4ZHPA

The crystal structure of potato ferredoxin i with 2fe-2s cluster
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ASYKVKLITPDGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDVTIETHKEEELTAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potato Ferredoxin I
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhpA00
1PUTA 1TYGB 3W9CB 4USAA 1OFFA 1N5XA 1TKYA 2HTME 1L5PA 2JX5A 2E3TA 3AM9A 1CJEA 1JWAD 2WQYB 1TJEA 2WU5B 1FXIA 2Y5CA 3P1MA 4US9A 1JWBD 1KF6B 2PVOD 3FC4A 3HVZA 3AEDB 1NENB 1QF6A 2BS4B 4JWUC 5EE1A 2N0SB 2BT6A 5GXGB 1V8CA 2LEKA 1WXQA 3DWGC 1YJJA 1T3QA 5H92C 5AUIA 4YSYB 2CJOA 1R7SA 4WQMA 3VR8B 1EWYC 4P6VF 4YTMB 1QOGA 2MJEA 3AE2B 4YXDB 1J7CA 1SIJA 3CWIA 4YT0B 1J7BA 4ITKA 3VR9B 1FMAD 1KFYB 2DWQA 5EE0A 2KAJA 2WP9B 1AWDA 1ZOYB 3AEGB 3P63A 1XLNA 4YSZB 2M19A 1NI3A 1TKEA 5C2TB 3WCQA 3BIID 1SF0A 1J7AA 3VRAB 1WRIA 1N61A 2BS3B 2W3SA 2FBWB 3B2GA 3NRZA 4N59A 1DOXA 1E0ZA 3RPFC 1UWMA 1FRRA 1VJKA 1ZXIA 1AYFA 1QLBB 3AE3B 4ZHOA 1QOBA 2WS3B 3LXFA 1JQ4A 3P4SB 3VRBB 3ZYYX 1PDXA 1WYGA 3P4RB 1E6EB 3HRDD 4YTPB 2WDQB 2MJDA 4HRSA 2K22A 5G5HA 1E9MA 2PIAA 3AE5B 1YJIA 2H88B 2DBYA 4ZHPA 4C7ZA 3AEBB 3SFDB 5EE9A 1DOIA 1ZP0B 3B9JA 1FFVA 5MPOA 1L6VA 1YQ4B 3AEEB 3PO0A 1VLBA 2KMMA 2W54A 1FM0D 4KX6B 3HUIA 1DGJA 3AE4B 3ETRA 3FAHA 1F0ZA 3NS1A 3EUB2 2ACZB 3AECB 3CIRB 1QOFA 2W55A 2PKOA 3AV8A 1L6UA 3AE9B 1V97A 4LTUA 3LB8C 4FXCA 3AE1B 1GAQB 3W5UB 3AEFB 1NYQA 1N5WA 1DOYA 2G1EA 2QJLA 3AMZA 1IUEA 3W5VB 3P4QB 1RM6C 2CJNA 2WDVB 1XO3A 1N60A 1FFUA 2CU3A 4US8A 1WGKA 4YTNB 1RWSA 1JALA 1SB3C 1N63A 1OQRA 4ZOHC 1RFKA 2H89B 3ABVB 3AE7B 4N6EB 5G5GA 1FIQA 1I7HA 1L0VB 1CZPA 1QOAA 2QIEB 1B9RA 1KRHA 3NVZA 1XLOA 3NVVA 4C80A 1ROEA 1FO4A 3AN1A 1WWTA 2PVGC 3P4PB 3AE8B 1QT9A 1FRDA 2WLBA 3NVWA 2K9XA 2W3RA 1PFDA 1E10A 1E7PB 1FXAA 2L52A 1JRPA 1XLPA 1JROA 2L83A 4JX1C 4YSXB 1RYJA 4WWMA 2JQRB 2K5PA 2BS2B 1A70A 3DWMA 2WDRB 5AUKA 3AB5A 2B76B 3B2FA 3KWLA 3SFEB 4IDIA 3SR6A 1OQQA 1GPXA 2M56B 1YQ3B 3AH7A 2Q5WD 1VDVA 2WU2B 1XLQA 3L4PA 3NVYA 5H8YE 4C7YA 1ZUD2 2MJ3A 5EE3A 2OHFA 5C3JB 1NVID 4N58A 3AE6B 1N62A 1NEKB 2AX5A 1JW9D 4JWSC 4HROA 1NYRA 1TKGA 2MH7A 3AEAB 4A9AA 2EKIA
chains in the Genus database with same CATH superfamily
5D3IB 3ONSA 4DHZE 3APDA 4IM2A 1L5PA 4CQNA 3Q3MC 1TJEA 3N32A 3P1MA 2WXPA 4A3OA 1NENB 2KTFA 3U7ZA 1VZ8A 1FCCC 1WXQA 3K9PB 2GBKA 1YJJA 4AWJA 1R7SA 4NQKE 2HTHA 2KTRA 1WM3A 5C2TB 1NI3A 3RMKC 2MLBA 2K6QA 2FBWB 2K8CA 5HG2A 3Q8FA 1HTQA 4W9LA 3APFA 3NJTA 2BKFA 3PHXB 3PTFC 2UWQA 3DPDA 2KJ6A 1VZ7A 2BW2A 3UQAA 4MEMA 2PIAA 4MACA 3A9KA 1EU3A 4LNNA 4C7ZA 2N4FA 2LD9A 3O13A 5G2NA 2PE9A 2PMVA 2M17A 1UBIA 4NAMA 2L05A 2ACZB 1WJNA 2KWDA 2JRHA 3H7PB 3AE1B 4RF0A 2ZZPB 2AQ2B 4J3OD 3VUYA 2LRWA 1IBXB 5D3DA 2KO3A 2NPTB 1JALA 4BBNF 2K39A 1CZPA 5T8IA 3C8YA 3JSVA 2YLMA 1LM8B 1XD3B 2LXAA 3MP9A 4OVUA 1E8YA 3VUXA 1E8XA 1T6BX 2M8SA 2WDRB 3B2FA 3SFEB 2CR5A 3AH7A 3NVYA 2VRRB 4FBJB 4E74A 1UUPA 2JYEA 1EO6A 4II3B 3KW5B 3OJ3A 3PRPB 1P3QU 3WIMA 3TEWA 2IJ0A 4C4VA 2KHWB 2QC8A 2RSUA 5E6JA 4LJPB 3ZJTA 4JWUC 4YWGG 4RCOA 2KZRA 3TCAA 2E6XA 1FNUA 1GC6A 2ZNVB 1I4RA 1BXTA 3RNEC 1K50A 3EA6A 2BPSA 1KH0A 4IWQA 2KDMA 1J7BA 1WY8A 4G0NB 3B0AA 3O65B 4BBNC 1J7AA 1YIWA 2XK5B 4ZYNA 2Y5BB 3A9JB 1IYFA 2IY1B 3W1SC 1L0XB 2ZPNA 3N3KB 5IN7A 2NR2A 1YJIA 3Q2AC 1KLGD 3RI7C 3NHEB 4NAWB 1MI0A 1R4NB 4EZLA 1YN3A 5DPWA 3GE8C 3T3OA 4E3CA 4GDLA 3AV8A 3ML9A 2V4IB 3PHWB 4M02A 2D11A 3V61A 1N6ZA 1AW7A 2DZKA 2LFIA 4TMAB 2K1FA 1N60A 1P1AA 1U4AA 1FIQA 4II2B 1CK1A 1D6EC 2RPVA 3EC8A 3VH4B 3V3XA 2WLBA 3NVWA 1WGGA 3X0WA 4YSXB 4LJOB 1XCQL 1V5TA 2JQRB 2MSED 3M95A 3V62A 4FA6A 1JWSD 3B1LX 2A5UA 2JWZA 1VDVA 3VTVA 1CQVA 2NBWB 4FJYA 4GDKB 4HJGE 4ICUA 1TYGB 1I4XA 3JW0X 4LNKA 5D2MB 1N5XA 4W9FA 4ZRJA 2QILA 2L3ZA 2E3TA 2PPHA 3PT2B 1CJEA 2BVCA 5JHAA 1EU4A 1SJHD 4RFBA 4DQOC 2KD0A 1V1OA 1V8CA 2BB6A 2ZJDA 3K9OB 4RF1A 3UI3A 3N30A 2BB5A 2CHWA 2I38A 4MH8A 3I5JC 3CWIA 2M4NA 4WWOA 1UBQA 3DOWA 3R66C 2QMTA 3AULA 2N9LA 1FCLA 1V5OA 1XLNA 2FNJB 2DNFA 3ZNHB 4OVVA 2C60A 3RZWC 1UWMA 1TGZB 4DHJD 3QHTA 4ZYSA 5IAAC 1QLBB 3RNGC 4RGMA 1QOBA 3DHIC 1GB4A 3T3NA 4OZBA 1WFYA 3BZDB 3ZQ4A 3EECA 2ZNVC 4XX5A 3N20C 1WX9A 3ZKJC 2DENB 2WX0A 4MSMB 1EM7A 1Y56A 4L1BA 4WAFA 5E6PA 5IKCM 4RH6A 1EF1A 1ZXHA 4EE2A 4GGQA 1WXMA 4ZRIA 1L6UA 3PLUA 3AE9B 3DVGY 4BAXA 4LTUA 2KQ7A 3M63B 4LK0M 2W82A 4GLSC 1J8CA 3ZJUA 2J0MA 2FCSA 4US8A 2W9NA 5E6OA 1LXDA 1KM7A 2WGSA 1D5XC 3KUZA 3TEXA 1V81A 1FO4A 4IM0A 3V05A 3DCGA 3KUDB 1ZDXA 2HDEA 2MWSB 3GZNI 1I4GA 1JWUD 1JCKB 3DQVA 1YX5B 3C0RB 2R61A 4LLGM 2JT4B 4GSWA 3IBEA 2RDHA 2LUEA 1ZUD2 2LMCA 3JSVB 4A90A 2R2QA 4KKIA 3AEAB 4TSSA 4M0WA 1M4VA 4P7IA 3CMMB 3TIXA 1RLFA 4XDCA 3SDLC 2JX5A 3QC8B 2MRPA 4US9A 1QQRA 4NY0A 1BT0A 2PVOD 2IPKD 3I63C 5HHDG 4BKSA 1YN5A 2GOWA 3VHTC 5H92C 5J17A 4WQMA 1OQYA 4P6VF 1WJ4A 3VR9B 4C4VB 2ONQA 2KX3A 1ZOYB 2Y3AA 3VRAB 3VQIA 2LASA 3NG0A 4TQ1A 3RPFC 3H1UA 3CF6E 1TS4A 2JPHA 2OEDA 3ZYYX 2KVRA 1V80A 3Q8EA 1GUAB 5HI1A 3R8BA 3BK1A 2J0KA 2WWZA 1F9JA 2AQ3B 1DOIA 1YX6B 4JE3B 1VLBA 2KMMA 2NBUA 1WMHB 2WXLA 5BYSA 3ML8A 5LXHA 1QILA 1ZKHA 4P16A 4DWFA 4OHJA 1ESFA 3ZNID 1FXTB 2LI5A 1YJ1A 3CSTA 3KLSX 5EDSA 4EZKA 3UIOB 1MHXA 5CTRC 3HHMA 1XF5L 2DAJA 3ECIA 1ROEA 1UGJA 4ICVA 1FRDA 1G6JA 2K9XA 2W3RA 4DXFA 3S2AA 1WH3A 4J6IA 3AU4A 2J0JA 2IO3B 2KMAA 1K51A 2V0GA 2K3UA 2RDBC 2J53A 3Q3JA 4NJ7A 2EELA 2KMCA 4USAA 3Q8BA 4GN1A 3PZDA 2V3PA 4ZRKA 1VZ6A 2LXCA 3AM9A 4ZDVA 2Y5CA 5IA7A 2FUG1 3GP7A 3WAMA 5IP4D 3AEDB 3ZXVA 2L0TA 4HPLB 2TSSA 5FR6A 2X38A 3ZNZB 3MJWA 1FNVA 1GOZA 2IO2B 4WAAA 4C00A 2IGGA 4NZLB 2DYOA 3ZUNA 3NRZA 4N59A 2KN5A 4M01A 4HXDA 2KNBA 