4ZHPA

The crystal structure of potato ferredoxin i with 2fe-2s cluster
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ASYKVKLITPDGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDVTIETHKEEELTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potato Ferredoxin I
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhpA00
1N5WA 1NVID 4LTUA 2K5PA 3AMZA 1FIQA 4FXCA 1SB3C 4N6EB 3BIID 1A70A 3VRBB 3AN1A 1TYGB 1N5XA 4YXDB 2WLBA 1WXQA 4P6VF 1ZP0B 3W5VB 1DOYA 1J7CA 3SFEB 1V8CA 2OHFA 3P4QB 3CIRB 1E0ZA 2BT6A 2JX5A 4A9AA 1FFUA 2WDQB 3NVWA 1NEKB 1E10A 1J7BA 1VJKA 1QOAA 4US9A 4YTPB 3AEBB 3KWLA 3P1MA 3NVZA 2WDVB 5EE1A 2M56B 3AE2B 3P4PB 1JWBD 1PFDA 1SIJA 2HTME 3ZYYX 1WWTA 2MJEA 2BS4B 3AE4B 3AEFB 4IDIA 2CU3A 2WU5B 1T3QA 1L6VA 4ZHPA 2Y5CA 3L4PA 3AE8B 1QLBB 1NYRA 3SFDB 1AYFA 3P63A 5EE9A 3AE3B 1FXIA 4HRSA 1JQ4A 1OQRA 5C3JB 1R7SA 3LXFA 4JX1C 2FBWB 3AV8A 1YJIA 3AE7B 3LB8C 1FXAA 4JWSC 1JWAD 1SF0A 2H88B 2WQYB 2WU2B 3AM9A 2QIEB 2K9XA 1N60A 1KFYB 2MH7A 3AECB 1ZOYB 4YSYB 1RWSA 2L83A 4JWUC 1FO4A 2QJLA 2WDRB 3AEAB 3EUB2 3B9JA 3FAHA 2W3SA 1TKGA 1QF6A 3NVYA 3AEGB 1WRIA 2BS2B 3PO0A 4C80A 3HRDD 1XLPA 1OFFA 2CJNA 3P4SB 3P4RB 3ABVB 5AUIA 3WCQA 5H92C 3DWMA 2DBYA 3NRZA 2W54A 1DOXA 1TKYA 4N59A 3HVZA 5C2TB 2DWQA 2MJDA 1IUEA 2W55A 2MJ3A 4HROA 1J7AA 5EE0A 2L52A 1JW9D 3AE5B 1B9RA 3AH7A 2KMMA 4WQMA 3W5UB 2WS3B 4US8A 4YT0B 1GAQB 3VRAB 1FM0D 1PUTA 1YQ4B 2KAJA 3AE9B 1GPXA 1TKEA 3SR6A 1WYGA 1CZPA 1XLOA 1QT9A 2AX5A 2H89B 2PVOD 3VR8B 3DWGC 3RPFC 1DOIA 1UWMA 2PVGC 1L0VB 1NI3A 1KF6B 1VLBA 2W3RA 1FRDA 3AB5A 1ZUD2 1ROEA 3AE6B 1XLNA 3CWIA 1QOBA 4YTNB 5GXGB 3B2GA 1F0ZA 1RFKA 5EE3A 1JALA 1VDVA 4ZHOA 3ETRA 1JROA 2BS3B 4YSZB 4YTMB 1CJEA 2G1EA 3FC4A 4USAA 1EWYC 2PKOA 2CJOA 1JRPA 3VR9B 1I7HA 1E9MA 5H8YE 4ITKA 2E3TA 1YJJA 1N62A 1N63A 3HUIA 2PIAA 1RM6C 5AUKA 5MPOA 1KRHA 1AWDA 1FMAD 1NYQA 1XLQA 2B76B 3NS1A 1TJEA 4N58A 2Q5WD 1QOFA 1L5PA 3AE1B 1ZXIA 3B2FA 1PDXA 4YSXB 1RYJA 3AEDB 2N0SB 1L6UA 3NVVA 2LEKA 1WGKA 1E6EB 1N61A 1V97A 5G5HA 2WP9B 1DGJA 2M19A 1OQQA 2K22A 2JQRB 2EKIA 5G5GA 3W9CB 4ZOHC 1FRRA 4C7YA 4WWMA 3AEEB 1YQ3B 4KX6B 1NENB 2ACZB 4C7ZA 1E7PB 1QOGA 1FFVA 1XO3A
chains in the Genus database with same CATH superfamily
1NVID 4MGZE 4LTUA 2JYEA 5HKHA 2IGHA 2OJWA 1WXQA 4JLCA 2EMSA 2FUG1 1J7CA 3P4QB 1C9FA 2GMIC 1ZKHA 5BYQA 4FULA 4LJOB 5JHAA 2WDVB 2XEWA 2LWPA 2MRPA 1SIJA 3VVWB 3C0RB 5D94A 2BS4B 3AEFB 3TL5A 4LCDE 4ZHPA 3L4PA 4MSQB 2HTHA 3A4RA 4TUUA 1OQRA 5D6JB 3LXFA 2LRWA 3ZKJC 2WXRA 4B0EA 2D3BA 4OVZA 2LJ5A 2WQYB 2ONQA 5IA7A 1U4AA 3MC8A 2MH7A 2PPHA 1RWSA 2K8CA 2L83A 3WALA 3TBLD 3DHHC 2BS2B 4NAWB 1V5OA 4PYUA 2BYFA 2KT7A 4W9EA 2K6DB 1DYQA 5J18A 1B9RA 4AJYB 1GAQB 2QILA 4AS1A 4B95A 4EZLA 4ZRKA 3RPFC 1DOIA 4QAYA 3D32A 2LVPA 2FCSA 3WA0A 2MBEA 2I1KA 4JE3B 3C8YA 2KD0A 1X1MA 1RM6C 4RGOS 3KH0A 4WH4A 3VXWA 3MHZA 3L17A 4G0NB 2PE9A 1L6UA 3URYA 1E90A 2JWUA 2J4XA 3DVNV 2M19A 2L00B 2C9WB 1T0QC 4C7ZA 3ZNZB 4BZAA 2ZW1A 5IP4D 3L54A 3UIOB 1UBIA 3RNGC 1XT9B 1SB3C 1OTRB 1D3ZA 3FILA 3VRBB 3W1SA 4XZ4A 3DBRB 3IFWB 2N7EA 2KTFA 1E7VA 4K7UA 1K52A 2LGDA 3H7PA 3N1YC 4ZRJA 1QILA 5EE1A 2M56B 1FPYA 4A3PA 1YNTE 2QSDA 1PGAA 2XN9C 3U7ZA 1OEYA 5D3IB 4AQ7A 2KX0A 3MFGA 2KWVB 2G4DB 2D5GA 4OVVA 2QJLA 2N1VA 1QF6A 2DAJA 4WURA 3HHMA 2KHWB 2J52A 5KHQA 2C7NB 2IBIB 4KGSA 3N1ZC 1GPXA 3A9JA 1P7EA 3SD5A 2PVOD 5EDSA 2IPKD 2WHIA 2MX2A 2YEPF 1EU3A 2L3ZA 2K25A 1Z2MA 4ZHOA 2WXQA 3Q8BA 2G1EA 1M4VA 1YX6B 4L1BA 2K0PA 1VZ6A 4WQOB 3RMKC 3BINA 1C4PA 1OQQA 1D6EC 4C00A 1TY0A 2INDC 4WWMA 3Q8FA 1WM2A 3MC0B 2FIDA 4GOCA 2I2YA 1ZE3D 1I4PA 2IY1B 4EOYA 3VUWA 2JY6A 3GZNB 3W5VB 1IYFA 3U2SC 2IO3B 2Z8LA 3M95A 2KO3A 3GS2A 3I5JC 3TJPA 3M63B 4K1RB 3V60A 1HE8A 2K6QA 3QARA 1C4AA 3OJ3A 5TSSA 2LI5A 3AE3B 4RGTA 3I57A 1AW7A 2FBWB 5IO9A 3W1YA 3RFZB 1FCCC 3R2IA 2WXNA 2NTTA 1SJHD 4JWUC 4OW0A 2GOWA 3PO0A 3WANA 3TEYA 3TEWA 5GMVA 4P7IA 2L52A 2G9HD 2KMMA 3AH7A 3APFA 3VTWA 1TS3A 1WR6E 1OEYJ 4MT5A 1T5XD 2WYQA 4TQ0A 1JALA 2KLCA 1CJEA 2RPVA 5AZGA 4F7ZA 3H7PB 1JRPA 1TT5B 2V3PA 2ZVNA 4XX5A 2FCQA 2LHEA 1Y56A 4KKJA 4M0WB 2UU7A 3VUXA 2WXFA 3Q14C 1GC6A 4IC7B 4KSKC 3TSSA 1T0YA 4AJWA 1ET6A 2D11A 1V80A 1QOGA 1MFWA 3PRPB 2FCMA 2K5PA 2OJRA 1JMLA 4KSLC 3RNAC 1ZP0B 2MP2B 4RM8A 3ZIMA 3UF8A 4BKGA 1VR9A 3ZRFA 3AEBB 3PS6A 4WAFA 1WJUA 1XXGA 4WWOA 4RGNA 2AQ1B 2IGDA 1D5XC 2WXKA 1YOVB 3CSFA 4FJYA 4BBNF 1CQVA 4GLSC 4UDUC 1P1AA 4ZYSA 2SEBD 3IAM1 3QA8A 4WJPA 1IBXA 1TZ1A 4W9JA 1SE2A 3TEZA 2WDRB 3QX1A 2C7HA 2L0FA 1ZW7A 5C2TB 3GB1A 4A90A 1WFYA 1J7AA 1E8YA 2WS3B 1P98A 4J3OD 3DHGC 2M1MA 1QT9A 2BKRB 2LGXA 2VRRB 1XLNA 2IGGA 4XDCA 2FNJB 3MJWA 1TS2A 1VDVA 2J53A 1TTNA 4YSZB 3ZXVA 3AU4A 3VTVA 4BVUC 1XEEA 1I7HA 2DYOA 1YJJA 4FJZA 1N62A 2ZNVB 4BOSC 1NYQA 3NS1A 1SEBD 1QOFA 1VRAB 1H4RA 2OEDA 4MGKE 1GG3A 2KDBA 3R66C 5E6PA 2KWUB 4L23A 2KACA 4MDKE 3OJ4B 5FKAC 1YQ3B 1C3TA 4FADA 1XO3A 4REZA 1XCQL 1ZDXA 3EHVA 4RCOA 2CR5A 2QCZA 4XYCA 4ZDVA 4ARIA 2JX5A 3H6NA 4WWNA 4II2B 3B1LX 2JZPA 1I4GA 4LNOA 3E9SA 3NY5A 1C78A 1L6VA 2KXJA 4JQWC 4AOFA 4I6LB 1YN5A 3DBSA 4HRSA 5C3JB 2I38A 1WRDB 3BVGA 2JRHA 3ZXRA 3PREA 3TCAA 3AECB 3DBHB 4LNFA 4MGYE 3AEAB 3IHPC 1MVKA 2Z0DB 4ANWA 2Y5BB 1WIAA 4GN1A 5AUIA 4FN2A 2MJDA 3A9KB 4AWJA 2DLBA 2G45B 3H7SA 3ZNID 1RFAA 3Q3FA 5JZEB 1A5RA 4HDOA 3SEBA 1FRDA 2YVCA 3AB5A 3RCZA 2NVUI 2N9LA 4RNAA 5TR5A 2BS3B 2N9XA 2X38A 2BTEA 1V9JA 4W9DA 1E9MA 1AWDA 5JXVA 2Q5WD 1ZXIA 4GXBA 3RULA 4YSXB 3Q3NC 2W9NA 4OZCA 3QK0A 1WJNA 3ZLZA 2FIFA 1FIQA 5LLIA 3IT6B 3AN1A 3V05A 2NBUA 1Q1OA 1IP9A 2ZVOA 3RZFA 2OHFA 3T8MA 4ICVA 3TEXA 1E10A 2BQQA 2IO2B 2JZ3B 2C60A 2INNE 3APCA 2D07B 3P4PB 3ZJVA 2HTME 3AE4B 