4ZHFA

Siderocalin-mediated recognition and cellular uptake of actinides
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
177
Chain Sequence
b'DSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin-mediated recognition, sensitization, and cellular uptake of actinides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/inhibitor
total genus 40
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4zhfA00
3WJBA 5H9NA 2Q9SA 4RUNA 1QWDA 5HZQA 1U18A 1AELA 2Q2PA 1FDQA 2YG2A 4YCHA 3ZQ3A 1CBRA 3EBKA 1B56A 2GJ5A 4M6SA 3BU1A 1GKAB 1IKEA 1HMRA 1YWBA 2XSTA 4OMXA 4PSQA 3BDRA 3B2LA 1EIOA 1YIVA 1HQPA 1DFVA 1LNMA 2ANSA 1RBPA 1NP4A 1UZ2X 1NP1A 3FEKA 5IO7A 1LIDA 1PBOA 4IAWA 4AZOA 1EQDA 5LJCA 5HCDC 3FW4A 5IO6A 4IB9A 1OEJA 4QYNA 4D6AA 2QO5A 4ALOA 3UEWA 1B0OA 3PPTA 4ZGUA 1GM6A 4XMHA 1G74A 1G7NA 2R56A 4WFUA 2RCTA 1X8PA 3FR2A 1SXXA 5AQ6A 4ORRA 4TKHA 2OVAA 4OS8A 3KQ0A 2RCQA 3AKNA 4WFVA 1IFBA 3MBTA 4YBPA 1KXOA 1EALA 1EPBA 2MM3A 2BLGA 4HPDA 1ZNHA 5LJEA 2HNXA 2O62A 1DZPA 4BVMA 3U9PC 4O9SA 1VYGA 3FIQA 3FA9A 2POAA 5LJBA 2L5PA 1SA8A 3FENA 2KT4B 4AZPA 2RD7C 2WQAE 2W2FA 4ZFXA 1EW3A 4I9RA 1ML7A 5FAZA 1U0XA 1TW4A 1X8QA 2WUTA 2K62A 3VG2A 3VG3A 1GT5A 2A13A 2HYSA 4I3DA 3FR4A 4YKOA 5HCEC 1GT1A 2FRSA 1BM5A 2WSJA 1ICMA 2K23A 3NQ9A 3STMX 1ERXA 3F9DA 1BLRA 1MUPA 2ACOA 2HLVA 1E5PA 3APVA 1LICA 1VPRA 4Y0RA 3B2IA 3EBWA 1FELA 3P6CA 5F6BA 1HN2A 1EPAA 2FWVA 2MO5A 1OEKA 1YWAA 4ZH6A 2CZTA 5FFHA 5HZ8A 5D48A 5EEDA 4NLJA 2WEXA 5LKFA 1MVGA 3NP1A 5BVSA 5L8IA 3APUA 1G5WA 2R73A 4TKBA 3BLGA 5HAEA 2OVEA 3CBCA 5EPQA 1GX9A 5LJHA 1JJJA 4LKPA 2R74A 3ELXA 2LB6A 4EEJA 2CM4A 2G79A 3BX7A 3VG6A 2G7BA 3DTQA 2EU7X 3IA8A 1AVGI 3B2HA 1T0VA 5B29A 4TNNA 1BWYA 4ODDA 1I06A 2HMBA 1FTPA 4QGWA 4YKMA 4ZH9A 1IFCA 1IIUA 2GTFX 4ORYA 4ZHCA 1MX7A 2JU8A 3I0AA 4MVIA 4UU2A 1A2DA 4ZHFA 1ZRYA 4R0BA 1BBPA 5K06A 1IW2A 3U03A 2RA6A 1YWCA 3WJFA 4EDEA 2QM9A 2WWPA 3PH6A 1SXYA 2A2UA 5D4AA 1HMSA 3K3LA 4Y0QA 2NNEA 3HWDA 4Y0SA 4K19A 3JSQA 1O1UA 1GKAA 1ERBA 4ORSA 2FS7A 4YGZA 1P6PA 2WQ9A 4AZNA 5EZ2A 1ACDA 2JOZA 1O1VA 1KT4A 2CM9A 2ASNX 3UEVA 1YP6A 4NLIA 1E00A 4YGGA 4QGVA 4GKCA 1I05A 2G78A 3APXA 1A57A 5HBSA 1YWDA 1BRQA 4DQ3A 3UEUA 1X89A 3P6HA 3KFIA 2XKLA 1OBQA 3U0DA 3P6EA 3PECA 3TGAA 3VG5A 5HTEA 2QOSC 4XMDA 2HZRA 3PEDA 4ES7A 2OVDA 3CQRA 2N93A 5H8TA 3ZUOA 5HCCC 1ZNDA 3VG4A 1HMTA 2X46A 3FR5A 5C0NA 1BRPA 4LZUA 3B2KA 1D3SA 1X8UA 1PEEA 3WBGA 5JR8A 4OMWA 4YBUA 4GNYA 4ZHGA 1QG5A 3NPOA 4HPAA 4TKJA 3F8AA 1E06A 1GXAA 4A8ZA 3C76X 4QZTA 1QFTA 4YMYA 1Z24A 1S2PA 5H9KA 4TJZA 4I9SA 2FTBA 1B8EA 2AKQA 1PM1X 4MVKA 1ZNGA 1FE3A 1OBPA 3TGCA 2AMMX 5B27A 1PMPA 2Q4NA 5HTDA 5F58A 3DSZA 4AZRA 3NX1A 1TOUA 1LFOA 4IB7A 3TGBA 5DG4A 2AT8X 4KIIA 2FS6A 2A0AA 1NGLA 4N7DA 4XMGA 2WEWA 5KICA 3T1DA 2MJIA 4IBAA 1AB0A 1LIBA 4IMOA 4AW8A 3FA6A 4ZCBA 1GT4A 4NNTA 1SXUA 1L6MA 4ZHDA 4IB8A 3O2YA 4QAEA 1QQSA 3D95A 2JU7A 3D97A 3QKGA 3WJDA 3G7XA 3AKMA 3GAQA 1D2UA 4GNWA 1BEBA 2FR3A 3P6GA 1KT7A 1E02A 5D45A 4XMFA 5HZ6A 4A1YA 3PH5A 4EXZA 1MDCA 5KIDA 4GE1A 2LBVA 1YUPA 3RSWA 1KQXA 3HWGA 1GX8A 4ORWA 4QYPA 4YFRA 1DZMA 2A2GA 2OZQA 5KHPA 5HA1A 4ORXA 4ORUA 2E4JA 1GGLA 3BX8A 4M7MA 4BQUA 1DV9A 1JBHA 2L9CA 3ELZA 2HZQA 4OS0A 1I4UA 1EUOA 1GT3A 4UU3A 1LPJA 1S7DA 1OBUA 5D47A 4ARHA 4HPCA 2AT3X 4YGHA 1OEEA 2WR6A 1X8NA 5BVTA 1BSQA 1ZNLA 3WJCA 4YFPA 1KZWA 1HBPA 2QO6A 2JU3A 5DPQA 5F1EA 1EXSA 4ZHHA 1VYFA 1JYDA 1JV4A 3CQNA 1JZUA 1X8OA 2AT5X 5F7GA 3WVMA 1KT3A 3O19A 3IFBA 4YFQA 1R0UA 5EDBA 1JJXA 4XMEA 2CBRA 3RZYA 2AH7X 1O8VA 2LBAA 3FA8A 1N0SA 3APWA 3STNA 3STKA 1ALBA 3PP6A 5D8JA 3KZAA 2NP1A 4HFOA 1QFVA 3FW5A 3UEXA 1BJ7A 2KTDA 3ZUIA 3TZSA 4EFGA 1LF7A 2LKKA 1RLBE 3SAOA 5HA0A 4ZR2A 4GH7A 1B4MA 4OS3A 1DF3A 1TOWA 1CRBA 1FEMA 5FENA 3D96A 3CMPA 1CBQA 1DC9A 4IAXA 1SY2A 2ACPX 1KT6A 5EEEA 1OPBA 2Q39A 1SY1A 3EMMA 4IB6A 2FR2A 4GRJA 4YH0A 3BS2A 1T8VA 5IO5A 1XKIA 3BRNA 3HK1A 2OFRX 1X71A 1A18A 3JS1A 5F6ZA 1YP7A 2JN3A 4QGXA 3BY0A 1A3YA 2W2AA 4I3BA 4A1HA 4BOEA 1TVQA 1EIIA 1U17A 3L4RA 4RUUA 1QY2A 2ALLX 3WJEA 3HWFA 3P6FA 3Q6LA 2Q2MA 5LKEA 1BSOA 3OJYC 2RQ0A 2LFOA 5H9AA 4AZQA 1T68X 2IFBA 3B2JA 2AT0X 1DZKA 1IKJA 4LKTA 1ZNEA 1AQBA 3C77X 4I3CA 3CWKA 4YDBA 1KGLA 1ZNKA 5BVQA 2A3FX 3CR6A 3KFFA 4XMCA 1SY0A 1SY3A 5L8OA 2QO4A 5L8NA 3KFHA 3WXQA 2AT6X 1G85A 3MVFA 3WJGA 2CZUA 3BU9A 5LJGA 4A60A 1JYJA 1UREA 3EYCA 3O22A 4ALBA 1KOIA 1KT5A 2F73A 3NADA 4NYQA 5HWZA 1ICNA 2X45A 1TXLA 4WBKA 3FMZA 5LJDA 1KQWA 3FLLA 2OFMX 3KFGA 4Y0PA 2GC9A 4YDAA 4GETA 3I17A 4NNSA 1FENA 1QABE 2L67A 1OPAA 3FELA 4N7CA 1CJ5A 4TQ2A 4AYHA 1BSYA 1HBQA 2W2BA 2P8GA 4D6BA 5CE4A 3EM0A 3S26A 1CBSA 5LJKA 2FLJA 1CBIA 1MX8A 3P6DA 2PY1A 4ZJ0A 5HZ5A 1QY1A 2NNDA 1ADLA 4IMNA 1LIEA 1SXWA 5HZ9A 1S44A 1LIFA 3BSZE 4NYRA 2FT9A 5H9LA 1LKEA 4LZVA 3NX2A 2AL0X 4AZMA 1H91A 1QY0A 4YCEA 1I04A 3C78X 3TF6A 3HWEA 3FEPA 4QZUA 2L68A 3NQ3A 3NR3A 1XCAA 1KZXA 2CBSA 3FA7A 4CK4A 3CBSA 2DM5A 5EDCA 4MVLA 4TLJA 3VG7A 4HPBA 4NP1A 4DQ4A 1DZJA 2NNQA
chains in the Genus database with same CATH superfamily