1ZXIA 2N1VA 1Q0WB 3IVFA 3AE3B 3CSFA 3L16A 2LUMA 2WXMA 2KC2A 1E8WA 4ARCA 1EF5A 3MC0B 1D5ZC 2XEWA 2J7QB 1SEBD 3AE5B 1VR9A 1FPYA 2N7EA 3HUIA 3W1YA 2Y5PA 3EUB2 1QOFA 3MC8A 4HEA1 1IPGA 2WNMA 2C5LC 1KOTA 1PGAA 3VTUA 3OAWA 1QOAA 1I35A 3PGEA 3R2TA 2KJRA 2UU7A 3DBHI 4JGHB 2A4ZA 1E7UA 4ANUA 5AEKB 4GOCA 4DHJB 2AL6A 4GIVA 2IO1B 4WIPA 1GPXA 1OQQA 1YQ3B 3RNBC 1FNWA 3SEBA 4PK1A 1NVID 3E9SA 2AX5A 2K25A 5LLIA 3HIZA 1YNTE 2MH7A 4W9JA 1XQQA 1C77A 2DZJA 4NNJB 1P7EA 3W9CB 2HTME 2WXHA 1L4ZB 4CO7A 2MEKA 5G55A 2C7NB 3RFZB 4FULA 3BVMA 1ET9A 3KVFB 2UYZB 3PSEB 1WGYA 1QOGA 2GB1A 2GRIA 3A1QB 1C9FA 3IFWB 1WRIA 4MT5A 1HE8A 2GBMA 2FIDA 4O1NA 2O6VA 4X57B 3QQ8B 3TEZA 2ZW1A 1WE7A 3N1YC 3TSSA 1E6EB 2RD0A 4FJZA 2MBBB 1Q10A 2K22A 2HE7A 2B3AA 4AS1A 3B9JA 1ZP0B 3DBSA 1RAXA 1J0GA 3PV1A 1T0SC 2KACA 3AECB 5J18A 3PPAA 2NVUI 4FXCA 2LRUA 4DBGA 1NYQA 4IW0A 3AMZA 4GMVA 1LFDA 3NS8A 2KOXA 4ANVA 1E10A 1B9RA 1WR6E 1SXTA 2J52A 1V49A 4NQLB 2IDYA 2YEPF 4B9KA 1V9JA 1JROA 2LVQA 1EUVB 4WURA 1A70A 2I2YA 1VD2A 3KWLA 4IDIA 2O2VA 1HEZE 2INDC 2SEBD 1WSPA 2AWTA 3ZW3A 1YOVB 4G50A 3L54A 2MW5A 1YD8U 1SE9A 1D4BA 2CU1A 4IWOA 1WI0A 4L2YA 4ANWA 2BS4B 4EFOA 4XGAB 3AI5A 4ACFA 4B0EA 1V1PB 2PJHA 2MJEA 3QWZB 4YXDB 3HVDA 4EKUA 5C1ZA 3IG3A 2V9HA 5KHOA 3RT3B 3BVZA 2G45B 1VJKA 1AYFA 2DYBA 2FAZA 4RGTA 3P4SB 4PS3A 2D07B 2CHZA 2KLGA 2MA9B 3P2BA 4ARIA 3ZRFA 3NY5A 1E9MA 3VTWA 4ZHPA 1TY0A 3KH0A 2C9WB 4A55A 1XT9B 1K53A 5L95C 1FD6A 3AEEB 2GBJA 1LQBA 4KX6B 1ACCA 4IUMB 4KIKA 1YQBA 1WJUA 2KYWA 1PYWD 4A6QA 1GAQB 2BGFA 3W5UB 3NUHB 4MM3A 3EGRA 4P1BC 5BMIA 2CJNA 1XO3A 1WGKA 3N1ZC 2K8HA 4HDOA 4C80A 2PVGC 2MBHA 5FK9C 2BWES 3V6EB 1F2RC 4RM8A 2C7MB 3PRMB 1PGXA 3FILA 3QX1A 3AB5A 4P1CC 3H9DA 3KQ4A 2KDBA 1IGDA 2JZZA 5IO9A 1PUTA 1TY2A 5JH5C 2RR9A 1RRBA 4KZCA 2C7HA 2INNE 1UF0A 3N1XC 3HM3A 3U8ZA 4HCPB 4EOYA 4W9GA 3C19A 1J7CA 1C4AA 1C1YB 1ZGUB 2D3BA 1R4MB 5EE0A 1SSNA 3P63A 2M19A 1TKEA 2K8BA 2BF8B 4KDIC 3JYUA 3JVZX 1OEYA 1CMXB 3PS6A 4Q2JA 2KFJA 2AL3A 5DPSA 2PEAA 4WJQA 3L13A 1PDXA 1WYGA 5JXVA 1ET6A 4YTPB 4BOZB 2N1WA 4IOIE 3SD5A 3Q3FA 4E71A 1I42A 1WZ3A 4ANXA 2KJHB 1S3SG 2K0PA 1XEEA 4K3CA 2G3QB 2W54A 3ETRA 4HLEA 2IBIB 3NZSA 4XZ4A 2RGFA 2X8XX 2ZCBA 3BY4B 2PKOA 2K6DB 1UELA 2V1YA 3ZNGC 4KKJA 5LXIB 3LB8C 1N5WA 3HM6X 4NPNA 1RM6C 2KTRB 4JIOU 3L17A 1GC7A 2MP2A 1WIAA 2QIEB 1SE4A 2N9PC 3M3JA 4A20A 5DPTA 4W9IA 1ZPSA 3AE8B 4MGYE 4UDUC 2KFKA 4PS8A 3VXWA 2G4SA 3TJPA 2DHZA 3A9KB 3QA8A 5TR5A 1WRDB 2CKHB 2FUHB 1LGRA 4HDQA 1NEKB 1NYRA 4IM3A 1WXSA 3APCA 1WM2A 2REXA 3Q3OC 4BKSD 4GXBA 2DAFA 2KDIA 2L8JA 1JWBD 3WANA 3Q8CA 1FEHA 3ZXRA 1T5XD 2BT6A 2LEKA 4BKTA 4RMAA 3T8MA 2KXJA 2INPE 2KVZA 1D5MC 4G11A 1UZXB 2KQSA 3RUIB 2ON8A 1WE6A 2DWQA 4JL9A 2LJ5A 5FR3A 2D3GA 2BBCA 2JXXA 3B2GA 4MDKE 2L7RA 2ZVOA 3RZFA 5FKAC 2WS3B 3QAQA 2L76A 1IP9A 2MJDA 3BVGA 4MJSA 3MHZA 2FCNA 1OEYJ 2KLCA 3IT4B 2NCNA 3PRZA 3OWEB 1L2NA 3MJ5A 2OJRA 2W55A 1KTKA 3R7QA 4NJ6A 4S17A 3W1SA 1HXYD 5G5HA 1OQRA 2V4LA 3BINA 3MFGA 1XLOA 2WXOA 3QCAA 4BKGA 4AQ7A 1JRPA 3IXSA 4BOSC 1HZ5A 4WWMA 4AP4C 4L23A 5AUKA 3DWMA 2LGSA 2Q5WD 1XLQA 2HD5B 3OLMD 1TT5B 3UINB 4JWSC 2GLSA 1Z5SB 4DDGD 2M0AA 3Q69A 4GDLB 3NZUA 3ZTDA 4ZRPA 1WGDA 4K7SA 3U30A 3T9LA 4XDDA 2HJ8A 4GU2A 2INCC 2VH1A 2CJOA 1D3ZA 3L0WB 4F7ZA 3H7PA 3DVNU 1IBXA 2ZCCA 1UD7A 1AWDA 4AUQC 1R4NI 4YSZB 3MHSD 2NPTA 2JWUA 1DOXA 4KV2A 5DCNA 1SE3A 1HQRD 4HPPA 1TBEA 1S1QB 4KDLB 4HKQA 4DXGA 2N7JA 2DYMA 1I4HA 1UH6A 1FFVA 3RYTA 2WXRA 2YVCA 4KGRA 2KX0A 2IGDA 1C79A 1PQSA 3U7DA 4OZAA 1OGWA 1K8RB 4XC2A 2QJLA 2KC1A 1H8CA 4XWWA 1Q5WB 1RFAA 4R3DA 1NI2A 1TS2A 1TIFA 1V6EA 2Z59B 2LZ6A 5CHFA 3UIPB 2HJ1A 4K7WA 4W9CA 1E7PB 1AN8A 2L52A 1RYJA 1VRAB 3VVWB 3ZO5B 2FIFA 3I57A 2JF5A 2XK5A 2WU2B 4C56C 4B95A 5BYRA 4HKZE 5C3JB 3ZDMC 3A9JA 1JW9D 4HROA 4RNAA 4OZCA 4PT5A 3TL5A 5AZFA 1OFFA 3H7SA 4WWPA 2KDFB 3TMPB 1TKYA 2KDEB 4LNOA 1LO5D 2NBVB 4NAWA 1WZ0A 2N0SB 2RPQA 3A33B 2JZPA 3ZRCA 3A4SC 4HCNB 4MSQB 3VUWA 5CHWA 2L0FA 2JRIB 4LDTD 5E6NA 1L4DB 2O6VD 3WCQA 3BIID 2XNAC 3PZ8A 4PYZA 1FRRA 1WYWB 2KANA 2YEPB 2L32A 5BMGA 2N9KA 1GJZA 3VRBB 4M0WB 4M00A 3VAWA 4IKGA 4M8MA 1KJTA 4FLHA 4S0RA 2MBEA 3ZVVA 3AEBB 1L7YA 2LJIA 2QDFA 2VZKD 4MGZE 4HPMB 4YL8A 4FHKA 4N9F4 4GDKA 3AE4B 3MTNB 2LVOA 2SAKA 3DDCB 2MHJA 1K52A 3WAOA 1E5WA 2NTSA 1I4QA 1WGHA 1UGMA 2CU3A 1RWSA 1SB3C 3UQBA 4MH0E 2J42A 4PYUA 4URKA 4HK2A 5D94A 2ZW0A 2KK8A 3Q3NC 1JMLA 2AQ1B 3BWUD 2WXKA 2BS2B 2G4DB 4XWTA 1A5RA 1WXAA 1SE2A 2EMTA 5H8YE 5EE3A 1N62A 2DX5B 2LVPA 4W9DA 5BYQA 4PS7A 4I6PA 5GMVA 2GBRA 2RMMA 3GZNB 4W9HA 4K1RB 3DWGC 3AXCA 4WJNA 1SBBB 4RM9A 4YSYB 3IHPC 3RNAC 4MELA 3OG5A 2KAJA 1SF0A 2IGHA 2KWCA 2BS3B 1WF9A 1SIFA 4JQWC 1E90A 2JVCA 3TUOA 2PTLA 2FCQA 2BQQA 2D2QA 2DBYA 2GBNA 4TUUA 5JZEB 2LGYA 2QEJC 4ASWC 1MVKA 2MBOA 1L6VA 1XXGA 3DHHC 3WA0A 5KHQA 2CHXA 2KWVB 4M8NA 1C4CA 5CX3A 2MBQA 2JU6X 3URYA 1M94A 2D10A 4XYCA 3W5VB 4NJCA 4B0MA 2DZMA 2WXFA 2H89B 3AE7B 3RNCC 1TZOA 4W9KA 1SGHA 4DXAB 3FKYA 2LHEA 4LNIA 1MG4A 3ZDTA 3PLVA 4AJWA 5JHBA 2JY6A 2LGDA 3HK0A 1YN4A 1OTRB 2BYEA 4WJOA 2AEHA 4KZ0A 2OJWA 4KSLC 4EUTA 2QSDA 3AE6B 4F1SA 4KGTA 4TV3A 4HJKA 3L10B 2L1AA 2DLBA 2M1MA 3GB1A 4REZA 2Z0DB 3SU8X 4HVBA 2G9HD 2BYFA 2PLPA 1TS3A 2WU5B 2FE8A 1KF6B 2V3SA 4EZJA 3N9YC 4KSKC 1QF6A 1V2YA 1V86A 1KLUD 5GXGB 1WMHA 1BMLC 4FJVB 5TSSA 5AUIA 3WALA 3I3TB 2N9EB 3RD2A 4ZRQA 3R3MA 4ITKA 1PGBA 1YMHE 3ZGZA 3AEGB 5J2RA 3DVNV 1SJED 3MC9A 4ZHOA 1Q1OA 1F1HA 4BFRA 4DDID 2JUOA 1JQ4A 3Q6BA 2IYDB 1UWXA 2KN4A 1STEA 1WX8A 3P4RB 3QARA 5D6JB 2ZEQA 1JRUA 5EE9A 2J4XA 3H8HA 1YQ4B 3I9V1 1IGCA 2D3CA 4I6LB 1FM0D 4K3BA 1F77A 3NS1A 2N9XA 3CIRB 1P0RA 2WDTB 1J19A 4QAYA 1UNSA 2NTTA 