1P7FA 2IO0B 3VAWA 3N30A 4ANVA 1V49A 3B08A 3W2DA 1SF0A 1MI0A 2WU2B 1RRBA 2JVCA 4HVBA 1ESFA 4YSYB 2AEHA 2O2VA 1XLPA 3P4RB 2N4FA 5G2NA 2QEJC 2N1WA 1HEZE 1SJED 1CK1A 2YLMA 3AE5B 1WXVA 3DVGY 2WX1A 2BWFA 4PYZA 3AE9B 1SE3A 2LXCA 3JYUA 1EU4A 4M8NA 1WGRA 4CHKA 3PZ7A 4BOZB 4GDLB 1ZUD2 1MG8A 3UQAA 3DDCB 4XWTA 1V2YA 2M8SA 4GSWA 4GGQA 3PVLA 3H9DA 4G3XB 3ZQ4A 1FNVA 4A55A 2IYDB 2BF8B 4F8CB 5H8YE 3VDZA 2V3SA 1GUAB 1ZDVA 2ZJDA 4P1BC 3ZDTA 5BMIA 4A20A 2RD0A 3WAMA 1V97A 2N7JA 3PTFC 2O6VD 1YIWA 2REXA 1E7PB 2WX0A 4S0RA 4FBJB 5C1ZA 1YN4A 4FLHA 3PT2B 1HTQA 1XCTL 2RDGA 3J9CA 1WI0A 2KDIA 4RMAA 4O1NA 3DOWA 4IG7B 2DZKA 1N5XA 1WY8A 2WLBA 2WXMA 1I42A 4DXAB 3KYCD 1ISNA 2GBJA 3WAOA 1FFUA 4LNNA 3N9YC 1YJ1A 1J7BA 2NBVB 2YEPB 3K9OB 2CU1A 1JWBD 2KJ6A 4MH0E 4CQNA 1LM8B 1T3QA 2HJ8A 3OLMD 4WAAA 4IUMB 1YJIA 2GBRA 2DZMA 4TMAB 5IN7A 3AEGB 1PYWD 2JXTA 4NY0A 2J42A 3QJZA 3KUCB 4M0WA 3HVZA 1Z5SB 1MG4A 3HM3A 2CS4A 1WXAA 3VHTC 2QC8A 4URKA 3KW5B 4MACA 4XC2A 2M0XA 4NJ7A 4E74A 4LDTD 3JSVA 1IGDA 1QOBA 5GXGB 1F0ZA 2FE8A 4OZAA 3KUDB 1Q10A 3MJ5A 1WZ3A 1IGCA 1EWCA 2LHDA 3H8HA 2MP2A 2V3NA 1P0RA 2BKFA 1I35A 2WXOA 4TSSA 3RNEC 3B2FA 2ZPNA 1C1YB 1WGKA 1L0YB 3NS8A 2BYTA 3L13A 1FRRA 1YMHE 1WJ6A 4BBNC 4M01A 4NJCA 1F52A 2UWQA 5DCNA 3X0WA 2O2VB 4FXCA 4W9KA 3E56A 2L8JA 3BYTB 4RGMA 2BW2A 4ARCA 3X23A 3P42A 3T9LA 4IM3A 4ANXA 2V4IB 3U4EG 4CYEA 3CIRB 4WWPA 1HXYD 1PGXA 1KH0A 1I4QA 1XF5L 1R4MI 2NBWB 4IKGA 3CF6E 3EC8A 2MJEA 4IDIA 4KZ0A 3R2TA 2K8BA 3KQ4A 3VH4B 2D3GA 4DDGD 1JQ4A 3UGBB 4CO7A 2B3AA 1UF0A 4DXFA 2D3CA 1KLVA 2DHZA 3KLSX 4DK5A 1TIFA 3VUYA 5HG2A 1WRIA 2KFKA 2JUOA 3T3OA 1CMXB 3WCQA 3C19A 5C23A 5CHWA 2W82A 1C4CA 4W9IA 4IWPA 3W5UB 4LLGM 3QHTA 1FM0D 5DPTA 3Q3OC 2H89B 2RR9A 4HPPA 1E8XA 3AE6B 1J0GA 2WXGA 1TS5A 4K3BA 4RF1A 1WYWB 1WE7A 2JT4B 2WWZA 3QCAA 5AUKA 1KRHA 2X8XX 1FMAD 1UELA 4N58A 2A5UA 4HWIB 1K51A 3RNBC 1L5PA 5FR3A 1WSPA 4NQLB 2MCNB 4TKNA 4GB9A 3IXSA 2MW5A 2UYZB 3AEEB 1XD3B 2RMMA 2IDYA 1BT0A 1GB1A 1AN8A 3APDA 1YX5B 2GRIA 4LNIA 4MH8A 2MWSB 4PS3A 5FK9C 4AP4C 1P3QU 1WGHA 2I1JA 4YXDB 4P16A 1NI2A 2OOBB 2DNFA 4C4VB 3NVZA 3A9KA 1YN3A 4KKIA 4MEMA 2KQSA 1UNSA 2Y5CA 3Q69A 3AE8B 3MC9A 3JSVB 1WX8A 2NMQA 3QC8B 2BGFA 1LO5D 5DPSA 1I4XA 1FXAA 2H88B 5IOIA 2KKCA 1PGBA 3BVZA 1K50A 4GMVA 4A6QA 1UBQA 1I4HA 5JH5C 2BYEA 2CJNA 2M0AA 1L2NA 1WMHB 4B9KA 2DBYA 3NRZA 2EKEC 3ML9A 4OVUA 4LK0M 1C79A 3PZDA 2PW9A 2V4LA 3BWUD 3VQIA 2M17A 1V86A 1XQQA 1YQ4B 1WYGA 4G50A 5BMHA 3NZSA 3BY4B 3TIXA 3DQVA 2PE6B 3CWIA 4JPSA 5IKCM 3UINB 4K81A 4DHJD 1V6EA 3DBLI 2MBQA 2KLGA 1N63A 2B76B 1HQRD 5BYRA 1SE4A 2K8HA 5DPWA 1PDXA 3WIMA 3AEDB 1WXMA 2KVRA 3PSEB 2WP9B 1HZ5A 1KLGD 5E6OA 2K22A 2JQRB 2EKIA 3V6CB 2PMVA 4GDKA 4MSMB 3VFKA 2J7QB 4PS8A 1I4RA 4LJPB 2JSVX 3R3MA 2KFKB 3LJ3A 4K7SA 2MLBA 4DHZE 4RH6A 1V8CA 5IAAC 1NEKB 1R4NI 4YTPB 4JIOU 3HM6X 3AE2B 3U30A 4W9CA 4WIPA 1F2RC 2BB6A 1F9JA 1WWTA 1RAXA 4D2KA 3L10B 4E3CA 1JRUA 1R7SA 3IAS1 4NQKE 3AV8A 4PK1A 4GDLA 1GNUA 4W9HA 4M00A 2G3QB 1L7YA 4A8XC 1ZOYB 1AARA 4IWQA 3RI7C 3FKYA 4KVGB 4C80A 2RSUA 2XK5B 2JWZA 3P2BA 2KC2A 3LDZE 3GP7A 1IUEA 4EZJA 2FCNA 2MJ3A 1LFDA 2NS5A 4YT0B 4ASWC 2AL3A 3OAWA 2AQ2B 5HI1A 2PVGC 3Q8EA 2VZKD 3PRMB 3BK1A 3AI5A 4G11A 1Q5WB 2DENB 2KQ7A 4KGRA 5EE3A 4HLEA 2QMTA 1MJDA 2CJOA 1GC7A 2C7MB 1YD8U 3NZUA 2E3TA 2MBOA 1XLQA 4BFRA 3IBEA 3JW0X 1B1ZA 4KZCA 2PTLA 4NAMA 2RGFA 1DGJA 3R7RA 2BYVE 3HIZA 1TZOA 4ZOHC 4KX6B 2WXPA 3IVFA 1N6ZA 4EE2A 1MHHE 2L0TA 3I9V1 1A70A 1TBEA 2GI9A 1DOYA 4JL9A 1T0SC 1HZ6A 4ACFA 2LUEA 4DDID 2LMCA 3ZYYX 3ONSA 1PFDA 2JF5A 2BB5A 1NYRA 1AYFA 2LFIA 5EE9A 5AEKB 2CHXA 2IJ0A 4LNKA 1VZ8A 2A4ZA 4KDIC 4KDLB 4JWSC 1UGJA 3O13A 3AM9A 1IPGA 2KTRB 3PPAA 1JWUD 4NJ6A 4XDDA 4HEA1 3I3TB 5AZHA 2K3UA 2KZRA 2KMCA 3PV1A 2LGSA 4GDKB 1QQRA 2BBCA 2ICIA 2QHOA 3UI3A 1OQYA 3PLUA 3NJTA 1ACCA 5J2RA 3L0WB 2J0JA 1F77A 1GOZA 1XLOA 2NTSA 2RPQA 3DWGC 1UWMA 3TUOA 4XE0A 1VLBA 4BAXA 3BVMA 2N9EB 4HPLB 4YTNB 2AWTA 4P1CC 1E8WA 3FC4A 1NDDA 1ZXHA 3RT3B 3VR9B 3MHSD 5MPOA 1K53A 4MM3B 1F2RI 2CHWA 4RM9A 3AE1B 5HHDG 1UH6A 3N20C 1T0RC 2MA9B 5FR6A 2D10A 1STEA 4MELA 4R3DA 4M8MA 1K8RB 1RLFA 4EFOA 3AMZA 4BKSA 3KYDD 4IW0A 2IO1B 1TYGB 3GOEA 2JXXA 2PLPA 1MHXA 3KUZA 2ZCCA 2LXAA 1WX7A 1E0ZA 3JVZX 4GIVA 2WDQB 2D3AA 1M94A 2GLSA 2SAKA 4EKUA 3OG5A 2KYWA 2LGIA 2LVOA 1FXIA 3RUIB 1WZ0A 3ZGZA 3DPDA 3Q3JA 4KV2A 2TSSA 3ZTCA 5J17A 1SXTA 1TGZB 4GU2A 1J8CA 1FO4A 4HPMB 2KJRA 2ZCBA 3EUB2 1S3SG 2W3SA 1J19A 1TKGA 2LD9A 3EFCA 2LRUA 4I6PA 1MPEA 2AYOB 3ZNGC 3NOBA 2L7RA 1HTOA 4NZLB 2DWQA 1KTKA 3VH3B 3M62B 3A33B 2LVQA 3MTNB 1FNWA 4US8A 4ICUA 1PUTA 3BK2A 1WGYA 2KDEB 3SDLC 2LZ6A 3NZ3A 1L0VB 2BWES 2LJIA 3NG0A 3Q2AC 3ZO5B 2XNAC 2KQ4X 1R4MB 5D7GA 3OWEB 3B2GA 3K9PB 2HD5B 1RFKA 2ZW0A 3V62A 4II3B 4NPNA 2L05A 1EUVB 1PQSA 3U7DA 1TS4A 4NNJB 4C4VA 2KDFB 3N3KB 3EFUA 4ZRQA 2BPSA 4N9F4 5HFYA 3ZW3A 2FUHB 3DCGA 1OGWA 4EZKA 3HK0A 1NENB 1UZXB 2N9PC 4E71A 1C77A 2WXLA 1N5WA 1GJZA 1SGHA 4KIKB 1F1HA 2DAFA 2LGYA 2MQJA 5DPRA 4ZYNA 4HDQA 2CKHB 4P6VF 2N9KA 2GBKA 2IY0B 4MJSB 5BO4B 3H1UA 1JWSD 2JRIB 1WMHA 1VCBA 2NPTA 3A1QB 4DHJB 4ZRIA 3PGEA 1LXDA 2M4NA 2XBBC 1FXTB 1QLBB 2L32A 2KX3A 1KJTA 4OZBA 5CX3A 2K39A 4EEWA 2NR2A 4PT5A 5I4DA 1Q0WB 3ML8A 3GE8C 1L0XB 2QDFA 1N60A 4IOIE 3Q8AA 3B9JA 2KWDA 2JU6X 1V81A 1SSNA 1OFFA 1EO6A 2BVCA 2W54A 1E7UA 1V1PA 4A3OA 4HROA 3WAPA 4TV3A 3W1SC 3N1XC 3DBRI 3AU5A 3ZTDA 4C56C 1KM7A 1C76A 3L16A 3KVFB 1KF6B 2W3RA 3T3NA 3QAQA 2GBNA 2KMAA 4HKQA 2MBHA 1H8CA 3UIPB 4YWGG 2K1FA 4IM0A 1EWYC 1YQBA 2RDBC 4ITKA 2GBMA 2PIAA 2KJHB 1TJEA 1L4ZB 1SE9A 2LASA 3EA6A 4MGIE 3BYYB 3NVVA 3A4SC 5BMGA 3U52E 3O65B 2ACZB 4W9FA 1FFVA 3HVDA 3NUHB 