5AJBA 4FQBB 4O4UA 3VG2A 3TGCA 1B8EA 2LFOA 5FQ8E 2A2GA 1SY1A 5HZQA 2JN3A 2L67A 2RA6A 1TW4A 3CMPA 4IB6A 5EEEA 1G5WA 3RWXA 3VPJE 3FR5A 1ZNHA 4D6BA 1QY2A 3SAOA 2OVSA 3GE2A 3UEXA 4YKMA 1T0VA 4Y0QA 2LA7A 4CK4A 3KZAA 4A8ZA 1MUPA 2F73A 4QQ1A 1OEEA 2ASNX 4R0BA 5KICA 1DC9A 3OD9A 2QO4A 2O62A 1EIOA 4YMYA 4XMDA 3E3CA 1HBPA 5F6BA 4QGWA 3CR6A 3O2YA 4AZRA 5KHPA 2NP1A 1GGLA 1FEMA 4M7MA 4TJZA 4QGVA 3CWKA 4GNYA 1I04A 1LIDA 1G85A 1JYDA 5EPQA 1NGLA 1RBPA 3NP1A 3O22A 5B27A 3ZI8A 2POAA 4YBUA 4U3QA 2AH7X 1G7NA 4ZHGA 2QO6A 4ALBA 1QWDA 2FR2A 3T1DA 3ZUIA 3IFBA 4NYQA 4MIRA 4YCHA 1QABE 3FEPA 1BRQA 1PMPA 1ICNA 2KTSA 1S44A 4ON1A 4Y0PA 5H9LA 1VYGA 2AT3X 2MHDA 3WJFA 3P6EA 4ZHDA 1FE3A 3P02A 2WR6A 3FMZA 1X8QA 2RD7C 4HPBA 4NLJA 1IKEA 4L3RA 3JQOA 3BU1A 2FLJA 2EU7X 4IAXA 1TVQA 4ORSA 1MX8A 4ARHA 3IA8A 1BRPA 1BEBA 2JMBA 4GDZA 4HPCA 5HTEA 1DZPA 4YFRA 3UEVA 3D95A 3WJDA 3UEUA 5EZ2A 2MM3A 2FWVA 1Z24A 4MISA 3B2IA 4WHIA 2F09A 4YCEA 4XMCA 2MJIA 4N7CA 2OVAA 5FENA 1OBPA 2ACOA 5BVQA 1JZUA 1KGLA 2X45A 2GJ5A 1U0XA 2AT6X 2W2FA 3EYCA 1SA8A 3GAQA 4A1HA 1UREA 2NNQA 3KFIA 2A0AA 2R74A 1GXAA 1MDCA 1O1VA 3CBCA 3S5XA 2AT0X 4COTA 4KC7A 4RUNA 3P6DA 1CBSA 4YBPA 4ALOA 4UU3A 4AZNA 1X8UA 2GTFX 3BY0A 5HZ5A 4WBKA 3WJEA 1I06A 3ZW0B 1GX9A 4TKBA 4O4XA 3F6ZB 2Q2MA 1X8NA 1S2PA 2GC9A 1X71A 2GTLM 1OPAA 1D3SA 2OVDA 1SY0A 4I9SA 3B2LA 4KIIA 2ACPX 3EMMA 3ZW2A 4ES7A 3CBSA 3C76X 3PH5A 1AQBA 4HPDA 5FAZA 1SXWA 1A2DA 3HTYA 1PBOA 1I05A 1A18A 3HWFA 2BS6A 3P24A 4KCAA 1CRBA 1ZNGA 4YDBA 4ZGFA 3WXQA 1KQWA 4BOEA 3AKNA 3BX7A 3PECA 4EFGA 4EQAC 1MX7A 4O3XB 3TGAA 1DZJA 3V8UA 1O8VA 3PH6A 4JGLA 5LKEA 4O3ZA 4WFVA 3VG4A 1U18A 1FENA 3VG3A 4AYHA 5FQ6E 1BLRA 4YKOA 4WFUA 5EDCA 1OBUA 5HBSA 1KOIA 3STMX 5C0NA 3RKGA 4YFQA 1EUOA 1EPAA 1IFBA 2BLGA 2KT4B 3ZQ3A 1YIVA 5H9NA 2A13A 5BYPA 2FTBA 4NNSA 3ZW1B 4YH0A 4CSBA 5LJBA 2X46A 5HCCC 4O3WA 3U03A 3TF6A 2RN4A 3KFGA 1NP1A 2X8SA 4YFPA 2Q2PA 3ELZA 4YGGA 3BS2A 3C77X 4TQ2A 1YUPA 1BSYA 4NW4A 3PEDA 4BQUA 4GNWA 3MBTA 1KXOA 1ICMA 3D97A 1ERBA 2AL0X 3EBWA 3UAQA 5DG4A 4KH8A 1GT3A 2FS6A 4NNTA 1HMRA 3C78X 4NP1A 3F8AA 3HOEA 3U9PC 5IO6A 2Z4IA 3BDRA 1DZKA 3NADA 1JYJA 2OVEA 3FR4A 1ZNLA 3BSZE 4ZCBA 2PY1A 4AW8A 2QMIA 3NX2A 1H91A 2W2BA 4RUUA 3I0AA 4TKJA 4NYRA 3MX7A 4HPAA 1PM1X 4IMOA 4HFOA 1JIWI 3D4RA 3PPTA 4XMEA 5F7GA 4GKCA 3BX8A 3RSWA 2FR3A 3ZW1A 3UEWA 5BVSA 4FBRA 2OFRX 4ORRA 2XSTA 1JV4A 1VYFA 1XCAA 1Y9LA 4U8UN 4GK9A 1GKAB 1HQPA 3NQ3A 4I9RA 2BHVA 4EDEA 1IW2A 1LIEA 2R73A 3QKGA 3VG7A 1OBQA 4EEJA 1EALA 1CBIA 2BT9A 3LV4A 3TGBA 1NP4A 2HZRA 1BJ7A 1O1UA 3EBKA 2CM4A 2MWHA 1JJXA 1HBQA 1YWCA 1HMSA 1YWDA 1XKIA 4Y0SA 5CYBA 3S5VA 4MVKA 4OS8A 2Q39A 4YGHA 4MVIA 3STKA 5HCDC 1OPBA 2FT9A 1SY2A 2W2AA 3HK1A 3SOTA 3WOVA 3O19A 2BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NND A;  2AT5 X;  2QM9 A;  2WQ9 A;  3FEN A;  5IO7 A;  1LIC A;  3APU A;  4TLJ A;  4UU2 A;  2XKL A;  4TNN A;  1GX8 A;  5AQ6 A;  5LJE A;  3CQR A;  1DZM A;  1IFC A;  1U17 A;  1ZNE A;  2Q4N A;  3S26 A;  2CM9 A;  5D45 A;  3FEK A;  5HZ9 A;  2RCT A;  1S7D A;  4I3C A;  1L6M A;  2JU8 A;  4A60 A;  1I4U A;  2LKK A;  4QYN A;  5BVT A;  3KFH A;  4YGZ A;  5LJC A;  1EPB A;  1B0O A;  3OJY C;  4QYP A;  5LKF A;  2OFM X;  4LZU A;  1HMT A;  5LJD A;  3AKM A;  4BVM A;  3P6G A;  3APV A;  3KFF A;  1LFO A;  2JU3 A;  2FS7 A;  1G74 A;  4ZHF A;  1TXL A;  5DPQ A;  1E5P A;  1CJ5 A;  2JU7 A;  3FA7 A;  1GT1 A;  1LPJ A;  1MVG A;  2Q9S A;  1ZRY A;  1HN2 A;  5D47 A;  3Q6L A;  4LZV A;  1FTP A;  1QFT A;  4GE1 A;  3ELX A;  4ZHC A;  4ZGU A;  5HA0 A;  1A3Y A;  4NLI A;  5D48 A;  2HMB A;  4A1Y A;  2QO5 A;  5F6Z A;  1VPR