2EMSA 1Z2MA 4F8CB 3AEFB 1NBFC 2OOBB 4BVUC 1E8ZA 2WDVB 4MGIE 2XBBC 1QZEA 2IO0B 4YTNB 4LDTB 1GB1A 3KYDD 1NDDA 2O6VB 3NVVA 5IOIA 3L08A 4MGKE 3Q8AA 3TBLD 1QT9A 3PREA 4K7UA 2WXGA 1FXAA 3B08A 1XLPA 2Z0EB 5BMHA 3DHGC 4CHKA 4TQ0A 1Y8RC 3DBLB 3SR6A 3TEYA 2QCZA 1ZE3D 3GE3C 4N58A 1TKGA 4A9AA 4WQOB 2VZKB 4JLCA 2MQJA 3AU5A 4I6NB 2WQYB 1WX7A 3DBHB 2IY0B 2I1JA 4IC7B 3RNFC 1GNUA 5HFYA 3VDZA 2GI9A 1EWYC 1SIJA 3GOEA 3EHVA 3LYYA 1ISNA 1F2RI 3KYCD 1WJ6A 1C78A 1C76A 2JZ3B 2W3SA 2XN9C 1E0ZA 3DBRB 2O2VB 1F52A 3SHQA 4HWIB 3U52E 1MG8A 2DZIA 1ZW7A 1WGRA 2CS4A 3NZ3A 4HRSA 1MJDA 3SFDB 4IWPA 1XCTL 4FHJA 2KQ4X 1H4RA 4FN2A 2D3AA 2GMIC 2BKRB 1V97A 4OVZA 4H2AA 3OJ4B 1DOYA 3H6NA 1VCBA 4W9EA 1FFUA 1MPEA 4ZOHC 1N63A 5CHVC 3VR8B 1KRHA 2WYQA 4AJYB 1MFWA 1WWTA 1TZ1A 3D32A 3A1QA 1PFDA 1GG3A 1P7FA 3VFKA 1MHHE 3Q14C 3ZJVA 3QJZA 4JX1C 3X23A 2LHDA 3ALBA 5D7GA 2B76B 3PZ7A 2N7DA 4K81A 2NMQA 4C7YA 2MJ3A 3U4EG 2I1KA 4LNFA 5L83A 2EKIA 4KIKB 3V60A 2MCNB 1P98A 2M0XA 4B6WA 1FXIA 2BYTA 3KUCB 1QKZA 4MM3B 2AYOB 2RDGA 2PE6B 1WR1A 3DVGX 4YTMB 5AZGA 3AE2B 4YT0B 3IT6B 3J9CA 4A3PA 3P42A 3GS2A 4RGNA 3FILB 1N61A 5LNK1 3E56A 4BZAA 4IG7B 3ZIMA 4A8XC 3LXFA 1T0QC 4WWNA 3QK0A 1C4PA 5AZHA 3HRDD 2WDQB 1WXVA 4DHZB 2H88B 1AARA 1TS5A 5MPOA 1P9DU 1DGJA 3PVLA 3VH3B 3R2IA 1JWMD 2WXQA 2G1EA 4WH4A 1IUEA 3LDZE 5I4DA 1ENFA 2WHIA 4N6EB 3EFUA 1I7HA 2NS5A 1V1PA 1T0YA 4D2KA 3AN1A 2V3NA 3P4PB 1X1MA 1L0YB 4XE0A 2BTEA 3IAS1 2M56B 3L4PA 2BWFA 4G3XB 1EWCA 3NOBA 3RCZA 1R4MI 4RGOS 2EKEC 3M62B 4GB9A 4KVGB 1JWAD 2LWPA 4JPSA 3EFCA 3FC4A 3HVZA 3U2SC 2L00B 3UF8A 5EE1A 3UGBB 1HZ6A 2IZVB 3RN9C 2KWUB 2MP2B 1T3QA 1ZDVA 2KKCA 3ENEA 1TTNA 3IAM1 2WXNA 1B1ZA 2R2OA 1FMAD 1KFYB 2KFKB 1KLVA 2WP9B 5C23A 4CYEA 4KGSA 1BUIC 3ZLZA 2JXTA 3LJ3A 5DPRA 3W2DA 2KT7A 4LCDE 4AOFA 3DBLI 2ASQA 1HA5A 5BO4B 3BK2A 1E7VA 3BYYB 2JYTA 4FADA 1HTOA 1DYQA 2WXIA 3R7RA 3QIJA 2LGIA 3PO0A 2ZPYA 3A4RA 3FAHA 1F0ZA 4DK5A 2VH2A 4WJPA 2D5GA 2WX1A 4TKNA 3ZTCA 2LGXA 2JSVX 3P4QB 5HKHA 2QHOA 5G5GA 1RFKA 3ABVB 3KWVA 1L0VB 3NVZA 2PW9A 4EEWA 3DBRI 2ZVNA 1C3TA 3BYTB 2BYVE 2L83A 2FCMA 2K5PA 4MJSB 1T0RC 3WAPA 4OW0A 1I4PA 2ICIA 3RULA 2OHFA 2Z8LA 2MX2A 3V6CB 2WXJA
chains in the Genus database with same CATH topology
5D3IB 2EELA 4REZA 4USAA 2G9HD 3Q8BA 2V3PA 1L5PA 1VZ6A 3AM9A 4CQNA 2PLPA 2WU5B 1TJEA 1TS3A 2FE8A 2Y5CA 3P1MA 2WXPA 2FUG1 3GP7A 1JWBD 1KF6B 3Q8CA 3AEDB 1FEHA 3N9YC 1NENB 1QF6A 1T5XD 3U7ZA 1KLUD 1VZ8A 2BT6A 5GXGB 1FCCC 2LEKA 1WXQA 2TSSA 1BMLC 1YJJA 5TSSA 5AUIA 1R7SA 2X38A 2INPE 1D5MC 4ZRQA 2ON8A 1FNVA 4ITKA 1GOZA 2DWQA 1PGBA 1YMHE 3ZGZA 3AEGB 5C2TB 1NI3A 5FR3A 2IGGA 4NZLB 2DYOA 2BBCA 3NRZA 2FBWB 3B2GA 4N59A 5HG2A 3Q8FA 1ZXIA 3AE3B 5FKAC 1SJED 4ZHOA 2LUMA 2WS3B 2WXMA 1JQ4A 1UWXA 1VZ7A 2BW2A 2KN4A 1STEA 3P4RB 4ARCA 3MC0B 2MJDA 1D5ZC 3BVGA 2PIAA 3MHZA 4MACA 1SEBD 3AE5B 1EU3A 4C7ZA 3O13A 1VR9A 5EE9A 2J4XA 3IT4B 3H8HA 1YQ4B 2PMVA 3I9V1 1IGCA 1FM0D 4NAMA 3HUIA 3OWEB 3MJ5A 1F77A 2Y5PA 3NS1A 3EUB2 2ACZB 3CIRB 1QOFA 2W55A 1UNSA 2KWDA 2NTTA 1KTKA 3AE1B 4HEA1 3AEFB 4RF0A 2AQ2B 2WNMA 4J3OD 1IBXB 3W1SA 5D3DA 1HXYD 2WDVB 1PGAA 4YTNB 1JALA 5G5HA 1GB1A 1OQRA 1CZPA 1QOAA 3MFGA 1XLOA 2WXOA 3NVVA 5T8IA 3Q8AA 3C8YA 3R2TA 1QT9A 3MP9A 4AQ7A 2WXGA 1FXAA 1JRPA 1XLPA 3IXSA 1HZ5A 1T6BX 4WWMA 4L23A 5AUKA 3DWMA 5BMHA 2WDRB 4WIPA 4TQ0A 3B2FA 3SFEB 3SR6A 1GPXA 1OQQA 1YQ3B 3AH7A 2Q5WD 3NVYA 3TEYA 1XLQA 1FNWA 3SEBA 1ZE3D 1NVID 4N58A 3E9SA 2AX5A 4JWSC 1TKGA 1YNTE 2MH7A 4A9AA 1UUPA 2JYEA 2M0AA 1C77A 3Q69A 1P7EA 3W9CB 4GDLB 2VZKB 2HTME 3TEWA 2WXHA 2IJ0A 2WQYB 1L4ZB 2MEKA 4ZRPA 5E6JA 3RFZB 3ZJTA 4JWUC 4YWGG 4RCOA 3BVMA 5HFYA 4XDDA 1ET9A 1FNUA 2E6XA 2GI9A 1I4RA 2CJOA 1BXTA 1K50A 1EWYC 3EA6A 1QOGA 1KH0A 1SIJA 2KDMA 2GB1A 1J7BA 2GRIA 3LYYA 1C9FA 1F2RI 1IBXA 1AWDA 4YSZB 2JWUA 1J7AA 1WRIA 1C78A 1C76A 4MT5A 2W3SA 2XN9C 1DOXA 1E0ZA 4O1NA 1SE3A 1HQRD 3U52E 3TEZA 2ZW1A 1L0XB 3TSSA 1E6EB 3NZ3A 4HKQA 1Q10A 2K22A 4HRSA 4DXGA 2N7JA 2DYMA 1YJIA 1I4HA 1KLGD 3SFDB 1XCTL 4AS1A 4NAWB 3B9JA 1ZP0B 1MI0A 2KQ4X 1FFVA 1YN3A 2WXRA 3T3OA 4KGRA 2KACA 3AECB 3AV8A 2IGDA 2V4IB 1C79A 1V97A 4OVZA 4H2AA 4FXCA 4OZAA 1NYQA 1DOYA 1AW7A 2QJLA 3AMZA 2LFIA 4TMAB 1N60A 4XWWA 1FFUA 1MPEA 4ZOHC 1N63A 4R3DA 1E10A 1TS2A 3VR8B 1B9RA 1FIQA 1KRHA 1CK1A 1D6EC 2RPVA 1WWTA 1SXTA 3V3XA 2WLBA 3NVWA 1PFDA 1P7FA 2J52A 1E7PB 1AN8A 1MHHE 2IDYA 2YEPF 2L52A 1JROA 3ZJVA 4JX1C 4YSXB 1RYJA 1VRAB 1XCQL 2JQRB 3I57A 4WURA 1A70A 2LHDA 2I2YA 1JWSD 5D7GA 2B76B 3PZ7A 3KWLA 4IDIA 2WU2B 1HEZE 1VDVA 2NMQA 1WSPA 2SEBD 4C56C 4C7YA 5BYRA 2MJ3A 4HKZE 3U4EG 5C3JB 1CQVA 1JW9D 4HROA 4RNAA 2EKIA 4GDKB 4OZCA 4HJGE 1D4BA 1TYGB 4PT5A 1I4XA 1OFFA 1N5XA 2QILA 1TKYA 1LO5D 2E3TA 4L2YA 1CJEA 1FXIA 2BYTA 1QKZA 4MM3B 1EU4A 1SJHD 2BS4B 2N0SB 4RFBA 4DQOC 1V1OA 1V8CA 2BB6A 2JZPA 2RDGA 4RF1A 3UI3A 4B0EA 2BB5A 1V1PB 4YTMB 2I38A 2MJEA 3AE2B 4MH8A 4YXDB 3HVDA 3CWIA 4YT0B 3IT6B 3J9CA 1L4DB 3P42A 2QMTA 3GS2A 2N9LA 4RGNA 1XLNA 1FCLA 3WCQA 3BIID 3FILB 1N61A 5LNK1 2XNAC 3BVZA 3PZ8A 3E56A 1UWMA 1FRRA 1VJKA 2YEPB 4ZYSA 1AYFA 1QLBB 4RGMA 2L32A 5BMGA 1QOBA 4A8XC 2N9KA 3LXFA 4RGTA 3P4SB 3VRBB 1C4PA 3T3NA 1GB4A 4OZBA 4ARIA 3HRDD 3BZDB 2WDQB 4IKGA 3ZQ4A 1E9MA 4ZHPA 2H88B 1TY0A 4A55A 1K53A 3AEBB 1TS5A 1FD6A 2LJIA 2VZKD 5MPOA 4WAFA 1EM7A 1Y56A 3AEEB 4L1BA 4KX6B 1ACCA 1DGJA 3AE4B 4RH6A 1ZXHA 2SAKA 4EE2A 1L6UA 1PYWD 1K52A 3AE9B 4LTUA 3R2IA 2NTSA 4A6QA 1GAQB 1JWMD 2WXQA 4LK0M 3W5UB 2W82A 4GLSC 3NUHB 2G1EA 1I4QA 3EGRA 4WH4A 1IUEA 5BMIA 3ZJUA 2CJNA 1XO3A 2CU3A 4US8A 1WGKA 5I4DA 1ENFA 1RWSA 1SB3C 4N6EB 1I7HA 1D5XC 1V1PA 2J42A 3TEXA 4C80A 4D2KA 1FO4A 3AN1A 2V3NA 2PVGC 3V05A 2ZW0A 