5BYSA 1FCLA 4RFBA 4B6WA 2O6VA 3ZJUA 1VD2A 3AXCA 4X57B 3R7QA 3ZUNA 2VZKB 5CHVC 3L08A 2XK5A 3DVGX 4FA6A 3IG3A 4L2YA 4XGAB 4K3CA 2WXJA 2AQ3B 3DBLB 2LUMA 3P63A 3M3JA 3U8ZA 5LXIB 2ON8A 2INCC 3AE7B 2DYMA 3FILB 2L1AA 1KFYB 4FJVB 4K7WA 4HCPB 1L4DB 2PJHA 3CMMB 2Z0EB 4RF0A 2VH1A 2MSED 4KGTA 1DOXA 1TKYA 5LNK1 1ENFA 3UQBA 3RNFC 2KNBA 1WX9A 4XWWA 3V6EB 1TY2A 2AL6A 1P9DU 3GZNI 3PHXB 2KOXA 1CZPA 1WGGA 1ZGUB 3VR8B 3I63C 3DVNU 1NI3A 1R4NB 2PEAA 3MP9A 1WF9A 4OHJA 4DQOC 4Q2JA 2Y5PA 4ZRPA 4EUTA 2ZNVC 4HJGE 1LGRA 1JCKB 4YTMB 1LQBA 1UGMA 2PKOA 2NPTB 3ECIA 3HUIA 1G6JA 2VH2A 5L83A 2DZJA 1SIFA 5D3DA 1KOTA 5E6NA 4DXGA 3RZWC 4J6IA 3ZDMC 3V61A 1EF5A 3A9JB 4DHZB 4DWFA 1UUPA 4W9LA 5AZFA 2KDMA 2R2OA 1WR1A 2DYBA 1EM7A 1Y8RC 1E8ZA 1WM3A 4N6EB 2ZZPB 2NCNA 3BIID 4AUQC 1S1QB 3NHEB 3ZJTA 5KHOA 1V1PB 4HCNB 1KLUD 3SFEB 2KTRA 3DHIC 2HJ1A 2G4SA 2BT6A 4A9AA 3NVWA 1VJKA 1FNUA 3KWLA 3P1MA 1WXSA 4WJNA 3Q6BA 2HE7A 4HXDA 2CU3A 4JGHB 4W9GA 3SFDB 2INPE 4JX1C 3Q3MC 2JZZA 3KWVA 2DZIA 1JWAD 3V3XA 1UD7A 2EMTA 1GB4A 2V9HA 4M02A 3RN9C 2KK8A 3FAHA 2FAZA 2R2QA 3P4SB 4IM2A 3ABVB 5G55A 3DWMA 4MM3A 2MBBB 3PZ8A 1FEHA 1WJ4A 3PLVA 5L95C 5EE0A 4FHJA 1JW9D 3PRZA 4WQMA 3QIJA 1WH3A 2MEKA 2KN5A 3VRAB 2KAJA 1D4BA 1TKEA 2R61A 3SR6A 2O6VB 5CTRC 2AX5A 5E6JA 2EELA 4WJQA 4HKZE 2C5LC 4YL8A 2WGSA 3CSTA 1BXTA 4BKSD 3IT4B 3RYTA 3TMPB 3R8BA 2KC1A 3ETRA 1VZ7A 2V0GA 2ZEQA 4USAA 3GE3C 3Q8CA 2J0MA 1V1OA 1D5MC 2KN4A 3N32A 4NAWA 5LXHA 2N0SB 1JWMD 2KFJA 1EF1A 1N61A 3SU8X 2V1YA 2K9XA 2MHJA 1WGDA 2JYTA 1FD6A 2DX5B 4I6NB 3VTUA 4IWOA 1ZPSA 1BUIC 2JPHA 2L76A 4DBGA 3B0AA 3QWZB 1NBFC 1QOAA 4US9A 2ASQA 3AULA 1HA5A 2ZPYA 4H2AA 3ENEA 2KWCA 2WU5B 2KVZA 3LB8C 2IZVB 4LDTB 2QIEB 4WJOA 3EGRA 3ZRCA 4ANUA 1V5TA 1QKZA 2E6XA 4TQ1A 3NVYA 5T8IA 3HRDD 1ET9A 5H92C 2WDTB 2Z59B 4N59A 4F1SA 2W55A 5JHBA 4BKTA 2RDHA 5CHFA 3EECA 3RD2A 3LYYA 3QQ8B 4FHKA 2KANA 2WXHA 4HJKA 2CHZA 2WNMA 1SBBB 3ALBA 2HDEA 3RNCC 2J0KA 2GB1A 3S2AA 1ROEA 2D2QA 4KIKA 1IBXB 1UWXA 1JROA 2N7DA 4S17A 1T6BX 4PS7A 1E5WA 1WE6A 4MJSA 2WXIA 3ZNHB 1D5ZC 3A1QA 3ZVVA 3BZDB 1RYJA 1BMLC 2LEKA 1E6EB 3PHWB 5G5HA 3SHQA 3DBHI 5G5GA 5D2MB 3W9CB 4HK2A 4C7YA 1QZEA 2Y3AA 4B0MA
chains in the Genus database with same CATH topology
1N5WA 1NVID 1XCQL 1GB1A 1AN8A 1ZDXA 2JYEA 4LTUA 4RCOA 2GRIA 2IGHA 4MH8A 5FK9C 4YXDB 4P6VF 1WXQA 2N9KA 2FUG1 1J7CA 4P16A 3P4QB 4ARIA 1C9FA 2JX5A 1JWSD 5BYQA 2JZPA 1I4GA 2WDVB 3NVZA 1SIJA 1YN3A 2BS4B 3AEFB 3E9SA 1C78A 4KKIA 1UNSA 1L6VA 4ZHPA 2Y5CA 3L4PA 3Q69A 3AE8B 1QLBB 1YN5A 2L32A 2NMQA 4HRSA 4OZBA 1OQRA 5C3JB 3LXFA 2WXRA 2I38A 3BVGA 4B0EA 1LO5D 4PT5A 5I4DA 4OVZA 1I4XA 1FXAA 2H88B 2ONQA 2WQYB 1L0XB 1N60A 1PGBA 4IOIE 3BVZA 2MH7A 3AECB 1K50A 1RWSA 2L83A 4A6QA 3Q8AA 3AEAB 3B9JA 2KWDA 2JU6X 1MVKA 1I4HA 1SSNA 2BS2B 4NAWB 1OFFA 2CJNA 2M0AA 5AUIA 2DBYA 3NRZA 2W54A 4LK0M 1V1PA 1C79A 2MJDA 1DYQA 2PW9A 4HROA 1B9RA 2DLBA 3BWUD 3VQIA 1GAQB 1YQ4B 2QILA 1WYGA 4AS1A 4C56C 3RPFC 1DOIA 5BMHA 1C76A 1KF6B 2W3RA 3SEBA 3T3NA 4HKQA 1FRDA 3AB5A 3CWIA 4JPSA 2N9LA 4RNAA 2BS3B 4YWGG 2X38A 2BTEA 1EWYC 1E9MA 4ITKA 4JE3B 3C8YA 1N63A 2PIAA 1RM6C 4RGOS 1AWDA 2B76B 5JXVA 1TJEA 1L4ZB 1HQRD 2Q5WD 4WH4A 3MHZA 5BYRA 1SE4A 1ZXIA 1PDXA 3EA6A 4YSXB 3AEDB 1L6UA 3BYYB 3NVVA 3URYA 2JWUA 5BMGA 2J4XA 2WP9B 1HZ5A 1KLGD 2M19A 2K22A 2JQRB 2EKIA 4OZCA 2PMVA 3U52E 4C7ZA 2ACZB 1I4RA 1FFVA 3HVDA 2ZW1A 3NUHB 5BYSA 2JSVX 1FCLA 4RFBA 1FIQA 3ZJUA 1SB3C 3IT6B 3FILA 3VRBB 3AN1A 3V05A 3W1SA 4RH6A 2VZKB 1V8CA 2OHFA 3TEXA 1NEKB 1K52A 4L2YA 1E10A 4YTPB 1QILA 2INNE 5EE1A 2M56B 3AE2B 3P4PB 3ZJVA 2HTME 1F2RC 2BB6A 4WIPA 1WWTA 3AE4B 1P7FA 2WXJA 4D2KA 1YNTE 2AQ3B 2LUMA 2QSDA 1PGAA 3P63A 2XN9C 3U7ZA 1R7SA 2ON8A 3IAS1 3AV8A 3AE7B 3W2DA 5D3IB 4AQ7A 3MFGA 1SF0A 2DYMA 1MI0A 2WU2B 3FILB 2L1AA 1KFYB 2D5GA 4A8XC 1ESFA 4YSYB 1ZOYB 1L4DB 2QJLA 1QF6A 4RF0A 4WURA 4C80A 1XLPA 3P4RB 2QEJC 2J52A 4KGTA 1HEZE 1DOXA 1TKYA 1SJED 5LNK1 1CK1A 1ENFA 3GP7A 1IUEA 2MJ3A 4XWWA 4KGSA 3AE5B 1TY2A 4YT0B 1GPXA 3AE9B 1P7EA 1SE3A 1CZPA 4REZA 2AQ2B 2PVOD 1EU4A 3VR8B 5HI1A 2IPKD 2PVGC 3PZ7A 1NI3A 4GDLB 3Q8EA 1ZUD2 2YEPF 2VZKD 3MP9A 4OHJA 1EU3A 4DQOC 4Q2JA 2Y5PA 4XWTA 4ZRPA 3BK1A 4HJGE 4KGRA 5EE3A 3ZQ4A 4ZHOA 1FNVA 4A55A 1JCKB 2QMTA 4YTMB 2WXQA 3Q8BA 2G1EA 2PKOA 2CJOA 1M4VA 5H8YE 2E3TA 4L1BA 3HUIA 2K0PA 1VZ6A 1XLQA 1ZDVA 5D3DA 5BMIA 1B1ZA 4DXGA 2PTLA 4NAMA 1V97A 2N7JA 1C4PA 1DGJA 1OQQA 1D6EC 1TZOA 1UUPA 4ZOHC 1TY0A 4WWMA 2KDMA 4KX6B 3Q8FA 1EM7A 2WXPA 1E7PB 3MC0B 1YN4A 2I2YA 1ZE3D 1XCTL 2RDGA 1I4PA 3J9CA 4EE2A 1MHHE 4N6EB 3I9V1 3BIID 1A70A 4O1NA 1N5XA 2GI9A 2WLBA 3W5VB 3ZJTA 1V1PB 1DOYA 2WXMA 3U2SC 1KLUD 3SFEB 2Z8LA 3GS2A 1HZ6A 2BT6A 4A9AA 1FFUA 3NVWA 3N9YC 1J7BA 1VJKA 1FNUA 2YEPB 2LMCA 3KWLA 3P1MA 3ZYYX 1JWBD 1PFDA 4CQNA 2CU3A 1T3QA 1C4AA 2BB5A 1NYRA 5TSSA 1AYFA 3SFDB 2LFIA 5EE9A 3AE3B 2INPE 4RGTA 2IJ0A 4JX1C 3I57A 1AW7A 2FBWB 1YJIA 1VZ8A 3KWVA 1FCCC 3RFZB 3R2IA 4JWSC 1JWAD 1UGJA 3O13A 3V3XA 3AM9A 1GB4A 2WXNA 2NTTA 1SJHD 4JWUC 4TMAB 3FAHA 3AEGB 1PYWD 2JXTA 4OW0A 3PO0A 3P4SB 1JWUD 4XDDA 4HEA1 2K3UA 3ABVB 3TEYA 2J42A 3DWMA 3TEWA 4M0WA 3PZ8A 1FEHA 3HVZA 4GDKB 1QQRA 5EE0A 2L52A 2BBCA 1JW9D 2ICIA 3UI3A 2G9HD 2KMMA 3AH7A 4WQMA 2MEKA 3VRAB 4MACA 1TS3A 2KAJA 1ACCA 1D4BA 1TKEA 2R61A 3SR6A 2NTSA 1F77A 1GOZA 1XLOA 2AX5A 5E6JA 2EELA 3DWGC 4HKZE 1UWMA 4MT5A 3TUOA 4XE0A 1T5XD 1VLBA 1BXTA 3BVMA 3IT4B 4TQ0A 1IGDA 1QOBA 4YTNB 5GXGB 3R8BA 1F0ZA 2FE8A 4OZAA 1JALA 1Q10A 3ETRA 3MJ5A 1VZ7A 2V0GA 1CJEA 2RPVA 1IGCA 3FC4A 1EWCA 4USAA 2LHDA 3Q8CA 1ZXHA 3H8HA 1JRPA 3VR9B 2V3PA 2V3NA 1V1OA 5MPOA 1D5MC 1K53A 2LHEA 1Y56A 2KN4A 4KKJA 4MM3B 1F2RI 2WXOA 2WXFA 