4ZHPA

The crystal structure of potato ferredoxin i with 2fe-2s cluster
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ASYKVKLITPDGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDVTIETHKEEELTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacterial plant-ferredoxin receptor FusA.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Electron transport
molecule keywords Potato Ferredoxin I
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zhpA00
2LEKA 2OHFA 2Y5CA 2K5PA 1NI3A 1QT9A 3W5VB 3DWGC 1NYRA 1NYQA 1PDXA 4ZHPA 1SF0A 1RM6C 3AB5A 3FAHA 2K22A 1SIJA 1DOIA 1WYGA 2E3TA 5AUKA 1N5WA 3HRDD 1GAQB 2Q5WD 1IUEA 3AE7B 4N6EB 1B9RA 1VLBA 1NENB 1DOYA 2WU5B 1UWMA 1KF6B 1EWYC 1AWDA 1QOFA 4JX1C 1TKGA 2BS3B 2QIEB 3KWLA 4FXCA 1JWAD 1N62A 3AE4B 3L4PA 5G5GA 5MPOA 3P1MA 1TKYA 2L83A 3AE8B 1YQ4B 4ZHOA 1ZUD2 3AEEB 5AUIA 2KAJA 1QOGA 2QJLA 3CWIA 1WGKA 1I7HA 4YSXB 4US9A 1XLNA 3SR6A 3ZYYX 1J7CA 1L0VB 3HVZA 4N59A 1QF6A 3AEDB 1FRDA 1L6UA 4IDIA 1ZOYB 3VRAB 1KRHA 1V8CA 2MJEA 1FIQA 1N5XA 1PUTA 4YSYB 5EE9A 3NS1A 2L52A 3AEFB 2M19A 1V97A 2H89B 1E7PB 1R7SA 3FC4A 3NVYA 1XLOA 1VJKA 1YJJA 3AE1B 3NRZA 1FMAD 2B76B 1QOAA 1JWBD 2PIAA 3B2GA 1T3QA 2M56B 3LB8C 3P4SB 2H88B 1WWTA 3W9CB 1CZPA 1N63A 3AEAB 2WS3B 4A9AA 4LTUA 5C2TB 4USAA 1RWSA 2PVOD 3B2FA 4HRSA 1JRPA 1SB3C 3ABVB 2G1EA 3AEBB 3LXFA 2MJ3A 2PKOA 3AE6B 5GXGB 3VR9B 2WDVB 2FBWB 4YXDB 5H92C 2BS2B 1ZP0B 3WCQA 1TYGB 3NVZA 2WU2B 1E9MA 3EUB2 3AV8A 4YSZB 1N61A 3SFEB 1JQ4A 1WRIA 3NVVA 3BIID 1OFFA 2JX5A 2HTME 3B9JA 3AMZA 1XO3A 1WXQA 1ROEA 2WLBA 1E0ZA 1JALA 1F0ZA 4YT0B 2K9XA 4ITKA 1DGJA 1YQ3B 2DBYA 1XLPA 4HROA 1TJEA 2PVGC 1TKEA 2KMMA 2CJOA 1FFUA 1JROA 4N58A 1J7BA 1NVID 1FRRA 4YTNB 4C7ZA 1E6EB 4C7YA 1E10A 1FFVA 3RPFC 4C80A 2W3SA 2CJNA 2AX5A 1JW9D 3W5UB 1FO4A 4JWSC 1NEKB 1OQRA 3AEGB 4KX6B 1KFYB 3P63A 4P6VF 2BS4B 3AE3B 1A70A 2ACZB 3DWMA 3AE9B 5G5HA 2BT6A 4WQMA 1CJEA 1DOXA 1QOBA 1PFDA 5EE1A 2MJDA 2CU3A 5EE0A 2JQRB 3VR8B 2N0SB 3P4PB 2W55A 1L5PA 2W3RA 3P4RB 1VDVA 3AM9A 1RFKA 5H8YE 1OQQA 2WDRB 4WWMA 4YTMB 3HUIA 1L6VA 2DWQA 1ZXIA 3AECB 2W54A 2WQYB 1N60A 1AYFA 4JWUC 5C3JB 3NVWA 3AE2B 4YTPB 1RYJA 2EKIA 5EE3A 3SFDB 1FM0D 2WDQB 3AE5B 1J7AA 3PO0A 4US8A 1FXAA 1QLBB 1YJIA 3AH7A 2WP9B 3CIRB 3ETRA 3P4QB 4ZOHC 3VRBB 1GPXA 1FXIA 3AN1A 1XLQA 2MH7A
chains in the Genus database with same CATH superfamily
2HE7A 1NBFC 3AU4A 3KQ4A 2BYFA 1VZ8A 1YMHE 3AI5A 3AE7B 1P3QU 1VLBA 5TR5A 5BMHA 1L0XB 2BW2A 1VD2A 3A4SC 3N20C 3PZ7A 2I1KA 2PPHA 1B1ZA 2AQ1B 2O6VD 4KZ0A 2NTSA 4ZRQA 3L54A 5T8IA 1I7HA 1XF5L 4KVGB 3SR6A 4M0WB 2V3NA 3L10B 2ON8A 1V9JA 4QAYA 3NVYA 1ZDXA 5CHWA 4C4VB 4B9KA 1JRUA 3U2SC 2XBBC 1ISNA 1WWTA 3Q3NC 3KWVA 1RWSA 2V1YA 1C4AA 4G3XB 4GDLB 3URYA 4KIKA 5FR3A 5GXGB 1WSPA 3IAS1 2KWCA 1ZP0B 1BMLC 2ZCCA 4NJCA 4OHJA 4DQOC 1NI2A 1T6BX 1SE9A 3Q3FA 1D6EC 3B08A 4XDCA 4W9KA 3PREA 1WXQA 1M94A 1E0ZA 2BKFA 2K9XA 2YLMA 2ZPYA 3RNCC 2NPTA 2KX3A 4IM2A 1WMHB 3T3NA 2KZRA 2KTFA 4UDUC 4J3OD 1ZKHA 2VRRB 3R7RA 1EM7A 3AEGB 3KYDD 1WJ4A 4MELA 5DPTA 3ZO5B 2GBKA 1PFDA 5LNK1 2RPVA 1OQQA 2J0MA 2WDRB 2QCZA 1L6VA 1WGDA 1UD7A 3QWZB 2KQ4X 4HDQA 3I63C 1H8CA 1TY2A 5AZHA 1WYWB 5IA7A 3U7ZA 1IYFA 1MPEA 1QLBB 4EZJA 3KW5B 4FA6A 2LEKA 2LGIA 2ONQA 4OW0A 2G4SA 2GBNA 2VH1A 4MEMA 1N5WA 2KDBA 3CF6E 2LUMA 4J6IA 5BYQA 4I6LB 4HCNB 3PRPB 3V61A 2KAJA 3AU5A 1EF1A 4OVUA 1CQVA 2LMCA 2GBMA 2QHOA 2N9EB 2INDC 2BB5A 3QC8B 1V8CA 3ML9A 1C77A 4YSYB 1YN3A 2ZW0A 2NS5A 1ET9A 1AARA 4LJPB 1XD3B 1VCBA 2KXJA 3WAOA 2DYMA 1N63A 4AUQC 2LD9A 1YQBA 2INCC 4WWOA 4ZRKA 4EE2A 5C1ZA 5LXIB 2V3SA 1SSNA 1IGDA 4TV3A 3ABVB 3U4EG 1LXDA 4WH4A 2BS2B 3ZXRA 1Q1OA 4LNOA 4W9GA 1WRDB 4AJYB 5BO4B 4DHJB 1ROEA 3TL5A 2QILA 2IJ0A 4WAAA 1J7BA 4YTNB 3SD5A 4C80A 2LXCA 1WIAA 2HJ1A 4XWTA 3NY5A 2K0PA 3L13A 1Q10A 4CHKA 1GJZA 3DPDA 1L5PA 2LWPA 2A4ZA 1WJUA 3HUIA 1GC6A 1SE4A 1GB1A 1L0YB 1P7FA 3CSFA 2FUHB 4TQ0A 4US8A 4MT5A 3IAM1 1E8XA 4MGIE 2D3BA 1T0QC 4HPLB 2REXA 1NYQA 1IBXB 2KO3A 3L08A 1IBXA 4NAMA 4I6PA 2BYTA 1YN5A 3K9PB 1QOFA 4GSWA 2K6QA 1N62A 2KJHB 3AE8B 4NY0A 4FJVB 3BY4B 2Z59B 4DXFA 2BQQA 4GB9A 1VR9A 3APDA 3PRZA 2ZZPB 1AW7A 5HG2A 1F77A 3BK1A 2QSDA 3W9CB 5L95C 2CHWA 2PLPA 2V3PA 3EFUA 4GIVA 4IM0A 3RNBC 1JWUD 4MGKE 3A4RA 3UIPB 1LQBA 4IUMB 1Z2MA 2KQSA 2KANA 4BZAA 4MSMB 1V2YA 1FD6A 4MJSB 3DVGY 2VH2A 2PEAA 3QCAA 2AX5A 2I38A 4FJYA 4JWSC 3RULA 3I5JC 4XYCA 1JMLA 1XQQA 1K51A 2JQRB 3P4RB 2DZMA 3Q2AC 2DWQA 1K53A 3Q3MC 3ZJUA 2KACA 1CK1A 2AEHA 3EECA 3VTUA 3UINB 2QDFA 5FK9C 2WDTB 4II3B 3N1XC 3APCA 3VH4B 5IP4D 2WXNA 1LO5D 3W1SA 3ONSA 1Y8RC 1T5XD 3V3XA 4JX1C 1FPYA 1F52A 4BKTA 3FILB 5AEKB 1TS4A 3LYYA 3C0RB 2J52A 1VZ6A 2N1WA 1FRDA 2MJEA 2SEBD 1N5XA 3N9YC 2M1MA 1V97A 1R7SA 1YJJA 3ZTDA 3B2GA 1UZXB 4KSLC 3ZJTA 1CZPA 2WS3B 3RNEC 1RAXA 4HRSA 1JRPA 2KN4A 1I4XA 2CKHB 4RGNA 5DCNA 1Z5SB 3AE6B 4GMVA 1WJNA 2DLBA 2JXTA 3U7DA 2C7HA 1SE2A 5D7GA 4HKZE 2KDEB 3MC0B 3AMZA 4K1RB 3DDCB 2ZVOA 4RNAA 4MJSA 5HKHA 4AP4C 2N7EA 2PVGC 1MFWA 4RF0A 3RZWC 3DBRB 1JWMD 5BYRA 3NUHB 1UGJA 3KUDB 1C4CA 1MG8A 1ACCA 2D5GA 1TTNA 4KGSA 1EU3A 2R2OA 4JGHB 2D11A 1MJDA 2GOWA 1TIFA 5E6OA 3QK0A 3L17A 4TQ1A 3OJ3A 2OEDA 4JWUC 5C3JB 4RCOA 1GC7A 2LJ5A 2ZW1A 1L4DB 1J7AA 2GBRA 1YJIA 4EOYA 1GPXA 4ITKA 5HHDG 4TKNA 1NI3A 2WWZA 3AB5A 1K8RB 1WYGA 2RGFA 3NS8A 3DVNU 4S17A 5JH5C 2GI9A 3AE4B 3L4PA 4ARCA 3Q69A 3ZLZA 2GBJA 4A3PA 2YEPB 1HTOA 1D5ZC 2M17A 4YSXB 3RYTA 1SIFA 3HVZA 1KOTA 4M00A 2MBBB 1TZOA 3VRAB 4W9CA 2Y5PA 3VQIA 3M95A 5HFYA 3UF8A 2RDGA 1SXTA 1T3QA 1PYWD 3HHMA 4LTUA 3JSVB 1R4MI 3T9LA 