3WJBA 1STPA 2KTSA 5H9NA 2Q9SA 4RUNA 1QWDA 5HZQA 3OE3A 4O4SA 3UAQA 1U18A 4ON1A 1AELA 2Q2PA 3QQ2A 1FDQA 2YG2A 4YCHA 3ZQ3A 1CBRA 4FBVA 1Y53X 1B56A 1RXHA 2GJ5A 2QMIA 3EBKA 5B11O 3PQUA 4M6SA 2A5BA 1GKAB 1IKEA 1HMRA 1YWBA 2IZEB 2XSTA 3BU1A 3BDRA 4OMXA 4GDAA 2OYBO 1STRB 3B2LA 3VE2A 4ID2A 1EIOA 1YIVA 2IZGB 4FBRA 1HQPA 1SWUA 4INNA 3EW2A 4HWMA 1DFVA 1LNMA 2ANSA 4BX7B 4CDDA 1RBPA 1NP4A 1UZ2X 1NP1A 2I5VO 3FEKA 3CKFA 5IO7A 1LIDA 1PBOA 4IAWA 1VWPB 4AZOA 4B55A 1EQDA 5LJCA 1N43A 5HCDC 4FBOA 5AEOA 4QNIA 3FW4A 4DCBA 2OF9A 5IO6A 4IB9A 2RTAA 1OEJA 2F01A 4BX5B 4QYNA 3RWXA 1GX3A 2QO5A 3RDMA 4D6AA 4ALOA 3UEWA 1VWIB 1B0OA 1SWKA 3PPTA 4ZGUA 3GE2A 1GM6A 4XMHA 1G74A 1G7NA 2LA7A 2R56A 1VWOB 4WFUA 2RCTA 4BX6B 1X8PA 3WZPA 3FR2A 1SXXA 5AQ6A 4ORRA 4TKHA 4EKVA 2OVAA 4OS8A 3KQ0A 1IJ8A 2RCQA 3AKNA 1IFBA 3MBTA 4WFVA 1KXOA 4YBPA 1EALA 5F6ZA 1EPBA 1SWPA 2RTNB 3T2WA 2MM3A 2BLGA 2G5LA 1ZNHA 3P24A 1WUBA 2HNXA 2O62A 4HPDA 3RDXA 5LJEA 1DF8A 1DZPA 4BVMA 3U9PC 1VWFB 4O9SA 1SWEA 1VYGA 3FIQA 3HOLA 2OF8A 3FA9A 1RXKA 2POAA 5LJBA 1MK5A 1SA8A 1SWQA 2KT4B 2L5PA 3FENA 4JO6A 4AZPA 1JJUA 1SREA 4C5PA 2RD7C 2WQAE 2W2FA 4ZFXA 1EW3A 3WYQA 1VWBB 2YMSA 4I9RA 1ML7A 5FAZA 1U0XA 1TW4A 5K67A 1X8QA 2WUTA 2K62A 3VG2A 3VG3A 1SWLA 4EQAC 1GT5A 1SRIA 2A13A 2HYSA 4I3DA 3FR4A 4YKOA 2IZHB 5HCEC 1GT1A 2GTLO 1Y0GA 1KFFA 2FRSA 2RTFB 2WSJA 1ICMA 2K23A 3NQ9A 3STMX 1ERXA 3F9DA 2HKDA 2UYWA 1BLRA 2IZFB 1MUPA 2ACOA 2HLVA 5HZ5A 1HQQA 1SWDA 1E5PA 4Z27A 3APVA 1LICA 4CDCA 2RTOB 4PSQA 1SWNA 1VPRA 2OY1O 4Y0RA 2RTLA 3B2IA 4CDEA 3EBWA 1FELA 3P6CA 5F6BA 1HN2A 3N91A 4LQZA 2RTIB 4GGTA 1EPAA 4MISA 1VWDB 1OEKA 2FWVA 1YWAA 2MO5A 4U46A 2OL7A 4ZH6A 3WZNA 2CZTA 2IZDB 5FFHA 5HZ8A 5D48A 5EEDA 1SWCA 4NLJA 2RTQB 2WEXA 5LKFA 3ZW1A 4O4XA 3RDSA 1MVGA 1SRJA 2M4LA 3NP1A 5BVSA 4GJSA 5L8IA 3NQKA 3APUA 3CKGA 2ZAIA 1G5WA 4Y59A 2R73A 4TKBA 3BLGA 1SLGB 5HAEA 4Z28A 3WOVA 2Y3EA 5IXGA 2I5ZO 2OVEA 2X4MA 3CBCA 5EPQA 1GX9A 4I95A 5LJHA 1JJJA 4LKPA 4ML7B 2R74A 2ZAGA 3ELXA 2LB6A 4EEJA 3LTWA 2CM4A 2G79A 3BX7A 3VG6A 2G7BA 3DTQA 2IZCB 2EU7X 1LUQA 3IA8A 1AVGI 3B2HA 1PBYA 2RTHB 1T0VA 5B29A 4TNNA 3RY2A 4ODDA 1BWYA 1I06A 2HMBA 4OKAA 1FTPA 4QGWA 4YKMA 4ZH9A 1IFCA 1IIUA 1KL5A 2FHLA 2GTFX 2JW1A 2IZBA 4ORYA 4U8UO 4ZHCA 1MX7A 1NDJA 4WHIA 2JU8A 3I0AA 1RSUB 4MVIA 2OY8A 1A2DA 4UU2A 5AJCA 3VU1A 1ZRYA 4R0BA 1BBPA 2BS6A 2UZ2A 4ZHFA 1IW2A 5K06A 3U03A 2RA6A 1YWCA 3WJFA 4EDEA 3RDUA 2QM9A 2WWPA 3PH6A 3ZWEA 1SXYA 2A2UA 3NBXX 1VWHB 2IZAA 1Y55X 5D4AA 1HMSA 3K3LA 3VHMA 5IRWA 4Y0QA 2IZJA 2NNEA 3HWDA 1VYOA 2X8FA 4Y0SA 4K19A 4BBOA 1SWHA 2X32A 2Z4HA 1O1UA 3JSQA 1GKAA 1ERBA 2AVIA 1I78A 3PDFA 4ORSA 5CYBA 2FS7A 4YGZA 1P6PA 4COTA 1W5RA 2WQ9A 4AZNA 5EZ2A 1OSPO 4BX7A 2F09A 2RTRB 1ACDA 2JOZA 2X8SA 1O1VA 1KT4A 2CM9A 2ZSCA 2ASNX 4BCSA 3UEVA 4OEMA 4Z6JA 1RSTB 1YP6A 2MWHA 1E00A 4NLIA 1SWTA 2OFBA 4YGGA 3WZQA 4QGVA 4GGRA 1JMZA 4GKCA 1I05A 2G78A 3APXA 4ZGFA 1A57A 4GUZA 1YWDA 2Z4IA 1BRQA 2BT9A 5HBSA 4DQ3A 3UEUA 1SWJA 1JIWI 3SOTA 1X89A 3FYFA 3P6HA 3RBYA 3KFIA 3PK2A 4O3XB 2XKLA 1OBQA 3U0DA 3P6EA 3PECA 3TGAA 3VG5A 4U3QA 5HTEA 4BX6A 2QOSC 4XMDA 4Z2VA 2HZRA 3PEDA 4GZVA 4ES7A 4QQ1A 2OVDA 3VPJE 2RN4A 3CQRA 2N93A 5H8TA 3ZUOA 5HCCC 1ZNDA 3VG4A 1HMTA 2X46A 2DJGA 3FR5A 5C0NA 1BRPA 4U8UN 4LZUA 3SZIA 3B2KA 1D3SA 1X8UA 2VFBA 2BS5A 3OD9A 1NQNA 4FGIB 1PEEA 3WBGA 5JR8A 4OMWA 1MOYA 4YBUA 4GNYA 5B10O 4CPEA 4ZHGA 1QG5A 3NPOA 4HPAA 4TKJA 2OL6O 2BSZA 2C1QA 1E06A 1VWNB 3F8AA 1GXAA 5B2AO 4A8ZA 3C76X 2C1SA 4QZTA 1QFTA 4PJ2A 4YMYA 1Z24A 1E2TA 1S2PA 5H9KA 2OY5O 2FKJA 4TJZA 4I9SA 4O3YA 4GJVA 1B8EA 2AKQA 2FTBA 1PM1X 4MVKA 1ZNGA 1FE3A 1OBPA 3JQOA 3TGCA 2AMMX 5B27A 1PMPA 2Q4NA 5HTDA 5F58A 3DSZA 1LCWA 4AZRA 5CHKA 5FQ6E 3NX1A 4CPFA 1TOUA 1LFOA 1Y52X 4IB7A 3TGBA 2RTGB 5DG4A 1W4TA 2AT8X 2FS6A 4KIIA 2A0AA 4YVBA 2VFCA 1NGLA 4N7DA 4XMGA 2WEWA 3S5XA 5KICA 3T1DA 2MJIA 5F2BA 4IBAA 1AB0A 1LIBA 4IMOA 1VWLB 4AW8A 3FA6A 2WPUA 1GT4A 4ZCBA 4NNTA 5B3MO 4Z2OA 1SXUA 1L6MA 4ZHDA 4IB8A 3O2YA 4QAEA 1QQSA 3D95A 2JU7A 3EC5A 3D97A 3QKGA 3ZZVA 3RDOA 1VWEB 3AKMA 3G7XA 3GAQA 3KVNA 3Q34A 3WJDA 1VWQB 1D2UA 4GNWA 1BEBA 2FR3A 2RTEB 3P6GA 1JMXA 3SLJA 1KT7A 5BYPA 1E02A 5D45A 1SLFB 4XMFA 1K3BA 1N9MA 4A1YA 5HZ6A 3PH5A 1LELA 4EXZA 1MDCA 5KIDA 1SLDB 4GE1A 2LBVA 2JMBA 1YUPA 2RTCB 1VWRB 3RSWA 1KQXA 3HWGA 1GX8A 4ORWA 3H3IA 4QYPA 4CPHB 1RAVA 3LHNA 4JNJA 4YFRA 1DZMA 2A2GA 2OZQA 3P02A 5HA1A 5KHPA 1STSB 4ORXA 4ORUA 3T2XA 1NBXA 2E4JA 1GGLA 5L3YA 3BX8A 4M7MA 4BQUA 1DV9A 1JBHA 2L9CA 3ELZA 2HZQA 2IZIA 3S60A 3RDQA 4OS0A 2QCBA 1I4UA 1EUOA 2FGSA 1MEPA 2RTPB 4NW4A 1GT3A 4UU3A 5AJBA 1SRFA 1VWAB 2GH7A 1LPJA 2GTLN 1S7DA 1OBUA 1SWFA 5D47A 1MM9A 4HPCA 3ZW0B 3SZHA 4ARHA 2AT3X 3X00A 4YGHA 2A8GA 1OEEA 2WR6A 2OVSA 2X55A 3ZI8A 1X8NA 5BVTA 1BSQA 5JD2A 1ZNLA 4IABA 4YFPA 3T6LA 3WJCA 1HBPA 2QO6A 2JU3A 1KZWA 5DPQA 5F1EA 1HY2A 1VWJB 1EXSA 4O3WA 4ZHHA 3OBLA 3D4RA 1VYFA 1JYDA 1JV4A 3CQNA 1JZUA 1X8OA 2AT5X 5F7GA 3WVMA 1KT3A 3O19A 3IFBA 4YFQA 1R0UA 5EDBA 2C4IA 4O4UA 1JJXA 4XMEA 4CV7A 2CBRA 5CSEA 3RZYA 1SWRA 2AH7X 1O8VA 2LBAA 1EI5A 1SMPI 1VWCB 3HTYA 1HXLA 2DJFA 5FQ8E 3FA8A 2QOMA 1N0SA 3APWA 3STNA 3STKA 1ALBA 3PP6A 1LCVA 2CAMA 4GGZA 3KZAA 5D8JA 2X8TA 2NP1A 4HFOA 1QFVA 3FW5A 3UEXA 1BJ7A 2KTDA 3RKGA 3ZUIA 3TZSA 4EFGA 1LF7A 2LKKA 1RLBE 1Y9TA 2X56A 3LV4A 1N9YA 5K68A 3SAOA 4BX5A 5HA0A 4ZR2A 4GU8A 2GTLM 1JQPA 4GH7A 1K24A 1B4MA 4KT5A 4OS3A 2RTMA 1TOWA 4BGFA 1CRBA 1FEMA 5FENA 1DF3A 3D96A 3HPEA 3CMPA 1CBQA 1DC9A 4GD9A 3RE6A 4IAXA 1SY2A 2ACPX 1KT6A 5EEEA 1OPBA 2Q39A 1SY1A 3EMMA 4IB6A 3RE5A 2FR2A 2RTBB 4GRJA 4I60A 5FQ7E 4MEEA 4YH0A 3BS2A 1T8VA 5IO5A 1XKIA 3BRNA 3HK1A 2OFRX 1X71A 1A18A 2IZKA 1LCZA 1YP7A 2JN3A 2FHNX 2KW1A 3JS1A 2MF6A 1AVEA 3BY0A 3E3CA 4QGXA 1A3YA 1RXJA 2W2AA 4I3BA 4KH8A 4A1HA 1TVQA 4BOEA 1U17A 1LDQA 3L4RA 4RUUA 1QY2A 1EIIA 2ALLX 2X34A 3WJEA 5B5GA 4NV7A 3HWFA 3P6FA 1VWKB 3Q6LA 3AEHA 2Q2MA 5LKEA 2VDFA 1HXZA 1BSOA 3MG5A 3OJYC 1FJ1E 2RQ0A 4QRLA 2LFOA 3HOEA 4KC8A 3PQSA 5H9AA 4JHQA 1T68X 4AZQA 4Z2PA 3FDCA 2G8CO 2IFBA 3B2JA 4Y5DA 2AT0X 4NV8A 1DZKA 