A;  5D4A A;  3B2J A;  3K3L A;  3APX A;  1PEE A;  2R56 A;  1E06 A;  4N7D A;  4IAW A;  1TOU A;  3P6H A;  3NX1 A;  4AZO A;  1TOW A;  1D2U A;  1FDQ A;  5L8I A;  3KQ0 A;  4ZR2 A;  5EDB A;  2RCQ A;  1LF7 A;  2NNE A;  5CE4 A;  2L5P A;  1LKE A;  1LIF A;  2JOZ A;  2CZT A;  3U0D A;  4ZFX A;  3F9D A;  2YG2 A;  1BBP A;  1QG5 A;  4K19 A;  1R0U A;  3HWG A;  4XMH A;  3VG6 A;  1LIB A;  2DM5 A;  3WBG A;  1GM6 A;  2OZQ A;  4IB8 A;  5L8N A;  1EXS A;  4O9S A;  1ZND A;  3NPO A;  1ACD A;  2CZU A;  3G7X A;  4ORW A;  3VG5 A;  1KT4 A;  2ANS A;  2G78 A;  3MVF A;  3BLG A;  2IFB A;  3NQ9 A;  3L4R A;  2L68 A;  5LJH A;  4I3D A;  2RQ0 A;  3TZS A;  1T8V A;  4ZHH A;  2AMM X;  3FR2 A;  4LKT A;  1SXX A;  1ERX A;  4IB7 A;  5H8T A;  1YWA A;  1KZW A;  3JSQ A;  3FA6 A;  1BSQ A;  2CBS A;  3P6F A;  3WJG A;  1KQX A;  1X8P A;  4ODD A;  5H9A A;  5F58 A;  1ALB A;  1SXU A;  3BU9 A;  3DTQ A;  5B29 A;  1X89 A;  4QZU A;  2HNX A;  3BRN A;  3FW5 A;  2QOS C;  3ZUO A;  1E00 A;  1X8O A;  4IB9 A;  4OS3 A;  4D6A A;  4AZP A;  1BM5 A;  3APW A;  5JR8 A;  1JJJ A;  1B56 A;  1ADL A;  2MO5 A;  2LB6 A;  1GT4 A;  1QFV A;  4IMN A;  4ZH9 A;  5EED A;  1N0S A;  3STN A;  1SXY A;  4XMF A;  1BSO A;  5H9K A;  1YP6 A;  2P8G A;  3NR3 A;  3FLL A;  2A2U A;  1AB0 A;  1KT3 A;  1QQS A;  3HWE A;  1OEK A;  1GT5 A;  1AEL A;  4XMG A;  3EM0 A;  2HLV A;  1AVG I;  1KZX A;  3WJC A;  1B4M A;  1JBH A;  2KTD A;  3PP6 A;  1EW3 A;  5F1E A;  5HCE C;  1YP7 A;  4QZT A;  1EQD A;  1GKA A;  3D96 A;  4AZM A;  4QAE A;  2HYS A;  5L8O A;  3FIQ A;  4ZJ0 A;  3WVM A;  4QGX A;  3FEL A;  4YDA A;  2WEX A;  3JS1 A;  4IBA A;  1KT5 A;  1CBR A;  3B2K A;  2G79 A;  5HZ8 A;  1KT6 A;  3WJB A;  1QY1 A;  4Y0R A;  4OS0 A;  1SY3 A;  2E4J A;  5HTD A;  3DSZ A;  3FA8 A;  4ORX A;  5HAE A;  5KID A;  4GRJ A;  1ZNK A;  5D8J A;  4ORU A;  2L9C A;  2WWP A;  4GET A;  2ALL X;  2WEW A;  4ZH6 A;  5FFH A;  1CBQ A;  3CQN A;  4OMW A;  2G7B A;  1FEL A;  3RZY A;  1OEJ A;  1RLB E;  4DQ3 A;  1P6P A;  2AKQ A;  2LBV A;  4ORY A;  3B2H A;  3HWD A;  5IO5 A;  3P6C A;  3FA9 A;  4M6S A;  4MVL A;  4TKH A;  1QY0 A;  5HA1 A;  2LBA A;  1EII A;  4DQ4 A;  1DFV A;  1ML7 A;  2K62 A;  5K06 A;  1IKJ A;  2FRS A;  5HWZ A;  1KT7 A;  1YWB A;  2A3F X;  4AZQ A;  4GH7 A;  4OMX A;  1DF3 A;  2WQA E;  5HZ6 A;  2CBR A;  2WSJ A;  4EXZ A;  2WUT A;  1E02 A;  3I17 A;  1T68 X;  2N93 A;  5LJK A;  4I3B A;  2AT8 X;  2HZQ A;  5LJG A;  4PSQ A;  1DV9 A;  1UZ2 X;  2K23 A;  1IIU A;  1A57 A;  4LKP A;  3VG2 A;  1LNM A;  3FW4 A;  3TGC A;  1B8E A;  2LFO A;  2A2G A;  1SY1 A;  5HZQ A;  2JN3 A;  2L67 A;  2RA6 A;  1TW4 A;  3CMP A;  4IB6 A;  5EEE A;  1G5W A;  3FR5 A;  1ZNH A;  4D6B A;  1QY2 A;  3SAO A;  3UEX A;  4YKM A;  1T0V A;  4Y0Q A;  4CK4 A;  3KZA A;  4A8Z A;  1MUP A;  2F73 A;  1OEE A;  2ASN X;  4R0B A;  5KIC A;  1DC9 A;  2QO4 A;  2O62 A;  1EIO A;  4YMY A;  4XMD A;  1HBP A;  5F6B A;  4QGW A;  3CR6 A;  3O2Y A;  4AZR A;  5KHP A;  2NP1 A;  1GGL A;  1FEM A;  4M7M A;  4TJZ A;  4QGV A;  3CWK A;  4GNY A;  1I04 A;  1LID A;  1G85 A;  1JYD A;  5EPQ A;  1NGL A;  1RBP A;  3NP1 A;  3O22 A;  5B27 A;  2POA A;  4YBU A;  2AH7 X;  1G7N A;  4ZHG A;  2QO6 A;  4ALB A;  1QWD A;  2FR2 A;  3T1D A;  3ZUI A;  3IFB A;  4NYQ A;  4YCH A;  1QAB E;  3FEP A;  1BRQ A;  1PMP A;  1ICN A;  5H9L A;  1S44 A;  4Y0P A;  1VYG A;  2AT3 X;  4ZHD A;  3WJF A;  3P6E A;  1FE3 A;  2WR6 A;  3FMZ A;  1X8Q A;  2RD7 C;  4HPB A;  4NLJ A;  1IKE A;  3BU1 A;  2FLJ A;  2EU7 X;  4IAX A;  1TVQ A;  4ORS A;  1MX8 A;  4ARH A;  3IA8 A;  1BRP A;  1BEB A;  4HPC A;  5HTE A;  1DZP A;  4YFR A;  3UEV