1V80A 3BK2A 5LLIA 2OJWA 4RGOS 3VR9B 3UI3A 4YXDB 1RLFA 3N3KB 3AULA 2G9HD 4K3CA 1N61A 2L3ZA 1WX8A 1X1MA 3W2DA 1YQ3B 4O1NA 2KWVB 3PVLA 2MRPA 3GOEA 1T0YA 3APFA 4C7ZA 4EKUA 1OQRA 3P42A 3QJZA 4RGMA 4FLHA 4L2YA 1STEA 5CX3A 1CMXB 2KHWB 2MBEA 4MGZE 2DYBA 4M0WA 1YX5B 3BVZA 4YTPB 2K8CA 2NTTA 2EKIA 4IW0A 2IDYA 2IO2B 2KN5A 4LNNA 4RGTA 1HZ6A 1J8CA 1PGAA 2BYEA 3ZNZB 4DHJD 3VAWA 1QT9A 1XCQL 3U52E 4FBJB 4ZHPA 3JSVA 2BGFA 4WWPA 1WR1A 2DHZA 1GAQB 1TS2A 1BT0A 1UWMA 3H7PB 4L1BA 2IY0B 3Q8EA 2B3AA 1R4NB 1LM8B 2WXLA 2IO1B 1XLNA 5E6JA 3Q8BA 4N59A 2FNJB 1KM7A 1P7EA 1E7UA 4EZKA 4NPNA 1WR6E 1WMHA 1I4RA 2O2VA 2CU1A 2B76B 3Q8FA 1TS5A 2BPSA 4DXGA 1DYQA 4EUTA 1QILA 2HJ8A 1SJED 5KHQA 3CMMB 3ZRFA 4NJ6A 2D3AA 3ZIMA 2MWSB 3MHSD 2FBWB 5H92C 4PYZA 1BXTA 2MBHA 3QARA 3U30A 2C5LC 2KFKA 2AQ2B 3ZNGC 2RDBC 3ZTCA 2IO0B 4DHZE 3WAMA 3WIMA 4PS8A 2CJOA 1FFUA 1FCLA 2J0JA 1KLVA 3KVFB 4L23A 2ACZB 3OAWA 5G5HA 1C79A 2LHEA 1R4MB 2KOXA 4WWMA 1ZXIA 4PK1A 3I3TB 5EE3A 1D5XC 3GZNI 4JPSA 3PO0A 3AH7A 3UQBA 2WP9B 3A9KB 3N1YC 1A5RA 1KLUD 2C9WB 2X38A 3N32A 2K5PA 1TT5B 3RD2A 3DWGC 2DZIA 4XE0A 2KJRA 2WGSA 2WU5B 3DHHC 2BS3B 2QIEB 4GN1A 3Q6BA 4MSQB 2FCQA 2JUOA 5TSSA 1HA5A 2IO3B 4ARIA 3ML8A 4RFBA 1I4GA 2NBUA 4S0RA 3AEDB 1Q5WB 1YX6B 3GE3C 4WJQA 1K50A 3GP7A 5D94A 3NRZA 4LDTD 1QOAA 2LUEA 1KTKA 4II2B 2LGYA 1HEZE 3DCGA 3TUOA 2FUG1 2D07B 2JVCA 1GNUA 2WXGA 3MJWA 2BTEA 3HM3A 2PKOA 3DBHB 5D2MB 2MSED 2CHXA 2J42A 3PLUA 4CYEA 1KJTA 3AV8A 4YSZB 4WURA 3SFEB 5DPRA 2JX5A 3A9KA 2KQ7A 4GOCA 1JALA 1DGJA 2FE8A 1R4NI 1FEHA 3H9DA 3K9OB 4KKIA 2NCNA 2J7QB 2UYZB 4E3CA 2MHJA 4BVUC 2CHZA 4OZCA 3VTWA 1JWSD 1KFYB 1KLGD 2KLCA 1EUVB 1E8YA 1V81A 2WYQA 2M4NA 5FKAC 1V1PA 2L00B 1XCTL 1WF9A 2V4IB 2PE9A 2D2QA 4JQWC 2ZEQA 1L2NA 2LHDA 4ZOHC 3ETRA 4A8XC 1MVKA 2EMSA 3ZKJC 1OGWA 4CQNA 2RPQA 2RSUA 2SAKA 5AUKA 2LRUA 4KV2A 2XK5A 3B1LX 3NZUA 3PLVA 2KK8A 4MACA 5CHVC 4AJWA 4FJZA 1E5WA 4FXCA 2MQJA 2PTLA 1UUPA 2ZCBA 1TKYA 2L83A 1D4BA 2AWTA 2IBIB 3CWIA 1S1QB 1UH6A 3KUZA 4IDIA 4IC7B 2QC8A 3IVFA 1IGCA 5EE9A 4OVZA 1XLOA 4M8MA 4K81A 3L16A 1UWXA 2LXAA 2WXHA 1RRBA 2M56B 4C00A 4P16A 4ANXA 4DDID 2Z0DB 5D3IB 2L8JA 2NR2A 5C2TB 1UGMA 3RFZB 1HQRD 2MJ3A 2V9HA 4NZLB 1ZE3D 1OQYA 3LDZE 2DNFA 3D32A 4F8CB 4CO7A 4NNJB 3IG3A 2DAFA 2MP2B 3RNGC 4WQOB 1Y56A 3GB1A 2K39A 3HM6X 3TIXA 1T0SC 2KTRA 2C60A 2L7RA 4XWWA 4PS3A 4WQMA 1XT9B 2N0SB 4TSSA 1RFKA 2N7DA 4OZAA 4MM3B 3Q8CA 5BMGA 4ANWA 2KLGA 1LGRA 2OJRA 3Q3JA 3JVZX 2OHFA 4JIOU 2FIDA 5HI1A 2VZKB 4M01A 4GDLA 3HRDD 2KDIA 1DOYA 1NENB 2NBWB 2GLSA 1F2RC 1YIWA 1JWAD 3ZNID 1ZDVA 2WXQA 3VDZA 1WGGA 3BYTB 5AZGA 4ZRIA 4HKQA 2XN9C 1QKZA 1QF6A 1J7CA 1C78A 1WXMA 4BOZB 1PUTA 2KT7A 1QQRA 2HDEA 2N9XA 2M19A 2K8HA 4JE3B 3P4SB 5JHAA 2PJHA 4E74A 1YN4A 3IFWB 3DBLB 1WJ6A 1WE6A 4FULA 1E90A 5AZFA 4HXDA 2MBOA 2G4DB 5J17A 3ZRCA 3H7SA 3ZDTA 4YT0B 1V86A 4KGRA 4OZBA 2DBYA 1ZW7A 2LJIA 4BKSD 2KMMA 2LGXA 3PHXB 1JROA 3O13A 3QA8A 3I9V1 2CJNA 4R3DA 3Q14C 2KTRB 4A6QA 2ICIA 2QEJC 3DWMA 1CJEA 2E6XA 1E7VA 1F9JA 3DVGX 3TMPB 4TMAB 3AECB 3RN9C 2INNE 2WXFA 4WJPA 2O2VB 3VUXA 5DPSA 3IHPC 1WM3A 1FXAA 1P98A 2D3GA 2IPKD 1XLQA 2LVOA 2K1FA 4F7ZA 1U4AA 3VFKA 2L32A 3FAHA 3MHZA 2NPTB 2UU7A 3BWUD 3B0AA 1UF0A 2WX0A 4GU2A 1ZGUB 3H7PA 2L0TA 3WA0A 5EDSA 3IT4B 3OJ4B 4K7SA 1E8WA 3RUIB 2PE6B 1I4QA 1QZEA 4B0EA 1L7YA 2KVRA 5E6NA 3P2BA 2WXMA 2WHIA 1VJKA 4M02A 2C7NB 1E8ZA 5IOIA 1WX9A 5IN7A 3DHGC 4A9AA 4M8NA 4PT5A 1V6EA 2JWUA 3RZFA 3QX1A 3VTVA 2DZJA 3OLMD 2OOBB 4P7IA 3AXCA 2J53A 1XXGA 2N7JA 1E9MA 3C19A 4HPPA 1OFFA 3SEBA 4BAXA 2CR5A 1GB4A 3IT6B 1WM2A 3V6CB 1F2RI 1TJEA 3T8MA 1C3TA 4D2KA 1NVID 3SU8X 3MC8A 2W9NA 3DBSA 1FFVA 3RPFC 2BWFA 2BKRB 4WWNA 3NHEB 2C7MB 5IKCM 2UWQA 2DENB 1SBBB 2KWUB 3P63A 2FIFA 3AE3B 3R7QA 1A70A 2JWZA 4ICVA 3V05A 4W9JA 5CTRC 3MP9A 5EE1A 3RT3B 3VR8B 3DBRI 2I2YA 4XGAB 4YL8A 2JZZA 2LGSA 3AE2B 3SHQA 1Q0WB 4W9DA 2MCNB 3TEZA 2KNBA 1PGBA 4DDGD 3ZW3A 3BYYB 2K6DB 2MW5A 4NQLB 1SF0A 4G11A 2KWDA 3R2TA 1OEYA 2M0XA 4XX5A 4N6EB 1XEEA 4FHJA 1B9RA 1F1HA 2NMQA 1KF6B 2HTHA 3ALBA 4DWFA 1SJHD 4KGTA 2Z0EB 3X0WA 4KSKC 1VZ7A 4K3BA 4ZHOA 1ENFA 4KZCA 3HK0A 5AUIA 4GLSC 2Y5BB 4LCDE 4US9A 4LDTB 3ZXVA 3ECIA 4LLGM 1TZ1A 3AE1B 5LXHA 2JY6A 1WXAA 2G3QB 2BWES 1YOVB 3PT2B 4BOSC 2PVOD 2Z8LA 3B2FA 3BVGA 1D3ZA 5J2RA 2G1EA 1H4RA 1I4HA 1FNWA 2WDVB 3NVZA 2IGDA 3EUB2 2KDFB 3R66C 1I4PA 3O65B 4E71A 2PMVA 2ZJDA 1F0ZA 5C23A 2QMTA 2L0FA 1TBEA 2D3CA 1C76A 3KLSX 2GRIA 2W3SA 1JW9D 2KVZA 2AYOB 1NEKB 1DOXA 1QOBA 3PGEA 2MJDA 3P4PB 2W82A 3GE8C 2MBQA 4YTMB 2W54A 2XNAC 2X8XX 2FCSA 4WAFA 1RYJA 1HZ5A 3ZQ4A 5GMVA 1FXIA 2EELA 3DHIC 1LFDA 3EC8A 1EWCA 1UNSA 3W5VB 3Q3OC 4AQ7A 2E3TA 4W9FA 4MGYE 4BBNC 4ZDVA 3MTNB 2MLBA 1EU4A 4MH8A 2RD0A 1P0RA 4URKA 1K52A 3ZYYX 4F1SA 4I6NB 1ZOYB 2LI5A 1V5OA 2IGHA 2I1JA 4EZLA 1TGZB 3FC4A 2GMIC 2EMTA 1JWBD 4ASWC 3JW0X 3M3JA 2A5UA 2J0KA 2HD5B 2WNMA 3DBLI 2BF8B 5CHFA 3BINA 1OTRB 2DAJA 3UQAA 1SE3A 2KD0A 1GUAB 4HVBA 3TEXA 4NQKE 3WAPA 5BMIA 1WGRA 3FILA 1JQ4A 3PSEB 2HTME 1XO3A 2WXIA 4HROA 3KH0A 1TKEA 2JRIB 2PW9A 4H2AA 3GS2A 4ICUA 2LFIA 1JCKB 4C4VA 1UELA 2R61A 4B6WA 4KX6B 1P9DU 2BS4B 2JSVX 1WY8A 3A9JB 3S2AA 1MHHE 3NG0A 1WXSA 1YNTE 1VDVA 4A3OA 2JYEA 2WQYB 3DQVA 1AYFA 3TBLD 3NVWA 3ZDMC 4HJGE 3AE5B 3OG5A 1EO6A 2MX2A 1V49A 4MH0E 3AM9A 2KYWA 2IY1B 2XEWA 3TEWA 3L0WB 1D5MC 2KFJA 2Q5WD 1IUEA 4GGQA 1FCCC 2INPE 1AWDA 4LJOB 3ZGZA 3KWLA 1HXYD 4B0MA 3P1MA 5IO9A 2N9KA 3T3OA 1ZUD2 2MP2A 2WX1A 4REZA 5G2NA 2WXJA 5DPWA 2L05A 3ZUNA 1KH0A 3E56A 3PZDA 1GOZA 3JYUA 1J0GA 4IM3A 4LNKA 1RFAA 1FMAD 2JZPA 