4DNEA 1IKJA 1SLEB 4LKTA 4OELA 1ZNEA 3VHIA 1AQBA 3C77X 4I3CA 1UYNX 2PI3O 3CWKA 4YDBA 4CDFA 1KGLA 1ZNKA 5BVQA 2A3FX 3CR6A 3KFFA 4XMCA 3VGWA 1SY0A 1SY3A 5L8OA 4U8UM 2QO4A 5L8NA 4O4OA 3KFHA 4U9CA 3WXQA 2AT6X 3VHHA 1G85A 2OL8O 3MVFA 3WJGA 2CZUA 2FKGA 5IRUA 3BU9A 2MHDA 5LJGA 4A60A 1JYJA 1UREA 3EYCA 3O22A 4ALBA 3SZJA 2Y3FA 4L3RA 1KOIA 1KT5A 2F73A 3SLOA 3F6ZB 3NADA 4I6SA 2RTJA 4NYQA 3SLTA 5B5FA 1PTSA 5HWZA 4GK9A 1ICNA 2X45A 1TXLA 1UYOX 2AF5A 4WBKA 2OY7A 3FMZA 5LJDA 1KQWA 2JGSA 3FLLA 2OFMX 3KFGA 1SWOA 1KL3A 4Y0PA 1SWBA 2GC9A 4YDAA 1N7YA 4GETA 4CPHA 3I17A 4NNSA 4KCAA 1BM5A 1FENA 1QABE 3MM0A 1WBIA 1VWGB 2KD2A 1SWAA 1SWSA 2L67A 3VE1A 4L1NA 4CPIA 1SRHA 3WYPA 1OPAA 3FELA 2BHVA 4N7CA 1CJ5A 3RY1A 4TQ2A 4AYHA 1BSYA 1HBQA 1NC9A 2W2BA 1KL4A 2P8GA 3ZW1B 4D6BA 5CE4A 3EM0A 3S26A 1CBSA 5LJKA 2FLJA 1CBIA 1MX8A 3FIDA 3P6DA 2PY1A 4O49A 3MX7A 3ZW2A 3WZOA 4JGLA 1QY1A 1LDOA 1W6FA 3ZW0A 4ZJ0A 2RTKA 2BC3A 2NNDA 4O3ZA 1ADLA 4MIRA 1Y9LA 1AVDA 4IMNA 4FQBB 4MVEA 1SWGA 1LIEA 4IRWA 1SXWA 5HZ9A 1S44A 1LIFA 3BSZE 2A5CA 2FT9A 4NYRA 5H9LA 1LKEA 4LZVA 3NX2A 2AL0X 4AZMA 1H91A 1QY0A 3AUMO 4YCEA 1I9HA 1I04A 3C78X 4GDZA 1N4JA 1SRGA 3TF6A 3HWEA 3EW1A 3FEPA 4QZUA 2L68A 3S5VA 3D9WA 2Y32A 3NQ3A 3NR3A 1XCAA 1VWMB 2CBSA 1KZXA 3FA7A 3V8UA 4CK4A 3CBSA 2DM5A 4KC7A 5EDCA 5IRAA 4MVLA 4TLJA 3VG7A 4CSBA 2OFAA 1NQMA 2IZLB 2RTDB 4HPBA 4NP1A 4BJ8A 3T6FA 4DQ4A 1DZJA 2NNQA
chains in the Genus database with same CATH topology
3WJBA 2KTSA 5H9NA 2Q9SA 4RUNA 1QWDA 5HZQA 3OE3A 4O4SA 3UAQA 1U18A 4ON1A 1AELA 2Q2PA 1FDQA 2YG2A 4YCHA 3ZQ3A 1CBRA 4FBVA 3EBKA 1B56A 2GJ5A 2QMIA 3PQUA 4M6SA 3BU1A 1GKAB 1IKEA 1HMRA 1YWBA 2XSTA 4OMXA 4PSQA 3BDRA 3B2LA 3VE2A 4ID2A 1EIOA 1YIVA 4FBRA 1HQPA 4INNA 4HWMA 1DFVA 1LNMA 2ANSA 1RBPA 1NP4A 1UZ2X 1NP1A 3FEKA 5IO7A 1LIDA 1PBOA 4IAWA 4AZOA 1EQDA 5LJCA 5HCDC 4FBOA 5AEOA 4QNIA 3FW4A 5IO6A 4IB9A 1OEJA 4QYNA 3RWXA 2QO5A 4D6AA 4ALOA 3UEWA 1B0OA 3PPTA 4ZGUA 3GE2A 1GM6A 4XMHA 1G74A 1G7NA 2LA7A 2R56A 4WFUA 2RCTA 1X8PA 3FR2A 1SXXA 5AQ6A 4ORRA 4TKHA 2OVAA 4OS8A 3KQ0A 2RCQA 3AKNA 4WFVA 1IFBA 3MBTA 4YBPA 1KXOA 1EALA 1EPBA 2MM3A 2BLGA 4HPDA 1ZNHA 3P24A 5LJEA 2HNXA 2O62A 1DZPA 4BVMA 3U9PC 4O9SA 1VYGA 3FIQA 3HOLA 3FA9A 2POAA 5LJBA 2L5PA 1SA8A 3FENA 2KT4B 4AZPA 2RD7C 2WQAE 2W2FA 4ZFXA 1EW3A 2YMSA 4I9RA 1ML7A 5FAZA 1U0XA 1TW4A 1X8QA 2WUTA 2K62A 3VG2A 3VG3A 4EQAC 1GT5A 2A13A 2HYSA 4I3DA 3FR4A 4YKOA 5HCEC 1GT1A 2GTLO 2FRSA 1BM5A 2WSJA 1ICMA 2K23A 3NQ9A 3STMX 1ERXA 3F9DA 1BLRA 1MUPA 2ACOA 2HLVA 1E5PA 3APVA 1LICA 1VPRA 4Y0RA 3B2IA 3EBWA 1FELA 3P6CA 5F6BA 1HN2A 3N91A 4LQZA 1EPAA 4MISA 2FWVA 2MO5A 1OEKA 1YWAA 4ZH6A 2CZTA 5FFHA 5HZ8A 5D48A 5EEDA 4NLJA 3ZW1A 2WEXA 5LKFA 4O4XA 1MVGA 2M4LA 3NP1A 5BVSA 5L8IA 3NQKA 3APUA 2ZAIA 1G5WA 2R73A 4TKBA 3BLGA 5HAEA 3WOVA 2OVEA 3CBCA 5EPQA 1GX9A 4I95A 5LJHA 1JJJA 4LKPA 4ML7B 2R74A 2ZAGA 3ELXA 2LB6A 4EEJA 2CM4A 2G79A 3BX7A 3VG6A 2G7BA 3DTQA 2EU7X 3IA8A 1AVGI 3B2HA 1T0VA 5B29A 4TNNA 1BWYA 4ODDA 1I06A 2HMBA 1FTPA 4QGWA 4YKMA 4ZH9A 1IFCA 1IIUA 2GTFX 2JW1A 4ORYA 4U8UO 4ZHCA 1MX7A 4WHIA 2JU8A 3I0AA 4MVIA 5AJCA 4UU2A 1A2DA 3VU1A 4ZHFA 1ZRYA 4R0BA 1BBPA 2BS6A 5K06A 1IW2A 3U03A 2RA6A 1YWCA 3WJFA 4EDEA 2QM9A 2WWPA 3PH6A 3ZWEA 1SXYA 2A2UA 3NBXX 5D4AA 1HMSA 3K3LA 4Y0QA 2NNEA 3HWDA 4Y0SA 2X8FA 4K19A 3JSQA 2Z4HA 1O1UA 1GKAA 1ERBA 4ORSA 5CYBA 2FS7A 4YGZA 1P6PA 4COTA 2WQ9A 4AZNA 5EZ2A 2F09A 1ACDA 2JOZA 2X8SA 1O1VA 1KT4A 2CM9A 2ASNX 3UEVA 2MWHA 1YP6A 4NLIA 1E00A 4YGGA 4QGVA 4GKCA 1I05A 2G78A 3APXA 4ZGFA 1A57A 5HBSA 1YWDA 2Z4IA 1BRQA 2BT9A 4DQ3A 3UEUA 3SOTA 1JIWI 1X89A 3FYFA 3P6HA 3RBYA 3KFIA 4O3XB 2XKLA 1OBQA 3U0DA 3P6EA 3PECA 3TGAA 3VG5A 4U3QA 5HTEA 2QOSC 4XMDA 2HZRA 3PEDA 4GZVA 4ES7A 4QQ1A 2OVDA 3VPJE 2RN4A 3CQRA 2N93A 5H8TA 3ZUOA 5HCCC 1ZNDA 3VG4A 1HMTA 2X46A 3FR5A 5C0NA 1BRPA 4U8UN 4LZUA 3B2KA 1D3SA 1X8UA 3OD9A 2BS5A 4FGIB 1PEEA 3ZW2A 3WBGA 5JR8A 4OMWA 4YBUA 4GNYA 4ZHGA 1QG5A 3NPOA 4HPAA 4TKJA 3F8AA 1E06A 1GXAA 4A8ZA 3C76X 4QZTA 1QFTA 4PJ2A 4YMYA 1Z24A 1S2PA 5H9KA 4TJZA 4I9SA 4O3YA 2FTBA 1B8EA 2AKQA 1PM1X 4MVKA 1ZNGA 1FE3A 1OBPA 3JQOA 3TGCA 2AMMX 5B27A 1PMPA 2Q4NA 5HTDA 5F58A 3DSZA 4AZRA 5FQ6E 3NX1A 1TOUA 1LFOA 4IB7A 3TGBA 5DG4A 2AT8X 4KIIA 2FS6A 2A0AA 1NGLA 4N7DA 4XMGA 2WEWA 3S5XA 5KICA 3T1DA 2MJIA 4IBAA 1AB0A 1LIBA 4IMOA 4AW8A 3FA6A 4ZCBA 1GT4A 4NNTA 1SXUA 1L6MA 4ZHDA 4IB8A 3O2YA 4QAEA 1QQSA 3D95A 2JU7A 3D97A 3QKGA 3ZZVA 3WJDA 3G7XA 3AKMA 3GAQA 1D2UA 4GNWA 1BEBA 2FR3A 3P6GA 5BYPA 1KT7A 1E02A 5D45A 4XMFA 5HZ6A 4A1YA 3PH5A 4EXZA 1MDCA 5KIDA 4GE1A 2LBVA 2JMBA 1YUPA 3RSWA 1KQXA 3HWGA 1GX8A 4ORWA 3H3IA 4QYPA 3LHNA 4YFRA 1DZMA 2A2GA 2OZQA 3P02A 5HA1A 5KHPA 4ORXA 4ORUA 2E4JA 1GGLA 3BX8A 4M7MA 4BQUA 1DV9A 1JBHA 2L9CA 3ELZA 2HZQA 3S60A 4OS0A 1I4UA 1EUOA 4NW4A 1GT3A 4UU3A 5AJBA 1LPJA 2GTLN 1S7DA 1OBUA 5D47A 3ZW0B 4ARHA 4HPCA 2AT3X 4YGHA 1OEEA 2WR6A 2OVSA 3ZI8A 1X8NA 5BVTA 1BSQA 1ZNLA 4IABA 4YFPA 3WJCA 1KZWA 1HBPA 2QO6A 2JU3A 5DPQA 5F1EA 1EXSA 4O3WA 4ZHHA 3OBLA 3D4RA 1VYFA 1JYDA 1JV4A 3CQNA 1JZUA 1X8OA 2AT5X 5F7GA 3WVMA 1KT3A 3O19A 3IFBA 4YFQA 1R0UA 5EDBA 4O4UA 1JJXA 4XMEA 4CV7A 2CBRA 3RZYA 2AH7X 1O8VA 2LBAA 1EI5A 1SMPI 3HTYA 5FQ8E 3FA8A 1N0SA 3APWA 3STNA 3STKA 1ALBA 3PP6A 5D8JA 3KZAA 2X8TA 2NP1A 4HFOA 1QFVA 3FW5A 3UEXA 1BJ7A 2KTDA 3RKGA 3ZUIA 3TZSA 4EFGA 1LF7A 2LKKA 1RLBE 1Y9TA 3LV4A 3SAOA 5HA0A 4ZR2A 4GU8A 2GTLM 4GH7A 1B4MA 4KT5A 4OS3A 1DF3A 1TOWA 1CRBA 1FEMA 5FENA 3D96A 3CMPA 1CBQA 1DC9A 4IAXA 1SY2A 2ACPX 1KT6A 5EEEA 1OPBA 2Q39A 1SY1A 3EMMA 4IB6A 