A;  3D95 A;  3WJD A;  3UEU A;  5EZ2 A;  2MM3 A;  2FWV A;  1Z24 A;  3B2I A;  4YCE A;  4XMC A;  2MJI A;  4N7C A;  2OVA A;  5FEN A;  1OBP A;  2ACO A;  5BVQ A;  1JZU A;  1KGL A;  2X45 A;  2GJ5 A;  1U0X A;  2AT6 X;  2W2F A;  3EYC A;  1SA8 A;  3GAQ A;  4A1H A;  1URE A;  2NNQ A;  3KFI A;  2R74 A;  2A0A A;  1GXA A;  1MDC A;  1O1V A;  3CBC A;  2AT0 X;  4RUN A;  3P6D A;  1CBS A;  4YBP A;  4ALO A;  4UU3 A;  4AZN A;  1X8U A;  2GTF X;  3BY0 A;  5HZ5 A;  4WBK A;  3WJE A;  1I06 A;  1GX9 A;  4TKB A;  2Q2M A;  1X8N A;  1S2P A;  2GC9 A;  1X71 A;  1OPA A;  1D3S A;  2OVD A;  1SY0 A;  4I9S A;  3B2L A;  4KII A;  2ACP X;  3EMM A;  4ES7 A;  3CBS A;  3C76 X;  3PH5 A;  1AQB A;  4HPD A;  5FAZ A;  1SXW A;  1A2D A;  1PBO A;  1I05 A;  1A18 A;  3HWF A;  1CRB A;  1ZNG A;  4YDB A;  3WXQ A;  1KQW A;  4BOE A;  3AKN A;  3BX7 A;  3PEC A;  4EFG A;  1MX7 A;  3TGA A;  1DZJ A;  1O8V A;  3PH6 A;  5LKE A;  4WFV A;  3VG4 A;  1U18 A;  1FEN A;  3VG3 A;  4AYH A;  1BLR A;  4YKO A;  4WFU A;  5EDC A;  1OBU A;  5HBS A;  1KOI A;  3STM X;  5C0N A;  4YFQ A;  1EUO A;  1EPA A;  1IFB A;  2BLG A;  2KT4 B;  3ZQ3 A;  1YIV A;  5H9N A;  2A13 A;  2FTB A;  4NNS A;  5LJB A;  4YH0 A;  2X46 A;  5HCC C;  3U03 A;  3TF6 A;  3KFG A;  1NP1 A;  4YFP A;  2Q2P A;  3ELZ A;  4YGG A;  3BS2 A;  3C77 X;  4TQ2 A;  1YUP A;  1BSY A;  3PED A;  4BQU A;  4GNW A;  3MBT A;  1KXO A;  1ICM A;  3D97 A;  1ERB A;  2AL0 X;  3EBW A;  5DG4 A;  1GT3 A;  2FS6 A;  4NNT A;  1HMR A;  3C78 X;  4NP1 A;  3F8A A;  3U9P C;  5IO6 A;  3BDR A;  1DZK A;  3NAD A;  1JYJ A;  2OVE A;  3FR4 A;  1ZNL A;  3BSZ E;  4ZCB A;  2PY1 A;  4AW8 A;  3NX2 A;  1H91 A;  2W2B A;  4RUU A;  3I0A A;  4TKJ A;  4NYR A;  4HPA A;  1PM1 X;  4IMO A;  4HFO A;  3PPT A;  4XME A;  5F7G A;  4GKC A;  3BX8 A;  3RSW A;  2FR3 A;  3UEW A;  5BVS A;  2OFR X;  4ORR A;  2XST A;  1JV4 A;  1VYF A;  1XCA A;  1BWY A;  1GKA B;  1HQP A;  3NQ3 A;  4I9R A;  4EDE A;  1IW2 A;  1LIE A;  2R73 A;  3QKG A;  3VG7 A;  1OBQ A;  4EEJ A;  1EAL A;  1CBI A;  3TGB A;  1NP4 A;  2HZR A;  1BJ7 A;  1O1U A;  3EBK A;  2CM4 A;  1JJX A;  1HBQ A;  1YWC A;  1HMS A;  1YWD A;  1XKI A;  4Y0S A;  4MVK A;  4OS8 A;  2Q39 A;  4YGH A;  4MVI A;  3STK A;  5HCD C;  1OPB A;  2FT9 A;  1SY2 A;  2W2A A;  3HK1 A;  3O19 A; 
#chains in the Genus database with same CATH topology
 1OSP O;  3RE6 A;  2NND A;  2AT5 X;  2QM9 A;  2WQ9 A;  3FEN A;  4I60 A;  5IO7 A;  1LIC A;  3APU A;  4TLJ A;  4UU2 A;  2XKL A;  4TNN A;  3VHM A;  4QNI A;  1N9Y A;  1GX8 A;  4Z2P A;  5AQ6 A;  5LJE A;  3CQR A;  1DZM A;  1IFC A;  2IZJ A;  1AVE A;  1U17 A;  1ZNE A;  2Q4N A;  5JD2 A;  4MEE A;  2CM9 A;  3CKF A;  3FEK A;  4IAB A;  5D45 A;  3S26 A;  1UYN X;  2ZAG A;  5HZ9 A;  2RCT A;  1S7D A;  4I3C A;  1L6M A;  2JU8 A;  4A60 A;  1I4U A;  2HKD A;  1VYO A;  2GH7 A;  2LKK A;  2WPU A;  4QYN A;  1NBX A;  3KFH A;  5BVT A;  4YGZ A;  4BX7 B;  3SZH A;  1EPB A;  1B0O A;  3OJY C;  4QYP A;  5LKF A;  2OFM X;  4LZU A;  1HMT A;  5LJD A;  3AKM A;  1SWF A;  4LQZ A;  4BVM A;  3P6G A;  3APV A;  3KFF A;  1LFO A;  2JU3 A;  2FS7 A;  1G74 A;  2AVI A;  4ZHF A;  1TXL A;  3PQU A;  5DPQ A;  1SMP I;  1MK5 A;  1E5P A;  2UYW A;  1CJ5 A;  1HY2 A;  2JU7 A;  2OFA A;  2RTC B;  3FA7 A;  1GT1 A;  1LPJ A;  1WBI A;  1MVG A;  2Q9S A;  1ZRY A;  1HN2 A;  2X8F A;  5D47 A;  3Q6L A;  4LZV A;  1FTP A;  3RDQ A;  3NBX X;  2Z4H A;  1JMZ A;  1QFT A;  3AUM O;  4GE1 A;  3ELX A;  4ZHC A;  4ZGU A;  5FQ7 E;  5HA0 A;  2FHN X;  2FKJ A;  1A3Y A;  4NLI A;  5D48 A;  4U9C A;  5B10 O;  3RE5 A;  2HMB A;  2X32 A;  2QCB A;  4A1Y A;  4BCS A;  2QO5 