5FK9C 3P4PB 1ZDXA 2HDEA 1JMLA 2AQ1B 1L0YB 4XE0A 1F2RC 1I4GA 1JWUD 2BTEA 1PGXA 1JCKB 3BWUD 2WXKA 3FILA 3IAS1 2BS2B 2R61A 4LLGM 3AB5A 4XWTA 3KQ4A 1SE2A 2M56B 2RDHA 5H8YE 3L4PA 1IGDA 1EWCA 1ZUD2 5EE3A 2LMCA 1N62A 4A90A 4KKIA 3AEAB 4TSSA 4M0WA 1PUTA 4RGOS 1M4VA 1TY2A 5BYQA 2INNE 4XDCA 2JX5A 1JWAD 4US9A 1QQRA 4JPSA 2RMMA 2PVOD 3FC4A 3HVZA 3U2SC 2IPKD 5EE1A 1HZ6A 5HHDG 1YN5A 3DWGC 1T3QA 1ZDVA 1SBBB 5H92C 4YSYB 4WQMA 4P6VF 3IAM1 1J7CA 1C4AA 2WXNA 3VR9B 1B1ZA 2ONQA 1FMAD 1KFYB 5EE0A 1SSNA 2KAJA 2WP9B 1ZOYB 4KGSA 2Y3AA 3P63A 1BUIC 2M19A 1TKEA 3VRAB 1SF0A 3VQIA 2IGHA 2JXTA 2L1AA 2BS3B 3W2DA 4TQ1A 3RPFC 1TS4A 3TUOA 2PTLA 4Q2JA 1HA5A 2OEDA 3BK2A 3BYYB 3ZYYX 1PDXA 1WYGA 5JXVA 3Q8EA 1ET6A 4YTPB 5HI1A 3R8BA 4IOIE 3BK1A 2JYTA 2DBYA 1DYQA 2WXIA 2QEJC 2AQ3B 1DOIA 1MVKA 4JE3B 2LGIA 1L6VA 2K0PA 1XXGA 3PO0A 1XEEA 1VLBA 2KMMA 2W54A 1C4CA 3ETRA 2WXLA 3FAHA 1F0ZA 5BYSA 2JU6X 2D5GA 2PKOA 3URYA 1QILA 4KKJA 3LB8C 2JSVX 4P16A 1N5WA 4OHJA 1ESFA 3W5VB 3P4QB 1RM6C 4NJCA 4B0MA 3KLSX 1MHXA 2WXFA 5G5GA 1RFKA 2H89B 3ABVB 3AE7B 3KWVA 1XF5L 1L0VB 1TZOA 2QIEB 3NVZA 1SE4A 1ROEA 2PW9A 1UGJA 1ZPSA 2LHEA 3AE8B 1FRDA 2K9XA 2W3RA 4UDUC 3BYTB 2L83A 4DXFA 2K5PA 1YN4A 4OW0A 1I4PA 2ICIA 2QSDA 2OHFA 3AE6B 1NEKB 2Z8LA 1K51A 4KGTA 2V0GA 2K3UA 1NYRA 2J53A 2DLBA 2WXJA 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUT A;  1TYG B;  3W9C B;  4USA A;  1OFF A;  1N5X A;  1TKY A;  2HTM E;  1L5P A;  2JX5 A;  2E3T A;  3AM9 A;  1CJE A;  1JWA D;  2WQY B;  1TJE A;  2WU5 B;  1FXI A;  2Y5C A;  3P1M A;  4US9 A;  1JWB D;  1KF6 B;  2PVO D;  3FC4 A;  3HVZ A;  3AED B;  1NEN B;  1QF6 A;  2BS4 B;  4JWU C;  5EE1 A;  2N0S B;  2BT6 A;  5GXG B;  1V8C A;  2LEK A;  1WXQ A;  3DWG C;  1YJJ A;  1T3Q A;  5H92 C;  5AUI A;  4YSY B;  2CJO A;  1R7S A;  4WQM A;  3VR8 B;  1EWY C;  4P6V F;  4YTM B;  1QOG A;  2MJE A;  3AE2 B;  4YXD B;  1J7C A;  1SIJ A;  3CWI A;  4YT0 B;  1J7B A;  4ITK A;  3VR9 B;  1FMA D;  1KFY B;  2DWQ A;  5EE0 A;  2KAJ A;  2WP9 B;  1AWD A;  1ZOY B;  3AEG B;  3P63 A;  1XLN A;  4YSZ B;  2M19 A;  1NI3 A;  1TKE A;  5C2T B;  3WCQ A;  3BII D;  1SF0 A;  1J7A A;  3VRA B;  1WRI A;  1N61 A;  2BS3 B;  2W3S A;  2FBW B;  3B2G A;  3NRZ A;  4N59 A;  1DOX A;  1E0Z A;  3RPF C;  1UWM A;  1FRR A;  1VJK A;  1ZXI A;  1AYF A;  1QLB B;  3AE3 B;  4ZHO A;  1QOB A;  2WS3 B;  3LXF A;  1JQ4 A;  3P4S B;  3VRB B;  3ZYY X;  1PDX A;  1WYG A;  3P4R B;  1E6E B;  3HRD D;  4YTP B;  2WDQ B;  2MJD A;  4HRS A;  2K22 A;  5G5H A;  1E9M A;  2PIA A;  3AE5 B;  1YJI A;  2H88 B;  2DBY A;  4ZHP A;  4C7Z A;  3AEB B;  3SFD B;  5EE9 A;  1DOI A;  1ZP0 B;  3B9J A;  1FFV A;  5MPO A;  1L6V A;  1YQ4 B;  3AEE B;  3PO0 A;  1VLB A;  2KMM A;  2W54 A;  1FM0 D;  4KX6 B;  3HUI A;  1DGJ A;  3AE4 B;  3ETR A;  3FAH A;  1F0Z A;  3NS1 A;  3EUB 2;  2ACZ B;  3AEC B;  3CIR B;  1QOF A;  2W55 A;  2PKO A;  3AV8 A;  1L6U A;  3AE9 B;  1V97 A;  4LTU A;  3LB8 C;  4FXC A;  3AE1 B;  1GAQ B;  3W5U B;  3AEF B;  1NYQ A;  1N5W A;  1DOY A;  2G1E A;  2QJL A;  3AMZ A;  1IUE A;  3W5V B;  3P4Q B;  1RM6 C;  2CJN A;  2WDV B;  1XO3 A;  1N60 A;  1FFU A;  2CU3 A;  4US8 A;  1WGK A;  4YTN B;  1RWS A;  1JAL A;  1SB3 C;  1N63 A;  1OQR A;  4ZOH C;  1RFK A;  2H89 B;  3ABV B;  3AE7 B;  4N6E B;  5G5G A;  1FIQ A;  1I7H A;  1L0V B;  1CZP A;  1QOA A;  2QIE B;  1B9R A;  1KRH A;  3NVZ A;  1XLO A;  3NVV A;  4C80 A;  1ROE A;  1FO4 A;  3AN1 A;  1WWT A;  2PVG C;  3P4P B;  3AE8 B;  1QT9 A;  1FRD A;  2WLB A;  3NVW A;  2K9X A;  2W3R A;  1PFD A;  1E10 A;  1E7P B;  1FXA A;  2L52 A;  1JRP A;  1XLP A;  1JRO A;  2L83 A;  4JX1 C;  4YSX B;  1RYJ A;  4WWM A;  2JQR B;  2K5P A;  2BS2 B;  1A70 A;  3DWM A;  2WDR B;  5AUK A;  3AB5 A;  2B76 B;  3B2F A;  3KWL A;  3SFE B;  4IDI A;  3SR6 A;  1OQQ A;  1GPX A;  2M56 B;  1YQ3 B;  3AH7 A;  2Q5W D;  1VDV A;  2WU2 B;  1XLQ A;  3L4P A;  3NVY A;  5H8Y E;  4C7Y A;  1ZUD 2;  2MJ3 A;  5EE3 A;  2OHF A;  5C3J B;  1NVI D;  4N58 A;  3AE6 B;  1N62 A;  1NEK B;  2AX5 A;  1JW9 D;  4JWS C;  4HRO A;  1NYR A;  1TKG A;  2MH7 A;  3AEA B;  4A9A A;  2EKI A; 
#chains in the Genus database with same CATH topology
 5D3I B;  3ONS A;  4DHZ E;  3APD A;  4IM2 A;  1L5P A;  4CQN A;  3Q3M C;  1TJE A;  3N32 A;  3P1M A;  2WXP A;  4A3O A;  1NEN B;  2KTF A;  3U7Z A;  1VZ8 A;  1FCC C;  1WXQ A;  3K9P B;  2GBK A;  1YJJ A;  4AWJ A;  1R7S A;  4NQK E;  2HTH A;  2KTR A;  1WM3 A;  5C2T B;  1NI3 A;  3RMK C;  2MLB A;  2K6Q A;  2FBW B;  2K8C A;  5HG2 A;  3Q8F A;  1HTQ A;  4W9L A;  3APF A;  3NJT A;  2BKF A;  3PHX B;  3PTF C;  2UWQ A;  3DPD A;  2KJ6 A;  1VZ7 A;  2BW2 A;  3UQA A;  4MEM A;  2PIA A;  4MAC A;  3A9K A;  1EU3 A;  4LNN A;  4C7Z A;  2N4F A;  2LD9 A;  3O13 A;  5G2N A;  2PE9 A;  2PMV A;  2M17 A;  1UBI A;  4NAM A;  2L05 A;  2ACZ B;  1WJN A;  2KWD A;  2JRH A;  3H7P B;  3AE1 B;  4RF0 A;  2ZZP B;  2AQ2 B;  4J3O D;  3VUY A;  2LRW A;  1IBX B;  5D3D A;  2KO3 A;  2NPT B;  1JAL A;  4BBN F;  2K39 A;  1CZP A;  5T8I A;  3C8Y A;  3JSV A;  2YLM A;  1LM8 B;  1XD3 B;  2LXA A;  3MP9 A;  4OVU A;  1E8Y A;  3VUX A;  1E8X A;  1T6B X;  2M8S A;  2WDR B;  3B2F A;  3SFE B;  2CR5 A;  3AH7 A;  3NVY A;  2VRR B;  4FBJ B;  4E74 A;  1UUP A;  2JYE A;  1EO6 A;  4II3 B;  3KW5 B;  3OJ3 A;  3PRP B;  1P3Q U;  3WIM A;  3TEW A;  2IJ0 A;  4C4V A;  2KHW B;  2QC8 A;  2RSU A;  5E6J A;  4LJP B;  3ZJT A;  4JWU C;  4YWG G;  4RCO A;  2KZR A;  3TCA A;  2E6X A;  1FNU A;  1GC6 A;  2ZNV B;  1I4R A;  1BXT A;  3RNE C;  1K50 A;  3EA6 A;  2BPS A;  1KH0 A;  4IWQ A;  2KDM A;  1J7B A;  1WY8 A;  4G0N B;  3B0A A;  3O65 B;  4BBN C;  