2FR2A 4GRJA 5FQ7E 4YH0A 3BS2A 1T8VA 5IO5A 1XKIA 3BRNA 3HK1A 2OFRX 1X71A 1A18A 3JS1A 5F6ZA 1YP7A 2JN3A 2KW1A 4QGXA 3BY0A 3E3CA 1A3YA 2W2AA 4I3BA 4KH8A 4A1HA 4BOEA 1TVQA 1EIIA 1U17A 3L4RA 4RUUA 1QY2A 2ALLX 3WJEA 3HWFA 3P6FA 3Q6LA 2Q2MA 5LKEA 1BSOA 3OJYC 2RQ0A 4QRLA 2LFOA 3HOEA 4KC8A 3PQSA 5H9AA 4AZQA 1T68X 2IFBA 3B2JA 2AT0X 1DZKA 1IKJA 4LKTA 1ZNEA 1AQBA 3C77X 4I3CA 3CWKA 4YDBA 1KGLA 1ZNKA 5BVQA 2A3FX 3CR6A 3KFFA 4XMCA 1SY0A 1SY3A 5L8OA 4U8UM 2QO4A 5L8NA 4O4OA 3KFHA 4U9CA 3WXQA 2AT6X 1G85A 3MVFA 3WJGA 2CZUA 3BU9A 2MHDA 5LJGA 4A60A 1JYJA 1UREA 3EYCA 3O22A 4ALBA 4L3RA 1KOIA 1KT5A 2F73A 3F6ZB 3NADA 4I6SA 4NYQA 5HWZA 4GK9A 1ICNA 2X45A 1TXLA 4WBKA 3FMZA 5LJDA 1KQWA 3FLLA 2OFMX 3KFGA 4Y0PA 2GC9A 4YDAA 4GETA 3I17A 4NNSA 4KCAA 1FENA 1QABE 2L67A 2KD2A 3VE1A 4L1NA 1OPAA 3FELA 2BHVA 4N7CA 1CJ5A 4TQ2A 4AYHA 1BSYA 1HBQA 2W2BA 2P8GA 3ZW1B 4D6BA 5CE4A 3EM0A 3S26A 1CBSA 5LJKA 2FLJA 1CBIA 1MX8A 3P6DA 4O49A 2PY1A 4ZJ0A 3MX7A 5HZ5A 4JGLA 1QY1A 3ZW0A 4O3ZA 2NNDA 1ADLA 4MIRA 1Y9LA 4IMNA 4FQBB 4MVEA 1LIEA 1SXWA 5HZ9A 1S44A 1LIFA 3BSZE 4NYRA 2FT9A 5H9LA 1LKEA 4LZVA 3NX2A 2AL0X 4AZMA 1H91A 1QY0A 4YCEA 1I04A 3C78X 4GDZA 3TF6A 3HWEA 3FEPA 4QZUA 2L68A 3S5VA 3NQ3A 3NR3A 1XCAA 1KZXA 2CBSA 3FA7A 3V8UA 4CK4A 3CBSA 2DM5A 4KC7A 5EDCA 4MVLA 4TLJA 3VG7A 4CSBA 4HPBA 4NP1A 4DQ4A 1DZJA 2NNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJB A;  5H9N A;  2Q9S A;  4RUN A;  1QWD A;  5HZQ A;  1U18 A;  1AEL A;  2Q2P A;  1FDQ A;  2YG2 A;  4YCH A;  3ZQ3 A;  1CBR A;  3EBK A;  1B56 A;  2GJ5 A;  4M6S A;  3BU1 A;  1GKA B;  1IKE A;  1HMR A;  1YWB A;  2XST A;  4OMX A;  4PSQ A;  3BDR A;  3B2L A;  1EIO A;  1YIV A;  1HQP A;  1DFV A;  1LNM A;  2ANS A;  1RBP A;  1NP4 A;  1UZ2 X;  1NP1 A;  3FEK A;  5IO7 A;  1LID A;  1PBO A;  4IAW A;  4AZO A;  1EQD A;  5LJC A;  5HCD C;  3FW4 A;  5IO6 A;  4IB9 A;  1OEJ A;  4QYN A;  4D6A A;  2QO5 A;  4ALO A;  3UEW A;  1B0O A;  3PPT A;  4ZGU A;  1GM6 A;  4XMH A;  1G74 A;  1G7N A;  2R56 A;  4WFU A;  2RCT A;  1X8P A;  3FR2 A;  1SXX A;  5AQ6 A;  4ORR A;  4TKH A;  2OVA A;  4OS8 A;  3KQ0 A;  2RCQ A;  3AKN A;  4WFV A;  1IFB A;  3MBT A;  4YBP A;  1KXO A;  1EAL A;  1EPB A;  2MM3 A;  2BLG A;  4HPD A;  1ZNH A;  5LJE A;  2HNX A;  2O62 A;  1DZP A;  4BVM A;  3U9P C;  4O9S A;  1VYG A;  3FIQ A;  3FA9 A;  2POA A;  5LJB A;  2L5P A;  1SA8 A;  3FEN A;  2KT4 B;  4AZP A;  2RD7 C;  2WQA E;  2W2F A;  4ZFX A;  1EW3 A;  4I9R A;  1ML7 A;  5FAZ A;  1U0X A;  1TW4 A;  1X8Q A;  2WUT A;  2K62 A;  3VG2 A;  3VG3 A;  1GT5 A;  2A13 A;  2HYS A;  4I3D A;  3FR4 A;  4YKO A;  5HCE C;  1GT1 A;  2FRS A;  1BM5 A;  2WSJ A;  1ICM A;  2K23 A;  3NQ9 A;  3STM X;  1ERX A;  3F9D A;  1BLR A;  1MUP A;  2ACO A;  2HLV A;  1E5P A;  3APV A;  1LIC A;  1VPR A;  4Y0R A;  3B2I A;  3EBW A;  1FEL A;  3P6C A;  5F6B A;  1HN2 A;  1EPA A;  2FWV A;  2MO5 A;  1OEK A;  1YWA A;  4ZH6 A;  2CZT A;  5FFH A;  5HZ8 A;  5D48 A;  5EED A;  4NLJ A;  2WEX A;  5LKF A;  1MVG A;  3NP1 A;  5BVS A;  5L8I A;  3APU A;  1G5W A;  2R73 A;  4TKB A;  3BLG A;  5HAE A;  2OVE A;  3CBC A;  5EPQ A;  1GX9 A;  5LJH A;  1JJJ A;  4LKP A;  2R74 A;  3ELX A;  2LB6 A;  4EEJ A;  2CM4 A;  2G79 A;  3BX7 A;  3VG6 A;  2G7B A;  3DTQ A;  2EU7 X;  3IA8 A;  1AVG I;  3B2H A;  1T0V A;  5B29 A;  4TNN A;  1BWY A;  4ODD A;  1I06 A;  2HMB A;  1FTP A;  4QGW A;  4YKM A;  4ZH9 A;  1IFC A;  1IIU A;  2GTF X;  4ORY A;  4ZHC A;  1MX7 A;  2JU8 A;  3I0A A;  4MVI A;  4UU2 A;  1A2D A;  4ZHF A;  1ZRY A;  4R0B A;  1BBP A;  5K06 A;  1IW2 A;  3U03 A;  2RA6 A;  1YWC A;  3WJF A;  4EDE A;  2QM9 A;  2WWP A;  3PH6 A;  1SXY A;  2A2U A;  5D4A A;  1HMS A;  3K3L A;  4Y0Q A;  2NNE A;  3HWD A;  4Y0S A;  4K19 A;  3JSQ A;  1O1U A;  1GKA A;  1ERB A;  4ORS A;  2FS7 A;  4YGZ A;  1P6P A;  2WQ9 A;  4AZN A;  5EZ2 A;  1ACD A;  2JOZ A;  1O1V A;  1KT4 A;  2CM9 A;  2ASN X;  3UEV A;  1YP6 A;  4NLI A;  1E00 A;  4YGG A;  4QGV A;  4GKC A;  1I05 A;  2G78 A;  3APX A;  1A57 A;  5HBS A;  1YWD A;  1BRQ A;  4DQ3 A;  3UEU A;  1X89 A;  3P6H A;  3KFI A;  2XKL A;  1OBQ A;  3U0D A;  3P6E A;  3PEC A;  3TGA A;  3VG5 A;  5HTE A;  2QOS C;  4XMD A;  2HZR A;  3PED A;  4ES7 A;  2OVD A;  3CQR A;  2N93 A;  5H8T A;  3ZUO A;  5HCC C;  1ZND A;  3VG4 A;  1HMT A;  2X46 A;  3FR5 A;  5C0N A;  1BRP A;  4LZU A;  3B2K A;  1D3S A;  1X8U A;  1PEE A;  3WBG A;  5JR8 A;  4OMW A;  4YBU A;  4GNY A;  4ZHG A;  1QG5 A;  3NPO A;  4HPA A;  4TKJ A;  3F8A A;  1E06 A;  1GXA A;  4A8Z A;  3C76 X;  4QZT A;  1QFT A;  4YMY A;  1Z24 A;  1S2P A;  5H9K A;  4TJZ A;  4I9S A;  2FTB A;  1B8E A;  2AKQ A;  1PM1 X;  4MVK A;  1ZNG A;  1FE3 A;  1OBP A;  3TGC A;  2AMM X;  5B27 A;  1PMP A;  2Q4N A;  5HTD A;  5F58 A;  3DSZ A;  4AZR A;  3NX1 A;  1TOU A;  1LFO A;  4IB7 A;  3TGB A;  5DG4 A;  2AT8 X;  4KII A;  2FS6 A;  2A0A A;  1NGL A;  4N7D A;  4XMG A;  2WEW A;  5KIC A;  3T1D A;  2MJI A;  4IBA A;  1AB0 A;  1LIB A;  4IMO A;  4AW8 A;  3FA6 A;  4ZCB A;  1GT4 A;  4NNT A;  1SXU A;  1L6M A;  4ZHD A;  4IB8 A;  3O2Y A;  4QAE A;  1QQS A;  3D95 A;  2JU7 A;  3D97 A;  3QKG A;  3WJD A;  3G7X A;  3AKM A;  3GAQ A;  1D2U A;  4GNW A;  1BEB A;  2FR3 A;  3P6G A;  1KT7 A;  1E02 A;  5D45 A;  4XMF A;  5HZ6 A;  4A1Y A;  3PH5 A;  4EXZ A;  1MDC A;  5KID A;  4GE1 A;  2LBV A;  1YUP A;  3RSW A;  1KQX A;  3HWG A;  1GX8 A;  4ORW A;  4QYP A;  4YFR A;  1DZM A;  2A2G A;  2OZQ A;  5KHP A;  5HA1 A;  4ORX A;  4ORU A;  2E4J A;  1GGL A;  3BX8 A;  4M7M A;  4BQU A;  1DV9 A;  1JBH A;  2L9C A;  