5JZEB 2V4LA 1P1AA 2GB1A 2L76A 2IGGA 4WIPA 3A9JA 5D6JB 4USAA 2DYOA 4A20A 3QIJA 2BYVE 5D3DA 2AL6A 1WE7A 3BVMA 4MM3A 4ANVA 4HJKA 1WGHA 1WRIA 2J4XA 3B9JA 4P1BC 5IAAC 4HLEA 3I57A 2LVQA 4KDIC 2CS4A 4C7YA 1FRRA 1E6EB 4DXAB 2JZ3B 3W5UB 3V6EB 1SEBD 2KX0A 1NDDA 2VZKD 5E6PA 3IBEA 3WANA 4LNIA 5I4DA 4IWOA 5H8YE 4HPMB 3W1SC 1N60A 4A55A 3PZ8A 2WDQB 4P1CC 1YJ1A 3H6NA 3CIRB 4ZYNA 2EKEC 2G45B 2MH7A 2WXOA 3EGRA 1NYRA 1PDXA 2TSSA 4FN2A 3EFCA 2DX5B 2K22A 1SIJA 3V62A 4W9IA 4BFRA 4RF1A 4AWJA 4K7UA 1I42A 3WALA 3N1ZC 3N30A 3RI7C 5G5GA 1V5TA 2N1VA 3Q8AA 4DBGA 4G50A 1YQ4B 1WZ0A 2O6VB 2O6VA 1MHXA 1QOGA 2KMAA 1L6UA 1FIQA 1V1OA 1E7PB 4KKJA 4A90A 1HE8A 1C9FA 5J18A 4BKSA 4BKGA 4AS1A 3LB8C 2R2QA 2H88B 3X23A 4HK2A 2RMMA 3OWEB 5JHBA 4X57B 1SGHA 4DHZB 3LXFA 2K8BA 4KDLB 4RH6A 1HTQA 1TY0A 1WFYA 2WU2B 2WXKA 1IP9A 3M63B 2KMCA 2MA9B 1EF5A 3A1QB 3PS6A 1FO4A 1N6ZA 3MC9A 1FNVA 4IWPA 4P6VF 2RDHA 3VHTC 1GG3A 1S3SG 4IKGA 1ZXHA 4HDOA 1ET6A 4NJ7A 1M4VA 4RM9A 4PS7A 3ZJVA 3RNAC 3PHWB 2M8SA 4RM8A 1UBQA 3MFGA 4JL9A 1C4PA 3CSTA 5JXVA 2KFKB 2N9LA 4GDKB 3VRBB 3P4QB 3W1YA 3R2IA 4EFOA 3AN1A 4HWIB 3HVDA 3UIOB 2IZVB 3TCAA 3R3MA 3ENEA 4K7WA 1DOIA 1PQSA 4FADA 2LRWA 2N4FA 1EWYC 3DBHI 3QHTA 2BBCA 4ZYSA 2KC1A 5MPOA 4AOFA 3UGBB 2FCNA 4ZRPA 2K25A 1L4ZB 3AEEB 2QJLA 4JLCA 1OEYJ 1WH3A 2FCMA 3LJ3A 3PPAA 2IYDB 1KRHA 1T0RC 4BBNF 2JXXA 3V60A 4G0NB 3NS1A 2L52A 3AEFB 3A1QA 3FKYA 2MEKA 3VH3B 3ZVVA 5BYSA 2PIAA 1ESFA 2ZNVC 5G55A 5KHOA 4HEA1 3DVNV 3NOBA 4B95A 4WJOA 2K3UA 1V1PB 3U8ZA 1SB3C 3AEBB 4LK0M 3A33B 3VUWA 4C56C 4EEWA 1VRAB 1AN8A 4LNFA 4XDDA 3ZNHB 2LGDA 2NVUI 2Y3AA 3QQ8B 4GDKA 4MDKE 2JRHA 1XLPA 4GXBA 2KC2A 2LVPA 3PV1A 2FAZA 3SDLC 3J9CA 4HCPB 1TS3A 1WXVA 1IPGA 4ZRJA 2D10A 4XZ4A 1I35A 2YVCA 1FNUA 3AE9B 3EA6A 2CU3A 2L1AA 5EE0A 2W55A 4OVVA 4N9F4 1FM0D 2KDMA 3MJ5A 4IG7B 2JYTA 3KUCB 3E9SA 1ZPSA 2Y5CA 3HIZA 2NBVB 3NZSA 1RM6C 1UBIA 2JU6X 3C8YA 2AQ3B 4WJNA 5FR6A 2RR9A 4W9HA 3VVWB 4ANUA 1TKGA 1G6JA 1J19A 3R8BA 2ASQA 3TJPA 4IWQA 1WGKA 2YEPF 1L0VB 2WXRA 4PYUA 1C1YB 2JPHA 1BUIC 4ACFA 3H8HA 2LASA 3NJTA 3PTFC 2H89B 4W9LA 2M0AA 3TEYA 4IOIE 1MG4A 3M62B 4RMAA 1PGXA 3AEAB 4TUUA 2KJ6A 2ZVNA 5L83A 2XK5B 3RNFC 2ZNVB 1FXTB 3WCQA 1TYGB 2AL3A 3RMKC 3NVVA 3BIID 4XC2A 3RCZA 4FHKA 4YWGG 3GZNB 2ZPNA 2WLBA 3IXSA 4W9EA 2LZ6A 4Q2JA 1WZ3A 4NAWB 2JT4B 4NAWA 1YD8U 4N58A 1WI0A 2KKCA 1WGYA 4DK5A 2JF5A 1E10A 3EHVA 3PRMB 2V0GA 3NZ3A 3BZDB 3DOWA 2BB6A 2BT6A 1WX7A 3TSSA 2W3RA 3QAQA 3VUYA 4KIKB 3KYCD 2BVCA 1MI0A 2DZKA 3SFDB 2WXPA 3VXWA 3H1UA 2N9PC
chains in the Genus database with same CATH topology
2OHFA 5HHDG 1NI3A 3TEWA 5HI1A 3KQ4A 3AB5A 1WYGA 1VZ8A 2VZKB 1YMHE 1D5MC 3HRDD 2Q5WD 1IUEA 3AE7B 1DOYA 1VLBA 1NENB 5BMHA 1FCCC 1L0XB 2INPE 1AWDA 3ZGZA 2GI9A 3KWLA 1F2RC 2BW2A 1HXYD 1JWAD 3AE4B 3PZ7A 3L4PA 4B0MA 3P1MA 4ARCA 3Q69A 1B1ZA 1ZDVA 2WXQA 2AQ1B 3BYTB 2N9KA 3T3OA 2NTSA 4ZRQA 2YEPB 1ZUD2 4HKQA 2XN9C 1QKZA 1D5ZC 5T8IA 1I7HA 4YSXB 4REZA 1XF5L 2WXJA 1J7CA 1C78A 3HVZA 3SR6A 1QF6A 1KH0A 1TZOA 3E56A 2V3NA 3VRAB 2Y5PA 1GOZA 1PUTA 2ON8A 1QQRA 2HDEA 3VQIA 2M19A 3NVYA 1ZDXA 5HFYA 4JE3B 2RDGA 1FMAD 1SXTA 2JZPA 3U2SC 1T3QA 3P4SB 2GB1A 1WWTA 1PYWD 4LTUA 1YN4A 2IGGA 4WIPA 4USAA 2DYOA 1RWSA 3KWVA 1C4AA 4GDLB 3BK2A 3URYA 4RGOS 5FR3A 3VR9B 5D3DA 5GXGB 1WSPA 3BVMA 3IAS1 3UI3A 4YXDB 1ZP0B 1BMLC 4NJCA 4OHJA 4DQOC 1T6BX 2G9HD 1N61A 1WRIA 2J4XA 3B9JA 1D6EC 4XDCA 3W2DA 1WXQA 1E0ZA 4YT0B 2K9XA 4KGRA 1YQ3B 4O1NA 4OZBA 2DBYA 2LJIA 3I57A 2KMMA 1JROA 3O13A 4C7YA 1FRRA 4C7ZA 1E6EB 3T3NA 4UDUC 3I9V1 4J3OD 2CJNA 3W5UB 4R3DA 1OQRA 1SEBD 1EM7A 3AEGB 3P42A 4A6QA 2VZKD 2ICIA 2QEJC 4RGMA 3DWMA 1CJEA 2E6XA 1PFDA 5I4DA 5LNK1 4L2YA 2RPVA 1STEA 5H8YE 1OQQA 2WDRB 4TMAB 1L6VA 4M0WA 3AECB 1N60A 2KQ4X 3BVZA 4A55A 4YTPB 3PZ8A 2INNE 2NTTA 2WXFA 1TY2A 2EKIA 2WDQB 3U7ZA 2IDYA 1MPEA 1FXAA 1QLBB 3CIRB 4RGTA 1HZ6A 2IPKD 1PGAA 1XLQA 2MH7A 2LEKA 2LGIA 2WXOA 1QT9A 2ONQA 3EGRA 4OW0A 1XCQL 1NYRA 1PDXA 2TSSA 3U52E 4ZHPA 2L32A 3FAHA 2K22A 3MHZA 1SIJA 3BWUD 1N5WA 1GAQB 1TS2A 1UWMA 4RF1A 4L1BA 3IT4B 2LUMA 3Q8EA 5G5GA 5BYQA 3Q8AA 1YQ4B 1MHXA 2WXLA 2KAJA 1QOGA 1CQVA 1I4QA 1XLNA 5E6JA 3Q8BA 2LMCA 4N59A 4B0EA 1L6UA 1P7EA 2BB5A 1V8CA 1FIQA 1C77A 1V1OA 4YSYB 1YN3A 2WXMA 2ZW0A 1I4RA 1E7PB 4KKJA 4A90A 1VJKA 1C9FA 1ET9A 2B76B 3Q8FA 1TS5A 4DXGA 4AS1A 1DYQA 3LB8C 2DYMA 2H88B 1N63A 4A9AA 1QILA 4PT5A 4EE2A 2RMMA 2JWUA 3OWEB 1SSNA 1IGDA 1SJED 3ABVB 3U4EG 3LXFA 4WH4A 2FBWB 4RH6A 5H92C 2BS2B 2J53A 1XXGA 1TY0A 2N7JA 2WU2B 1BXTA 2WXKA 1E9MA 1OFFA 3SEBA 3TEZA 2AQ2B 1GB4A 3IT6B 1ROEA 2QILA 2IJ0A 1F2RI 1TJEA 2CJOA 1FFUA 1FCLA 4D2KA 1J7BA 1NVID 4YTNB 1FFVA 3RPFC 4C80A 1FO4A 4XWTA 1SBBB 1FNVA 3P63A 4P6VF 2K0PA 3AE3B 1Q10A 3V05A 1A70A 2RDHA 4L23A 2ACZB 5G5HA 1C79A 2LHEA 3MP9A 1ZXHA 4IKGA 5EE1A 3VR8B 1ET6A 2I2YA 1L5PA 1M4VA 4WWMA 3HUIA 1ZXIA 3ZJVA 1SE4A 3AE2B 1GB1A 1L0YB 3MFGA 1P7FA 5EE3A 1D5XC 4JPSA 1C4PA 3PO0A 4TQ0A 4US8A 5JXVA 3AH7A 4MT5A 1PGBA 2N9LA 2WP9B 4GDKB 3P4QB 3VRBB 3R2IA 3IAM1 3AN1A 3BYYB 1KLUD 2X38A 3HVDA 2K5PA 3DWGC 1NYQA 4XE0A 1IBXB 1SF0A 1IBXA 2KWDA 1DOIA 4NAMA 3R2TA 2BYTA 1YN5A 4N6EB 1XEEA 1B9RA 2WU5B 2NMQA 1KF6B 1EWYC 1QOFA 2BS3B 2QIEB 2BBCA 4ZYSA 1N62A 5MPOA 1SJHD 4KGTA 1VZ7A 3AE8B 5TSSA 1HA5A 4ZRPA 1ENFA 4ZHOA 1L4ZB 3AEEB 5AUIA 2QJLA 4ARIA 4GLSC 4RFBA 4US9A 1I4GA 4DXFA 3AEDB 1VR9A 4LLGM 1KRHA 1AW7A 3NS1A 5HG2A 2L52A 1K50A 3AEFB 1F77A 2MEKA 3AE1B 3GP7A 3NRZA 5BYSA 2PIAA 1QOAA 3BK1A 1KTKA 2QSDA 1ESFA 3W9CB 1HEZE 4HEA1 3TUOA 2K3UA 2FUG1 2PVOD 2Z8LA 3B2FA 3BVGA 2WXGA 1V1PB 1SB3C 