4TSSA 2WXLA 3AE1B 5HHDG 3B2FA 2N0SB 1JWMD 1WGKA 3TSSA 1N61A 1L0YB 2BYTA 1STEA 1ET6A 1FRRA 4R3DA 1YMHE 2K9XA 1QOGA 4NJCA 2JYTA 2K5PA 3AMZA 4FXCA 1FD6A 3E56A 1JMLA 3BYTB 4RGMA 1TYGB 2BW2A 4ARCA 1ZP0B 2PLPA 3P42A 1MHXA 2V4IB 1ZPSA 3U4EG 1BUIC 3CIRB 1E0ZA 1HXYD 2WDQB 1VR9A 1PGXA 1KH0A 1QOAA 4US9A 1I4QA 3AEBB 1HA5A 4H2AA 4WAFA 1XF5L 1XXGA 4IKGA 2SAKA 2MJEA 4IDIA 3R2TA 4RGNA 2AQ1B 2LGIA 2WU5B 3KQ4A 2IGDA 1D5XC 1JQ4A 1FXIA 2WXKA 3ZGZA 1CQVA 4GLSC 4UDUC 4DXFA 3LB8C 2TSSA 4ZYSA 2SEBD 3IAM1 2QIEB 1SXTA 1IBXA 3TEZA 1SE2A 3EGRA 3KLSX 1QKZA 1FO4A 2WDRB 3EUB2 2E6XA 1TKGA 2W3SA 3NVYA 4TQ1A 5HG2A 1WRIA 5T8IA 3HRDD 1MPEA 3T3OA 1ET9A 3WCQA 5H92C 4N59A 4NZLB 5C2TB 2W82A 3GB1A 2DWQA 4A90A 1KTKA 2W55A 1C4CA 1J7AA 2RDHA 3LYYA 1FNWA 3W5UB 4LLGM 2WS3B 2WXHA 4US8A 4J3OD 1FM0D 1PUTA 3BK2A 1QT9A 2H89B 2WNMA 1SBBB 2HDEA 1L0VB 3NZ3A 2LJIA 2GB1A 1ROEA 3AE6B 2XNAC 1XLNA 2KQ4X 5D7GA 2WXGA 1TS5A 3OWEB 3B2GA 2IGGA 4XDCA 1IBXB 1RFKA 1UWXA 1TS2A 1VDVA 2J53A 1JROA 2ZW0A 4RF1A 4YSZB 1T6BX 1XEEA 1I7HA 2DYOA 1YJJA 2WXIA 1N62A 5AUKA 1KRHA 1FMAD 1NYQA 1TS4A 3NS1A 4N58A 1SEBD 1D5ZC 1K51A 1QOFA 1VRAB 1L5PA 2OEDA 3BZDB 4ZRQA 1RYJA 1BMLC 5FR3A 5HFYA 1WSPA 2LEKA 1E6EB 5G5HA 4L23A 5G5GA 2KACA 3W9CB 3IXSA 4C7YA 3AEEB 5FKAC 1YQ3B 1NENB 2Y3AA 2RMMA 4B0MA 1C77A 2IDYA 1XO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W A;  1NVI D;  4LTU A;  2K5P A;  3AMZ A;  1FIQ A;  4FXC A;  1SB3 C;  4N6E B;  3BII D;  1A70 A;  3VRB B;  3AN1 A;  1TYG B;  1N5X A;  4YXD B;  2WLB A;  1WXQ A;  4P6V F;  1ZP0 B;  3W5V B;  1DOY A;  1J7C A;  3SFE B;  1V8C A;  2OHF A;  3P4Q B;  3CIR B;  1E0Z A;  2BT6 A;  2JX5 A;  4A9A A;  1FFU A;  2WDQ B;  3NVW A;  1NEK B;  1E10 A;  1J7B A;  1VJK A;  1QOA A;  4US9 A;  4YTP B;  3AEB B;  3KWL A;  3P1M A;  3NVZ A;  2WDV B;  5EE1 A;  2M56 B;  3AE2 B;  3P4P B;  1JWB D;  1PFD A;  1SIJ A;  2HTM E;  3ZYY X;  1WWT A;  2MJE A;  2BS4 B;  3AE4 B;  3AEF B;  4IDI A;  2CU3 A;  2WU5 B;  1T3Q A;  1L6V A;  4ZHP A;  2Y5C A;  3L4P A;  3AE8 B;  1QLB B;  1NYR A;  3SFD B;  1AYF A;  3P63 A;  5EE9 A;  3AE3 B;  1FXI A;  4HRS A;  1JQ4 A;  1OQR A;  5C3J B;  1R7S A;  3LXF A;  4JX1 C;  2FBW B;  3AV8 A;  1YJI A;  3AE7 B;  3LB8 C;  1FXA A;  4JWS C;  1JWA D;  1SF0 A;  2H88 B;  2WQY B;  2WU2 B;  3AM9 A;  2QIE B;  2K9X A;  1N60 A;  1KFY B;  2MH7 A;  3AEC B;  1ZOY B;  4YSY B;  1RWS A;  2L83 A;  4JWU C;  1FO4 A;  2QJL A;  2WDR B;  3AEA B;  3EUB 2;  3B9J A;  3FAH A;  2W3S A;  1TKG A;  1QF6 A;  3NVY A;  3AEG B;  1WRI A;  2BS2 B;  3PO0 A;  4C80 A;  3HRD D;  1XLP A;  1OFF A;  2CJN A;  3P4S B;  3P4R B;  3ABV B;  5AUI A;  3WCQ A;  5H92 C;  3DWM A;  2DBY A;  3NRZ A;  2W54 A;  1DOX A;  1TKY A;  4N59 A;  3HVZ A;  5C2T B;  2DWQ A;  2MJD A;  1IUE A;  2W55 A;  2MJ3 A;  4HRO A;  1J7A A;  5EE0 A;  2L52 A;  1JW9 D;  3AE5 B;  1B9R A;  3AH7 A;  2KMM A;  4WQM A;  3W5U B;  2WS3 B;  4US8 A;  4YT0 B;  1GAQ B;  3VRA B;  1FM0 D;  1PUT A;  1YQ4 B;  2KAJ A;  3AE9 B;  1GPX A;  1TKE A;  3SR6 A;  1WYG A;  1CZP A;  1XLO A;  1QT9 A;  2AX5 A;  2H89 B;  2PVO D;  3VR8 B;  3DWG C;  3RPF C;  1DOI A;  1UWM A;  2PVG C;  1L0V B;  1NI3 A;  1KF6 B;  1VLB A;  2W3R A;  1FRD A;  3AB5 A;  1ZUD 2;  1ROE A;  3AE6 B;  1XLN A;  3CWI A;  1QOB A;  4YTN B;  5GXG B;  3B2G A;  1F0Z A;  1RFK A;  5EE3 A;  1JAL A;  1VDV A;  4ZHO A;  3ETR A;  1JRO A;  2BS3 B;  4YSZ B;  4YTM B;  1CJE A;  2G1E A;  3FC4 A;  4USA A;  1EWY C;  2PKO A;  2CJO A;  1JRP A;  3VR9 B;  1I7H A;  1E9M A;  5H8Y E;  4ITK A;  2E3T A;  1YJJ A;  1N62 A;  1N63 A;  3HUI A;  2PIA A;  1RM6 C;  5AUK A;  5MPO A;  1KRH A;  1AWD A;  1FMA D;  1NYQ A;  1XLQ A;  2B76 B;  3NS1 A;  1TJE A;  4N58 A;  2Q5W D;  1QOF A;  1L5P A;  3AE1 B;  1ZXI A;  3B2F A;  1PDX A;  4YSX B;  1RYJ A;  3AED B;  2N0S B;  1L6U A;  3NVV A;  2LEK A;  1WGK A;  1E6E B;  1N61 A;  1V97 A;  5G5H A;  2WP9 B;  1DGJ A;  2M19 A;  1OQQ A;  2K22 A;  2JQR B;  2EKI A;  5G5G A;  3W9C B;  4ZOH C;  1FRR A;  4C7Y A;  4WWM A;  3AEE B;  1YQ3 B;  4KX6 B;  1NEN B;  2ACZ B;  4C7Z A;  1E7P B;  1QOG A;  1FFV A;  1XO3 A; 
#chains in the Genus database with same CATH topology
 1NVI D;  4MGZ E;  4LTU A;  2JYE A;  5HKH A;  2IGH A;  2OJW A;  1WXQ A;  4JLC A;  2EMS A;  2FUG 1;  1J7C A;  3P4Q B;  1C9F A;  2GMI C;  1ZKH A;  5BYQ A;  4FUL A;  4LJO B;  5JHA A;  2WDV B;  2XEW A;  2LWP A;  2MRP A;  1SIJ A;  3VVW B;  3C0R B;  5D94 A;  2BS4 B;  3AEF B;  3TL5 A;  4LCD E;  4ZHP A;  3L4P A;  4MSQ B;  2HTH A;  3A4R A;  4TUU A;  1OQR A;  5D6J B;  3LXF A;  2LRW A;  3ZKJ C;  2WXR A;  4B0E A;  2D3B A;  4OVZ A;  2LJ5 A;  2WQY B;  2ONQ A;  5IA7 A;  1U4A A;  3MC8 A;  2MH7 A;  2PPH A;  1RWS A;  2K8C A;  2L83 A;  3WAL A;  3TBL D;  3DHH C;  2BS2 B;  4NAW B;  1V5O A;  4PYU A;  2BYF A;  2KT7 A;  4W9E A;  2K6D B;  1DYQ A;  5J18 A;  1B9R A;  4AJY B;  1GAQ B;  2QIL A;  4AS1 A;  4B95 A;  4EZL A;  4ZRK A;  3RPF C;  1DOI A;  4QAY A;  3D32 A;  2LVP A;  2FCS A;  3WA0 A;  2MBE A;  2I1K A;  4JE3 B;  3C8Y A;  2KD0 A;  1X1M A;  1RM6 C;  4RGO S;  3KH0 A;  4WH4 A;  3VXW A;  3MHZ A;  3L17 A;  4G0N B;  2PE9 A;  1L6U A;  3URY A;  1E90 A;  2JWU A;  2J4X A;  3DVN V;  2M19 A;  2L00 B;  2C9W B;  1T0Q C;  4C7Z A;  3ZNZ B;  4BZA A;  2ZW1 A;  5IP4 D;  3L54 A;  3UIO B;  1UBI A;  3RNG C;  1XT9 B;  1SB3 C;  1OTR B;  1D3Z A;  3FIL A;  3VRB B;  3W1S A;  4XZ4 A;  3DBR B;  3IFW B;  2N7E A;  2KTF A;  1E7V A;  4K7U A;  1K52 A;  2LGD A;  3H7P A;  3N1Y C;  4ZRJ A;  1QIL A;  5EE1 A;  2M56 B;  1FPY A;  4A3P A;  1YNT E;  2QSD A;  1PGA A;  2XN9 C;  3U7Z A;  1OEY A;  5D3I B;  4AQ7 A;  2KX0 