3ELZ A;  2HZQ A;  4OS0 A;  1I4U A;  1EUO A;  1GT3 A;  4UU3 A;  1LPJ A;  1S7D A;  1OBU A;  5D47 A;  4ARH A;  4HPC A;  2AT3 X;  4YGH A;  1OEE A;  2WR6 A;  1X8N A;  5BVT A;  1BSQ A;  1ZNL A;  3WJC A;  4YFP A;  1KZW A;  1HBP A;  2QO6 A;  2JU3 A;  5DPQ A;  5F1E A;  1EXS A;  4ZHH A;  1VYF A;  1JYD A;  1JV4 A;  3CQN A;  1JZU A;  1X8O A;  2AT5 X;  5F7G A;  3WVM A;  1KT3 A;  3O19 A;  3IFB A;  4YFQ A;  1R0U A;  5EDB A;  1JJX A;  4XME A;  2CBR A;  3RZY A;  2AH7 X;  1O8V A;  2LBA A;  3FA8 A;  1N0S A;  3APW A;  3STN A;  3STK A;  1ALB A;  3PP6 A;  5D8J A;  3KZA A;  2NP1 A;  4HFO A;  1QFV A;  3FW5 A;  3UEX A;  1BJ7 A;  2KTD A;  3ZUI A;  3TZS A;  4EFG A;  1LF7 A;  2LKK A;  1RLB E;  3SAO A;  5HA0 A;  4ZR2 A;  4GH7 A;  1B4M A;  4OS3 A;  1DF3 A;  1TOW A;  1CRB A;  1FEM A;  5FEN A;  3D96 A;  3CMP A;  1CBQ A;  1DC9 A;  4IAX A;  1SY2 A;  2ACP X;  1KT6 A;  5EEE A;  1OPB A;  2Q39 A;  1SY1 A;  3EMM A;  4IB6 A;  2FR2 A;  4GRJ A;  4YH0 A;  3BS2 A;  1T8V A;  5IO5 A;  1XKI A;  3BRN A;  3HK1 A;  2OFR X;  1X71 A;  1A18 A;  3JS1 A;  5F6Z A;  1YP7 A;  2JN3 A;  4QGX A;  3BY0 A;  1A3Y A;  2W2A A;  4I3B A;  4A1H A;  4BOE A;  1TVQ A;  1EII A;  1U17 A;  3L4R A;  4RUU A;  1QY2 A;  2ALL X;  3WJE A;  3HWF A;  3P6F A;  3Q6L A;  2Q2M A;  5LKE A;  1BSO A;  3OJY C;  2RQ0 A;  2LFO A;  5H9A A;  4AZQ A;  1T68 X;  2IFB A;  3B2J A;  2AT0 X;  1DZK A;  1IKJ A;  4LKT A;  1ZNE A;  1AQB A;  3C77 X;  4I3C A;  3CWK A;  4YDB A;  1KGL A;  1ZNK A;  5BVQ A;  2A3F X;  3CR6 A;  3KFF A;  4XMC A;  1SY0 A;  1SY3 A;  5L8O A;  2QO4 A;  5L8N A;  3KFH A;  3WXQ A;  2AT6 X;  1G85 A;  3MVF A;  3WJG A;  2CZU A;  3BU9 A;  5LJG A;  4A60 A;  1JYJ A;  1URE A;  3EYC A;  3O22 A;  4ALB A;  1KOI A;  1KT5 A;  2F73 A;  3NAD A;  4NYQ A;  5HWZ A;  1ICN A;  2X45 A;  1TXL A;  4WBK A;  3FMZ A;  5LJD A;  1KQW A;  3FLL A;  2OFM X;  3KFG A;  4Y0P A;  2GC9 A;  4YDA A;  4GET A;  3I17 A;  4NNS A;  1FEN A;  1QAB E;  2L67 A;  1OPA A;  3FEL A;  4N7C A;  1CJ5 A;  4TQ2 A;  4AYH A;  1BSY A;  1HBQ A;  2W2B A;  2P8G A;  4D6B A;  5CE4 A;  3EM0 A;  3S26 A;  1CBS A;  5LJK A;  2FLJ A;  1CBI A;  1MX8 A;  3P6D A;  2PY1 A;  4ZJ0 A;  5HZ5 A;  1QY1 A;  2NND A;  1ADL A;  4IMN A;  1LIE A;  1SXW A;  5HZ9 A;  1S44 A;  1LIF A;  3BSZ E;  4NYR A;  2FT9 A;  5H9L A;  1LKE A;  4LZV A;  3NX2 A;  2AL0 X;  4AZM A;  1H91 A;  1QY0 A;  4YCE A;  1I04 A;  3C78 X;  3TF6 A;  3HWE A;  3FEP A;  4QZU A;  2L68 A;  3NQ3 A;  3NR3 A;  1XCA A;  1KZX A;  2CBS A;  3FA7 A;  4CK4 A;  3CBS A;  2DM5 A;  5EDC A;  4MVL A;  4TLJ A;  3VG7 A;  4HPB A;  4NP1 A;  4DQ4 A;  1DZJ A;  2NNQ A; 
#chains in the Genus database with same CATH topology
 3WJB A;  1STP A;  2KTS A;  5H9N A;  2Q9S A;  4RUN A;  1QWD A;  5HZQ A;  3OE3 A;  4O4S A;  3UAQ A;  1U18 A;  4ON1 A;  1AEL A;  2Q2P A;  3QQ2 A;  1FDQ A;  2YG2 A;  4YCH A;  3ZQ3 A;  1CBR A;  4FBV A;  1Y53 X;  1B56 A;  1RXH A;  2GJ5 A;  2QMI A;  3EBK A;  5B11 O;  3PQU A;  4M6S A;  2A5B A;  1GKA B;  1IKE A;  1HMR A;  1YWB A;  2IZE B;  2XST A;  3BU1 A;  3BDR A;  4OMX A;  4GDA A;  2OYB O;  1STR B;  3B2L A;  3VE2 A;  4ID2 A;  1EIO A;  1YIV A;  2IZG B;  4FBR A;  1HQP A;  1SWU A;  4INN A;  3EW2 A;  4HWM A;  1DFV A;  1LNM A;  2ANS A;  4BX7 B;  4CDD A;  1RBP A;  1NP4 A;  1UZ2 X;  1NP1 A;  2I5V O;  3FEK A;  3CKF A;  5IO7 A;  1LID A;  1PBO A;  4IAW A;  1VWP B;  4AZO A;  4B55 A;  1EQD A;  5LJC A;  1N43 A;  5HCD C;  4FBO A;  5AEO A;  4QNI A;  3FW4 A;  4DCB A;  2OF9 A;  5IO6 A;  4IB9 A;  2RTA A;  1OEJ A;  2F01 A;  4BX5 B;  4QYN A;  3RWX A;  1GX3 A;  2QO5 A;  3RDM A;  4D6A A;  4ALO A;  3UEW A;  1VWI B;  1B0O A;  1SWK A;  3PPT A;  4ZGU A;  3GE2 A;  1GM6 A;  4XMH A;  1G74 A;  1G7N A;  2LA7 A;  2R56 A;  1VWO B;  4WFU A;  2RCT A;  4BX6 B;  1X8P A;  3WZP A;  3FR2 A;  1SXX A;  5AQ6 A;  4ORR A;  4TKH A;  4EKV A;  2OVA A;  4OS8 A;  3KQ0 A;  1IJ8 A;  2RCQ A;  3AKN A;  1IFB A;  3MBT A;  4WFV A;  1KXO A;  4YBP A;  1EAL A;  5F6Z A;  1EPB A;  1SWP A;  2RTN B;  3T2W A;  2MM3 A;  2BLG A;  2G5L A;  1ZNH A;  3P24 A;  1WUB A;  2HNX A;  2O62 A;  4HPD A;  3RDX A;  5LJE A;  1DF8 A;  1DZP A;  4BVM A;  3U9P C;  1VWF B;  4O9S A;  1SWE A;  1VYG A;  3FIQ A;  3HOL A;  2OF8 A;  3FA9 A;  1RXK A;  2POA A;  5LJB A;  1MK5 A;  1SA8 A;  1SWQ A;  2KT4 B;  2L5P A;  3FEN A;  4JO6 A;  4AZP A;  1JJU A;  1SRE A;  4C5P A;  2RD7 C;  2WQA E;  2W2F A;  4ZFX A;  1EW3 A;  3WYQ A;  1VWB B;  2YMS A;  4I9R A;  1ML7 A;  5FAZ A;  1U0X A;  1TW4 A;  5K67 A;  1X8Q A;  2WUT A;  2K62 A;  3VG2 A;  3VG3 A;  1SWL A;  4EQA C;  1GT5 A;  1SRI A;  2A13 A;  2HYS A;  4I3D A;  3FR4 A;  4YKO A;  2IZH B;  5HCE C;  1GT1 A;  2GTL O;  1Y0G A;  1KFF A;  2FRS A;  2RTF B;  2WSJ A;  1ICM A;  2K23 A;  3NQ9 A;  3STM X;  1ERX A;  3F9D A;  2HKD A;  2UYW A;  1BLR A;  2IZF B;  1MUP A;  2ACO A;  2HLV A;  5HZ5 A;  1HQQ A;  1SWD A;  1E5P A;  4Z27 A;  3APV A;  1LIC A;  4CDC A;  2RTO B;  4PSQ A;  1SWN A;  1VPR A;  2OY1 O;  4Y0R A;  2RTL A;  3B2I A;  4CDE A;  3EBW A;  1FEL A;  3P6C A;  5F6B A;  1HN2 A;  3N91 A;  4LQZ A;  2RTI B;  4GGT A;  1EPA A;  4MIS A;  1VWD B;  1OEK A;  2FWV A;  1YWA A;  2MO5 A;  4U46 A;  2OL7 A;  4ZH6 A;  3WZN A;  2CZT A;  2IZD B;  5FFH A;  5HZ8 A;  5D48 A;  5EED A;  1SWC A;  4NLJ A;  2RTQ B;  2WEX A;  5LKF A;  3ZW1 A;  4O4X A;  3RDS A;  1MVG A;  1SRJ A;  2M4L A;  3NP1 A;  5BVS A;  4GJS A;  5L8I A;  3NQK A;  3APU A;  3CKG A;  2ZAI A;  1G5W A;  4Y59 A;  2R73 A;  4TKB A;  3BLG A;  1SLG B;  5HAE