2G1EA 2BTEA 3AEBB 4LK0M 1I4HA 2PKOA 1FNWA 2PLPA 2WDVB 2V3PA 2J42A 4C56C 3NVZA 1JWUD 2IGDA 3EUB2 1VRAB 1AN8A 3AV8A 4WURA 1I4PA 4XDDA 3SFEB 4YSZB 2JX5A 2Y3AA 2PMVA 1JALA 1F0ZA 1DGJA 2FE8A 2QMTA 1FD6A 1XLPA 1FEHA 4KKIA 3J9CA 1C76A 3KLSX 1TS3A 2GRIA 2W3SA 2AX5A 1JW9D 2I38A 4JWSC 4OZCA 1NEKB 1JWSD 1KFYB 1KLGD 1JMLA 1FNUA 3AE9B 1DOXA 1QOBA 3EA6A 1K51A 1V1PA 2CU3A 2JQRB 2L1AA 2MJDA 5EE0A 3P4PB 5FKAC 2W55A 1XCTL 2W82A 3P4RB 2V4IB 4YTMB 2DWQA 1K53A 2W54A 3ZJUA 2XNAC 2KACA 1CK1A 4WAFA 1RYJA 1FM0D 2KDMA 2LHDA 1HZ5A 3MJ5A 5FK9C 4ZOHC 3ETRA 4A8XC 3ZQ4A 1FXIA 2JYTA 1MVKA 3E9SA 2EELA 1ZPSA 2Y5CA 4CQNA 1EWCA 1UNSA 3W5VB 2WXNA 1RM6C 4AQ7A 1LO5D 2JU6X 2E3TA 2SAKA 5AUKA 3W1SA 3C8YA 2AQ3B 1T5XD 4MACA 3V3XA 4JX1C 1TKGA 4FXCA 2PTLA 3R8BA 1EU4A 1UUPA 3FILB 1TS4A 1TKYA 2L83A 1D4BA 4MH8A 3LYYA 3CWIA 1WGKA 2YEPF 1K52A 3ZYYX 1L0VB 2WXRA 2J52A 1VZ6A 1FRDA 4IDIA 1ZOYB 1BUIC 2MJEA 2SEBD 1N5XA 3N9YC 2IGHA 1IGCA 3H8HA 5EE9A 1V97A 2H89B 1R7SA 3FC4A 4OVZA 1XLOA 1YJJA 2M0AA 3TEYA 4IOIE 1JWBD 1UWXA 2WXHA 3B2GA 2M56B 1PGXA 3ZJTA 1CZPA 4P16A 2WNMA 3AEAB 5D3IB 2WS3B 5C2TB 4HRSA 3RFZB 1JRPA 1SE3A 2KN4A 1I4XA 4RGNA 1HQRD 2MJ3A 3AE6B 3TEXA 2DLBA 3WCQA 1TYGB 4NZLB 1ZE3D 2JXTA 5BMIA 1SE2A 3FILA 5D7GA 1JQ4A 3NVVA 4HKZE 3BIID 2HTME 3MC0B 4YWGG 3AMZA 1XO3A 2WXIA 2WLBA 3IXSA 4RNAA 4Q2JA 4HROA 2PVGC 1Y56A 1TKEA 4NAWB 3GB1A 4N58A 2PW9A 4H2AA 4RF0A 3GS2A 1E10A 1JWMD 1JCKB 2LFIA 5BYRA 3NUHB 1UGJA 2R61A 1C4CA 4KX6B 2V0GA 3NZ3A 1ACCA 2BS4B 2D5GA 3BZDB 4XWWA 2JSVX 2BB6A 2BT6A 1EU3A 4KGSA 4WQMA 3TSSA 1MHHE 1YNTE 2N0SB 2W3RA 4TSSA 1VDVA 1RFKA 2JYEA 4TQ1A 4OZAA 2OEDA 4JWUC 5C3JB 4MM3B 2WQYB 3Q8CA 1AYFA 4RCOA 5BMGA 3NVWA 4HJGE 1MI0A 3SFDB 2WXPA 3AE5B 2ZW1A 1L4DB 1J7AA 1YJIA 1GPXA 3AM9A 4ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEK A;  2OHF A;  2Y5C A;  2K5P A;  1NI3 A;  1QT9 A;  3W5V B;  3DWG C;  1NYR A;  1NYQ A;  1PDX A;  4ZHP A;  1SF0 A;  1RM6 C;  3AB5 A;  3FAH A;  2K22 A;  1SIJ A;  1DOI A;  1WYG A;  2E3T A;  5AUK A;  1N5W A;  3HRD D;  1GAQ B;  2Q5W D;  1IUE A;  3AE7 B;  4N6E B;  1B9R A;  1VLB A;  1NEN B;  1DOY A;  2WU5 B;  1UWM A;  1KF6 B;  1EWY C;  1AWD A;  1QOF A;  4JX1 C;  1TKG A;  2BS3 B;  2QIE B;  3KWL A;  4FXC A;  1JWA D;  1N62 A;  3AE4 B;  3L4P A;  5G5G A;  5MPO A;  3P1M A;  1TKY A;  2L83 A;  3AE8 B;  1YQ4 B;  4ZHO A;  1ZUD 2;  3AEE B;  5AUI A;  2KAJ A;  1QOG A;  2QJL A;  3CWI A;  1WGK A;  1I7H A;  4YSX B;  4US9 A;  1XLN A;  3SR6 A;  3ZYY X;  1J7C A;  1L0V B;  3HVZ A;  4N59 A;  1QF6 A;  3AED B;  1FRD A;  1L6U A;  4IDI A;  1ZOY B;  3VRA B;  1KRH A;  1V8C A;  2MJE A;  1FIQ A;  1N5X A;  1PUT A;  4YSY B;  5EE9 A;  3NS1 A;  2L52 A;  3AEF B;  2M19 A;  1V97 A;  2H89 B;  1E7P B;  1R7S A;  3FC4 A;  3NVY A;  1XLO A;  1VJK A;  1YJJ A;  3AE1 B;  3NRZ A;  1FMA D;  2B76 B;  1QOA A;  1JWB D;  2PIA A;  3B2G A;  1T3Q A;  2M56 B;  3LB8 C;  3P4S B;  2H88 B;  1WWT A;  3W9C B;  1CZP A;  1N63 A;  3AEA B;  2WS3 B;  4A9A A;  4LTU A;  5C2T B;  4USA A;  1RWS A;  2PVO D;  3B2F A;  4HRS A;  1JRP A;  1SB3 C;  3ABV B;  2G1E A;  3AEB B;  3LXF A;  2MJ3 A;  2PKO A;  3AE6 B;  5GXG B;  3VR9 B;  2WDV B;  2FBW B;  4YXD B;  5H92 C;  2BS2 B;  1ZP0 B;  3WCQ A;  1TYG B;  3NVZ A;  2WU2 B;  1E9M A;  3EUB 2;  3AV8 A;  4YSZ B;  1N61 A;  3SFE B;  1JQ4 A;  1WRI A;  3NVV A;  3BII D;  1OFF A;  2JX5 A;  2HTM E;  3B9J A;  3AMZ A;  1XO3 A;  1WXQ A;  1ROE A;  2WLB A;  1E0Z A;  1JAL A;  1F0Z A;  4YT0 B;  2K9X A;  4ITK A;  1DGJ A;  1YQ3 B;  2DBY A;  1XLP A;  4HRO A;  1TJE A;  2PVG C;  1TKE A;  2KMM A;  2CJO A;  1FFU A;  1JRO A;  4N58 A;  1J7B A;  1NVI D;  1FRR A;  4YTN B;  4C7Z A;  1E6E B;  4C7Y A;  1E10 A;  1FFV A;  3RPF C;  4C80 A;  2W3S A;  2CJN A;  2AX5 A;  1JW9 D;  3W5U B;  1FO4 A;  4JWS C;  1NEK B;  1OQR A;  3AEG B;  4KX6 B;  1KFY B;  3P63 A;  4P6V F;  2BS4 B;  3AE3 B;  1A70 A;  2ACZ B;  3DWM A;  3AE9 B;  5G5H A;  2BT6 A;  4WQM A;  1CJE A;  1DOX A;  1QOB A;  1PFD A;  5EE1 A;  2MJD A;  2CU3 A;  5EE0 A;  2JQR B;  3VR8 B;  2N0S B;  3P4P B;  2W55 A;  1L5P A;  2W3R A;  3P4R B;  1VDV A;  3AM9 A;  1RFK A;  5H8Y E;  1OQQ A;  2WDR B;  4WWM A;  4YTM B;  3HUI A;  1L6V A;  2DWQ A;  1ZXI A;  3AEC B;  2W54 A;  2WQY B;  1N60 A;  1AYF A;  4JWU C;  5C3J B;  3NVW A;  3AE2 B;  4YTP B;  1RYJ A;  2EKI A;  5EE3 A;  3SFD B;  1FM0 D;  2WDQ B;  3AE5 B;  1J7A A;  3PO0 A;  4US8 A;  1FXA A;  1QLB B;  1YJI A;  3AH7 A;  2WP9 B;  3CIR B;  3ETR A;  3P4Q B;  4ZOH C;  3VRB B;  1GPX A;  1FXI A;  3AN1 A;  1XLQ A;  2MH7 A; 
#chains in the Genus database with same CATH topology
 2HE7 A;  1NBF C;  3AU4 A;  3KQ4 A;  2BYF A;  1VZ8 A;  1YMH E;  3AI5 A;  3AE7 B;  1P3Q U;  1VLB A;  5TR5 A;  5BMH A;  1L0X B;  2BW2 A;  1VD2 A;  3A4S C;  3N20 C;  3PZ7 A;  2I1K A;  2PPH A;  1B1Z A;  2AQ1 B;  2O6V D;  4KZ0 A;  2NTS A;  4ZRQ A;  3L54 A;  5T8I A;  1I7H A;  1XF5 L;  4KVG B;  3SR6 A;  4M0W B;  2V3N A;  3L10 B;  2ON8 A;  1V9J A;  4QAY A;  3NVY A;  1ZDX A;  5CHW A;  4C4V B;  4B9K A;  1JRU A;  3U2S C;  2XBB C;  1ISN A;  1WWT A;  3Q3N C;  3KWV A;  1RWS A;  2V1Y A;  1C4A A;  4G3X B;  4GDL B;  3URY A;  4KIK A;  5FR3 A;  5GXG B;  1WSP A;  3IAS 1;  2KWC A;  1ZP0 B;  1BML C;  2ZCC A;  4NJC A;  4OHJ A;  4DQO C;  1NI2 A;  1T6B X;  1SE9 A;  3Q3F A;  1D6E C;  3B08 A;  4XDC A;  4W9K A;  3PRE A;  1WXQ A;  1M94 A;  1E0Z A;  2BKF A;  2K9X A;  2YLM A;  2ZPY A;  3RNC C;  2NPT A;  2KX3 A;  4IM2 A;  1WMH B;  3T3N A;  2KZR A;  2KTF A;  4UDU C;  4J3O D;  