A;  3MFG A;  2KWV B;  2G4D B;  2D5G A;  4OVV A;  2QJL A;  2N1V A;  1QF6 A;  2DAJ A;  4WUR A;  3HHM A;  2KHW B;  2J52 A;  5KHQ A;  2C7N B;  2IBI B;  4KGS A;  3N1Z C;  1GPX A;  3A9J A;  1P7E A;  3SD5 A;  2PVO D;  5EDS A;  2IPK D;  2WHI A;  2MX2 A;  2YEP F;  1EU3 A;  2L3Z A;  2K25 A;  1Z2M A;  4ZHO A;  2WXQ A;  3Q8B A;  2G1E A;  1M4V A;  1YX6 B;  4L1B A;  2K0P A;  1VZ6 A;  4WQO B;  3RMK C;  3BIN A;  1C4P A;  1OQQ A;  1D6E C;  4C00 A;  1TY0 A;  2IND C;  4WWM A;  3Q8F A;  1WM2 A;  3MC0 B;  2FID A;  4GOC A;  2I2Y A;  1ZE3 D;  1I4P A;  2IY1 B;  4EOY A;  3VUW A;  2JY6 A;  3GZN B;  3W5V B;  1IYF A;  3U2S C;  2IO3 B;  2Z8L A;  3M95 A;  2KO3 A;  3GS2 A;  3I5J C;  3TJP A;  3M63 B;  4K1R B;  3V60 A;  1HE8 A;  2K6Q A;  3QAR A;  1C4A A;  3OJ3 A;  5TSS A;  2LI5 A;  3AE3 B;  4RGT A;  3I57 A;  1AW7 A;  2FBW B;  5IO9 A;  3W1Y A;  3RFZ B;  1FCC C;  3R2I A;  2WXN A;  2NTT A;  1SJH D;  4JWU C;  4OW0 A;  2GOW A;  3PO0 A;  3WAN A;  3TEY A;  3TEW A;  5GMV A;  4P7I A;  2L52 A;  2G9H D;  2KMM A;  3AH7 A;  3APF A;  3VTW A;  1TS3 A;  1WR6 E;  1OEY J;  4MT5 A;  1T5X D;  2WYQ A;  4TQ0 A;  1JAL A;  2KLC A;  1CJE A;  2RPV A;  5AZG A;  4F7Z A;  3H7P B;  1JRP A;  1TT5 B;  2V3P A;  2ZVN A;  4XX5 A;  2FCQ A;  2LHE A;  1Y56 A;  4KKJ A;  4M0W B;  2UU7 A;  3VUX A;  2WXF A;  3Q14 C;  1GC6 A;  4IC7 B;  4KSK C;  3TSS A;  1T0Y A;  4AJW A;  1ET6 A;  2D11 A;  1V80 A;  1QOG A;  1MFW A;  3PRP B;  2FCM A;  2K5P A;  2OJR A;  1JML A;  4KSL C;  3RNA C;  1ZP0 B;  2MP2 B;  4RM8 A;  3ZIM A;  3UF8 A;  4BKG A;  1VR9 A;  3ZRF A;  3AEB B;  3PS6 A;  4WAF A;  1WJU A;  1XXG A;  4WWO A;  4RGN A;  2AQ1 B;  2IGD A;  1D5X C;  2WXK A;  1YOV B;  3CSF A;  4FJY A;  4BBN F;  1CQV A;  4GLS C;  4UDU C;  1P1A A;  4ZYS A;  2SEB D;  3IAM 1;  3QA8 A;  4WJP A;  1IBX A;  1TZ1 A;  4W9J A;  1SE2 A;  3TEZ A;  2WDR B;  3QX1 A;  2C7H A;  2L0F A;  1ZW7 A;  5C2T B;  3GB1 A;  4A90 A;  1WFY A;  1J7A A;  1E8Y A;  2WS3 B;  1P98 A;  4J3O D;  3DHG C;  2M1M A;  1QT9 A;  2BKR B;  2LGX A;  2VRR B;  1XLN A;  2IGG A;  4XDC A;  2FNJ B;  3MJW A;  1TS2 A;  1VDV A;  2J53 A;  1TTN A;  4YSZ B;  3ZXV A;  3AU4 A;  3VTV A;  4BVU C;  1XEE A;  1I7H A;  2DYO A;  1YJJ A;  4FJZ A;  1N62 A;  2ZNV B;  4BOS C;  1NYQ A;  3NS1 A;  1SEB D;  1QOF A;  1VRA B;  1H4R A;  2OED A;  4MGK E;  1GG3 A;  2KDB A;  3R66 C;  5E6P A;  2KWU B;  4L23 A;  2KAC A;  4MDK E;  3OJ4 B;  5FKA C;  1YQ3 B;  1C3T A;  4FAD A;  1XO3 A;  4REZ A;  1XCQ L;  1ZDX A;  3EHV A;  4RCO A;  2CR5 A;  2QCZ A;  4XYC A;  4ZDV A;  4ARI A;  2JX5 A;  3H6N A;  4WWN A;  4II2 B;  3B1L X;  2JZP A;  1I4G A;  4LNO A;  3E9S A;  3NY5 A;  1C78 A;  1L6V A;  2KXJ A;  4JQW C;  4AOF A;  4I6L B;  1YN5 A;  3DBS A;  4HRS A;  5C3J B;  2I38 A;  1WRD B;  3BVG A;  2JRH A;  3ZXR A;  3PRE A;  3TCA A;  3AEC B;  3DBH B;  4LNF A;  4MGY E;  3AEA B;  3IHP C;  1MVK A;  2Z0D B;  4ANW A;  2Y5B B;  1WIA A;  4GN1 A;  5AUI A;  4FN2 A;  2MJD A;  3A9K B;  4AWJ A;  2DLB A;  2G45 B;  3H7S A;  3ZNI D;  1RFA A;  3Q3F A;  5JZE B;  1A5R A;  4HDO A;  3SEB A;  1FRD A;  2YVC A;  3AB5 A;  3RCZ A;  2NVU I;  2N9L A;  4RNA A;  5TR5 A;  2BS3 B;  2N9X A;  2X38 A;  2BTE A;  1V9J A;  4W9D A;  1E9M A;  1AWD A;  5JXV A;  2Q5W D;  1ZXI A;  4GXB A;  3RUL A;  4YSX B;  3Q3N C;  2W9N A;  4OZC A;  3QK0 A;  1WJN A;  3ZLZ A;  2FIF A;  1FIQ A;  5LLI A;  3IT6 B;  3AN1 A;  3V05 A;  2NBU A;  1Q1O A;  1IP9 A;  2ZVO A;  3RZF A;  2OHF A;  3T8M A;  4ICV A;  3TEX A;  1E10 A;  2BQQ A;  2IO2 B;  2JZ3 B;  2C60 A;  2INN E;  3APC A;  2D07 B;  3P4P B;  3ZJV A;  2HTM E;  3AE4 B;  1P7F A;  2IO0 B;  3VAW A;  3N30 A;  4ANV A;  1V49 A;  3B08 A;  3W2D A;  1SF0 A;  1MI0 A;  2WU2 B;  1RRB A;  2JVC A;  4HVB A;  1ESF A;  4YSY B;  2AEH A;  2O2V A;  1XLP A;  3P4R B;  2N4F A;  5G2N A;  2QEJ C;  2N1W A;  1HEZ E;  1SJE D;  1CK1 A;  2YLM A;  3AE5 B;  1WXV A;  3DVG Y;  2WX1 A;  2BWF A;  4PYZ A;  3AE9 B;  1SE3 A;  2LXC A;  3JYU A;  1EU4 A;  4M8N A;  1WGR A;  4CHK A;  3PZ7 A;  4BOZ B;  4GDL B;  1ZUD 2;  1MG8 A;  3UQA A;  3DDC B;  4XWT A;  1V2Y A;  2M8S A;  4GSW A;  4GGQ A;  3PVL A;  3H9D A;  4G3X B;  3ZQ4 A;  1FNV A;  4A55 A;  2IYD B;  2BF8 B;  4F8C B;  5H8Y E;  3VDZ A;  2V3S A;  1GUA B;  1ZDV A;  2ZJD A;  4P1B C;  3ZDT A;  5BMI A;  4A20 A;  2RD0 A;  3WAM A;  1V97 A;  2N7J A;  3PTF C;  2O6V D;  1YIW A;  2REX A;  1E7P B;  2WX0 A;  4S0R A;  4FBJ B;  5C1Z A;  1YN4 A;  4FLH A;  3PT2 B;  1HTQ A;  1XCT L;  2RDG A;  3J9C A;  1WI0 A;  2KDI A;  4RMA A;  4O1N A;  3DOW A;  4IG7 B;  2DZK A;  1N5X A;  1WY8 A;  2WLB A;  2WXM A;  1I42 A;  4DXA B;  3KYC D;  1ISN A;  2GBJ A;  3WAO A;  1FFU A;  4LNN A;  3N9Y C;  1YJ1 A;  1J7B A;  2NBV B;  2YEP B;  3K9O B;  2CU1 A;  1JWB D;  2KJ6 A;  4MH0 E;  4CQN A;  1LM8 B;  1T3Q A;  2HJ8 A;  3OLM D;  4WAA A;  4IUM B;  1YJI A;  2GBR A;  2DZM A;  4TMA B;  5IN7 A;  3AEG B;  1PYW D;  2JXT A;  4NY0 A;  2J42 A;  3QJZ A;  3KUC B;  4M0W A;  3HVZ A;  1Z5S B;  1MG4 A;  3HM3 A;  2CS4 A;  1WXA A;  3VHT C;  2QC8 A;  4URK A;  3KW5 B;  4MAC A;  4XC2 A;  2M0X A;  4NJ7 A;  4E74 A;  4LDT D;  3JSV A;  1IGD A;  1QOB A;  5GXG B;  1F0Z A;  2FE8 A;  4OZA A;  3KUD B;  1Q10 A;  3MJ5 A;  1WZ3 A;  1IGC A;  1EWC A;  2LHD A;  3H8H A;  2MP2 A;  2V3N A;  1P0R A;  2BKF A;  1I35 A;  2WXO A;  4TSS A;  3RNE C;  3B2F A;  2ZPN A;  1C1Y B;  1WGK A;  1L0Y B;  3NS8 A;  2BYT A;  3L13 A;  1FRR A;  1YMH E;  1WJ6 A;  4BBN C;  4M01 A;  4NJC A;  1F52 A;  2UWQ A;  5DCN A;  3X0W A;  2O2V B;  4FXC A;  4W9K A;  3E56 A;  2L8J A;  3BYT B;  4RGM A;  2BW2 A;  4ARC A;  3X23 A;  3P42 