1J7A A;  1YIW A;  2XK5 B;  4ZYN A;  2Y5B B;  3A9J B;  1IYF A;  2IY1 B;  3W1S C;  1L0X B;  2ZPN A;  3N3K B;  5IN7 A;  2NR2 A;  1YJI A;  3Q2A C;  1KLG D;  3RI7 C;  3NHE B;  4NAW B;  1MI0 A;  1R4N B;  4EZL A;  1YN3 A;  5DPW A;  3GE8 C;  3T3O A;  4E3C A;  4GDL A;  3AV8 A;  3ML9 A;  2V4I B;  3PHW B;  4M02 A;  2D11 A;  3V61 A;  1N6Z A;  1AW7 A;  2DZK A;  2LFI A;  4TMA B;  2K1F A;  1N60 A;  1P1A A;  1U4A A;  1FIQ A;  4II2 B;  1CK1 A;  1D6E C;  2RPV A;  3EC8 A;  3VH4 B;  3V3X A;  2WLB A;  3NVW A;  1WGG A;  3X0W A;  4YSX B;  4LJO B;  1XCQ L;  1V5T A;  2JQR B;  2MSE D;  3M95 A;  3V62 A;  4FA6 A;  1JWS D;  3B1L X;  2A5U A;  2JWZ A;  1VDV A;  3VTV A;  1CQV A;  2NBW B;  4FJY A;  4GDK B;  4HJG E;  4ICU A;  1TYG B;  1I4X A;  3JW0 X;  4LNK A;  5D2M B;  1N5X A;  4W9F A;  4ZRJ A;  2QIL A;  2L3Z A;  2E3T A;  2PPH A;  3PT2 B;  1CJE A;  2BVC A;  5JHA A;  1EU4 A;  1SJH D;  4RFB A;  4DQO C;  2KD0 A;  1V1O A;  1V8C A;  2BB6 A;  2ZJD A;  3K9O B;  4RF1 A;  3UI3 A;  3N30 A;  2BB5 A;  2CHW A;  2I38 A;  4MH8 A;  3I5J C;  3CWI A;  2M4N A;  4WWO A;  1UBQ A;  3DOW A;  3R66 C;  2QMT A;  3AUL A;  2N9L A;  1FCL A;  1V5O A;  1XLN A;  2FNJ B;  2DNF A;  3ZNH B;  4OVV A;  2C60 A;  3RZW C;  1UWM A;  1TGZ B;  4DHJ D;  3QHT A;  4ZYS A;  5IAA C;  1QLB B;  3RNG C;  4RGM A;  1QOB A;  3DHI C;  1GB4 A;  3T3N A;  4OZB A;  1WFY A;  3BZD B;  3ZQ4 A;  3EEC A;  2ZNV C;  4XX5 A;  3N20 C;  1WX9 A;  3ZKJ C;  2DEN B;  2WX0 A;  4MSM B;  1EM7 A;  1Y56 A;  4L1B A;  4WAF A;  5E6P A;  5IKC M;  4RH6 A;  1EF1 A;  1ZXH A;  4EE2 A;  4GGQ A;  1WXM A;  4ZRI A;  1L6U A;  3PLU A;  3AE9 B;  3DVG Y;  4BAX A;  4LTU A;  2KQ7 A;  3M63 B;  4LK0 M;  2W82 A;  4GLS C;  1J8C A;  3ZJU A;  2J0M A;  2FCS A;  4US8 A;  2W9N A;  5E6O A;  1LXD A;  1KM7 A;  2WGS A;  1D5X C;  3KUZ A;  3TEX A;  1V81 A;  1FO4 A;  4IM0 A;  3V05 A;  3DCG A;  3KUD B;  1ZDX A;  2HDE A;  2MWS B;  3GZN I;  1I4G A;  1JWU D;  1JCK B;  3DQV A;  1YX5 B;  3C0R B;  2R61 A;  4LLG M;  2JT4 B;  4GSW A;  3IBE A;  2RDH A;  2LUE A;  1ZUD 2;  2LMC A;  3JSV B;  4A90 A;  2R2Q A;  4KKI A;  3AEA B;  4TSS A;  4M0W A;  1M4V A;  4P7I A;  3CMM B;  3TIX A;  1RLF A;  4XDC A;  3SDL C;  2JX5 A;  3QC8 B;  2MRP A;  4US9 A;  1QQR A;  4NY0 A;  1BT0 A;  2PVO D;  2IPK D;  3I63 C;  5HHD G;  4BKS A;  1YN5 A;  2GOW A;  3VHT C;  5H92 C;  5J17 A;  4WQM A;  1OQY A;  4P6V F;  1WJ4 A;  3VR9 B;  4C4V B;  2ONQ A;  2KX3 A;  1ZOY B;  2Y3A A;  3VRA B;  3VQI A;  2LAS A;  3NG0 A;  4TQ1 A;  3RPF C;  3H1U A;  3CF6 E;  1TS4 A;  2JPH A;  2OED A;  3ZYY X;  2KVR A;  1V80 A;  3Q8E A;  1GUA B;  5HI1 A;  3R8B A;  3BK1 A;  2J0K A;  2WWZ A;  1F9J A;  2AQ3 B;  1DOI A;  1YX6 B;  4JE3 B;  1VLB A;  2KMM A;  2NBU A;  1WMH B;  2WXL A;  5BYS A;  3ML8 A;  5LXH A;  1QIL A;  1ZKH A;  4P16 A;  4DWF A;  4OHJ A;  1ESF A;  3ZNI D;  1FXT B;  2LI5 A;  1YJ1 A;  3CST A;  3KLS X;  5EDS A;  4EZK A;  3UIO B;  1MHX A;  5CTR C;  3HHM A;  1XF5 L;  2DAJ A;  3ECI A;  1ROE A;  1UGJ A;  4ICV A;  1FRD A;  1G6J A;  2K9X A;  2W3R A;  4DXF A;  3S2A A;  1WH3 A;  4J6I A;  3AU4 A;  2J0J A;  2IO3 B;  2KMA A;  1K51 A;  2V0G A;  2K3U A;  2RDB C;  2J53 A;  3Q3J A;  4NJ7 A;  2EEL A;  2KMC A;  4USA A;  3Q8B A;  4GN1 A;  3PZD A;  2V3P A;  4ZRK A;  1VZ6 A;  2LXC A;  3AM9 A;  4ZDV A;  2Y5C A;  5IA7 A;  2FUG 1;  3GP7 A;  3WAM A;  5IP4 D;  3AED B;  3ZXV A;  2L0T A;  4HPL B;  2TSS A;  5FR6 A;  2X38 A;  3ZNZ B;  3MJW A;  1FNV A;  1GOZ A;  2IO2 B;  4WAA A;  4C00 A;  2IGG A;  4NZL B;  2DYO A;  3ZUN A;  3NRZ A;  4N59 A;  2KN5 A;  4M01 A;  4HXD A;  2KNB A;  1ZXI A;  2N1V A;  1Q0W B;  3IVF A;  3AE3 B;  3CSF A;  3L16 A;  2LUM A;  2WXM A;  2KC2 A;  1E8W A;  4ARC A;  1EF5 A;  3MC0 B;  1D5Z C;  2XEW A;  2J7Q B;  1SEB D;  3AE5 B;  1VR9 A;  1FPY A;  2N7E A;  3HUI A;  3W1Y A;  2Y5P A;  3EUB 2;  1QOF A;  3MC8 A;  4HEA 1;  1IPG A;  2WNM A;  2C5L C;  1KOT A;  1PGA A;  3VTU A;  3OAW A;  1QOA A;  1I35 A;  3PGE A;  3R2T A;  2KJR A;  2UU7 A;  3DBH I;  4JGH B;  2A4Z A;  1E7U A;  4ANU A;  5AEK B;  4GOC A;  4DHJ B;  2AL6 A;  4GIV A;  2IO1 B;  4WIP A;  1GPX A;  1OQQ A;  1YQ3 B;  3RNB C;  1FNW A;  3SEB A;  4PK1 A;  1NVI D;  3E9S A;  2AX5 A;  2K25 A;  5LLI A;  3HIZ A;  1YNT E;  2MH7 A;  4W9J A;  1XQQ A;  1C77 A;  2DZJ A;  4NNJ B;  1P7E A;  3W9C B;  2HTM E;  2WXH A;  1L4Z B;  4CO7 A;  2MEK A;  5G55 A;  2C7N B;  3RFZ B;  4FUL A;  3BVM A;  1ET9 A;  3KVF B;  2UYZ B;  3PSE B;  1WGY A;  1QOG A;  2GB1 A;  2GRI A;  3A1Q B;  1C9F A;  3IFW B;  1WRI A;  4MT5 A;  1HE8 A;  2GBM A;  2FID A;  4O1N A;  2O6V A;  4X57 B;  3QQ8 B;  3TEZ A;  2ZW1 A;  1WE7 A;  3N1Y C;  3TSS A;  1E6E B;  2RD0 A;  4FJZ A;  2MBB B;  1Q10 A;  2K22 A;  2HE7 A;  2B3A A;  4AS1 A;  3B9J A;  1ZP0 B;  3DBS A;  1RAX A;  1J0G A;  3PV1 A;  1T0S C;  2KAC A;  3AEC B;  5J18 A;  3PPA A;  2NVU I;  4FXC A;  2LRU A;  4DBG A;  1NYQ A;  4IW0 A;  3AMZ A;  4GMV A;  1LFD A;  3NS8 A;  2KOX A;  4ANV A;  1E10 A;  1B9R A;  1WR6 E;  1SXT A;  2J52 A;  1V49 A;  4NQL B;  2IDY A;  2YEP F;  4B9K A;  1V9J A;  1JRO A;  2LVQ A;  1EUV B;  4WUR A;  1A70 A;  2I2Y A;  1VD2 A;  3KWL A;  4IDI A;  2O2V A;  1HEZ E;  2IND C;  2SEB D;  1WSP A;  2AWT A;  3ZW3 A;  1YOV B;  4G50 A;  3L54 A;  2MW5 A;  1YD8 U;  1SE9 A;  1D4B A;  2CU1 A;  4IWO A;  1WI0 A;  4L2Y A;  4ANW A;  2BS4 B;  4EFO A;  4XGA B;  3AI5 A;  4ACF A;  4B0E A;  1V1P B;  2PJH A;  2MJE A;  3QWZ B;  4YXD B;  3HVD A;  4EKU A;  5C1Z A;  3IG3 A;  2V9H A;  5KHO A;  3RT3 B;  3BVZ A;  2G45 B;  1VJK A;  1AYF A;  2DYB A;  2FAZ A;  4RGT A;  3P4S B;  4PS3 A;  2D07 B;  