1ZKH A;  2VRR B;  3R7R A;  1EM7 A;  3AEG B;  3KYD D;  1WJ4 A;  4MEL A;  5DPT A;  3ZO5 B;  2GBK A;  1PFD A;  5LNK 1;  2RPV A;  1OQQ A;  2J0M A;  2WDR B;  2QCZ A;  1L6V A;  1WGD A;  1UD7 A;  3QWZ B;  2KQ4 X;  4HDQ A;  3I63 C;  1H8C A;  1TY2 A;  5AZH A;  1WYW B;  5IA7 A;  3U7Z A;  1IYF A;  1MPE A;  1QLB B;  4EZJ A;  3KW5 B;  4FA6 A;  2LEK A;  2LGI A;  2ONQ A;  4OW0 A;  2G4S A;  2GBN A;  2VH1 A;  4MEM A;  1N5W A;  2KDB A;  3CF6 E;  2LUM A;  4J6I A;  5BYQ A;  4I6L B;  4HCN B;  3PRP B;  3V61 A;  2KAJ A;  3AU5 A;  1EF1 A;  4OVU A;  1CQV A;  2LMC A;  2GBM A;  2QHO A;  2N9E B;  2IND C;  2BB5 A;  3QC8 B;  1V8C A;  3ML9 A;  1C77 A;  4YSY B;  1YN3 A;  2ZW0 A;  2NS5 A;  1ET9 A;  1AAR A;  4LJP B;  1XD3 B;  1VCB A;  2KXJ A;  3WAO A;  2DYM A;  1N63 A;  4AUQ C;  2LD9 A;  1YQB A;  2INC C;  4WWO A;  4ZRK A;  4EE2 A;  5C1Z A;  5LXI B;  2V3S A;  1SSN A;  1IGD A;  4TV3 A;  3ABV B;  3U4E G;  1LXD A;  4WH4 A;  2BS2 B;  3ZXR A;  1Q1O A;  4LNO A;  4W9G A;  1WRD B;  4AJY B;  5BO4 B;  4DHJ B;  1ROE A;  3TL5 A;  2QIL A;  2IJ0 A;  4WAA A;  1J7B A;  4YTN B;  3SD5 A;  4C80 A;  2LXC A;  1WIA A;  2HJ1 A;  4XWT A;  3NY5 A;  2K0P A;  3L13 A;  1Q10 A;  4CHK A;  1GJZ A;  3DPD A;  1L5P A;  2LWP A;  2A4Z A;  1WJU A;  3HUI A;  1GC6 A;  1SE4 A;  1GB1 A;  1L0Y B;  1P7F A;  3CSF A;  2FUH B;  4TQ0 A;  4US8 A;  4MT5 A;  3IAM 1;  1E8X A;  4MGI E;  2D3B A;  1T0Q C;  4HPL B;  2REX A;  1NYQ A;  1IBX B;  2KO3 A;  3L08 A;  1IBX A;  4NAM A;  4I6P A;  2BYT A;  1YN5 A;  3K9P B;  1QOF A;  4GSW A;  2K6Q A;  1N62 A;  2KJH B;  3AE8 B;  4NY0 A;  4FJV B;  3BY4 B;  2Z59 B;  4DXF A;  2BQQ A;  4GB9 A;  1VR9 A;  3APD A;  3PRZ A;  2ZZP B;  1AW7 A;  5HG2 A;  1F77 A;  3BK1 A;  2QSD A;  3W9C B;  5L95 C;  2CHW A;  2PLP A;  2V3P A;  3EFU A;  4GIV A;  4IM0 A;  3RNB C;  1JWU D;  4MGK E;  3A4R A;  3UIP B;  1LQB A;  4IUM B;  1Z2M A;  2KQS A;  2KAN A;  4BZA A;  4MSM B;  1V2Y A;  1FD6 A;  4MJS B;  3DVG Y;  2VH2 A;  2PEA A;  3QCA A;  2AX5 A;  2I38 A;  4FJY A;  4JWS C;  3RUL A;  3I5J C;  4XYC A;  1JML A;  1XQQ A;  1K51 A;  2JQR B;  3P4R B;  2DZM A;  3Q2A C;  2DWQ A;  1K53 A;  3Q3M C;  3ZJU A;  2KAC A;  1CK1 A;  2AEH A;  3EEC A;  3VTU A;  3UIN B;  2QDF A;  5FK9 C;  2WDT B;  4II3 B;  3N1X C;  3APC A;  3VH4 B;  5IP4 D;  2WXN A;  1LO5 D;  3W1S A;  3ONS A;  1Y8R C;  1T5X D;  3V3X A;  4JX1 C;  1FPY A;  1F52 A;  4BKT A;  3FIL B;  5AEK B;  1TS4 A;  3LYY A;  3C0R B;  2J52 A;  1VZ6 A;  2N1W A;  1FRD A;  2MJE A;  2SEB D;  1N5X A;  3N9Y C;  2M1M A;  1V97 A;  1R7S A;  1YJJ A;  3ZTD A;  3B2G A;  1UZX B;  4KSL C;  3ZJT A;  1CZP A;  2WS3 B;  3RNE C;  1RAX A;  4HRS A;  1JRP A;  2KN4 A;  1I4X A;  2CKH B;  4RGN A;  5DCN A;  1Z5S B;  3AE6 B;  4GMV A;  1WJN A;  2DLB A;  2JXT A;  3U7D A;  2C7H A;  1SE2 A;  5D7G A;  4HKZ E;  2KDE B;  3MC0 B;  3AMZ A;  4K1R B;  3DDC B;  2ZVO A;  4RNA A;  4MJS A;  5HKH A;  4AP4 C;  2N7E A;  2PVG C;  1MFW A;  4RF0 A;  3RZW C;  3DBR B;  1JWM D;  5BYR A;  3NUH B;  1UGJ A;  3KUD B;  1C4C A;  1MG8 A;  1ACC A;  2D5G A;  1TTN A;  4KGS A;  1EU3 A;  2R2O A;  4JGH B;  2D11 A;  1MJD A;  2GOW A;  1TIF A;  5E6O A;  3QK0 A;  3L17 A;  4TQ1 A;  3OJ3 A;  2OED A;  4JWU C;  5C3J B;  4RCO A;  1GC7 A;  2LJ5 A;  2ZW1 A;  1L4D B;  1J7A A;  2GBR A;  1YJI A;  4EOY A;  1GPX A;  4ITK A;  5HHD G;  4TKN A;  1NI3 A;  2WWZ A;  3AB5 A;  1K8R B;  1WYG A;  2RGF A;  3NS8 A;  3DVN U;  4S17 A;  5JH5 C;  2GI9 A;  3AE4 B;  3L4P A;  4ARC A;  3Q69 A;  3ZLZ A;  2GBJ A;  4A3P A;  2YEP B;  1HTO A;  1D5Z C;  2M17 A;  4YSX B;  3RYT A;  1SIF A;  3HVZ A;  1KOT A;  4M00 A;  2MBB B;  1TZO A;  3VRA B;  4W9C A;  2Y5P A;  3VQI A;  3M95 A;  5HFY A;  3UF8 A;  2RDG A;  1SXT A;  1T3Q A;  1PYW D;  3HHM A;  4LTU A;  3JSV B;  1R4M I;  3T9L A;  1V80 A;  3BK2 A;  5LLI A;  2OJW A;  4RGO S;  3VR9 B;  3UI3 A;  4YXD B;  1RLF A;  3N3K B;  3AUL A;  2G9H D;  4K3C A;  1N61 A;  2L3Z A;  1WX8 A;  1X1M A;  3W2D A;  1YQ3 B;  4O1N A;  2KWV B;  3PVL A;  2MRP A;  3GOE A;  1T0Y A;  3APF A;  4C7Z A;  4EKU A;  1OQR A;  3P42 A;  3QJZ A;  4RGM A;  4FLH A;  4L2Y A;  1STE A;  5CX3 A;  1CMX B;  2KHW B;  2MBE A;  4MGZ E;  2DYB A;  4M0W A;  1YX5 B;  3BVZ A;  4YTP B;  2K8C A;  2NTT A;  2EKI A;  4IW0 A;  2IDY A;  2IO2 B;  2KN5 A;  4LNN A;  4RGT A;  1HZ6 A;  1J8C A;  1PGA A;  2BYE A;  3ZNZ B;  4DHJ D;  3VAW A;  1QT9 A;  1XCQ L;  3U52 E;  4FBJ B;  4ZHP A;  3JSV A;  2BGF A;  4WWP A;  1WR1 A;  2DHZ A;  1GAQ B;  1TS2 A;  1BT0 A;  1UWM A;  3H7P B;  4L1B A;  2IY0 B;  3Q8E A;  2B3A A;  1R4N B;  1LM8 B;  2WXL A;  2IO1 B;  1XLN A;  5E6J A;  3Q8B A;  4N59 A;  2FNJ B;  1KM7 A;  1P7E A;  1E7U A;  4EZK A;  4NPN A;  1WR6 E;  1WMH A;  1I4R A;  2O2V A;  2CU1 A;  2B76 B;  3Q8F A;  1TS5 A;  2BPS A;  4DXG A;  1DYQ A;  4EUT A;  1QIL A;  2HJ8 A;  1SJE D;  5KHQ A;  3CMM B;  3ZRF A;  4NJ6 A;  2D3A A;  3ZIM A;  2MWS B;  3MHS D;  2FBW B;  5H92 C;  4PYZ A;  1BXT A;  2MBH A;  3QAR A;  3U30 A;  2C5L C;  2KFK A;  2AQ2 B;  3ZNG C;  2RDB C;  3ZTC A;  2IO0 B;  4DHZ E;  3WAM A;  3WIM A;  4PS8 A;  2CJO A;  1FFU A;  1FCL A;  2J0J A;  1KLV A;  3KVF B;  4L23 A;  2ACZ B;  3OAW A;  5G5H A;  1C79 A;  2LHE A;  1R4M B;  2KOX A;  4WWM A;  1ZXI A;  4PK1 A;  3I3T B;  5EE3 A;  1D5X C;  3GZN I;  4JPS A;  3PO0 A;  3AH7 A;  3UQB A;  2WP9 B;  3A9K B;  3N1Y C;  1A5R A;  1KLU D;  2C9W B;  2X38 A;  3N32 A;  2K5P A;  1TT5 B;  3RD2 A;  3DWG C;  2DZI A;  4XE0 A;  2KJR A;  2WGS A;  2WU5 B;  3DHH C;  2BS3 B;  