A;  5F6Z A;  1VPR A;  5D4A A;  3B2J A;  3SLT A;  2I5Z O;  3K3L A;  3APX A;  1PEE A;  2OY8 A;  4I95 A;  2R56 A;  1E06 A;  4N7D A;  4IAW A;  1TOU A;  3P6H A;  4KC8 A;  3NX1 A;  4Z27 A;  2IZG B;  1TOW A;  1D2U A;  4AZO A;  1FDQ A;  5L8I A;  3KQ0 A;  4ZR2 A;  5EDB A;  2RCQ A;  2ZAI A;  1LF7 A;  2NNE A;  5CE4 A;  1BWY A;  4O3Y A;  2L5P A;  1LKE A;  4INN A;  1LIF A;  2JOZ A;  2CZT A;  3ZW0 A;  3U0D A;  4ZFX A;  3F9D A;  2YG2 A;  4GUZ A;  2CAM A;  1BBP A;  1QG5 A;  4O49 A;  4K19 A;  1R0U A;  3HWG A;  4XMH A;  3VG6 A;  1LIB A;  2DM5 A;  3VE1 A;  3WBG A;  1GM6 A;  2OZQ A;  3NQK A;  1PBY A;  4IB8 A;  2IZF B;  5L8N A;  1EXS A;  4O9S A;  1ZND A;  3NPO A;  1SRJ A;  1MOY A;  4U46 A;  3OBL A;  3AEH A;  1ACD A;  2CZU A;  3G7X A;  4ORW A;  2X4M A;  5CHK A;  1KT4 A;  2ANS A;  2G78 A;  3VG5 A;  4EKV A;  1K3B A;  3MVF A;  3OE3 A;  2IZD B;  2Y3F A;  3BLG A;  4L1N A;  2IFB A;  4BX5 B;  3NQ9 A;  3L4R A;  2L68 A;  3H3I A;  5LJH A;  4I3D A;  3WZP A;  2RQ0 A;  1SLF B;  3TZS A;  1T8V A;  4ZHH A;  2AMM X;  3FR2 A;  4LKT A;  1SXX A;  1ERX A;  4IB7 A;  5H8T A;  1YWA A;  3PQS A;  3JSQ A;  3FA6 A;  2OL8 O;  1KZW A;  1BSQ A;  2CBS A;  5IXG A;  2AF5 A;  3P6F A;  5B3M O;  3WJG A;  4QRL A;  1KQX A;  1X8P A;  4ODD A;  5H9A A;  2IZH B;  4GU8 A;  4NV8 A;  5F58 A;  1ALB A;  1SXU A;  3X00 A;  3BU9 A;  3DTQ A;  3N91 A;  3VE2 A;  1X89 A;  1VWC B;  5B29 A;  4QZU A;  4OKA A;  1GX3 A;  2HNX A;  1EI5 A;  3BRN A;  3FW5 A;  4CPF A;  2QOS C;  3HOL A;  3ZUO A;  1E00 A;  1X8O A;  4IB9 A;  4OS3 A;  4BBO A;  5LJC A;  4D6A A;  4AZP A;  1BM5 A;  1KL3 A;  3APW A;  2A5C A;  4KT5 A;  1RXJ A;  2OY5 O;  5JR8 A;  4OEL A;  1JJJ A;  2OL6 O;  1B56 A;  4B55 A;  1ADL A;  2MO5 A;  1VWG B;  2LB6 A;  1N4J A;  3MG5 A;  4GD9 A;  1GT4 A;  3HPE A;  4FGI B;  1JJU A;  1QFV A;  2X55 A;  4HWM A;  4IMN A;  2RTL A;  2OY7 A;  5AJC A;  2DJF A;  3RDU A;  3S60 A;  4Z6J A;  4CV7 A;  4ZH9 A;  5EED A;  4CPH B;  2OL7 A;  1N0S A;  3STN A;  1SXY A;  4XMF A;  1BSO A;  5H9K A;  1YP6 A;  2P8G A;  3WYP A;  3NR3 A;  1LEL A;  2A2U A;  3FLL A;  2GTL N;  1AB0 A;  1KT3 A;  4MVE A;  1N9M A;  1QQS A;  1OEK A;  1GT5 A;  3HWE A;  1AEL A;  2DJG A;  4XMG A;  3EM0 A;  3SZJ A;  2HLV A;  1AVG I;  3SLO A;  1KZX A;  3WJC A;  1B4M A;  4CDE A;  1JBH A;  5IRA A;  2KTD A;  3PP6 A;  3VU1 A;  1FJ1 E;  1RAV A;  1EW3 A;  1VWM B;  5F1E A;  5HCE C;  1YP7 A;  3QQ2 A;  5K67 A;  4QZT A;  4O4O A;  1EQD A;  1GKA A;  3D96 A;  5IRU A;  3WZO A;  4AZM A;  4GGZ A;  4QAE A;  2RTD B;  4ID2 A;  1Y55 X;  2KW1 A;  2BSZ A;  2HYS A;  1SWH A;  5L8O A;  3FIQ A;  4FBV A;  4DNE A;  4ZJ0 A;  3WVM A;  4QGX A;  2IZB A;  1SWR A;  3FEL A;  4YDA A;  2RTR B;  5L3Y A;  1SWU A;  1SRE A;  2WEX A;  3JS1 A;  4IBA A;  4I6S A;  1KT5 A;  1CBR A;  3B2K A;  2G79 A;  2VFB A;  1KT6 A;  4GZV A;  3WJB A;  5HZ8 A;  1QY1 A;  4Y0R A;  3ZWE A;  4OS0 A;  1SY3 A;  2E4J A;  3PK2 A;  5HTD A;  3DSZ A;  1NDJ A;  1VWI B;  2YMS A;  3VG2 A;  3FA8 A;  4ORX A;  5B5F A;  5HAE A;  5KID A;  4GRJ A;  1ZNK A;  4U8U M;  2OY1 O;  2M4L A;  4ORU A;  5D8J A;  1VWA B;  2L9C A;  2WWP A;  4GET A;  2ALL X;  2WEW A;  4ZH6 A;  5FFH A;  2OF8 A;  4PJ2 A;  1CBQ A;  3CQN A;  4OMW A;  4BX6 B;  3KVN A;  2G7B A;  2VFC A;  1FEL A;  1SLD B;  3RZY A;  1OEJ A;  1RLB E;  4U8U O;  4DQ3 A;  4C5P A;  1P6P A;  2AKQ A;  2LBV A;  4ORY A;  3B2H A;  4O4S A;  5AEO A;  3HWD A;  1W6F A;  2X8T A;  5IO5 A;  1LCV A;  1LCW A;  3P6C A;  3FA9 A;  4M6S A;  4BX7 A;  2IZI A;  4MVL A;  4TKH A;  1QY0 A;  5HA1 A;  5CSE A;  3ZZV A;  2LBA A;  2OFB A;  3FYF A;  1EII A;  2IZE