A;  3T9L A;  4IM3 A;  4ANX A;  2V4I B;  3U4E G;  4CYE A;  3CIR B;  4WWP A;  1HXY D;  1PGX A;  1KH0 A;  1I4Q A;  1XF5 L;  1R4M I;  2NBW B;  4IKG A;  3CF6 E;  3EC8 A;  2MJE A;  4IDI A;  4KZ0 A;  3R2T A;  2K8B A;  3KQ4 A;  3VH4 B;  2D3G A;  4DDG D;  1JQ4 A;  3UGB B;  4CO7 A;  2B3A A;  1UF0 A;  4DXF A;  2D3C A;  1KLV A;  2DHZ A;  3KLS X;  4DK5 A;  1TIF A;  3VUY A;  5HG2 A;  1WRI A;  2KFK A;  2JUO A;  3T3O A;  1CMX B;  3WCQ A;  3C19 A;  5C23 A;  5CHW A;  2W82 A;  1C4C A;  4W9I A;  4IWP A;  3W5U B;  4LLG M;  3QHT A;  1FM0 D;  5DPT A;  3Q3O C;  2H89 B;  2RR9 A;  4HPP A;  1E8X A;  3AE6 B;  1J0G A;  2WXG A;  1TS5 A;  4K3B A;  4RF1 A;  1WYW B;  1WE7 A;  2JT4 B;  2WWZ A;  3QCA A;  5AUK A;  1KRH A;  2X8X X;  1FMA D;  1UEL A;  4N58 A;  2A5U A;  4HWI B;  1K51 A;  3RNB C;  1L5P A;  5FR3 A;  1WSP A;  4NQL B;  2MCN B;  4TKN A;  4GB9 A;  3IXS A;  2MW5 A;  2UYZ B;  3AEE B;  1XD3 B;  2RMM A;  2IDY A;  1BT0 A;  1GB1 A;  1AN8 A;  3APD A;  1YX5 B;  2GRI A;  4LNI A;  4MH8 A;  2MWS B;  4PS3 A;  5FK9 C;  4AP4 C;  1P3Q U;  1WGH A;  2I1J A;  4YXD B;  4P16 A;  1NI2 A;  2OOB B;  2DNF A;  4C4V B;  3NVZ A;  3A9K A;  1YN3 A;  4KKI A;  4MEM A;  2KQS A;  1UNS A;  2Y5C A;  3Q69 A;  3AE8 B;  3MC9 A;  3JSV B;  1WX8 A;  2NMQ A;  3QC8 B;  2BGF A;  1LO5 D;  5DPS A;  1I4X A;  1FXA A;  2H88 B;  5IOI A;  2KKC A;  1PGB A;  3BVZ A;  1K50 A;  4GMV A;  4A6Q A;  1UBQ A;  1I4H A;  5JH5 C;  2BYE A;  2CJN A;  2M0A A;  1L2N A;  1WMH B;  4B9K A;  2DBY A;  3NRZ A;  2EKE C;  3ML9 A;  4OVU A;  4LK0 M;  1C79 A;  3PZD A;  2PW9 A;  2V4L A;  3BWU D;  3VQI A;  2M17 A;  1V86 A;  1XQQ A;  1YQ4 B;  1WYG A;  4G50 A;  5BMH A;  3NZS A;  3BY4 B;  3TIX A;  3DQV A;  2PE6 B;  3CWI A;  4JPS A;  5IKC M;  3UIN B;  4K81 A;  4DHJ D;  1V6E A;  3DBL I;  2MBQ A;  2KLG A;  1N63 A;  2B76 B;  1HQR D;  5BYR A;  1SE4 A;  2K8H A;  5DPW A;  1PDX A;  3WIM A;  3AED B;  1WXM A;  2KVR A;  3PSE B;  2WP9 B;  1HZ5 A;  1KLG D;  5E6O A;  2K22 A;  2JQR B;  2EKI A;  3V6C B;  2PMV A;  4GDK A;  4MSM B;  3VFK A;  2J7Q B;  4PS8 A;  1I4R A;  4LJP B;  2JSV X;  3R3M A;  2KFK B;  3LJ3 A;  4K7S A;  2MLB A;  4DHZ E;  4RH6 A;  1V8C A;  5IAA C;  1NEK B;  1R4N I;  4YTP B;  4JIO U;  3HM6 X;  3AE2 B;  3U30 A;  4W9C A;  4WIP A;  1F2R C;  2BB6 A;  1F9J A;  1WWT A;  1RAX A;  4D2K A;  3L10 B;  4E3C A;  1JRU A;  1R7S A;  3IAS 1;  4NQK E;  3AV8 A;  4PK1 A;  4GDL A;  1GNU A;  4W9H A;  4M00 A;  2G3Q B;  1L7Y A;  4A8X C;  1ZOY B;  1AAR A;  4IWQ A;  3RI7 C;  3FKY A;  4KVG B;  4C80 A;  2RSU A;  2XK5 B;  2JWZ A;  3P2B A;  2KC2 A;  3LDZ E;  3GP7 A;  1IUE A;  4EZJ A;  2FCN A;  2MJ3 A;  1LFD A;  2NS5 A;  4YT0 B;  4ASW C;  2AL3 A;  3OAW A;  2AQ2 B;  5HI1 A;  2PVG C;  3Q8E A;  2VZK D;  3PRM B;  3BK1 A;  3AI5 A;  4G11 A;  1Q5W B;  2DEN B;  2KQ7 A;  4KGR A;  5EE3 A;  4HLE A;  2QMT A;  1MJD A;  2CJO A;  1GC7 A;  2C7M B;  1YD8 U;  3NZU A;  2E3T A;  2MBO A;  1XLQ A;  4BFR A;  3IBE A;  3JW0 X;  1B1Z A;  4KZC A;  2PTL A;  4NAM A;  2RGF A;  1DGJ A;  3R7R A;  2BYV E;  3HIZ A;  1TZO A;  4ZOH C;  4KX6 B;  2WXP A;  3IVF A;  1N6Z A;  4EE2 A;  1MHH E;  2L0T A;  3I9V 1;  1A70 A;  1TBE A;  2GI9 A;  1DOY A;  4JL9 A;  1T0S C;  1HZ6 A;  4ACF A;  2LUE A;  4DDI D;  2LMC A;  3ZYY X;  3ONS A;  1PFD A;  2JF5 A;  2BB5 A;  1NYR A;  1AYF A;  2LFI A;  5EE9 A;  5AEK B;  2CHX A;  2IJ0 A;  4LNK A;  1VZ8 A;  2A4Z A;  4KDI C;  4KDL B;  4JWS C;  1UGJ A;  3O13 A;  3AM9 A;  1IPG A;  2KTR B;  3PPA A;  1JWU D;  4NJ6 A;  4XDD A;  4HEA 1;  3I3T B;  5AZH A;  2K3U A;  2KZR A;  2KMC A;  3PV1 A;  2LGS A;  4GDK B;  1QQR A;  2BBC A;  2ICI A;  2QHO A;  3UI3 A;  1OQY A;  3PLU A;  3NJT A;  1ACC A;  5J2R A;  3L0W B;  2J0J A;  1F77 A;  1GOZ A;  1XLO A;  2NTS A;  2RPQ A;  3DWG C;  1UWM A;  3TUO A;  4XE0 A;  1VLB A;  4BAX A;  3BVM A;  2N9E B;  4HPL B;  4YTN B;  2AWT A;  4P1C C;  1E8W A;  3FC4 A;  1NDD A;  1ZXH A;  3RT3 B;  3VR9 B;  3MHS D;  5MPO A;  1K53 A;  4MM3 B;  1F2R I;  2CHW A;  4RM9 A;  3AE1 B;  5HHD G;  1UH6 A;  3N20 C;  1T0R C;  2MA9 B;  5FR6 A;  2D10 A;  1STE A;  4MEL A;  4R3D A;  4M8M A;  1K8R B;  1RLF A;  4EFO A;  3AMZ A;  4BKS A;  3KYD D;  4IW0 A;  2IO1 B;  1TYG B;  3GOE A;  2JXX A;  2PLP A;  1MHX A;  3KUZ A;  2ZCC A;  2LXA A;  1WX7 A;  1E0Z A;  3JVZ X;  4GIV A;  2WDQ B;  2D3A A;  1M94 A;  2GLS A;  2SAK A;  4EKU A;  3OG5 A;  2KYW A;  2LGI A;  2LVO A;  1FXI A;  3RUI B;  1WZ0 A;  3ZGZ A;  3DPD A;  3Q3J A;  4KV2 A;  2TSS A;  3ZTC A;  5J17 A;  1SXT A;  1TGZ B;  4GU2 A;  1J8C A;  1FO4 A;  4HPM B;  2KJR A;  2ZCB A;  3EUB 2;  1S3S G;  2W3S A;  1J19 A;  1TKG A;  2LD9 A;  3EFC A;  2LRU A;  4I6P A;  1MPE A;  2AYO B;  3ZNG C;  3NOB A;  2L7R A;  1HTO A;  4NZL B;  2DWQ A;  1KTK A;  3VH3 B;  3M62 B;  3A33 B;  2LVQ A;  3MTN B;  1FNW A;  4US8 A;  4ICU A;  1PUT A;  3BK2 A;  1WGY A;  2KDE B;  3SDL C;  2LZ6 A;  3NZ3 A;  1L0V B;  2BWE S;  2LJI A;  3NG0 A;  3Q2A C;  3ZO5 B;  2XNA C;  2KQ4 X;  1R4M B;  5D7G A;  3OWE B;  3B2G A;  3K9P B;  2HD5 B;  1RFK A;  2ZW0 A;  3V62 A;  4II3 B;  4NPN A;  2L05 A;  1EUV B;  1PQS A;  3U7D A;  1TS4 A;  4NNJ B;  4C4V A;  2KDF B;  3N3K B;  3EFU A;  4ZRQ A;  2BPS A;  4N9F 4;  5HFY A;  3ZW3 A;  2FUH B;  3DCG A;  1OGW A;  4EZK A;  3HK0 A;  1NEN B;  1UZX B;  2N9P C;  4E71 A;  1C77 A;  2WXL A;  1N5W A;  1GJZ A;  1SGH A;  4KIK B;  1F1H A;  2DAF A;  2LGY A;  2MQJ A;  5DPR A;  4ZYN A;  4HDQ A;  2CKH B;  4P6V F;  2N9K A;  2GBK A;  2IY0 B;  4MJS B;  5BO4 B;  3H1U A;  1JWS D;  2JRI B;  1WMH A;  1VCB A;  2NPT A;  3A1Q B;  4DHJ B;  4ZRI A;  3PGE A;  1LXD A;  