2QIE B;  4GN1 A;  3Q6B A;  4MSQ B;  2FCQ A;  2JUO A;  5TSS A;  1HA5 A;  2IO3 B;  4ARI A;  3ML8 A;  4RFB A;  1I4G A;  2NBU A;  4S0R A;  3AED B;  1Q5W B;  1YX6 B;  3GE3 C;  4WJQ A;  1K50 A;  3GP7 A;  5D94 A;  3NRZ A;  4LDT D;  1QOA A;  2LUE A;  1KTK A;  4II2 B;  2LGY A;  1HEZ E;  3DCG A;  3TUO A;  2FUG 1;  2D07 B;  2JVC A;  1GNU A;  2WXG A;  3MJW A;  2BTE A;  3HM3 A;  2PKO A;  3DBH B;  5D2M B;  2MSE D;  2CHX A;  2J42 A;  3PLU A;  4CYE A;  1KJT A;  3AV8 A;  4YSZ B;  4WUR A;  3SFE B;  5DPR A;  2JX5 A;  3A9K A;  2KQ7 A;  4GOC A;  1JAL A;  1DGJ A;  2FE8 A;  1R4N I;  1FEH A;  3H9D A;  3K9O B;  4KKI A;  2NCN A;  2J7Q B;  2UYZ B;  4E3C A;  2MHJ A;  4BVU C;  2CHZ A;  4OZC A;  3VTW A;  1JWS D;  1KFY B;  1KLG D;  2KLC A;  1EUV B;  1E8Y A;  1V81 A;  2WYQ A;  2M4N A;  5FKA C;  1V1P A;  2L00 B;  1XCT L;  1WF9 A;  2V4I B;  2PE9 A;  2D2Q A;  4JQW C;  2ZEQ A;  1L2N A;  2LHD A;  4ZOH C;  3ETR A;  4A8X C;  1MVK A;  2EMS A;  3ZKJ C;  1OGW A;  4CQN A;  2RPQ A;  2RSU A;  2SAK A;  5AUK A;  2LRU A;  4KV2 A;  2XK5 A;  3B1L X;  3NZU A;  3PLV A;  2KK8 A;  4MAC A;  5CHV C;  4AJW A;  4FJZ A;  1E5W A;  4FXC A;  2MQJ A;  2PTL A;  1UUP A;  2ZCB A;  1TKY A;  2L83 A;  1D4B A;  2AWT A;  2IBI B;  3CWI A;  1S1Q B;  1UH6 A;  3KUZ A;  4IDI A;  4IC7 B;  2QC8 A;  3IVF A;  1IGC A;  5EE9 A;  4OVZ A;  1XLO A;  4M8M A;  4K81 A;  3L16 A;  1UWX A;  2LXA A;  2WXH A;  1RRB A;  2M56 B;  4C00 A;  4P16 A;  4ANX A;  4DDI D;  2Z0D B;  5D3I B;  2L8J A;  2NR2 A;  5C2T B;  1UGM A;  3RFZ B;  1HQR D;  2MJ3 A;  2V9H A;  4NZL B;  1ZE3 D;  1OQY A;  3LDZ E;  2DNF A;  3D32 A;  4F8C B;  4CO7 A;  4NNJ B;  3IG3 A;  2DAF A;  2MP2 B;  3RNG C;  4WQO B;  1Y56 A;  3GB1 A;  2K39 A;  3HM6 X;  3TIX A;  1T0S C;  2KTR A;  2C60 A;  2L7R A;  4XWW A;  4PS3 A;  4WQM A;  1XT9 B;  2N0S B;  4TSS A;  1RFK A;  2N7D A;  4OZA A;  4MM3 B;  3Q8C A;  5BMG A;  4ANW A;  2KLG A;  1LGR A;  2OJR A;  3Q3J A;  3JVZ X;  2OHF A;  4JIO U;  2FID A;  5HI1 A;  2VZK B;  4M01 A;  4GDL A;  3HRD D;  2KDI A;  1DOY A;  1NEN B;  2NBW B;  2GLS A;  1F2R C;  1YIW A;  1JWA D;  3ZNI D;  1ZDV A;  2WXQ A;  3VDZ A;  1WGG A;  3BYT B;  5AZG A;  4ZRI A;  4HKQ A;  2XN9 C;  1QKZ A;  1QF6 A;  1J7C A;  1C78 A;  1WXM A;  4BOZ B;  1PUT A;  2KT7 A;  1QQR A;  2HDE A;  2N9X A;  2M19 A;  2K8H A;  4JE3 B;  3P4S B;  5JHA A;  2PJH A;  4E74 A;  1YN4 A;  3IFW B;  3DBL B;  1WJ6 A;  1WE6 A;  4FUL A;  1E90 A;  5AZF A;  4HXD A;  2MBO A;  2G4D B;  5J17 A;  3ZRC A;  3H7S A;  3ZDT A;  4YT0 B;  1V86 A;  4KGR A;  4OZB A;  2DBY A;  1ZW7 A;  2LJI A;  4BKS D;  2KMM A;  2LGX A;  3PHX B;  1JRO A;  3O13 A;  3QA8 A;  3I9V 1;  2CJN A;  4R3D A;  3Q14 C;  2KTR B;  4A6Q A;  2ICI A;  2QEJ C;  3DWM A;  1CJE A;  2E6X A;  1E7V A;  1F9J A;  3DVG X;  3TMP B;  4TMA B;  3AEC B;  3RN9 C;  2INN E;  2WXF A;  4WJP A;  2O2V B;  3VUX A;  5DPS A;  3IHP C;  1WM3 A;  1FXA A;  1P98 A;  2D3G A;  2IPK D;  1XLQ A;  2LVO A;  2K1F A;  4F7Z A;  1U4A A;  3VFK A;  2L32 A;  3FAH A;  3MHZ A;  2NPT B;  2UU7 A;  3BWU D;  3B0A A;  1UF0 A;  2WX0 A;  4GU2 A;  1ZGU B;  3H7P A;  2L0T A;  3WA0 A;  5EDS A;  3IT4 B;  3OJ4 B;  4K7S A;  1E8W A;  3RUI B;  2PE6 B;  1I4Q A;  1QZE A;  4B0E A;  1L7Y A;  2KVR A;  5E6N A;  3P2B A;  2WXM A;  2WHI A;  1VJK A;  4M02 A;  2C7N B;  1E8Z A;  5IOI A;  1WX9 A;  5IN7 A;  3DHG C;  4A9A A;  4M8N A;  4PT5 A;  1V6E A;  2JWU A;  3RZF A;  3QX1 A;  3VTV A;  2DZJ A;  3OLM D;  2OOB B;  4P7I A;  3AXC A;  2J53 A;  1XXG A;  2N7J A;  1E9M A;  3C19 A;  4HPP A;  1OFF A;  3SEB A;  4BAX A;  2CR5 A;  1GB4 A;  3IT6 B;  1WM2 A;  3V6C B;  1F2R I;  1TJE A;  3T8M A;  1C3T A;  4D2K A;  1NVI D;  3SU8 X;  3MC8 A;  2W9N A;  3DBS A;  1FFV A;  3RPF C;  2BWF A;  2BKR B;  4WWN A;  3NHE B;  2C7M B;  5IKC M;  2UWQ A;  2DEN B;  1SBB B;  2KWU B;  3P63 A;  2FIF A;  3AE3 B;  3R7Q A;  1A70 A;  2JWZ A;  4ICV A;  3V05 A;  4W9J A;  5CTR C;  3MP9 A;  5EE1 A;  3RT3 B;  3VR8 B;  3DBR I;  2I2Y A;  4XGA B;  4YL8 A;  2JZZ A;  2LGS A;  3AE2 B;  3SHQ A;  1Q0W B;  4W9D A;  2MCN B;  3TEZ A;  2KNB A;  1PGB A;  4DDG D;  3ZW3 A;  3BYY B;  2K6D B;  2MW5 A;  4NQL B;  1SF0 A;  4G11 A;  2KWD A;  3R2T A;  1OEY A;  2M0X A;  4XX5 A;  4N6E B;  1XEE A;  4FHJ A;  1B9R A;  1F1H A;  2NMQ A;  1KF6 B;  2HTH A;  3ALB A;  4DWF A;  1SJH D;  4KGT A;  2Z0E B;  3X0W A;  4KSK C;  1VZ7 A;  4K3B A;  4ZHO A;  1ENF A;  4KZC A;  3HK0 A;  5AUI A;  4GLS C;  2Y5B B;  4LCD E;  4US9 A;  4LDT B;  3ZXV A;  3ECI A;  4LLG M;  1TZ1 A;  3AE1 B;  5LXH A;  2JY6 A;  1WXA A;  2G3Q B;  2BWE S;  1YOV B;  3PT2 B;  4BOS C;  2PVO D;  2Z8L A;  3B2F A;  3BVG A;  1D3Z A;  5J2R A;  2G1E A;  1H4R A;  1I4H A;  1FNW A;  2WDV B;  3NVZ A;  2IGD A;  3EUB 2;  2KDF B;  3R66 C;  1I4P A;  3O65 B;  4E71 A;  2PMV A;  2ZJD A;  1F0Z A;  5C23 A;  2QMT A;  2L0F A;  1TBE A;  2D3C A;  1C76 A;  3KLS X;  2GRI A;  2W3S A;  1JW9 D;  2KVZ A;  2AYO B;  1NEK B;  1DOX A;  1QOB A;  3PGE A;  2MJD A;  3P4P B;  2W82 A;  3GE8 C;  2MBQ A;  4YTM B;  2W54 A;  2XNA C;  2X8X X;  2FCS A;  4WAF A;  1RYJ A;  1HZ5 A;  3ZQ4 A;  5GMV A;  1FXI A;  2EEL A;  3DHI C;  1LFD A;  3EC8 A;  1EWC A;  1UNS A;  3W5V B;  3Q3O C;  4AQ7 A;  2E3T A;  4W9F A;  4MGY E;  4BBN C;  4ZDV A;  3MTN B;  2MLB A;  1EU4 A;  4MH8 A;  2RD0 A;  1P0R A;  4URK A;  1K52 A;  3ZYY X;  4F1S A;  4I6N B;  1ZOY B;  2LI5 A;  1V5O A;  2IGH A;  2I1J A;  4EZL A;  1TGZ B;  3FC4 A;  2GMI C;  2EMT A;  1JWB D;  4ASW C;  3JW0 X;  3M3J A;  2A5U A;  