2CHZ A;  2KLG A;  2MA9 B;  3P2B A;  4ARI A;  3ZRF A;  3NY5 A;  1E9M A;  3VTW A;  4ZHP A;  1TY0 A;  3KH0 A;  2C9W B;  4A55 A;  1XT9 B;  1K53 A;  5L95 C;  1FD6 A;  3AEE B;  2GBJ A;  1LQB A;  4KX6 B;  1ACC A;  4IUM B;  4KIK A;  1YQB A;  1WJU A;  2KYW A;  1PYW D;  4A6Q A;  1GAQ B;  2BGF A;  3W5U B;  3NUH B;  4MM3 A;  3EGR A;  4P1B C;  5BMI A;  2CJN A;  1XO3 A;  1WGK A;  3N1Z C;  2K8H A;  4HDO A;  4C80 A;  2PVG C;  2MBH A;  5FK9 C;  2BWE S;  3V6E B;  1F2R C;  4RM8 A;  2C7M B;  3PRM B;  1PGX A;  3FIL A;  3QX1 A;  3AB5 A;  4P1C C;  3H9D A;  3KQ4 A;  2KDB A;  1IGD A;  2JZZ A;  5IO9 A;  1PUT A;  1TY2 A;  5JH5 C;  2RR9 A;  1RRB A;  4KZC A;  2C7H A;  2INN E;  1UF0 A;  3N1X C;  3HM3 A;  3U8Z A;  4HCP B;  4EOY A;  4W9G A;  3C19 A;  1J7C A;  1C4A A;  1C1Y B;  1ZGU B;  2D3B A;  1R4M B;  5EE0 A;  1SSN A;  3P63 A;  2M19 A;  1TKE A;  2K8B A;  2BF8 B;  4KDI C;  3JYU A;  3JVZ X;  1OEY A;  1CMX B;  3PS6 A;  4Q2J A;  2KFJ A;  2AL3 A;  5DPS A;  2PEA A;  4WJQ A;  3L13 A;  1PDX A;  1WYG A;  5JXV A;  1ET6 A;  4YTP B;  4BOZ B;  2N1W A;  4IOI E;  3SD5 A;  3Q3F A;  4E71 A;  1I42 A;  1WZ3 A;  4ANX A;  2KJH B;  1S3S G;  2K0P A;  1XEE A;  4K3C A;  2G3Q B;  2W54 A;  3ETR A;  4HLE A;  2IBI B;  3NZS A;  4XZ4 A;  2RGF A;  2X8X X;  2ZCB A;  3BY4 B;  2PKO A;  2K6D B;  1UEL A;  2V1Y A;  3ZNG C;  4KKJ A;  5LXI B;  3LB8 C;  1N5W A;  3HM6 X;  4NPN A;  1RM6 C;  2KTR B;  4JIO U;  3L17 A;  1GC7 A;  2MP2 A;  1WIA A;  2QIE B;  1SE4 A;  2N9P C;  3M3J A;  4A20 A;  5DPT A;  4W9I A;  1ZPS A;  3AE8 B;  4MGY E;  4UDU C;  2KFK A;  4PS8 A;  3VXW A;  2G4S A;  3TJP A;  2DHZ A;  3A9K B;  3QA8 A;  5TR5 A;  1WRD B;  2CKH B;  2FUH B;  1LGR A;  4HDQ A;  1NEK B;  1NYR A;  4IM3 A;  1WXS A;  3APC A;  1WM2 A;  2REX A;  3Q3O C;  4BKS D;  4GXB A;  2DAF A;  2KDI A;  2L8J A;  1JWB D;  3WAN A;  3Q8C A;  1FEH A;  3ZXR A;  1T5X D;  2BT6 A;  2LEK A;  4BKT A;  4RMA A;  3T8M A;  2KXJ A;  2INP E;  2KVZ A;  1D5M C;  4G11 A;  1UZX B;  2KQS A;  3RUI B;  2ON8 A;  1WE6 A;  2DWQ A;  4JL9 A;  2LJ5 A;  5FR3 A;  2D3G A;  2BBC A;  2JXX A;  3B2G A;  4MDK E;  2L7R A;  2ZVO A;  3RZF A;  5FKA C;  2WS3 B;  3QAQ A;  2L76 A;  1IP9 A;  2MJD A;  3BVG A;  4MJS A;  3MHZ A;  2FCN A;  1OEY J;  2KLC A;  3IT4 B;  2NCN A;  3PRZ A;  3OWE B;  1L2N A;  3MJ5 A;  2OJR A;  2W55 A;  1KTK A;  3R7Q A;  4NJ6 A;  4S17 A;  3W1S A;  1HXY D;  5G5H A;  1OQR A;  2V4L A;  3BIN A;  3MFG A;  1XLO A;  2WXO A;  3QCA A;  4BKG A;  4AQ7 A;  1JRP A;  3IXS A;  4BOS C;  1HZ5 A;  4WWM A;  4AP4 C;  4L23 A;  5AUK A;  3DWM A;  2LGS A;  2Q5W D;  1XLQ A;  2HD5 B;  3OLM D;  1TT5 B;  3UIN B;  4JWS C;  2GLS A;  1Z5S B;  4DDG D;  2M0A A;  3Q69 A;  4GDL B;  3NZU A;  3ZTD A;  4ZRP A;  1WGD A;  4K7S A;  3U30 A;  3T9L A;  4XDD A;  2HJ8 A;  4GU2 A;  2INC C;  2VH1 A;  2CJO A;  1D3Z A;  3L0W B;  4F7Z A;  3H7P A;  3DVN U;  1IBX A;  2ZCC A;  1UD7 A;  1AWD A;  4AUQ C;  1R4N I;  4YSZ B;  3MHS D;  2NPT A;  2JWU A;  1DOX A;  4KV2 A;  5DCN A;  1SE3 A;  1HQR D;  4HPP A;  1TBE A;  1S1Q B;  4KDL B;  4HKQ A;  4DXG A;  2N7J A;  2DYM A;  1I4H A;  1UH6 A;  1FFV A;  3RYT A;  2WXR A;  2YVC A;  4KGR A;  2KX0 A;  2IGD A;  1C79 A;  1PQS A;  3U7D A;  4OZA A;  1OGW A;  1K8R B;  4XC2 A;  2QJL A;  2KC1 A;  1H8C A;  4XWW A;  1Q5W B;  1RFA A;  4R3D A;  1NI2 A;  1TS2 A;  1TIF A;  1V6E A;  2Z59 B;  2LZ6 A;  5CHF A;  3UIP B;  2HJ1 A;  4K7W A;  4W9C A;  1E7P B;  1AN8 A;  2L52 A;  1RYJ A;  1VRA B;  3VVW B;  3ZO5 B;  2FIF A;  3I57 A;  2JF5 A;  2XK5 A;  2WU2 B;  4C56 C;  4B95 A;  5BYR A;  4HKZ E;  5C3J B;  3ZDM C;  3A9J A;  1JW9 D;  4HRO A;  4RNA A;  4OZC A;  4PT5 A;  3TL5 A;  5AZF A;  1OFF A;  3H7S A;  4WWP A;  2KDF B;  3TMP B;  1TKY A;  2KDE B;  4LNO A;  1LO5 D;  2NBV B;  4NAW A;  1WZ0 A;  2N0S B;  2RPQ A;  3A33 B;  2JZP A;  3ZRC A;  3A4S C;  4HCN B;  4MSQ B;  3VUW A;  5CHW A;  2L0F A;  2JRI B;  4LDT D;  5E6N A;  1L4D B;  2O6V D;  3WCQ A;  3BII D;  2XNA C;  3PZ8 A;  4PYZ A;  1FRR A;  1WYW B;  2KAN A;  2YEP B;  2L32 A;  5BMG A;  2N9K A;  1GJZ A;  3VRB B;  4M0W B;  4M00 A;  3VAW A;  4IKG A;  4M8M A;  1KJT A;  4FLH A;  4S0R A;  2MBE A;  3ZVV A;  3AEB B;  1L7Y A;  2LJI A;  2QDF A;  2VZK D;  4MGZ E;  4HPM B;  4YL8 A;  4FHK A;  4N9F 4;  4GDK A;  3AE4 B;  3MTN B;  2LVO A;  2SAK A;  3DDC B;  2MHJ A;  1K52 A;  3WAO A;  1E5W A;  2NTS A;  1I4Q A;  1WGH A;  1UGM A;  2CU3 A;  1RWS A;  1SB3 C;  3UQB A;  4MH0 E;  2J42 A;  4PYU A;  4URK A;  4HK2 A;  5D94 A;  2ZW0 A;  2KK8 A;  3Q3N C;  1JML A;  2AQ1 B;  3BWU D;  2WXK A;  2BS2 B;  2G4D B;  4XWT A;  1A5R A;  1WXA A;  1SE2 A;  2EMT A;  5H8Y E;  5EE3 A;  1N62 A;  2DX5 B;  2LVP A;  4W9D A;  5BYQ A;  4PS7 A;  4I6P A;  5GMV A;  2GBR A;  2RMM A;  3GZN B;  4W9H A;  4K1R B;  3DWG C;  3AXC A;  4WJN A;  1SBB B;  4RM9 A;  4YSY B;  3IHP C;  3RNA C;  4MEL A;  3OG5 A;  2KAJ A;  1SF0 A;  2IGH A;  2KWC A;  2BS3 B;  1WF9 A;  1SIF A;  4JQW C;  1E90 A;  2JVC A;  3TUO A;  2PTL A;  2FCQ A;  2BQQ A;  2D2Q A;  2DBY A;  2GBN A;  4TUU A;  5JZE B;  2LGY A;  2QEJ C;  4ASW C;  1MVK A;  2MBO A;  1L6V A;  1XXG A;  3DHH C;  3WA0 A;  5KHQ A;  2CHX A;  2KWV B;  4M8N A;  1C4C A;  5CX3 A;  2MBQ A;  2JU6 X;  3URY A;  1M94 A;  2D10 A;  4XYC A;  3W5V B;  4NJC A;  4B0M A;  2DZM A;  2WXF A;  2H89 B;  3AE7 B;  3RNC C;  1TZO A;  4W9K A;  1SGH A;  4DXA B;  3FKY A;  2LHE A;  4LNI A;  1MG4 A;  3ZDT A;  3PLV A;  4AJW A;  5JHB A;  2JY6 A;  2LGD A;  3HK0 A;  1YN4 A;  1OTR B;  2BYE A;  4WJO A;  2AEH A;  4KZ0 A;  2OJW A;  4KSL C;  4EUT A;  2QSD A;  3AE6 B;  4F1S A;  4KGT A;  4TV3 