A;  4Z28 A;  3WOV A;  2Y3E A;  5IXG A;  2I5Z O;  2OVE A;  2X4M A;  3CBC A;  5EPQ A;  1GX9 A;  4I95 A;  5LJH A;  1JJJ A;  4LKP A;  4ML7 B;  2R74 A;  2ZAG A;  3ELX A;  2LB6 A;  4EEJ A;  3LTW A;  2CM4 A;  2G79 A;  3BX7 A;  3VG6 A;  2G7B A;  3DTQ A;  2IZC B;  2EU7 X;  1LUQ A;  3IA8 A;  1AVG I;  3B2H A;  1PBY A;  2RTH B;  1T0V A;  5B29 A;  4TNN A;  3RY2 A;  4ODD A;  1BWY A;  1I06 A;  2HMB A;  4OKA A;  1FTP A;  4QGW A;  4YKM A;  4ZH9 A;  1IFC A;  1IIU A;  1KL5 A;  2FHL A;  2GTF X;  2JW1 A;  2IZB A;  4ORY A;  4U8U O;  4ZHC A;  1MX7 A;  1NDJ A;  4WHI A;  2JU8 A;  3I0A A;  1RSU B;  4MVI A;  2OY8 A;  1A2D A;  4UU2 A;  5AJC A;  3VU1 A;  1ZRY A;  4R0B A;  1BBP A;  2BS6 A;  2UZ2 A;  4ZHF A;  1IW2 A;  5K06 A;  3U03 A;  2RA6 A;  1YWC A;  3WJF A;  4EDE A;  3RDU A;  2QM9 A;  2WWP A;  3PH6 A;  3ZWE A;  1SXY A;  2A2U A;  3NBX X;  1VWH B;  2IZA A;  1Y55 X;  5D4A A;  1HMS A;  3K3L A;  3VHM A;  5IRW A;  4Y0Q A;  2IZJ A;  2NNE A;  3HWD A;  1VYO A;  2X8F A;  4Y0S A;  4K19 A;  4BBO A;  1SWH A;  2X32 A;  2Z4H A;  1O1U A;  3JSQ A;  1GKA A;  1ERB A;  2AVI A;  1I78 A;  3PDF A;  4ORS A;  5CYB A;  2FS7 A;  4YGZ A;  1P6P A;  4COT A;  1W5R A;  2WQ9 A;  4AZN A;  5EZ2 A;  1OSP O;  4BX7 A;  2F09 A;  2RTR B;  1ACD A;  2JOZ A;  2X8S A;  1O1V A;  1KT4 A;  2CM9 A;  2ZSC A;  2ASN X;  4BCS A;  3UEV A;  4OEM A;  4Z6J A;  1RST B;  1YP6 A;  2MWH A;  1E00 A;  4NLI A;  1SWT A;  2OFB A;  4YGG A;  3WZQ A;  4QGV A;  4GGR A;  1JMZ A;  4GKC A;  1I05 A;  2G78 A;  3APX A;  4ZGF A;  1A57 A;  4GUZ A;  1YWD A;  2Z4I A;  1BRQ A;  2BT9 A;  5HBS A;  4DQ3 A;  3UEU A;  1SWJ A;  1JIW I;  3SOT A;  1X89 A;  3FYF A;  3P6H A;  3RBY A;  3KFI A;  3PK2 A;  4O3X B;  2XKL A;  1OBQ A;  3U0D A;  3P6E A;  3PEC A;  3TGA A;  3VG5 A;  4U3Q A;  5HTE A;  4BX6 A;  2QOS C;  4XMD A;  4Z2V A;  2HZR A;  3PED A;  4GZV A;  4ES7 A;  4QQ1 A;  2OVD A;  3VPJ E;  2RN4 A;  3CQR A;  2N93 A;  5H8T A;  3ZUO A;  5HCC C;  1ZND A;  3VG4 A;  1HMT A;  2X46 A;  2DJG A;  3FR5 A;  5C0N A;  1BRP A;  4U8U N;  4LZU A;  3SZI A;  3B2K A;  1D3S A;  1X8U A;  2VFB A;  2BS5 A;  3OD9 A;  1NQN A;  4FGI B;  1PEE A;  3WBG A;  5JR8 A;  4OMW A;  1MOY A;  4YBU A;  4GNY A;  5B10 O;  4CPE A;  4ZHG A;  1QG5 A;  3NPO A;  4HPA A;  4TKJ A;  2OL6 O;  2BSZ A;  2C1Q A;  1E06 A;  1VWN B;  3F8A A;  1GXA A;  5B2A O;  4A8Z A;  3C76 X;  2C1S A;  4QZT A;  1QFT A;  4PJ2 A;  4YMY A;  1Z24 A;  1E2T A;  1S2P A;  5H9K A;  2OY5 O;  2FKJ A;  4TJZ A;  4I9S A;  4O3Y A;  4GJV A;  1B8E A;  2AKQ A;  2FTB A;  1PM1 X;  4MVK A;  1ZNG A;  1FE3 A;  1OBP A;  3JQO A;  3TGC A;  2AMM X;  5B27 A;  1PMP A;  2Q4N A;  5HTD A;  5F58 A;  3DSZ A;  1LCW A;  4AZR A;  5CHK A;  5FQ6 E;  3NX1 A;  4CPF A;  1TOU A;  1LFO A;  1Y52 X;  4IB7 A;  3TGB A;  2RTG B;  5DG4 A;  1W4T A;  2AT8 X;  2FS6 A;  4KII A;  2A0A A;  4YVB A;  2VFC A;  1NGL A;  4N7D A;  4XMG A;  2WEW A;  3S5X A;  5KIC A;  3T1D A;  2MJI A;  5F2B A;  4IBA A;  1AB0 A;  1LIB A;  4IMO A;  1VWL B;  4AW8 A;  3FA6 A;  2WPU A;  1GT4 A;  4ZCB A;  4NNT A;  5B3M O;  4Z2O A;  1SXU A;  1L6M A;  4ZHD A;  4IB8 A;  3O2Y A;  4QAE A;  1QQS A;  3D95 A;  2JU7 A;  3EC5 A;  3D97 A;  3QKG A;  3ZZV A;  3RDO A;  1VWE B;  3AKM A;  3G7X A;  3GAQ A;  3KVN A;  3Q34 A;  3WJD A;  1VWQ B;  1D2U A;  4GNW A;  1BEB A;  2FR3 A;  2RTE B;  3P6G A;  1JMX A;  3SLJ A;  1KT7 A;  5BYP A;  1E02 A;  5D45 A;  1SLF B;  4XMF A;  1K3B A;  1N9M A;  4A1Y A;  5HZ6 A;  3PH5 A;  1LEL A;  4EXZ A;  1MDC A;  5KID A;  1SLD B;  4GE1 A;  2LBV A;  2JMB A;  1YUP A;  2RTC B;  1VWR B;  3RSW A;  1KQX A;  3HWG A;  1GX8 A;  4ORW A;  3H3I A;  4QYP A;  4CPH B;  1RAV A;  3LHN A;  4JNJ A;  4YFR A;  1DZM A;  2A2G A;  2OZQ A;  3P02 A;  5HA1 A;  5KHP A;  1STS B;  4ORX A;  4ORU A;  3T2X A;  1NBX A;  2E4J A;  1GGL A;  5L3Y A;  3BX8 A;  4M7M A;  4BQU A;  1DV9 A;  1JBH A;  2L9C A;  3ELZ A;  2HZQ A;  2IZI A;  3S60 A;  3RDQ A;  4OS0 A;  2QCB A;  1I4U A;  1EUO A;  2FGS A;  1MEP A;  2RTP B;  4NW4 A;  1GT3 A;  4UU3 A;  5AJB A;  1SRF A;  1VWA B;  2GH7 A;  1LPJ A;  2GTL N;  1S7D A;  1OBU A;  1SWF A;  5D47 A;  1MM9 A;  4HPC A;  3ZW0 B;  3SZH A;  4ARH A;  2AT3 X;  3X00 A;  4YGH A;  2A8G A;  1OEE A;  2WR6 A;  2OVS A;  2X55 A;  3ZI8 A;  1X8N A;  5BVT A;  1BSQ A;  5JD2 A;  1ZNL A;  4IAB A;  4YFP A;  3T6L A;  3WJC A;  1HBP A;  2QO6 A;  2JU3 A;  1KZW A;  5DPQ A;  5F1E A;  1HY2 A;  1VWJ B;  1EXS A;  4O3W A;  4ZHH A;  3OBL A;  3D4R A;  1VYF A;  1JYD A;  1JV4 A;  3CQN A;  1JZU A;  1X8O A;  2AT5 X;  5F7G A;  3WVM A;  1KT3 A;  3O19 A;  3IFB A;  4YFQ A;  1R0U A;  5EDB A;  2C4I A;  4O4U A;  1JJX A;  4XME A;  4CV7 A;  2CBR A;  5CSE A;  3RZY A;  1SWR A;  2AH7 X;  1O8V A;  2LBA A;  1EI5 A;  1SMP I;  1VWC B;  3HTY A;  1HXL A;  2DJF A;  5FQ8 E;  3FA8 A;  2QOM A;  1N0S A;  3APW A;  3STN A;  3STK A;  1ALB A;  3PP6 A;  1LCV A;  2CAM A;  4GGZ A;  3KZA A;  5D8J A;  2X8T A;  2NP1 A;  4HFO A;  1QFV A;  3FW5 A;  3UEX A;  1BJ7 A;  2KTD A;  3RKG A;  3ZUI A;  3TZS A;  4EFG A;  1LF7 A;  2LKK A;  1RLB E;  1Y9T A;  2X56 A;  3LV4 A;  1N9Y A;  5K68 A;  3SAO A;  4BX5 A;  5HA0 A;  4ZR2 A;  4GU8 A;  2GTL M;  1JQP A;  4GH7 A;  1K24 A;  1B4M A;  4KT5 A;  4OS3 A;  2RTM A;  1TOW A;  4BGF A;  1CRB A;  1FEM A;  5FEN A;  1DF3 A;  3D96 A;  3HPE A;  3CMP A;  1CBQ A;  1DC9 A;  4GD9 A;  3RE6 A;  4IAX A;  1SY2 A;  2ACP X;  1KT6 A;  5EEE A;  1OPB A;  2Q39 A;  1SY1 A;  3EMM A;  4IB6 A;  3RE5 A;  2FR2 A;  2RTB B;  4GRJ A;  4I60 A;  5FQ7 