2J0K A;  2HD5 B;  2WNM A;  3DBL I;  2BF8 B;  5CHF A;  3BIN A;  1OTR B;  2DAJ A;  3UQA A;  1SE3 A;  2KD0 A;  1GUA B;  4HVB A;  3TEX A;  4NQK E;  3WAP A;  5BMI A;  1WGR A;  3FIL A;  1JQ4 A;  3PSE B;  2HTM E;  1XO3 A;  2WXI A;  4HRO A;  3KH0 A;  1TKE A;  2JRI B;  2PW9 A;  4H2A A;  3GS2 A;  4ICU A;  2LFI A;  1JCK B;  4C4V A;  1UEL A;  2R61 A;  4B6W A;  4KX6 B;  1P9D U;  2BS4 B;  2JSV X;  1WY8 A;  3A9J B;  3S2A A;  1MHH E;  3NG0 A;  1WXS A;  1YNT E;  1VDV A;  4A3O A;  2JYE A;  2WQY B;  3DQV A;  1AYF A;  3TBL D;  3NVW A;  3ZDM C;  4HJG E;  3AE5 B;  3OG5 A;  1EO6 A;  2MX2 A;  1V49 A;  4MH0 E;  3AM9 A;  2KYW A;  2IY1 B;  2XEW A;  3TEW A;  3L0W B;  1D5M C;  2KFJ A;  2Q5W D;  1IUE A;  4GGQ A;  1FCC C;  2INP E;  1AWD A;  4LJO B;  3ZGZ A;  3KWL A;  1HXY D;  4B0M A;  3P1M A;  5IO9 A;  2N9K A;  3T3O A;  1ZUD 2;  2MP2 A;  2WX1 A;  4REZ A;  5G2N A;  2WXJ A;  5DPW A;  2L05 A;  3ZUN A;  1KH0 A;  3E56 A;  3PZD A;  1GOZ A;  3JYU A;  1J0G A;  4IM3 A;  4LNK A;  1RFA A;  1FMA D;  2JZP A;  5JZE B;  2V4L A;  1P1A A;  2GB1 A;  2L76 A;  2IGG A;  4WIP A;  3A9J A;  5D6J B;  4USA A;  2DYO A;  4A20 A;  3QIJ A;  2BYV E;  5D3D A;  2AL6 A;  1WE7 A;  3BVM A;  4MM3 A;  4ANV A;  4HJK A;  1WGH A;  1WRI A;  2J4X A;  3B9J A;  4P1B C;  5IAA C;  4HLE A;  3I57 A;  2LVQ A;  4KDI C;  2CS4 A;  4C7Y A;  1FRR A;  1E6E B;  4DXA B;  2JZ3 B;  3W5U B;  3V6E B;  1SEB D;  2KX0 A;  1NDD A;  2VZK D;  5E6P A;  3IBE A;  3WAN A;  4LNI A;  5I4D A;  4IWO A;  5H8Y E;  4HPM B;  3W1S C;  1N60 A;  4A55 A;  3PZ8 A;  2WDQ B;  4P1C C;  1YJ1 A;  3H6N A;  3CIR B;  4ZYN A;  2EKE C;  2G45 B;  2MH7 A;  2WXO A;  3EGR A;  1NYR A;  1PDX A;  2TSS A;  4FN2 A;  3EFC A;  2DX5 B;  2K22 A;  1SIJ A;  3V62 A;  4W9I A;  4BFR A;  4RF1 A;  4AWJ A;  4K7U A;  1I42 A;  3WAL A;  3N1Z C;  3N30 A;  3RI7 C;  5G5G A;  1V5T A;  2N1V A;  3Q8A A;  4DBG A;  4G50 A;  1YQ4 B;  1WZ0 A;  2O6V B;  2O6V A;  1MHX A;  1QOG A;  2KMA A;  1L6U A;  1FIQ A;  1V1O A;  1E7P B;  4KKJ A;  4A90 A;  1HE8 A;  1C9F A;  5J18 A;  4BKS A;  4BKG A;  4AS1 A;  3LB8 C;  2R2Q A;  2H88 B;  3X23 A;  4HK2 A;  2RMM A;  3OWE B;  5JHB A;  4X57 B;  1SGH A;  4DHZ B;  3LXF A;  2K8B A;  4KDL B;  4RH6 A;  1HTQ A;  1TY0 A;  1WFY A;  2WU2 B;  2WXK A;  1IP9 A;  3M63 B;  2KMC A;  2MA9 B;  1EF5 A;  3A1Q B;  3PS6 A;  1FO4 A;  1N6Z A;  3MC9 A;  1FNV A;  4IWP A;  4P6V F;  2RDH A;  3VHT C;  1GG3 A;  1S3S G;  4IKG A;  1ZXH A;  4HDO A;  1ET6 A;  4NJ7 A;  1M4V A;  4RM9 A;  4PS7 A;  3ZJV A;  3RNA C;  3PHW B;  2M8S A;  4RM8 A;  1UBQ A;  3MFG A;  4JL9 A;  1C4P A;  3CST A;  5JXV A;  2KFK B;  2N9L A;  4GDK B;  3VRB B;  3P4Q B;  3W1Y A;  3R2I A;  4EFO A;  3AN1 A;  4HWI B;  3HVD A;  3UIO B;  2IZV B;  3TCA A;  3R3M A;  3ENE A;  4K7W A;  1DOI A;  1PQS A;  4FAD A;  2LRW A;  2N4F A;  1EWY C;  3DBH I;  3QHT A;  2BBC A;  4ZYS A;  2KC1 A;  5MPO A;  4AOF A;  3UGB B;  2FCN A;  4ZRP A;  2K25 A;  1L4Z B;  3AEE B;  2QJL A;  4JLC A;  1OEY J;  1WH3 A;  2FCM A;  3LJ3 A;  3PPA A;  2IYD B;  1KRH A;  1T0R C;  4BBN F;  2JXX A;  3V60 A;  4G0N B;  3NS1 A;  2L52 A;  3AEF B;  3A1Q A;  3FKY A;  2MEK A;  3VH3 B;  3ZVV A;  5BYS A;  2PIA A;  1ESF A;  2ZNV C;  5G55 A;  5KHO A;  4HEA 1;  3DVN V;  3NOB A;  4B95 A;  4WJO A;  2K3U A;  1V1P B;  3U8Z A;  1SB3 C;  3AEB B;  4LK0 M;  3A33 B;  3VUW A;  4C56 C;  4EEW A;  1VRA B;  1AN8 A;  4LNF A;  4XDD A;  3ZNH B;  2LGD A;  2NVU I;  2Y3A A;  3QQ8 B;  4GDK A;  4MDK E;  2JRH A;  1XLP A;  4GXB A;  2KC2 A;  2LVP A;  3PV1 A;  2FAZ A;  3SDL C;  3J9C A;  4HCP B;  1TS3 A;  1WXV A;  1IPG A;  4ZRJ A;  2D10 A;  4XZ4 A;  1I35 A;  2YVC A;  1FNU A;  3AE9 B;  3EA6 A;  2CU3 A;  2L1A A;  5EE0 A;  2W55 A;  4OVV A;  4N9F 4;  1FM0 D;  2KDM A;  3MJ5 A;  4IG7 B;  2JYT A;  3KUC B;  3E9S A;  1ZPS A;  2Y5C A;  3HIZ A;  2NBV B;  3NZS A;  1RM6 C;  1UBI A;  2JU6 X;  3C8Y A;  2AQ3 B;  4WJN A;  5FR6 A;  2RR9 A;  4W9H A;  3VVW B;  4ANU A;  1TKG A;  1G6J A;  1J19 A;  3R8B A;  2ASQ A;  3TJP A;  4IWQ A;  1WGK A;  2YEP F;  1L0V B;  2WXR A;  4PYU A;  1C1Y B;  2JPH A;  1BUI C;  4ACF A;  3H8H A;  2LAS A;  3NJT A;  3PTF C;  2H89 B;  4W9L A;  2M0A A;  3TEY A;  4IOI E;  1MG4 A;  3M62 B;  4RMA A;  1PGX A;  3AEA B;  4TUU A;  2KJ6 A;  2ZVN A;  5L83 A;  2XK5 B;  3RNF C;  2ZNV B;  1FXT B;  3WCQ A;  1TYG B;  2AL3 A;  3RMK C;  3NVV A;  3BII D;  4XC2 A;  3RCZ A;  4FHK A;  4YWG G;  3GZN B;  2ZPN A;  2WLB A;  3IXS A;  4W9E A;  2LZ6 A;  4Q2J A;  1WZ3 A;  4NAW B;  2JT4 B;  4NAW A;  1YD8 U;  4N58 A;  1WI0 A;  2KKC A;  1WGY A;  4DK5 A;  2JF5 A;  1E10 A;  3EHV A;  3PRM B;  2V0G A;  3NZ3 A;  3BZD B;  3DOW A;  2BB6 A;  2BT6 A;  1WX7 A;  3TSS A;  2W3R A;  3QAQ A;  3VUY A;  4KIK B;  3KYC D;  2BVC A;  1MI0 A;  2DZK A;  3SFD B;  2WXP A;  3VXW A;  3H1U A;  2N9P C; 
#chains in the Genus database with same CATH homology