2M4N A;  2XBB C;  1FXT B;  1QLB B;  2L32 A;  2KX3 A;  1KJT A;  4OZB A;  5CX3 A;  2K39 A;  4EEW A;  2NR2 A;  4PT5 A;  5I4D A;  1Q0W B;  3ML8 A;  3GE8 C;  1L0X B;  2QDF A;  1N60 A;  4IOI E;  3Q8A A;  3B9J A;  2KWD A;  2JU6 X;  1V81 A;  1SSN A;  1OFF A;  1EO6 A;  2BVC A;  2W54 A;  1E7U A;  1V1P A;  4A3O A;  4HRO A;  3WAP A;  4TV3 A;  3W1S C;  3N1X C;  3DBR I;  3AU5 A;  3ZTD A;  4C56 C;  1KM7 A;  1C76 A;  3L16 A;  3KVF B;  1KF6 B;  2W3R A;  3T3N A;  3QAQ A;  2GBN A;  2KMA A;  4HKQ A;  2MBH A;  1H8C A;  3UIP B;  4YWG G;  2K1F A;  4IM0 A;  1EWY C;  1YQB A;  2RDB C;  4ITK A;  2GBM A;  2PIA A;  2KJH B;  1TJE A;  1L4Z B;  1SE9 A;  2LAS A;  3EA6 A;  4MGI E;  3BYY B;  3NVV A;  3A4S C;  5BMG A;  3U52 E;  3O65 B;  2ACZ B;  4W9F A;  1FFV A;  3HVD A;  3NUH B;  5BYS A;  1FCL A;  4RFB A;  4B6W A;  2O6V A;  3ZJU A;  1VD2 A;  3AXC A;  4X57 B;  3R7Q A;  3ZUN A;  2VZK B;  5CHV C;  3L08 A;  2XK5 A;  3DVG X;  4FA6 A;  3IG3 A;  4L2Y A;  4XGA B;  4K3C A;  2WXJ A;  2AQ3 B;  3DBL B;  2LUM A;  3P63 A;  3M3J A;  3U8Z A;  5LXI B;  2ON8 A;  2INC C;  3AE7 B;  2DYM A;  3FIL B;  2L1A A;  1KFY B;  4FJV B;  4K7W A;  4HCP B;  1L4D B;  2PJH A;  3CMM B;  2Z0E B;  4RF0 A;  2VH1 A;  2MSE D;  4KGT A;  1DOX A;  1TKY A;  5LNK 1;  1ENF A;  3UQB A;  3RNF C;  2KNB A;  1WX9 A;  4XWW A;  3V6E B;  1TY2 A;  2AL6 A;  1P9D U;  3GZN I;  3PHX B;  2KOX A;  1CZP A;  1WGG A;  1ZGU B;  3VR8 B;  3I63 C;  3DVN U;  1NI3 A;  1R4N B;  2PEA A;  3MP9 A;  1WF9 A;  4OHJ A;  4DQO C;  4Q2J A;  2Y5P A;  4ZRP A;  4EUT A;  2ZNV C;  4HJG E;  1LGR A;  1JCK B;  4YTM B;  1LQB A;  1UGM A;  2PKO A;  2NPT B;  3ECI A;  3HUI A;  1G6J A;  2VH2 A;  5L83 A;  2DZJ A;  1SIF A;  5D3D A;  1KOT A;  5E6N A;  4DXG A;  3RZW C;  4J6I A;  3ZDM C;  3V61 A;  1EF5 A;  3A9J B;  4DHZ B;  4DWF A;  1UUP A;  4W9L A;  5AZF A;  2KDM A;  2R2O A;  1WR1 A;  2DYB A;  1EM7 A;  1Y8R C;  1E8Z A;  1WM3 A;  4N6E B;  2ZZP B;  2NCN A;  3BII D;  4AUQ C;  1S1Q B;  3NHE B;  3ZJT A;  5KHO A;  1V1P B;  4HCN B;  1KLU D;  3SFE B;  2KTR A;  3DHI C;  2HJ1 A;  2G4S A;  2BT6 A;  4A9A A;  3NVW A;  1VJK A;  1FNU A;  3KWL A;  3P1M A;  1WXS A;  4WJN A;  3Q6B A;  2HE7 A;  4HXD A;  2CU3 A;  4JGH B;  4W9G A;  3SFD B;  2INP E;  4JX1 C;  3Q3M C;  2JZZ A;  3KWV A;  2DZI A;  1JWA D;  3V3X A;  1UD7 A;  2EMT A;  1GB4 A;  2V9H A;  4M02 A;  3RN9 C;  2KK8 A;  3FAH A;  2FAZ A;  2R2Q A;  3P4S B;  4IM2 A;  3ABV B;  5G55 A;  3DWM A;  4MM3 A;  2MBB B;  3PZ8 A;  1FEH A;  1WJ4 A;  3PLV A;  5L95 C;  5EE0 A;  4FHJ A;  1JW9 D;  3PRZ A;  4WQM A;  3QIJ A;  1WH3 A;  2MEK A;  2KN5 A;  3VRA B;  2KAJ A;  1D4B A;  1TKE A;  2R61 A;  3SR6 A;  2O6V B;  5CTR C;  2AX5 A;  5E6J A;  2EEL A;  4WJQ A;  4HKZ E;  2C5L C;  4YL8 A;  2WGS A;  3CST A;  1BXT A;  4BKS D;  3IT4 B;  3RYT A;  3TMP B;  3R8B A;  2KC1 A;  3ETR A;  1VZ7 A;  2V0G A;  2ZEQ A;  4USA A;  3GE3 C;  3Q8C A;  2J0M A;  1V1O A;  1D5M C;  2KN4 A;  3N32 A;  4NAW A;  5LXH A;  2N0S B;  1JWM D;  2KFJ A;  1EF1 A;  1N61 A;  3SU8 X;  2V1Y A;  2K9X A;  2MHJ A;  1WGD A;  2JYT A;  1FD6 A;  2DX5 B;  4I6N B;  3VTU A;  4IWO A;  1ZPS A;  1BUI C;  2JPH A;  2L76 A;  4DBG A;  3B0A A;  3QWZ B;  1NBF C;  1QOA A;  4US9 A;  2ASQ A;  3AUL A;  1HA5 A;  2ZPY A;  4H2A A;  3ENE A;  2KWC A;  2WU5 B;  2KVZ A;  3LB8 C;  2IZV B;  4LDT B;  2QIE B;  4WJO A;  3EGR A;  3ZRC A;  4ANU A;  1V5T A;  1QKZ A;  2E6X A;  4TQ1 A;  3NVY A;  5T8I A;  3HRD D;  1ET9 A;  5H92 C;  2WDT B;  2Z59 B;  4N59 A;  4F1S A;  2W55 A;  5JHB A;  4BKT A;  2RDH A;  5CHF A;  3EEC A;  3RD2 A;  3LYY A;  3QQ8 B;  4FHK A;  2KAN A;  2WXH A;  4HJK A;  2CHZ A;  2WNM A;  1SBB B;  3ALB A;  2HDE A;  3RNC C;  2J0K A;  2GB1 A;  3S2A A;  1ROE A;  2D2Q A;  4KIK A;  1IBX B;  1UWX A;  1JRO A;  2N7D A;  4S17 A;  1T6B X;  4PS7 A;  1E5W A;  1WE6 A;  4MJS A;  2WXI A;  3ZNH B;  1D5Z C;  3A1Q A;  3ZVV A;  3BZD B;  1RYJ A;  1BML C;  2LEK A;  1E6E B;  3PHW B;  5G5H A;  3SHQ A;  3DBH I;  5G5G A;  5D2M B;  3W9C B;  4HK2 A;  4C7Y A;  1QZE A;  2Y3A A;  4B0M A; 
#chains in the Genus database with same CATH homology
 1N5W A;  1NVI D;  1XCQ L;  1GB1 A;  1AN8 A;  1ZDX A;  2JYE A;  4LTU A;  4RCO A;  2GRI A;  2IGH A;  4MH8 A;  5FK9 C;  4YXD B;  4P6V F;  1WXQ A;  2N9K A;  2FUG 1;  1J7C A;  4P16 A;  3P4Q B;  4ARI A;  1C9F A;  2JX5 A;  1JWS D;  5BYQ A;  2JZP A;  1I4G A;  2WDV B;  3NVZ A;  1SIJ A;  1YN3 A;  2BS4 B;  3AEF B;  3E9S A;  1C78 A;  4KKI A;  1UNS A;  1L6V A;  4ZHP A;  2Y5C A;  3L4P A;  3Q69 A;  3AE8 B;  1QLB B;  1YN5 A;  2L32 A;  2NMQ A;  4HRS A;  4OZB A;  1OQR A;  5C3J B;  3LXF A;  2WXR A;  2I38 A;  3BVG A;  4B0E A;  1LO5 D;  4PT5 A;  5I4D A;  4OVZ A;  1I4X A;  1FXA A;  2H88 B;  2ONQ A;  2WQY B;  1L0X B;  1N60 A;  1PGB A;  4IOI E;  3BVZ A;  2MH7 A;  3AEC B;  1K50 A;  1RWS A;  2L83 A;  4A6Q A;  3Q8A A;  3AEA B;  3B9J A;  2KWD A;  2JU6 X;  1MVK A;  1I4H A;  1SSN A;  2BS2 B;  4NAW B;  1OFF A;  2CJN A;  2M0A A;  5AUI A;  2DBY A;  3NRZ A;  2W54 A;  4LK0 M;  1V1P A;  1C79 A;  2MJD A;  1DYQ A;  2PW9 A;  4HRO A;  1B9R A;  2DLB A;  3BWU D;  3VQI A;  1GAQ B;  1YQ4 B;  2QIL A;  1WYG A;  4AS1 A;  4C56 C;  3RPF C;  1DOI A;  5BMH A;  1C76 A;  1KF6 B;  2W3R A;  3SEB A;  3T3N A;  4HKQ A;  1FRD A;  3AB5 A;  3CWI A;  4JPS A;  2N9L A;  4RNA A;  2BS3 B;  4YWG G;  2X38 A;  2BTE A;  1EWY C;  1E9M A;  4ITK A;  4JE3 B;  3C8Y A;  1N63 A;  2PIA A;  1RM6 C;  4RGO S;  1AWD A;  2B76 B;  5JXV A;  1TJE A;  1L4Z B;  1HQR D;  2Q5W D;  4WH4 A;  3MHZ A;  5BYR A;  1SE4 A;  1ZXI A;  1PDX A;  3EA6 A;  4YSX B;  3AED B;  1L6U