A;  4HJK A;  3L10 B;  2L1A A;  2DLB A;  2M1M A;  3GB1 A;  4REZ A;  2Z0D B;  3SU8 X;  4HVB A;  2G9H D;  2BYF A;  2PLP A;  1TS3 A;  2WU5 B;  2FE8 A;  1KF6 B;  2V3S A;  4EZJ A;  3N9Y C;  4KSK C;  1QF6 A;  1V2Y A;  1V86 A;  1KLU D;  5GXG B;  1WMH A;  1BML C;  4FJV B;  5TSS A;  5AUI A;  3WAL A;  3I3T B;  2N9E B;  3RD2 A;  4ZRQ A;  3R3M A;  4ITK A;  1PGB A;  1YMH E;  3ZGZ A;  3AEG B;  5J2R A;  3DVN V;  1SJE D;  3MC9 A;  4ZHO A;  1Q1O A;  1F1H A;  4BFR A;  4DDI D;  2JUO A;  1JQ4 A;  3Q6B A;  2IYD B;  1UWX A;  2KN4 A;  1STE A;  1WX8 A;  3P4R B;  3QAR A;  5D6J B;  2ZEQ A;  1JRU A;  5EE9 A;  2J4X A;  3H8H A;  1YQ4 B;  3I9V 1;  1IGC A;  2D3C A;  4I6L B;  1FM0 D;  4K3B A;  1F77 A;  3NS1 A;  2N9X A;  3CIR B;  1P0R A;  2WDT B;  1J19 A;  4QAY A;  1UNS A;  2NTT A;  2EMS A;  1Z2M A;  4F8C B;  3AEF B;  1NBF C;  2OOB B;  4BVU C;  1E8Z A;  2WDV B;  4MGI E;  2XBB C;  1QZE A;  2IO0 B;  4YTN B;  4LDT B;  1GB1 A;  3KYD D;  1NDD A;  2O6V B;  3NVV A;  5IOI A;  3L08 A;  4MGK E;  3Q8A A;  3TBL D;  1QT9 A;  3PRE A;  4K7U A;  2WXG A;  1FXA A;  3B08 A;  1XLP A;  2Z0E B;  5BMH A;  3DHG C;  4CHK A;  4TQ0 A;  1Y8R C;  3DBL B;  3SR6 A;  3TEY A;  2QCZ A;  1ZE3 D;  3GE3 C;  4N58 A;  1TKG A;  4A9A A;  4WQO B;  2VZK B;  4JLC A;  2MQJ A;  3AU5 A;  4I6N B;  2WQY B;  1WX7 A;  3DBH B;  2IY0 B;  2I1J A;  4IC7 B;  3RNF C;  1GNU A;  5HFY A;  3VDZ A;  2GI9 A;  1EWY C;  1SIJ A;  3GOE A;  3EHV A;  3LYY A;  1ISN A;  1F2R I;  3KYC D;  1WJ6 A;  1C78 A;  1C76 A;  2JZ3 B;  2W3S A;  2XN9 C;  1E0Z A;  3DBR B;  2O2V B;  1F52 A;  3SHQ A;  4HWI B;  3U52 E;  1MG8 A;  2DZI A;  1ZW7 A;  1WGR A;  2CS4 A;  3NZ3 A;  4HRS A;  1MJD A;  3SFD B;  4IWP A;  1XCT L;  4FHJ A;  2KQ4 X;  1H4R A;  4FN2 A;  2D3A A;  2GMI C;  2BKR B;  1V97 A;  4OVZ A;  4H2A A;  3OJ4 B;  1DOY A;  3H6N A;  1VCB A;  4W9E A;  1FFU A;  1MPE A;  4ZOH C;  1N63 A;  5CHV C;  3VR8 B;  1KRH A;  2WYQ A;  4AJY B;  1MFW A;  1WWT A;  1TZ1 A;  3D32 A;  3A1Q A;  1PFD A;  1GG3 A;  1P7F A;  3VFK A;  1MHH E;  3Q14 C;  3ZJV A;  3QJZ A;  4JX1 C;  3X23 A;  2LHD A;  3ALB A;  5D7G A;  2B76 B;  3PZ7 A;  2N7D A;  4K81 A;  2NMQ A;  4C7Y A;  2MJ3 A;  3U4E G;  2I1K A;  4LNF A;  5L83 A;  2EKI A;  4KIK B;  3V60 A;  2MCN B;  1P98 A;  2M0X A;  4B6W A;  1FXI A;  2BYT A;  3KUC B;  1QKZ A;  4MM3 B;  2AYO B;  2RDG A;  2PE6 B;  1WR1 A;  3DVG X;  4YTM B;  5AZG A;  3AE2 B;  4YT0 B;  3IT6 B;  3J9C A;  4A3P A;  3P42 A;  3GS2 A;  4RGN A;  3FIL B;  1N61 A;  5LNK 1;  3E56 A;  4BZA A;  4IG7 B;  3ZIM A;  4A8X C;  3LXF A;  1T0Q C;  4WWN A;  3QK0 A;  1C4P A;  5AZH A;  3HRD D;  2WDQ B;  1WXV A;  4DHZ B;  2H88 B;  1AAR A;  1TS5 A;  5MPO A;  1P9D U;  1DGJ A;  3PVL A;  3VH3 B;  3R2I A;  1JWM D;  2WXQ A;  2G1E A;  4WH4 A;  1IUE A;  3LDZ E;  5I4D A;  1ENF A;  2WHI A;  4N6E B;  3EFU A;  1I7H A;  2NS5 A;  1V1P A;  1T0Y A;  4D2K A;  3AN1 A;  2V3N A;  3P4P B;  1X1M A;  1L0Y B;  4XE0 A;  2BTE A;  3IAS 1;  2M56 B;  3L4P A;  2BWF A;  4G3X B;  1EWC A;  3NOB A;  3RCZ A;  1R4M I;  4RGO S;  2EKE C;  3M62 B;  4GB9 A;  4KVG B;  1JWA D;  2LWP A;  4JPS A;  3EFC A;  3FC4 A;  3HVZ A;  3U2S C;  2L00 B;  3UF8 A;  5EE1 A;  3UGB B;  1HZ6 A;  2IZV B;  3RN9 C;  2KWU B;  2MP2 B;  1T3Q A;  1ZDV A;  2KKC A;  3ENE A;  1TTN A;  3IAM 1;  2WXN A;  1B1Z A;  2R2O A;  1FMA D;  1KFY B;  2KFK B;  1KLV A;  2WP9 B;  5C23 A;  4CYE A;  4KGS A;  1BUI C;  3ZLZ A;  2JXT A;  3LJ3 A;  5DPR A;  3W2D A;  2KT7 A;  4LCD E;  4AOF A;  3DBL I;  2ASQ A;  1HA5 A;  5BO4 B;  3BK2 A;  1E7V A;  3BYY B;  2JYT A;  4FAD A;  1HTO A;  1DYQ A;  2WXI A;  3R7R A;  3QIJ A;  2LGI A;  3PO0 A;  2ZPY A;  3A4R A;  3FAH A;  1F0Z A;  4DK5 A;  2VH2 A;  4WJP A;  2D5G A;  2WX1 A;  4TKN A;  3ZTC A;  2LGX A;  2JSV X;  3P4Q B;  5HKH A;  2QHO A;  5G5G A;  1RFK A;  3ABV B;  3KWV A;  1L0V B;  3NVZ A;  2PW9 A;  4EEW A;  3DBR I;  2ZVN A;  1C3T A;  3BYT B;  2BYV E;  2L83 A;  2FCM A;  2K5P A;  4MJS B;  1T0R C;  3WAP A;  4OW0 A;  1I4P A;  2ICI A;  3RUL A;  2OHF A;  2Z8L A;  2MX2 A;  3V6C B;  2WXJ A; 
#chains in the Genus database with same CATH homology
 5D3I B;  2EEL A;  4REZ A;  4USA A;  2G9H D;  3Q8B A;  2V3P A;  1L5P A;  1VZ6 A;  3AM9 A;  4CQN A;  2PLP A;  2WU5 B;  1TJE A;  1TS3 A;  2FE8 A;  2Y5C A;  3P1M A;  2WXP A;  2FUG 1;  3GP7 A;  1JWB D;  1KF6 B;  3Q8C A;  3AED B;  1FEH A;  3N9Y C;  1NEN B;  1QF6 A;  1T5X D;  3U7Z A;  1KLU D;  1VZ8 A;  2BT6 A;  5GXG B;  1FCC C;  2LEK A;  1WXQ A;  2TSS A;  1BML C;  1YJJ A;  5TSS A;  5AUI A;  1R7S A;  2X38 A;  2INP E;  1D5M C;  4ZRQ A;  2ON8 A;  1FNV A;  4ITK A;  1GOZ A;  2DWQ A;  1PGB A;  1YMH E;  3ZGZ A;  3AEG B;  5C2T B;  1NI3 A;  5FR3 A;  2IGG A;  4NZL B;  2DYO A;  2BBC A;  3NRZ A;  2FBW B;  3B2G A;  4N59 A;  5HG2 A;  3Q8F A;  1ZXI A;  3AE3 B;  5FKA C;  1SJE D;  4ZHO A;  2LUM A;  2WS3 B;  2WXM A;  1JQ4 A;  1UWX A;  1VZ7 A;  2BW2 A;  2KN4 A;  1STE A;  3P4R B;  4ARC A;  3MC0 B;  2MJD A;  1D5Z C;  3BVG A;  2PIA A;  3MHZ A;  4MAC A;  1SEB D;  3AE5 B;  1EU3 A;  4C7Z A;  3O13 A;  1VR9 A;  5EE9 A;  2J4X A;  3IT4 B;  3H8H A;  1YQ4 B;  2PMV A;  3I9V 1;  1IGC A;  1FM0 D;  4NAM A;  3HUI A;  3OWE B;  3MJ5 A;  1F77 A;  2Y5P A;  3NS1 A;  3EUB 2;  2ACZ B;  3CIR B;  1QOF A;  2W55 A;  1UNS A;  2KWD A;  2NTT A;  1KTK A;  3AE1 B;  4HEA 1;  3AEF B;  4RF0 A;  2AQ2 B;  2WNM A;  4J3O D;  1IBX B;  3W1S A;  5D3D A;  1HXY D;  2WDV B;  1PGA A;  4YTN B;  1JAL A;  5G5H A;  1GB1 A;  1OQR A;  1CZP A;  1QOA A;  3MFG A;  1XLO A;  2WXO A;  3NVV A;  5T8I A;  3Q8A A;  3C8Y A;  3R2T A;  1QT9 A;  3MP9 A;  4AQ7 A;  2WXG