E;  4MEE A;  4YH0 A;  3BS2 A;  1T8V A;  5IO5 A;  1XKI A;  3BRN A;  3HK1 A;  2OFR X;  1X71 A;  1A18 A;  2IZK A;  1LCZ A;  1YP7 A;  2JN3 A;  2FHN X;  2KW1 A;  3JS1 A;  2MF6 A;  1AVE A;  3BY0 A;  3E3C A;  4QGX A;  1A3Y A;  1RXJ A;  2W2A A;  4I3B A;  4KH8 A;  4A1H A;  1TVQ A;  4BOE A;  1U17 A;  1LDQ A;  3L4R A;  4RUU A;  1QY2 A;  1EII A;  2ALL X;  2X34 A;  3WJE A;  5B5G A;  4NV7 A;  3HWF A;  3P6F A;  1VWK B;  3Q6L A;  3AEH A;  2Q2M A;  5LKE A;  2VDF A;  1HXZ A;  1BSO A;  3MG5 A;  3OJY C;  1FJ1 E;  2RQ0 A;  4QRL A;  2LFO A;  3HOE A;  4KC8 A;  3PQS A;  5H9A A;  4JHQ A;  1T68 X;  4AZQ A;  4Z2P A;  3FDC A;  2G8C O;  2IFB A;  3B2J A;  4Y5D A;  2AT0 X;  4NV8 A;  1DZK A;  4DNE A;  1IKJ A;  1SLE B;  4LKT A;  4OEL A;  1ZNE A;  3VHI A;  1AQB A;  3C77 X;  4I3C A;  1UYN X;  2PI3 O;  3CWK A;  4YDB A;  4CDF A;  1KGL A;  1ZNK A;  5BVQ A;  2A3F X;  3CR6 A;  3KFF A;  4XMC A;  3VGW A;  1SY0 A;  1SY3 A;  5L8O A;  4U8U M;  2QO4 A;  5L8N A;  4O4O A;  3KFH A;  4U9C A;  3WXQ A;  2AT6 X;  3VHH A;  1G85 A;  2OL8 O;  3MVF A;  3WJG A;  2CZU A;  2FKG A;  5IRU A;  3BU9 A;  2MHD A;  5LJG A;  4A60 A;  1JYJ A;  1URE A;  3EYC A;  3O22 A;  4ALB A;  3SZJ A;  2Y3F A;  4L3R A;  1KOI A;  1KT5 A;  2F73 A;  3SLO A;  3F6Z B;  3NAD A;  4I6S A;  2RTJ A;  4NYQ A;  3SLT A;  5B5F A;  1PTS A;  5HWZ A;  4GK9 A;  1ICN A;  2X45 A;  1TXL A;  1UYO X;  2AF5 A;  4WBK A;  2OY7 A;  3FMZ A;  5LJD A;  1KQW A;  2JGS A;  3FLL A;  2OFM X;  3KFG A;  1SWO A;  1KL3 A;  4Y0P A;  1SWB A;  2GC9 A;  4YDA A;  1N7Y A;  4GET A;  4CPH A;  3I17 A;  4NNS A;  4KCA A;  1BM5 A;  1FEN A;  1QAB E;  3MM0 A;  1WBI A;  1VWG B;  2KD2 A;  1SWA A;  1SWS A;  2L67 A;  3VE1 A;  4L1N A;  4CPI A;  1SRH A;  3WYP A;  1OPA A;  3FEL A;  2BHV A;  4N7C A;  1CJ5 A;  3RY1 A;  4TQ2 A;  4AYH A;  1BSY A;  1HBQ A;  1NC9 A;  2W2B A;  1KL4 A;  2P8G A;  3ZW1 B;  4D6B A;  5CE4 A;  3EM0 A;  3S26 A;  1CBS A;  5LJK A;  2FLJ A;  1CBI A;  1MX8 A;  3FID A;  3P6D A;  2PY1 A;  4O49 A;  3MX7 A;  3ZW2 A;  3WZO A;  4JGL A;  1QY1 A;  1LDO A;  1W6F A;  3ZW0 A;  4ZJ0 A;  2RTK A;  2BC3 A;  2NND A;  4O3Z A;  1ADL A;  4MIR A;  1Y9L A;  1AVD A;  4IMN A;  4FQB B;  4MVE A;  1SWG A;  1LIE A;  4IRW A;  1SXW A;  5HZ9 A;  1S44 A;  1LIF A;  3BSZ E;  2A5C A;  2FT9 A;  4NYR A;  5H9L A;  1LKE A;  4LZV A;  3NX2 A;  2AL0 X;  4AZM A;  1H91 A;  1QY0 A;  3AUM O;  4YCE A;  1I9H A;  1I04 A;  3C78 X;  4GDZ A;  1N4J A;  1SRG A;  3TF6 A;  3HWE A;  3EW1 A;  3FEP A;  4QZU A;  2L68 A;  3S5V A;  3D9W A;  2Y32 A;  3NQ3 A;  3NR3 A;  1XCA A;  1VWM B;  2CBS A;  1KZX A;  3FA7 A;  3V8U A;  4CK4 A;  3CBS A;  2DM5 A;  4KC7 A;  5EDC A;  5IRA A;  4MVL A;  4TLJ A;  3VG7 A;  4CSB A;  2OFA A;  1NQM A;  2IZL B;  2RTD B;  4HPB A;  4NP1 A;  4BJ8 A;  3T6F A;  4DQ4 A;  1DZJ A;  2NNQ A; 
#chains in the Genus database with same CATH homology
 3WJB A;  2KTS A;  5H9N A;  2Q9S A;  4RUN A;  1QWD A;  5HZQ A;  3OE3 A;  4O4S A;  3UAQ A;  1U18 A;  4ON1 A;  1AEL A;  2Q2P A;  1FDQ A;  2YG2 A;  4YCH A;  3ZQ3 A;  1CBR A;  4FBV A;  3EBK A;  1B56 A;  2GJ5 A;  2QMI A;  3PQU A;  4M6S A;  3BU1 A;  1GKA B;  1IKE A;  1HMR A;  1YWB A;  2XST A;  4OMX A;  4PSQ A;  3BDR A;  3B2L A;  3VE2 A;  4ID2 A;  1EIO A;  1YIV A;  4FBR A;  1HQP A;  4INN A;  4HWM A;  1DFV A;  1LNM A;  2ANS A;  1RBP A;  1NP4 A;  1UZ2 X;  1NP1 A;  3FEK A;  5IO7 A;  1LID A;  1PBO A;  4IAW A;  4AZO A;  1EQD A;  5LJC A;  5HCD C;  4FBO A;  5AEO A;  4QNI A;  3FW4 A;  5IO6 A;  4IB9 A;  1OEJ A;  4QYN A;  3RWX A;  2QO5 A;  4D6A A;  4ALO A;  3UEW A;  1B0O A;  3PPT A;  4ZGU A;  3GE2 A;  1GM6 A;  4XMH A;  1G74 A;  1G7N A;  2LA7 A;  2R56 A;  4WFU A;  2RCT A;  1X8P A;  3FR2 A;  1SXX A;  5AQ6 A;  4ORR A;  4TKH A;  2OVA A;  4OS8 A;  3KQ0 A;  2RCQ A;  3AKN A;  4WFV A;  1IFB A;  3MBT A;  4YBP A;  1KXO A;  1EAL A;  1EPB A;  2MM3 A;  2BLG A;  4HPD A;  1ZNH A;  3P24 A;  5LJE A;  2HNX A;  2O62 A;  1DZP A;  4BVM A;  3U9P C;  4O9S A;  1VYG A;  3FIQ A;  3HOL A;  3FA9 A;  2POA A;  5LJB A;  2L5P A;  1SA8 A;  3FEN A;  2KT4 B;  4AZP A;  2RD7 C;  2WQA E;  2W2F A;  4ZFX A;  1EW3 A;  2YMS A;  4I9R A;  1ML7 A;  5FAZ A;  1U0X A;  1TW4 A;  1X8Q A;  2WUT A;  2K62 A;  3VG2 A;  3VG3 A;  4EQA C;  1GT5 A;  2A13 A;  2HYS A;  4I3D A;  3FR4 A;  4YKO A;  5HCE C;  1GT1 A;  2GTL O;  2FRS A;  1BM5 A;  2WSJ A;  1ICM A;  2K23 A;  3NQ9 A;  3STM X;  1ERX A;  3F9D A;  1BLR A;  1MUP A;  2ACO A;  2HLV A;  1E5P A;  3APV A;  1LIC A;  1VPR A;  4Y0R A;  3B2I A;  3EBW A;  1FEL A;  3P6C A;  5F6B A;  1HN2 A;  3N91 A;  4LQZ A;  1EPA A;  4MIS A;  2FWV A;  2MO5 A;  1OEK A;  1YWA A;  4ZH6 A;  2CZT A;  5FFH A;  5HZ8 A;  5D48 A;  5EED A;  4NLJ A;  3ZW1 A;  2WEX A;  5LKF A;  4O4X A;  1MVG A;  2M4L A;  3NP1 A;  5BVS A;  5L8I A;  3NQK A;  3APU A;  2ZAI A;  1G5W A;  2R73 A;  4TKB A;  3BLG A;  5HAE A;  3WOV A;  2OVE A;  3CBC A;  5EPQ A;  1GX9 A;  4I95 A;  5LJH A;  1JJJ A;  4LKP A;  4ML7 B;  2R74 A;  2ZAG A;  3ELX A;  2LB6 A;  4EEJ A;  2CM4 A;  2G79 A;  3BX7 A;  3VG6 A;  2G7B A;  3DTQ A;  2EU7 X;  3IA8 A;  1AVG I;  3B2H A;  1T0V A;  5B29 A;  4TNN A;  1BWY A;  4ODD A;  1I06 A;  2HMB A;  1FTP A;  4QGW A;  4YKM A;  4ZH9 A;  1IFC A;  1IIU A;  2GTF X;  2JW1 A;  4ORY A;  4U8U O;  4ZHC A;  1MX7 A;  4WHI A;  2JU8 A;  3I0A A;  4MVI A;  5AJC A;  4UU2 A;  1A2D A;  3VU1 A;  4ZHF A;  1ZRY A;  4R0B A;  1BBP A;  2BS6 A;  5K06 A;  1IW2 A;  3U03 A;  2RA6 A;  1YWC A;  3WJF A;  4EDE A;  2QM9 A;  2WWP A;  3PH6 A;  