B;  4DQ4 A;  1DFV A;  1ML7 A;  2K62 A;  2JW1 A;  5K06 A;  1IKJ A;  2FRS A;  5HWZ A;  1KT7 A;  1YWB A;  2A3F X;  4AZQ A;  1VWP B;  4FBO A;  3SLJ A;  4GH7 A;  4OMX A;  1DF3 A;  1MM9 A;  1VWE B;  2GTL O;  2WQA E;  2CBR A;  3LHN A;  5HZ6 A;  1W5R A;  2WSJ A;  4EXZ A;  2WUT A;  1E02 A;  3I17 A;  1T68 X;  3RBY A;  2N93 A;  5LJK A;  4ML7 B;  4I3B A;  2AT8 X;  2HZQ A;  5LJG A;  2KD2 A;  4PSQ A;  1RXK A;  1DV9 A;  1UZ2 X;  2RTO B;  2K23 A;  1IIU A;  1A57 A;  2IZL B;  1Y9T A;  1LNM A;  3FW4 A;  4LKP A;  4FQB B;  4O4U A;  5AJB A;  4NV7 A;  1B8E A;  2LFO A;  3TGC A;  1VWL B;  5FQ8 E;  2A2G A;  5B2A O;  1SY1 A;  2F01 A;  1SWE A;  5HZQ A;  2JN3 A;  2L67 A;  1SRH A;  2RA6 A;  1TW4 A;  3CMP A;  4IB6 A;  5EEE A;  1G5W A;  1VWN B;  3RWX A;  3VPJ E;  3FR5 A;  1STR B;  1VWR B;  1ZNH A;  4D6B A;  1QY2 A;  3SAO A;  1KL5 A;  2OVS A;  3GE2 A;  4YKM A;  3UEX A;  1T0V A;  4Y0Q A;  2LA7 A;  1SWK A;  3WYQ A;  4CK4 A;  3KZA A;  4A8Z A;  1MUP A;  4GJV A;  2F73 A;  4QQ1 A;  1OEE A;  2A5B A;  2PI3 O;  1N43 A;  1SLE B;  2ASN X;  2IZC B;  4R0B A;  5KIC A;  1DC9 A;  3OD9 A;  2QO4 A;  2O62 A;  1EIO A;  1VWF B;  4YMY A;  4XMD A;  1N7Y A;  1HBP A;  3E3C A;  4QGW A;  5F6B A;  3CR6 A;  3O2Y A;  4AZR A;  5KHP A;  2NP1 A;  5K68 A;  1GGL A;  1NQM A;  1FEM A;  4M7M A;  2C1S A;  4TJZ A;  4QGV A;  3CWK A;  4GNY A;  1I04 A;  1LID A;  1G85 A;  1JYD A;  4U8U N;  1NGL A;  5EPQ A;  1RBP A;  3NP1 A;  3O22 A;  5B27 A;  3ZI8 A;  5IRW A;  4BX5 A;  2POA A;  4YBU A;  1SWL A;  4U3Q A;  1HQQ A;  1K24 A;  1G7N A;  2AH7 X;  4BGF A;  3SZI A;  4ZHG A;  2QO6 A;  2OF9 A;  4ALB A;  2FGS A;  1SWN A;  1SWO A;  1QWD A;  2FR2 A;  3T1D A;  3ZUI A;  1DF8 A;  2RTB B;  3IFB A;  4NYQ A;  1VWO B;  4MIR A;  1QAB E;  4YCH A;  3FEP A;  1BRQ A;  1PMP A;  1ICN A;  2KTS A;  1S44 A;  4ON1 A;  4Y0P A;  5H9L A;  1VYG A;  4GK9 A;  1VWK B;  2AT3 X;  2MHD A;  4JHQ A;  3P6E A;  3WJF A;  4ZHD A;  5BYP A;  1RST B;  1FE3 A;  4CDC A;  3P02 A;  2WR6 A;  1KL4 A;  3FMZ A;  3RDS A;  1X8Q A;  2RD7 C;  2RTK A;  4HPB A;  4NLJ A;  1IKE A;  4L3R A;  3JQO A;  3BU1 A;  4Z28 A;  2FLJ A;  2EU7 X;  2RTA A;  4IAX A;  1TVQ A;  4ORS A;  1MX8 A;  4ARH A;  3IA8 A;  1BRP A;  1BEB A;  2JMB A;  4GDZ A;  4HPC A;  5HTE A;  1STP A;  1SRI A;  4CDD A;  1DZP A;  4YFR A;  3UEV A;  1E2T A;  3D95 A;  3WJD A;  1VWB B;  3UEU A;  5EZ2 A;  2MM3 A;  2FWV A;  1Z24 A;  1SWQ A;  4MIS A;  1Y52 X;  3B2I A;  1VWQ B;  4WHI A;  2F09 A;  2ZSC A;  4YCE A;  1PTS A;  1UYO X;  2MF6 A;  4XMC A;  2MJI A;  1SWB A;  4N7C A;  4CPH A;  1VWH B;  2OVA A;  3EW2 A;  3RDO A;  5FEN A;  1AVD A;  1IJ8 A;  4JO6 A;  1OBP A;  1SWG A;  2ACO A;  5BVQ A;  3T2W A;  2X45 A;  2RTN B;  2GJ5 A;  1JZU A;  1KGL A;  1U0X A;  2AT6 X;  3D9W A;  4OEM A;  2W2F A;  1JQP A;  3EYC A;  5F2B A;  1SA8 A;  1STS B;  2RTM A;  1Y0G A;  3GAQ A;  4A1H A;  1URE A;  2NNQ A;  3RY2 A;  3KFI A;  2A0A A;  2G8C O;  2R74 A;  1GXA A;  1MDC A;  1NQN A;  1NC9 A;  3WZQ A;  1SWT A;  1SLG B;  1O1V A;  3CBC A;  1I9H A;  3S5X A;  2Y3E A;  2AT0 X;  1SWA A;  2A8G A;  3EW1 A;  4Y5D A;  4COT A;  4KC7 A;  4RUN A;  3P6D A;  2RTF B;  1CBS A;  4YBP A;  4ALO A;  4UU3 A;  4AZN A;  1X8U A;  3Q34 A;  2GTF X;  3BY0 A;  5HZ5 A;  4WBK A;  3WJE A;  2RTI B;  1I06 A;  3ZW0 B;  1GX9 A;  2BC3 A;  4TKB A;  1LCZ A;  4O4X A;  3F6Z B;  2Q2M A;  1X8N A;  1S2P A;  2GC9 A;  1X71 A;  1I78 A;  1OPA A;  1D3S A;  2GTL M;  2IZK A;  2OVD A;  3LTW A;  3T6F A;  1LDO A;  1SY0 A;  4I9S A;  3B2L A;  4KII A;  2ACP X;  3EMM A;  3ZW2 A;  4ES7 A;  3CBS A;  3C76 X;  3PH5 A;  1KFF A;  1AQB