A;  1FXA A;  1JRP A;  1XLP A;  3IXS A;  1HZ5 A;  1T6B X;  4WWM A;  4L23 A;  5AUK A;  3DWM A;  5BMH A;  2WDR B;  4WIP A;  4TQ0 A;  3B2F A;  3SFE B;  3SR6 A;  1GPX A;  1OQQ A;  1YQ3 B;  3AH7 A;  2Q5W D;  3NVY A;  3TEY A;  1XLQ A;  1FNW A;  3SEB A;  1ZE3 D;  1NVI D;  4N58 A;  3E9S A;  2AX5 A;  4JWS C;  1TKG A;  1YNT E;  2MH7 A;  4A9A A;  1UUP A;  2JYE A;  2M0A A;  1C77 A;  3Q69 A;  1P7E A;  3W9C B;  4GDL B;  2VZK B;  2HTM E;  3TEW A;  2WXH A;  2IJ0 A;  2WQY B;  1L4Z B;  2MEK A;  4ZRP A;  5E6J A;  3RFZ B;  3ZJT A;  4JWU C;  4YWG G;  4RCO A;  3BVM A;  5HFY A;  4XDD A;  1ET9 A;  1FNU A;  2E6X A;  2GI9 A;  1I4R A;  2CJO A;  1BXT A;  1K50 A;  1EWY C;  3EA6 A;  1QOG A;  1KH0 A;  1SIJ A;  2KDM A;  2GB1 A;  1J7B A;  2GRI A;  3LYY A;  1C9F A;  1F2R I;  1IBX A;  1AWD A;  4YSZ B;  2JWU A;  1J7A A;  1WRI A;  1C78 A;  1C76 A;  4MT5 A;  2W3S A;  2XN9 C;  1DOX A;  1E0Z A;  4O1N A;  1SE3 A;  1HQR D;  3U52 E;  3TEZ A;  2ZW1 A;  1L0X B;  3TSS A;  1E6E B;  3NZ3 A;  4HKQ A;  1Q10 A;  2K22 A;  4HRS A;  4DXG A;  2N7J A;  2DYM A;  1YJI A;  1I4H A;  1KLG D;  3SFD B;  1XCT L;  4AS1 A;  4NAW B;  3B9J A;  1ZP0 B;  1MI0 A;  2KQ4 X;  1FFV A;  1YN3 A;  2WXR A;  3T3O A;  4KGR A;  2KAC A;  3AEC B;  3AV8 A;  2IGD A;  2V4I B;  1C79 A;  1V97 A;  4OVZ A;  4H2A A;  4FXC A;  4OZA A;  1NYQ A;  1DOY A;  1AW7 A;  2QJL A;  3AMZ A;  2LFI A;  4TMA B;  1N60 A;  4XWW A;  1FFU A;  1MPE A;  4ZOH C;  1N63 A;  4R3D A;  1E10 A;  1TS2 A;  3VR8 B;  1B9R A;  1FIQ A;  1KRH A;  1CK1 A;  1D6E C;  2RPV A;  1WWT A;  1SXT A;  3V3X A;  2WLB A;  3NVW A;  1PFD A;  1P7F A;  2J52 A;  1E7P B;  1AN8 A;  1MHH E;  2IDY A;  2YEP F;  2L52 A;  1JRO A;  3ZJV A;  4JX1 C;  4YSX B;  1RYJ A;  1VRA B;  1XCQ L;  2JQR B;  3I57 A;  4WUR A;  1A70 A;  2LHD A;  2I2Y A;  1JWS D;  5D7G A;  2B76 B;  3PZ7 A;  3KWL A;  4IDI A;  2WU2 B;  1HEZ E;  1VDV A;  2NMQ A;  1WSP A;  2SEB D;  4C56 C;  4C7Y A;  5BYR A;  2MJ3 A;  4HKZ E;  3U4E G;  5C3J B;  1CQV A;  1JW9 D;  4HRO A;  4RNA A;  2EKI A;  4GDK B;  4OZC A;  4HJG E;  1D4B A;  1TYG B;  4PT5 A;  1I4X A;  1OFF A;  1N5X A;  2QIL A;  1TKY A;  1LO5 D;  2E3T A;  4L2Y A;  1CJE A;  1FXI A;  2BYT A;  1QKZ A;  4MM3 B;  1EU4 A;  1SJH D;  2BS4 B;  2N0S B;  4RFB A;  4DQO C;  1V1O A;  1V8C A;  2BB6 A;  2JZP A;  2RDG A;  4RF1 A;  3UI3 A;  4B0E A;  2BB5 A;  1V1P B;  4YTM B;  2I38 A;  2MJE A;  3AE2 B;  4MH8 A;  4YXD B;  3HVD A;  3CWI A;  4YT0 B;  3IT6 B;  3J9C A;  1L4D B;  3P42 A;  2QMT A;  3GS2 A;  2N9L A;  4RGN A;  1XLN A;  1FCL A;  3WCQ A;  3BII D;  3FIL B;  1N61 A;  5LNK 1;  2XNA C;  3BVZ A;  3PZ8 A;  3E56 A;  1UWM A;  1FRR A;  1VJK A;  2YEP B;  4ZYS A;  1AYF A;  1QLB B;  4RGM A;  2L32 A;  5BMG A;  1QOB A;  4A8X C;  2N9K A;  3LXF A;  4RGT A;  3P4S B;  3VRB B;  1C4P A;  3T3N A;  1GB4 A;  4OZB A;  4ARI A;  3HRD D;  3BZD B;  2WDQ B;  4IKG A;  3ZQ4 A;  1E9M A;  4ZHP A;  2H88 B;  1TY0 A;  4A55 A;  1K53 A;  3AEB B;  1TS5 A;  1FD6 A;  2LJI A;  2VZK D;  5MPO A;  4WAF A;  1EM7 A;  1Y56 A;  3AEE B;  4L1B A;  4KX6 B;  1ACC A;  1DGJ A;  3AE4 B;  4RH6 A;  1ZXH A;  2SAK A;  4EE2 A;  1L6U A;  1PYW D;  1K52 A;  3AE9 B;  4LTU A;  3R2I A;  2NTS A;  4A6Q A;  1GAQ B;  1JWM D;  2WXQ A;  4LK0 M;  3W5U B;  2W82 A;  4GLS C;  3NUH B;  2G1E A;  1I4Q A;  3EGR A;  4WH4 A;  1IUE A;  5BMI A;  3ZJU A;  2CJN A;  1XO3 A;  2CU3 A;  4US8 A;  1WGK A;  5I4D A;  1ENF A;  1RWS A;  1SB3 C;  4N6E B;  1I7H A;  1D5X C;  1V1P A;  2J42 A;  3TEX A;  4C80 A;  4D2K A;  1FO4 A;  3AN1 A;  2V3N A;  2PVG C;  3V05 A;  2ZW0 A;  5FK9 C;  3P4P B;  1ZDX A;  2HDE A;  1JML A;  2AQ1 B;  1L0Y B;  4XE0 A;  1F2R C;  1I4G A;  1JWU D;  2BTE A;  1PGX A;  1JCK B;  3BWU D;  2WXK A;  3FIL A;  3IAS 1;  2BS2 B;  2R61 A;  4LLG M;  3AB5 A;  4XWT A;  3KQ4 A;  1SE2 A;  2M56 B;  2RDH A;  5H8Y E;  3L4P A;  1IGD A;  1EWC A;  1ZUD 2;  5EE3 A;  2LMC A;  1N62 A;  4A90 A;  4KKI A;  3AEA B;  4TSS A;  4M0W A;  1PUT A;  4RGO S;  1M4V A;  1TY2 A;  5BYQ A;  2INN E;  4XDC A;  2JX5 A;  1JWA D;  4US9 A;  1QQR A;  4JPS A;  2RMM A;  2PVO D;  3FC4 A;  3HVZ A;  3U2S C;  2IPK D;  5EE1 A;  1HZ6 A;  5HHD G;  1YN5 A;  3DWG C;  1T3Q A;  1ZDV A;  1SBB B;  5H92 C;  4YSY B;  4WQM A;  4P6V F;  3IAM 1;  1J7C A;  1C4A A;  2WXN A;  3VR9 B;  1B1Z A;  2ONQ A;  1FMA D;  1KFY B;  5EE0 A;  1SSN A;  2KAJ A;  2WP9 B;  1ZOY B;  4KGS A;  2Y3A A;  3P63 A;  1BUI C;  2M19 A;  1TKE A;  3VRA B;  1SF0 A;  3VQI A;  2IGH A;  2JXT A;  2L1A A;  2BS3 B;  3W2D A;  4TQ1 A;  3RPF C;  1TS4 A;  3TUO A;  2PTL A;  4Q2J A;  1HA5 A;  2OED A;  3BK2 A;  3BYY B;  3ZYY X;  1PDX A;  1WYG A;  5JXV A;  3Q8E A;  1ET6 A;  4YTP B;  5HI1 A;  3R8B A;  4IOI E;  3BK1 A;  2JYT A;  2DBY A;  1DYQ A;  2WXI A;  2QEJ C;  2AQ3 B;  1DOI A;  1MVK A;  4JE3 B;  2LGI A;  1L6V A;  2K0P A;  1XXG A;  3PO0 A;  1XEE A;  1VLB A;  2KMM A;  2W54 A;  1C4C A;  3ETR A;  2WXL A;  3FAH A;  1F0Z A;  5BYS A;  2JU6 X;  2D5G A;  2PKO A;  3URY A;  1QIL A;  4KKJ A;  3LB8 C;  2JSV X;  4P16 A;  1N5W A;  4OHJ A;  1ESF A;  3W5V B;  3P4Q B;  1RM6 C;  4NJC A;  4B0M A;  3KLS X;  1MHX A;  2WXF A;  5G5G A;  1RFK A;  2H89 B;  3ABV B;  3AE7 B;  3KWV A;  1XF5 L;  1L0V B;  1TZO A;  2QIE B;  3NVZ A;  1SE4 A;  1ROE A;  2PW9 A;  1UGJ A;  1ZPS A;  2LHE A;  3AE8 B;  1FRD A;  2K9X A;  2W3R A;  4UDU C;  3BYT B;  2L83 A;  4DXF A;  2K5P A;  1YN4 A;  4OW0 A;  1I4P A;  2ICI A;  2QSD A;  2OHF A;  3AE6 B;  1NEK B;  2Z8L A;  1K51 A;  4KGT A;  2V0G A;  2K3U A;  1NYR A;  2J53 A;  2DLB A;  2WXJ A;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...