3ZWE A;  1SXY A;  2A2U A;  3NBX X;  5D4A A;  1HMS A;  3K3L A;  4Y0Q A;  2NNE A;  3HWD A;  4Y0S A;  2X8F A;  4K19 A;  3JSQ A;  2Z4H A;  1O1U A;  1GKA A;  1ERB A;  4ORS A;  5CYB A;  2FS7 A;  4YGZ A;  1P6P A;  4COT A;  2WQ9 A;  4AZN A;  5EZ2 A;  2F09 A;  1ACD A;  2JOZ A;  2X8S A;  1O1V A;  1KT4 A;  2CM9 A;  2ASN X;  3UEV A;  2MWH A;  1YP6 A;  4NLI A;  1E00 A;  4YGG A;  4QGV A;  4GKC A;  1I05 A;  2G78 A;  3APX A;  4ZGF A;  1A57 A;  5HBS A;  1YWD A;  2Z4I A;  1BRQ A;  2BT9 A;  4DQ3 A;  3UEU A;  3SOT A;  1JIW I;  1X89 A;  3FYF A;  3P6H A;  3RBY A;  3KFI A;  4O3X B;  2XKL A;  1OBQ A;  3U0D A;  3P6E A;  3PEC A;  3TGA A;  3VG5 A;  4U3Q A;  5HTE A;  2QOS C;  4XMD A;  2HZR A;  3PED A;  4GZV A;  4ES7 A;  4QQ1 A;  2OVD A;  3VPJ E;  2RN4 A;  3CQR A;  2N93 A;  5H8T A;  3ZUO A;  5HCC C;  1ZND A;  3VG4 A;  1HMT A;  2X46 A;  3FR5 A;  5C0N A;  1BRP A;  4U8U N;  4LZU A;  3B2K A;  1D3S A;  1X8U A;  3OD9 A;  2BS5 A;  4FGI B;  1PEE A;  3ZW2 A;  3WBG A;  5JR8 A;  4OMW A;  4YBU A;  4GNY A;  4ZHG A;  1QG5 A;  3NPO A;  4HPA A;  4TKJ A;  3F8A A;  1E06 A;  1GXA A;  4A8Z A;  3C76 X;  4QZT A;  1QFT A;  4PJ2 A;  4YMY A;  1Z24 A;  1S2P A;  5H9K A;  4TJZ A;  4I9S A;  4O3Y A;  2FTB A;  1B8E A;  2AKQ A;  1PM1 X;  4MVK A;  1ZNG A;  1FE3 A;  1OBP A;  3JQO A;  3TGC A;  2AMM X;  5B27 A;  1PMP A;  2Q4N A;  5HTD A;  5F58 A;  3DSZ A;  4AZR A;  5FQ6 E;  3NX1 A;  1TOU A;  1LFO A;  4IB7 A;  3TGB A;  5DG4 A;  2AT8 X;  4KII A;  2FS6 A;  2A0A A;  1NGL A;  4N7D A;  4XMG A;  2WEW A;  3S5X A;  5KIC A;  3T1D A;  2MJI A;  4IBA A;  1AB0 A;  1LIB A;  4IMO A;  4AW8 A;  3FA6 A;  4ZCB A;  1GT4 A;  4NNT A;  1SXU A;  1L6M A;  4ZHD A;  4IB8 A;  3O2Y A;  4QAE A;  1QQS A;  3D95 A;  2JU7 A;  3D97 A;  3QKG A;  3ZZV A;  3WJD A;  3G7X A;  3AKM A;  3GAQ A;  1D2U A;  4GNW A;  1BEB A;  2FR3 A;  3P6G A;  5BYP A;  1KT7 A;  1E02 A;  5D45 A;  4XMF A;  5HZ6 A;  4A1Y A;  3PH5 A;  4EXZ A;  1MDC A;  5KID A;  4GE1 A;  2LBV A;  2JMB A;  1YUP A;  3RSW A;  1KQX A;  3HWG A;  1GX8 A;  4ORW A;  3H3I A;  4QYP A;  3LHN A;  4YFR A;  1DZM A;  2A2G A;  2OZQ A;  3P02 A;  5HA1 A;  5KHP A;  4ORX A;  4ORU A;  2E4J A;  1GGL A;  3BX8 A;  4M7M A;  4BQU A;  1DV9 A;  1JBH A;  2L9C A;  3ELZ A;  2HZQ A;  3S60 A;  4OS0 A;  1I4U A;  1EUO A;  4NW4 A;  1GT3 A;  4UU3 A;  5AJB A;  1LPJ A;  2GTL N;  1S7D A;  1OBU A;  5D47 A;  3ZW0 B;  4ARH A;  4HPC A;  2AT3 X;  4YGH A;  1OEE A;  2WR6 A;  2OVS A;  3ZI8 A;  1X8N A;  5BVT A;  1BSQ A;  1ZNL A;  4IAB A;  4YFP A;  3WJC A;  1KZW A;  1HBP A;  2QO6 A;  2JU3 A;  5DPQ A;  5F1E A;  1EXS A;  4O3W A;  4ZHH A;  3OBL A;  3D4R A;  1VYF A;  1JYD A;  1JV4 A;  3CQN A;  1JZU A;  1X8O A;  2AT5 X;  5F7G A;  3WVM A;  1KT3 A;  3O19 A;  3IFB A;  4YFQ A;  1R0U A;  5EDB A;  4O4U A;  1JJX A;  4XME A;  4CV7 A;  2CBR A;  3RZY A;  2AH7 X;  1O8V A;  2LBA A;  1EI5 A;  1SMP I;  3HTY A;  5FQ8 E;  3FA8 A;  1N0S A;  3APW A;  3STN A;  3STK A;  1ALB A;  3PP6 A;  5D8J A;  3KZA A;  2X8T A;  2NP1 A;  4HFO A;  1QFV A;  3FW5 A;  3UEX A;  1BJ7 A;  2KTD A;  3RKG A;  3ZUI A;  3TZS A;  4EFG A;  1LF7 A;  2LKK A;  1RLB E;  1Y9T A;  3LV4 A;  3SAO A;  5HA0 A;  4ZR2 A;  4GU8 A;  2GTL M;  4GH7 A;  1B4M A;  4KT5 A;  4OS3 A;  1DF3 A;  1TOW A;  1CRB A;  1FEM A;  5FEN A;  3D96 A;  3CMP A;  1CBQ A;  1DC9 A;  4IAX A;  1SY2 A;  2ACP X;  1KT6 A;  5EEE A;  1OPB A;  2Q39 A;  1SY1 A;  3EMM A;  4IB6 A;  2FR2 A;  4GRJ A;  5FQ7 E;  4YH0 A;  3BS2 A;  1T8V A;  5IO5 A;  1XKI A;  3BRN A;  3HK1 A;  2OFR X;  1X71 A;  1A18 A;  3JS1 A;  5F6Z A;  1YP7 A;  2JN3 A;  2KW1 A;  4QGX A;  3BY0 A;  3E3C A;  1A3Y A;  2W2A A;  4I3B A;  4KH8 A;  4A1H A;  4BOE A;  1TVQ A;  1EII A;  1U17 A;  3L4R A;  4RUU A;  1QY2 A;  2ALL X;  3WJE A;  3HWF A;  3P6F A;  3Q6L A;  2Q2M A;  5LKE A;  1BSO A;  3OJY C;  2RQ0 A;  4QRL A;  2LFO A;  3HOE A;  4KC8 A;  3PQS A;  5H9A A;  4AZQ A;  1T68 X;  2IFB A;  3B2J A;  2AT0 X;  1DZK A;  1IKJ A;  4LKT A;  1ZNE A;  1AQB A;  3C77 X;  4I3C A;  3CWK A;  4YDB A;  1KGL A;  1ZNK A;  5BVQ A;  2A3F X;  3CR6 A;  3KFF A;  4XMC A;  1SY0 A;  1SY3 A;  5L8O A;  4U8U M;  2QO4 A;  5L8N A;  4O4O A;  3KFH A;  4U9C A;  3WXQ A;  2AT6 X;  1G85 A;  3MVF A;  3WJG A;  2CZU A;  3BU9 A;  2MHD A;  5LJG A;  4A60 A;  1JYJ A;  1URE A;  3EYC A;  3O22 A;  4ALB A;  4L3R A;  1KOI A;  1KT5 A;  2F73 A;  3F6Z B;  3NAD A;  4I6S A;  4NYQ A;  5HWZ A;  4GK9 A;  1ICN A;  2X45 A;  1TXL A;  4WBK A;  3FMZ A;  5LJD A;  1KQW A;  3FLL A;  2OFM X;  3KFG A;  4Y0P A;  2GC9 A;  4YDA A;  4GET A;  3I17 A;  4NNS A;  4KCA A;  1FEN A;  1QAB E;  2L67 A;  2KD2 A;  3VE1 A;  4L1N A;  1OPA A;  3FEL A;  2BHV A;  4N7C A;  1CJ5 A;  4TQ2 A;  4AYH A;  1BSY A;  1HBQ A;  2W2B A;  2P8G A;  3ZW1 B;  4D6B A;  5CE4 A;  3EM0 A;  3S26 A;  1CBS A;  5LJK A;  2FLJ A;  1CBI A;  1MX8 A;  3P6D A;  4O49 A;  2PY1 A;  4ZJ0 A;  3MX7 A;  5HZ5 A;  4JGL A;  1QY1 A;  3ZW0 A;  4O3Z A;  2NND A;  1ADL A;  4MIR A;  1Y9L A;  4IMN A;  4FQB B;  4MVE A;  1LIE A;  1SXW A;  5HZ9 A;  1S44 A;  1LIF A;  3BSZ E;  4NYR A;  2FT9 A;  5H9L A;  1LKE A;  4LZV A;  3NX2 A;  2AL0 X;  4AZM A;  1H91 A;  1QY0 A;  4YCE A;  1I04 A;  3C78 X;  4GDZ A;  3TF6 A;  3HWE A;  3FEP A;  4QZU A;  2L68 A;  3S5V A;  3NQ3 A;  3NR3 A;  1XCA A;  1KZX A;  2CBS A;  3FA7 A;  3V8U A;  4CK4 A;  3CBS A;  2DM5 A;  4KC7 A;  5EDC A;  4MVL A;  4TLJ A;  3VG7 A;  4CSB A;  4HPB A;  4NP1 A;  4DQ4 A;  1DZJ A;  2NNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...