A;  3EC5 A;  4HPD A;  5FAZ A;  1SXW A;  3VGW A;  1A2D A;  3HTY A;  1PBO A;  1I05 A;  1A18 A;  3HWF A;  1SWJ A;  1W4T A;  2C4I A;  2BS6 A;  3P24 A;  4KCA A;  1CRB A;  1ZNG A;  4YDB A;  4ZGF A;  3WXQ A;  1KQW A;  1LDQ A;  4BOE A;  3AKN A;  3BX7 A;  3PEC A;  4EFG A;  4EQA C;  1MX7 A;  4GGR A;  4BX6 A;  4O3X B;  3TGA A;  1DZJ A;  3V8U A;  1O8V A;  1VWD B;  3RDX A;  2VDF A;  4YVB A;  3PH6 A;  4JGL A;  5LKE A;  4O3Z A;  2RTQ B;  4WFV A;  3VG4 A;  5B11 O;  1U18 A;  1FEN A;  3VG3 A;  4AYH A;  5FQ6 E;  4DCB A;  1BLR A;  1SWS A;  3WZN A;  1VWJ B;  1LUQ A;  4WFU A;  4YKO A;  5EDC A;  1OBU A;  5HBS A;  1KOI A;  1JJX A;  3STM X;  5C0N A;  3RKG A;  4YFQ A;  4CPE A;  1EUO A;  1EPA A;  1IFB A;  2BLG A;  2RTE B;  2FKG A;  2KT4 B;  3VHI A;  3ZQ3 A;  1YIV A;  4JNJ A;  2A13 A;  5H9N A;  3RY1 A;  2FTB A;  4NNS A;  3ZW1 B;  4YH0 A;  4GGT A;  4CSB A;  5LJB A;  2X46 A;  4Z2V A;  5HCC C;  4O3W A;  3MM0 A;  3TF6 A;  2RN4 A;  1JMX A;  1MEP A;  3U03 A;  2RTJ A;  3KFG A;  1NP1 A;  4CPI A;  2X8S A;  4YFP A;  1SWC A;  2Q2P A;  3ELZ A;  3BS2 A;  3C77 X;  4YGG A;  1YUP A;  1BSY A;  4NW4 A;  4TQ2 A;  3PED A;  4BQU A;  4GNW A;  3MBT A;  1KXO A;  1ICM A;  3D97 A;  1RSU B;  1ERB A;  2AL0 X;  3EBW A;  3UAQ A;  5DG4 A;  4KH8 A;  1GT3 A;  2FS6 A;  1HXL A;  1Y53 X;  1HMR A;  3C78 X;  4NNT A;  3F8A A;  4NP1 A;  3HOE A;  4BJ8 A;  3U9P C;  5IO6 A;  2Z4I A;  3BDR A;  1DZK A;  2RTP B;  3NAD A;  4EDE A;  1JYJ A;  2OVE A;  5B5G A;  3T2X A;  3FR4 A;  1ZNL A;  3BSZ E;  4ZCB A;  2PY1 A;  4AW8 A;  2QMI A;  3NX2 A;  1SWP A;  4Y59 A;  1H91 A;  2W2B A;  4RUU A;  3I0A A;  4TKJ A;  4NYR A;  1HXZ A;  2IZA A;  3MX7 A;  4GDA A;  4HPA A;  1PM1 X;  4IMO A;  4HFO A;  1JIW I;  3D4R A;  3PPT A;  4XME A;  5F7G A;  4GKC A;  3BX8 A;  3RSW A;  2FR3 A;  2RTH B;  1WUB A;  3ZW1 A;  3UEW A;  5BVS A;  4FBR A;  2OFR X;  4ORR A;  2XST A;  1JV4 A;  1VYF A;  1XCA A;  1Y9L A;  2I5V O;  3FDC A;  1GKA B;  1HQP A;  3FID A;  3NQ3 A;  2BHV A;  2FHL A;  1IW2 A;  1LIE A;  2R73 A;  3QKG A;  4GJS A;  4I9R A;  3SOT A;  3T6L A;  1OBQ A;  3VG7 A;  4EEJ A;  1CBI A;  1EAL A;  2BT9 A;  1SWD A;  3LV4 A;  3TGB A;  1NP4 A;  1RXH A;  2HZR A;  1BJ7 A;  2C1Q A;  2JGS A;  1O1U A;  3CKG A;  3EBK A;  2CM4 A;  2MWH A;  2RTG B;  3PDF A;  1HBQ A;  1YWC A;  2OYB O;  4Z2O A;  1HMS A;  1YWD A;  1XKI A;  4Y0S A;  5CYB A;  3S5V A;  4MVK A;  4OS8 A;  2Q39 A;  4YGH A;  4IRW A;  1SRF A;  3VHH A;  4MVI A;  3STK A;  2Y32 A;  2X34 A;  5HCD C;  3RDM A;  1OPB A;  2FT9 A;  1SY2 A;  1SRG A;  2W2A A;  3HK1 A;  4CDF A;  2X56 A;  2G5L A;  2UZ2 A;  2QOM A;  3WOV A;  3O19 A;  2BS5 A; 
#chains in the Genus database with same CATH homology
 2NND A;  2AT5 X;  2QM9 A;  2WQ9 A;  3FEN A;  5IO7 A;  1LIC A;  3APU A;  4TLJ A;  4UU2 A;  2XKL A;  4TNN A;  4QNI A;  1GX8 A;  5AQ6 A;  5LJE A;  3CQR A;  1DZM A;  1IFC A;  1U17 A;  1ZNE A;  2Q4N A;  3S26 A;  2CM9 A;  5D45 A;  3FEK A;  4IAB A;  2ZAG A;  5HZ9 A;  2RCT A;  1S7D A;  4I3C A;  1L6M A;  2JU8 A;  4A60 A;  1I4U A;  2LKK A;  4QYN A;  5BVT A;  3KFH A;  4YGZ A;  5LJC A;  1EPB A;  1B0O A;  3OJY C;  4QYP A;  5LKF A;  2OFM X;  4LZU A;  1HMT A;  5LJD A;  3AKM A;  4LQZ A;  4BVM A;  3P6G A;  3APV A;  3KFF A;  1LFO A;  2JU3 A;  2FS7 A;  1G74 A;  4ZHF A;  1TXL A;  3PQU A;  5DPQ A;  1SMP I;  1E5P A;  1CJ5 A;  2JU7 A;  3FA7 A;  1GT1 A;  1LPJ A;  1MVG A;  2Q9S A;  1ZRY A;  1HN2 A;  2X8F A;  5D47 A;  3Q6L A;  4LZV A;  1FTP A;  3NBX X;  2Z4H A;  1QFT A;  4GE1 A;  3ELX A;  4ZHC A;  4ZGU A;  5FQ7 E;  5HA0 A;  1A3Y A;  4NLI A;  5D48 A;  4U9C A;  2HMB