A;  3BYY B;  3NVV A;  3URY A;  2JWU A;  5BMG A;  2J4X A;  2WP9 B;  1HZ5 A;  1KLG D;  2M19 A;  2K22 A;  2JQR B;  2EKI A;  4OZC A;  2PMV A;  3U52 E;  4C7Z A;  2ACZ B;  1I4R A;  1FFV A;  3HVD A;  2ZW1 A;  3NUH B;  5BYS A;  2JSV X;  1FCL A;  4RFB A;  1FIQ A;  3ZJU A;  1SB3 C;  3IT6 B;  3FIL A;  3VRB B;  3AN1 A;  3V05 A;  3W1S A;  4RH6 A;  2VZK B;  1V8C A;  2OHF A;  3TEX A;  1NEK B;  1K52 A;  4L2Y A;  1E10 A;  4YTP B;  1QIL A;  2INN E;  5EE1 A;  2M56 B;  3AE2 B;  3P4P B;  3ZJV A;  2HTM E;  1F2R C;  2BB6 A;  4WIP A;  1WWT A;  3AE4 B;  1P7F A;  2WXJ A;  4D2K A;  1YNT E;  2AQ3 B;  2LUM A;  2QSD A;  1PGA A;  3P63 A;  2XN9 C;  3U7Z A;  1R7S A;  2ON8 A;  3IAS 1;  3AV8 A;  3AE7 B;  3W2D A;  5D3I B;  4AQ7 A;  3MFG A;  1SF0 A;  2DYM A;  1MI0 A;  2WU2 B;  3FIL B;  2L1A A;  1KFY B;  2D5G A;  4A8X C;  1ESF A;  4YSY B;  1ZOY B;  1L4D B;  2QJL A;  1QF6 A;  4RF0 A;  4WUR A;  4C80 A;  1XLP A;  3P4R B;  2QEJ C;  2J52 A;  4KGT A;  1HEZ E;  1DOX A;  1TKY A;  1SJE D;  5LNK 1;  1CK1 A;  1ENF A;  3GP7 A;  1IUE A;  2MJ3 A;  4XWW A;  4KGS A;  3AE5 B;  1TY2 A;  4YT0 B;  1GPX A;  3AE9 B;  1P7E A;  1SE3 A;  1CZP A;  4REZ A;  2AQ2 B;  2PVO D;  1EU4 A;  3VR8 B;  5HI1 A;  2IPK D;  2PVG C;  3PZ7 A;  1NI3 A;  4GDL B;  3Q8E A;  1ZUD 2;  2YEP F;  2VZK D;  3MP9 A;  4OHJ A;  1EU3 A;  4DQO C;  4Q2J A;  2Y5P A;  4XWT A;  4ZRP A;  3BK1 A;  4HJG E;  4KGR A;  5EE3 A;  3ZQ4 A;  4ZHO A;  1FNV A;  4A55 A;  1JCK B;  2QMT A;  4YTM B;  2WXQ A;  3Q8B A;  2G1E A;  2PKO A;  2CJO A;  1M4V A;  5H8Y E;  2E3T A;  4L1B A;  3HUI A;  2K0P A;  1VZ6 A;  1XLQ A;  1ZDV A;  5D3D A;  5BMI A;  1B1Z A;  4DXG A;  2PTL A;  4NAM A;  1V97 A;  2N7J A;  1C4P A;  1DGJ A;  1OQQ A;  1D6E C;  1TZO A;  1UUP A;  4ZOH C;  1TY0 A;  4WWM A;  2KDM A;  4KX6 B;  3Q8F A;  1EM7 A;  2WXP A;  1E7P B;  3MC0 B;  1YN4 A;  2I2Y A;  1ZE3 D;  1XCT L;  2RDG A;  1I4P A;  3J9C A;  4EE2 A;  1MHH E;  4N6E B;  3I9V 1;  3BII D;  1A70 A;  4O1N A;  1N5X A;  2GI9 A;  2WLB A;  3W5V B;  3ZJT A;  1V1P B;  1DOY A;  2WXM A;  3U2S C;  1KLU D;  3SFE B;  2Z8L A;  3GS2 A;  1HZ6 A;  2BT6 A;  4A9A A;  1FFU A;  3NVW A;  3N9Y C;  1J7B A;  1VJK A;  1FNU A;  2YEP B;  2LMC A;  3KWL A;  3P1M A;  3ZYY X;  1JWB D;  1PFD A;  4CQN A;  2CU3 A;  1T3Q A;  1C4A A;  2BB5 A;  1NYR A;  5TSS A;  1AYF A;  3SFD B;  2LFI A;  5EE9 A;  3AE3 B;  2INP E;  4RGT A;  2IJ0 A;  4JX1 C;  3I57 A;  1AW7 A;  2FBW B;  1YJI A;  1VZ8 A;  3KWV A;  1FCC C;  3RFZ B;  3R2I A;  4JWS C;  1JWA D;  1UGJ A;  3O13 A;  3V3X A;  3AM9 A;  1GB4 A;  2WXN A;  2NTT A;  1SJH D;  4JWU C;  4TMA B;  3FAH A;  3AEG B;  1PYW D;  2JXT A;  4OW0 A;  3PO0 A;  3P4S B;  1JWU D;  4XDD A;  4HEA 1;  2K3U A;  3ABV B;  3TEY A;  2J42 A;  3DWM A;  3TEW A;  4M0W A;  3PZ8 A;  1FEH A;  3HVZ A;  4GDK B;  1QQR A;  5EE0 A;  2L52 A;  2BBC A;  1JW9 D;  2ICI A;  3UI3 A;  2G9H D;  2KMM A;  3AH7 A;  4WQM A;  2MEK A;  3VRA B;  4MAC A;  1TS3 A;  2KAJ A;  1ACC A;  1D4B A;  1TKE A;  2R61 A;  3SR6 A;  2NTS A;  1F77 A;  1GOZ A;  1XLO A;  2AX5 A;  5E6J A;  2EEL A;  3DWG C;  4HKZ E;  1UWM A;  4MT5 A;  3TUO A;  4XE0 A;  1T5X D;  1VLB A;  1BXT A;  3BVM A;  3IT4 B;  4TQ0 A;  1IGD A;  1QOB A;  4YTN B;  5GXG B;  3R8B A;  1F0Z A;  2FE8 A;  4OZA A;  1JAL A;  1Q10 A;  3ETR A;  3MJ5 A;  1VZ7 A;  2V0G A;  1CJE A;  2RPV A;  1IGC A;  3FC4 A;  1EWC A;  4USA A;  2LHD A;  3Q8C A;  1ZXH A;  3H8H A;  1JRP A;  3VR9 B;  2V3P A;  2V3N A;  1V1O A;  5MPO A;  1D5M C;  1K53 A;  2LHE A;  1Y56 A;  2KN4 A;  4KKJ A;  4MM3 B;  1F2R I;  2WXO A;  2WXF A;  4TSS A;  2WXL A;  3AE1 B;  5HHD G;  3B2F A;  2N0S B;  1JWM D;  1WGK A;  3TSS A;  1N61 A;  1L0Y B;  2BYT A;  1STE A;  1ET6 A;  1FRR A;  4R3D A;  1YMH E;  2K9X A;  1QOG A;  4NJC A;  2JYT A;  2K5P A;  3AMZ A;  4FXC A;  1FD6 A;  3E56 A;  1JML A;  3BYT B;  4RGM A;  1TYG B;  2BW2 A;  4ARC A;  1ZP0 B;  2PLP A;  3P42 A;  1MHX A;  2V4I B;  1ZPS A;  3U4E G;  1BUI C;  3CIR B;  1E0Z A;  1HXY D;  2WDQ B;  1VR9 A;  1PGX A;  1KH0 A;  1QOA A;  4US9 A;  1I4Q A;  3AEB B;  1HA5 A;  4H2A A;  4WAF A;  1XF5 L;  1XXG A;  4IKG A;  2SAK A;  2MJE A;  4IDI A;  3R2T A;  4RGN A;  2AQ1 B;  2LGI A;  2WU5 B;  3KQ4 A;  2IGD A;  1D5X C;  1JQ4 A;  1FXI A;  2WXK A;  3ZGZ A;  1CQV A;  4GLS C;  4UDU C;  4DXF A;  3LB8 C;  2TSS A;  4ZYS A;  2SEB D;  3IAM 1;  2QIE B;  1SXT A;  1IBX A;  3TEZ A;  1SE2 A;  3EGR A;  3KLS X;  1QKZ A;  1FO4 A;  2WDR B;  3EUB 2;  2E6X A;  1TKG A;  2W3S A;  3NVY A;  4TQ1 A;  5HG2 A;  1WRI A;  5T8I A;  3HRD D;  1MPE A;  3T3O A;  1ET9 A;  3WCQ A;  5H92 C;  4N59 A;  4NZL B;  5C2T B;  2W82 A;  3GB1 A;  2DWQ A;  4A90 A;  1KTK A;  2W55 A;  1C4C A;  1J7A A;  2RDH A;  3LYY A;  1FNW A;  3W5U B;  4LLG M;  2WS3 B;  2WXH A;  4US8 A;  4J3O D;  1FM0 D;  1PUT A;  3BK2 A;  1QT9 A;  2H89 B;  2WNM A;  1SBB B;  2HDE A;  1L0V B;  3NZ3 A;  2LJI A;  2GB1 A;  1ROE A;  3AE6 B;  2XNA C;  1XLN A;  2KQ4 X;  5D7G A;  2WXG A;  1TS5 A;  3OWE B;  3B2G A;  2IGG A;  4XDC A;  1IBX B;  1RFK A;  1UWX A;  1TS2 A;  1VDV A;  2J53 A;  1JRO A;  2ZW0 A;  4RF1 A;  4YSZ B;  1T6B X;  1XEE A;  1I7H A;  2DYO A;  1YJJ A;  2WXI A;  1N62 A;  5AUK A;  1KRH A;  1FMA D;  1NYQ A;  1TS4 A;  3NS1 A;  4N58 A;  1SEB D;  1D5Z C;  1K51 A;  1QOF A;  1VRA B;  1L5P A;  2OED A;  3BZD B;  4ZRQ A;  1RYJ A;  1BML C;  5FR3 A;  5HFY A;  1WSP A;  2LEK A;  1E6E B;  5G5H A;  4L23 A;  5G5G A;  2KAC A;  3W9C B;  3IXS A;  4C7Y A;  3AEE B;  5FKA C;  1YQ3 B;  1NEN B;  2Y3A A;  2RMM A;  4B0M A;  1C77 A;  2IDY A;  1XO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...