A;  4A1Y A;  2QO5 A;  5F6Z A;  1VPR A;  5D4A A;  3B2J A;  3K3L A;  3APX A;  1PEE A;  4I95 A;  2R56 A;  1E06 A;  4N7D A;  4IAW A;  1TOU A;  3P6H A;  4KC8 A;  3NX1 A;  4AZO A;  1TOW A;  1D2U A;  1FDQ A;  5L8I A;  3KQ0 A;  4ZR2 A;  5EDB A;  2RCQ A;  2ZAI A;  1LF7 A;  2NNE A;  5CE4 A;  1BWY A;  4O3Y A;  2L5P A;  1LKE A;  4INN A;  1LIF A;  2JOZ A;  2CZT A;  3ZW0 A;  3U0D A;  4ZFX A;  3F9D A;  2YG2 A;  1BBP A;  1QG5 A;  4O49 A;  4K19 A;  1R0U A;  3HWG A;  4XMH A;  3VG6 A;  1LIB A;  2DM5 A;  3VE1 A;  3WBG A;  1GM6 A;  2OZQ A;  3NQK A;  4IB8 A;  5L8N A;  1EXS A;  4O9S A;  1ZND A;  3NPO A;  3OBL A;  1ACD A;  2CZU A;  3G7X A;  4ORW A;  3VG5 A;  1KT4 A;  2ANS A;  2G78 A;  3MVF A;  3OE3 A;  3BLG A;  4L1N A;  2IFB A;  3NQ9 A;  3L4R A;  2L68 A;  3H3I A;  5LJH A;  4I3D A;  2RQ0 A;  3TZS A;  1T8V A;  4ZHH A;  2AMM X;  3FR2 A;  4LKT A;  1SXX A;  1ERX A;  4IB7 A;  5H8T A;  1YWA A;  3PQS A;  3JSQ A;  3FA6 A;  1KZW A;  1BSQ A;  2CBS A;  3P6F A;  3WJG A;  4QRL A;  1KQX A;  1X8P A;  4ODD A;  5H9A A;  4GU8 A;  5F58 A;  1ALB A;  1SXU A;  3BU9 A;  3DTQ A;  3N91 A;  3VE2 A;  1X89 A;  5B29 A;  4QZU A;  2HNX A;  1EI5 A;  3BRN A;  3FW5 A;  2QOS C;  3HOL A;  3ZUO A;  1E00 A;  1X8O A;  4IB9 A;  4OS3 A;  4D6A A;  4AZP A;  1BM5 A;  4KT5 A;  3APW A;  5JR8 A;  1JJJ A;  1B56 A;  1ADL A;  2MO5 A;  2LB6 A;  1GT4 A;  4FGI B;  1QFV A;  4IMN A;  4HWM A;  5AJC A;  3S60 A;  4CV7 A;  4ZH9 A;  5EED A;  1N0S A;  3STN A;  1SXY A;  4XMF A;  1BSO A;  5H9K A;  1YP6 A;  2P8G A;  3NR3 A;  3FLL A;  2A2U A;  2GTL N;  1AB0 A;  1KT3 A;  4MVE A;  1QQS A;  3HWE A;  1OEK A;  1GT5 A;  1AEL A;  4XMG A;  3EM0 A;  2HLV A;  1AVG I;  1KZX A;  3WJC A;  1B4M A;  1JBH A;  2KTD A;  3PP6 A;  3VU1 A;  1EW3 A;  5F1E A;  5HCE C;  1YP7 A;  4QZT A;  4O4O A;  1EQD A;  1GKA A;  3D96 A;  4AZM A;  4QAE A;  4ID2 A;  2KW1 A;  2HYS A;  5L8O A;  3FIQ A;  4FBV A;  4ZJ0 A;  3WVM A;  4QGX A;  3FEL A;  4YDA A;  2WEX A;  3JS1 A;  4IBA A;  4I6S A;  1KT5 A;  1CBR A;  3B2K A;  2G79 A;  5HZ8 A;  1KT6 A;  4GZV A;  3WJB A;  1QY1 A;  4Y0R A;  3ZWE A;  4OS0 A;  1SY3 A;  2E4J A;  5HTD A;  3DSZ A;  2YMS A;  3FA8 A;  4ORX A;  5HAE A;  5KID A;  4GRJ A;  1ZNK A;  4U8U M;  5D8J A;  2M4L A;  4ORU A;  2L9C A;  2WWP A;  4GET A;  2ALL X;  2WEW A;  4ZH6 A;  5FFH A;  4PJ2 A;  1CBQ A;  3CQN A;  4OMW A;  2G7B A;  1FEL A;  3RZY A;  1OEJ A;  1RLB E;  4U8U O;  4DQ3 A;  1P6P A;  2AKQ A;  2LBV A;  4ORY A;  3B2H A;  4O4S A;  5AEO A;  3HWD A;  5IO5 A;  2X8T A;  3P6C A;  3FA9 A;  4M6S A;  4MVL A;  4TKH A;  1QY0 A;  5HA1 A;  3ZZV A;  2LBA A;  3FYF A;  1EII A;  4DQ4 A;  2K62 A;  1DFV A;  1ML7 A;  2JW1 A;  5K06 A;  1IKJ A;  2FRS A;  5HWZ A;  1KT7 A;  1YWB A;  2A3F X;  4AZQ A;  4FBO A;  4GH7 A;  4OMX A;  1DF3 A;  2WQA E;  2GTL O;  3LHN A;  2CBR A;  5HZ6 A;  2WSJ A;  4EXZ A;  2WUT A;  1E02 A;  3I17 A;  1T68 X;  3RBY A;  2N93 A;  5LJK A;  4ML7 B;  4I3B A;  2AT8 X;  2HZQ A;  5LJG A;  2KD2 A;  4PSQ A;  1DV9 A;  1UZ2 X;  2K23 A;  1IIU A;  1A57 A;  4LKP A;  1Y9T A;  1LNM A;  3FW4 A;  5AJB A;  4FQB B;  4O4U A;  3VG2 A;  3TGC A;  1B8E A;  2LFO A;  5FQ8 E;  2A2G A;  1SY1 A;  5HZQ A;  2JN3 A;  2L67 A;  2RA6 A;  1TW4 A;  3CMP A;  4IB6 A;  5EEE A;  1G5W A;  3RWX A;  3VPJ E;  3FR5 A;  1ZNH A;  4D6B A;  1QY2 A;  3SAO A;  2OVS A;  3GE2 A;  3UEX A;  4YKM A;  1T0V A;  4Y0Q A;  2LA7 A;  4CK4 A;  3KZA A;  4A8Z A;  1MUP A;  2F73 A;  4QQ1 A;  1OEE A;  2ASN X;  4R0B A;  5KIC A;  1DC9 A;  3OD9 A;  2QO4 A;  2O62 A;  1EIO A;  4YMY A;  4XMD A;  3E3C A;  1HBP A;  5F6B A;  4QGW A;  3CR6 A;  3O2Y A;  4AZR A;  5KHP A;  2NP1 A;  1GGL A;  1FEM A;  4M7M A;  4TJZ A;  4QGV A;  3CWK A;  4GNY A;  1I04 A;  1LID A;  1G85 A;  1JYD A;  5EPQ A;  1NGL A;  1RBP A;  3NP1 A;  3O22 A;  5B27 A;  3ZI8 A;  2POA A;  4YBU A;  4U3Q A;  2AH7 X;  1G7N A;  4ZHG A;  2QO6 A;  4ALB A;  1QWD A;  2FR2 A;  3T1D A;  3ZUI A;  3IFB A;  4NYQ A;  4MIR A;  4YCH A;  1QAB E;  3FEP A;  1BRQ A;  1PMP A;  1ICN A;  2KTS A;  1S44 A;  4ON1 A;  4Y0P A;  5H9L A;  1VYG A;  2AT3 X;  2MHD A;  3WJF A;  3P6E A;  4ZHD A;  1FE3 A;  3P02 A;  2WR6 A;  3FMZ A;  1X8Q A;  2RD7 C;  4HPB A;  4NLJ A;  1IKE A;  4L3R A;  3JQO A;  3BU1 A;  2FLJ A;  2EU7 X;  4IAX A;  1TVQ A;  4ORS A;  1MX8 A;  4ARH A;  3IA8 A;  1BRP A;  1BEB A;  2JMB A;  4GDZ A;  4HPC A;  5HTE A;  1DZP A;  4YFR A;  3UEV A;  3D95 A;  3WJD A;  3UEU A;  5EZ2 A;  2MM3 A;  2FWV A;  1Z24 A;  4MIS A;  3B2I A;  4WHI A;  2F09 A;  4YCE A;  4XMC A;  2MJI A;  4N7C A;  2OVA A;  5FEN A;  1OBP A;  2ACO A;  5BVQ A;  1JZU A;  1KGL A;  2X45 A;  2GJ5 A;  1U0X A;  2AT6 X;  2W2F A;  3EYC A;  1SA8 A;  3GAQ A;  4A1H A;  1URE A;  2NNQ A;  3KFI A;  2A0A A;  2R74 A;  1GXA A;  1MDC A;  1O1V A;  3CBC A;  3S5X A;  2AT0 X;  4COT A;  4KC7 A;  4RUN A;  3P6D A;  1CBS A;  4YBP A;  4ALO A;  4UU3 A;  4AZN A;  1X8U A;  2GTF X;  3BY0 A;  5HZ5 A;  4WBK A;  3WJE A;  1I06 A;  3ZW0 B;  1GX9 A;  4TKB A;  4O4X A;  3F6Z B;  2Q2M A;  1X8N A;  1S2P A;  2GC9 A;  1X71 A;  2GTL M;  1OPA A;  1D3S A;  2OVD A;  1SY0 A;  4I9S A;  3B2L A;  4KII A;  2ACP X;  3EMM A;  3ZW2 A;  4ES7 A;  3CBS A;  3C76 X;  3PH5 A;  1AQB A;  4HPD A;  5FAZ A;  1SXW A;  1A2D A;  3HTY A;  1PBO A;  1I05 A;  1A18 A;  3HWF A;  2BS6 A;  3P24 A;  4KCA A;  1CRB A;  1ZNG A;  4YDB A;  4ZGF A;  3WXQ A;  1KQW A;  4BOE A;  3AKN A;  3BX7 A;  3PEC A;  4EFG A;  4EQA C;  1MX7 A;  4O3X B;  3TGA A;  1DZJ A;  3V8U A;  1O8V A;  3PH6 A;  4JGL A;  5LKE A;  4O3Z A;  4WFV A;  3VG4 A;  1U18 A;  1FEN A;  3VG3 A;  4AYH A;  5FQ6 E;  1BLR A;  4YKO A;  4WFU A;  5EDC A;  1OBU A;  5HBS A;  1KOI A;  3STM X;  5C0N A;  3RKG A;  4YFQ A;  1EUO A;  1EPA A;  1IFB A;  2BLG A;  2KT4 B;  3ZQ3 A;  1YIV A;  5H9N A;  2A13 A;  5BYP A;  2FTB A;  4NNS A;  3ZW1 B;  4YH0 A;  4CSB A;  5LJB A;  2X46 A;  5HCC C;  4O3W A;  3U03 A;  3TF6 A;  2RN4 A;  3KFG A;  1NP1 A;  2X8S A;  4YFP A;  2Q2P A;  3ELZ A;  4YGG A;  3BS2 A;  3C77 X;  4TQ2 A;  1YUP A;  1BSY A;  4NW4 A;  3PED A;  4BQU A;  4GNW A;  3MBT A;  1KXO A;  1ICM A;  3D97 A;  1ERB A;  2AL0 X;  3EBW A;  3UAQ A;  5DG4 A;  4KH8 A;  1GT3 A;  2FS6 A;  4NNT A;  1HMR A;  3C78 X;  4NP1 A;  3F8A A;  3HOE A;  3U9P C;  5IO6 A;  2Z4I A;  3BDR A;  1DZK A;  3NAD A;  1JYJ A;  2OVE A;  3FR4 A;  1ZNL A;  3BSZ E;  4ZCB A;  2PY1 A;  4AW8 A;  2QMI A;  3NX2 A;  1H91 A;  2W2B A;  4RUU A;  3I0A A;  4TKJ A;  4NYR A;  3MX7 A;  4HPA A;  1PM1 X;  4IMO A;  4HFO A;  1JIW I;  3D4R A;  3PPT A;  4XME A;  5F7G A;  4GKC A;  3BX8 A;  3RSW A;  2FR3 A;  3ZW1 A;  3UEW A;  5BVS A;  4FBR A;  2OFR X;  4ORR A;  2XST A;  1JV4 A;  1VYF A;  1XCA A;  1Y9L A;  4U8U N;  4GK9 A;  1GKA B;  1HQP A;  3NQ3 A;  4I9R A;  2BHV A;  4EDE A;  1IW2 A;  1LIE A;  2R73 A;  3QKG A;  3VG7 A;  1OBQ A;  4EEJ A;  1EAL A;  1CBI A;  2BT9 A;  3LV4 A;  3TGB A;  1NP4 A;  2HZR A;  1BJ7 A;  1O1U A;  3EBK A;  2CM4 A;  2MWH A;  1JJX A;  1HBQ A;  1YWC A;  1HMS A;  1YWD A;  1XKI A;  4Y0S A;  5CYB A;  3S5V A;  4MVK A;  4OS8 A;  2Q39 A;  4YGH A;  4MVI A;  3STK A;  5HCD C;  1OPB A;  2FT9 A;  1SY2 A;  2W2A A;  3HK1 A;  3SOT A;  3WOV A;  3O19 A;  2BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...