 2OHF A;  5HHD G;  1NI3 A;  3TEW A;  5HI1 A;  3KQ4 A;  3AB5 A;  1WYG A;  1VZ8 A;  2VZK B;  1YMH E;  1D5M C;  3HRD D;  2Q5W D;  1IUE A;  3AE7 B;  1DOY A;  1VLB A;  1NEN B;  5BMH A;  1FCC C;  1L0X B;  2INP E;  1AWD A;  3ZGZ A;  2GI9 A;  3KWL A;  1F2R C;  2BW2 A;  1HXY D;  1JWA D;  3AE4 B;  3PZ7 A;  3L4P A;  4B0M A;  3P1M A;  4ARC A;  3Q69 A;  1B1Z A;  1ZDV A;  2WXQ A;  2AQ1 B;  3BYT B;  2N9K A;  3T3O A;  2NTS A;  4ZRQ A;  2YEP B;  1ZUD 2;  4HKQ A;  2XN9 C;  1QKZ A;  1D5Z C;  5T8I A;  1I7H A;  4YSX B;  4REZ A;  1XF5 L;  2WXJ A;  1J7C A;  1C78 A;  3HVZ A;  3SR6 A;  1QF6 A;  1KH0 A;  1TZO A;  3E56 A;  2V3N A;  3VRA B;  2Y5P A;  1GOZ A;  1PUT A;  2ON8 A;  1QQR A;  2HDE A;  3VQI A;  2M19 A;  3NVY A;  1ZDX A;  5HFY A;  4JE3 B;  2RDG A;  1FMA D;  1SXT A;  2JZP A;  3U2S C;  1T3Q A;  3P4S B;  2GB1 A;  1WWT A;  1PYW D;  4LTU A;  1YN4 A;  2IGG A;  4WIP A;  4USA A;  2DYO A;  1RWS A;  3KWV A;  1C4A A;  4GDL B;  3BK2 A;  3URY A;  4RGO S;  5FR3 A;  3VR9 B;  5D3D A;  5GXG B;  1WSP A;  3BVM A;  3IAS 1;  3UI3 A;  4YXD B;  1ZP0 B;  1BML C;  4NJC A;  4OHJ A;  4DQO C;  1T6B X;  2G9H D;  1N61 A;  1WRI A;  2J4X A;  3B9J A;  1D6E C;  4XDC A;  3W2D A;  1WXQ A;  1E0Z A;  4YT0 B;  2K9X A;  4KGR A;  1YQ3 B;  4O1N A;  4OZB A;  2DBY A;  2LJI A;  3I57 A;  2KMM A;  1JRO A;  3O13 A;  4C7Y A;  1FRR A;  4C7Z A;  1E6E B;  3T3N A;  4UDU C;  3I9V 1;  4J3O D;  2CJN A;  3W5U B;  4R3D A;  1OQR A;  1SEB D;  1EM7 A;  3AEG B;  3P42 A;  4A6Q A;  2VZK D;  2ICI A;  2QEJ C;  4RGM A;  3DWM A;  1CJE A;  2E6X A;  1PFD A;  5I4D A;  5LNK 1;  4L2Y A;  2RPV A;  1STE A;  5H8Y E;  1OQQ A;  2WDR B;  4TMA B;  1L6V A;  4M0W A;  3AEC B;  1N60 A;  2KQ4 X;  3BVZ A;  4A55 A;  4YTP B;  3PZ8 A;  2INN E;  2NTT A;  2WXF A;  1TY2 A;  2EKI A;  2WDQ B;  3U7Z A;  2IDY A;  1MPE A;  1FXA A;  1QLB B;  3CIR B;  4RGT A;  1HZ6 A;  2IPK D;  1PGA A;  1XLQ A;  2MH7 A;  2LEK A;  2LGI A;  2WXO A;  1QT9 A;  2ONQ A;  3EGR A;  4OW0 A;  1XCQ L;  1NYR A;  1PDX A;  2TSS A;  3U52 E;  4ZHP A;  2L32 A;  3FAH A;  2K22 A;  3MHZ A;  1SIJ A;  3BWU D;  1N5W A;  1GAQ B;  1TS2 A;  1UWM A;  4RF1 A;  4L1B A;  3IT4 B;  2LUM A;  3Q8E A;  5G5G A;  5BYQ A;  3Q8A A;  1YQ4 B;  1MHX A;  2WXL A;  2KAJ A;  1QOG A;  1CQV A;  1I4Q A;  1XLN A;  5E6J A;  3Q8B A;  2LMC A;  4N59 A;  4B0E A;  1L6U A;  1P7E A;  2BB5 A;  1V8C A;  1FIQ A;  1C77 A;  1V1O A;  4YSY B;  1YN3 A;  2WXM A;  2ZW0 A;  1I4R A;  1E7P B;  4KKJ A;  4A90 A;  1VJK A;  1C9F A;  1ET9 A;  2B76 B;  3Q8F A;  1TS5 A;  4DXG A;  4AS1 A;  1DYQ A;  3LB8 C;  2DYM A;  2H88 B;  1N63 A;  4A9A A;  1QIL A;  4PT5 A;  4EE2 A;  2RMM A;  2JWU A;  3OWE B;  1SSN A;  1IGD A;  1SJE D;  3ABV B;  3U4E G;  3LXF A;  4WH4 A;  2FBW B;  4RH6 A;  5H92 C;  2BS2 B;  2J53 A;  1XXG A;  1TY0 A;  2N7J A;  2WU2 B;  1BXT A;  2WXK A;  1E9M A;  1OFF A;  3SEB A;  3TEZ A;  2AQ2 B;  1GB4 A;  3IT6 B;  1ROE A;  2QIL A;  2IJ0 A;  1F2R I;  1TJE A;  2CJO A;  1FFU A;  1FCL A;  4D2K A;  1J7B A;  1NVI D;  4YTN B;  1FFV A;  3RPF C;  4C80 A;  1FO4 A;  4XWT A;  1SBB B;  1FNV A;  3P63 A;  4P6V F;  2K0P A;  3AE3 B;  1Q10 A;  3V05 A;  1A70 A;  2RDH A;  4L23 A;  2ACZ B;  5G5H A;  1C79 A;  2LHE A;  3MP9 A;  1ZXH A;  4IKG A;  5EE1 A;  3VR8 B;  1ET6 A;  2I2Y A;  1L5P A;  1M4V A;  4WWM A;  3HUI A;  1ZXI A;  3ZJV A;  1SE4 A;  3AE2 B;  1GB1 A;  1L0Y B;  3MFG A;  1P7F A;  5EE3 A;  1D5X C;  4JPS A;  1C4P A;  3PO0 A;  4TQ0 A;  4US8 A;  5JXV A;  3AH7 A;  4MT5 A;  1PGB A;  2N9L A;  2WP9 B;  4GDK B;  3P4Q B;  3VRB B;  3R2I A;  3IAM 1;  3AN1 A;  3BYY B;  1KLU D;  2X38 A;  3HVD A;  2K5P A;  3DWG C;  1NYQ A;  4XE0 A;  1IBX B;  1SF0 A;  1IBX A;  2KWD A;  1DOI A;  4NAM A;  3R2T A;  2BYT A;  1YN5 A;  4N6E B;  1XEE A;  1B9R A;  2WU5 B;  2NMQ A;  1KF6 B;  1EWY C;  1QOF A;  2BS3 B;  2QIE B;  2BBC A;  4ZYS A;  1N62 A;  5MPO A;  1SJH D;  4KGT A;  1VZ7 A;  3AE8 B;  5TSS A;  1HA5 A;  4ZRP A;  1ENF A;  4ZHO A;  1L4Z B;  3AEE B;  5AUI A;  2QJL A;  4ARI A;  4GLS C;  4RFB A;  4US9 A;  1I4G A;  4DXF A;  3AED B;  1VR9 A;  4LLG M;  1KRH A;  1AW7 A;  3NS1 A;  5HG2 A;  2L52 A;  1K50 A;  3AEF B;  1F77 A;  2MEK A;  3AE1 B;  3GP7 A;  3NRZ A;  5BYS A;  2PIA A;  1QOA A;  3BK1 A;  1KTK A;  2QSD A;  1ESF A;  3W9C B;  1HEZ E;  4HEA 1;  3TUO A;  2K3U A;  2FUG 1;  2PVO D;  2Z8L A;  3B2F A;  3BVG A;  2WXG A;  1V1P B;  1SB3 C;  2G1E A;  2BTE A;  3AEB B;  4LK0 M;  1I4H A;  2PKO A;  1FNW A;  2PLP A;  2WDV B;  2V3P A;  2J42 A;  4C56 C;  3NVZ A;  1JWU D;  2IGD A;  3EUB 2;  1VRA B;  1AN8 A;  3AV8 A;  4WUR A;  1I4P A;  4XDD A;  3SFE B;  4YSZ B;  2JX5 A;  2Y3A A;  2PMV A;  1JAL A;  1F0Z A;  1DGJ A;  2FE8 A;  2QMT A;  1FD6 A;  1XLP A;  1FEH A;  4KKI A;  3J9C A;  1C76 A;  3KLS X;  1TS3 A;  2GRI A;  2W3S A;  2AX5 A;  1JW9 D;  2I38 A;  4JWS C;  4OZC A;  1NEK B;  1JWS D;  1KFY B;  1KLG D;  1JML A;  1FNU A;  3AE9 B;  1DOX A;  1QOB A;  3EA6 A;  1K51 A;  1V1P A;  2CU3 A;  2JQR B;  2L1A A;  2MJD A;  5EE0 A;  3P4P B;  5FKA C;  2W55 A;  1XCT L;  2W82 A;  3P4R B;  2V4I B;  4YTM B;  2DWQ A;  1K53 A;  2W54 A;  3ZJU A;  2XNA C;  2KAC A;  1CK1 A;  4WAF A;  1RYJ A;  1FM0 D;  2KDM A;  2LHD A;  1HZ5 A;  3MJ5 A;  5FK9 C;  4ZOH C;  3ETR A;  4A8X C;  3ZQ4 A;  1FXI A;  2JYT A;  1MVK A;  3E9S A;  2EEL A;  1ZPS A;  2Y5C A;  4CQN A;  1EWC A;  1UNS A;  3W5V B;  2WXN A;  1RM6 C;  4AQ7 A;  1LO5 D;  2JU6 X;  2E3T A;  2SAK A;  5AUK A;  3W1S A;  3C8Y A;  2AQ3 B;  1T5X D;  4MAC A;  3V3X A;  4JX1 C;  1TKG A;  4FXC A;  2PTL A;  3R8B A;  1EU4 A;  1UUP A;  3FIL B;  1TS4 A;  1TKY A;  2L83 A;  1D4B A;  4MH8 A;  3LYY A;  3CWI A;  1WGK A;  2YEP F;  1K52 A;  3ZYY X;  1L0V B;  2WXR A;  2J52 A;  1VZ6 A;  1FRD A;  4IDI A;  1ZOY B;  1BUI C;  2MJE A;  2SEB D;  1N5X A;  3N9Y C;  2IGH A;  1IGC A;  3H8H A;  5EE9 A;  1V97 A;  2H89 B;  1R7S A;  3FC4 A;  4OVZ A;  1XLO A;  1YJJ A;  2M0A A;  3TEY A;  4IOI E;  1JWB D;  1UWX A;  2WXH A;  3B2G A;  2M56 B;  1PGX A;  3ZJT A;  1CZP A;  4P16 A;  2WNM A;  3AEA B;  5D3I B;  2WS3 B;  5C2T B;  4HRS A;  3RFZ B;  1JRP A;  1SE3 A;  2KN4 A;  1I4X A;  4RGN A;  1HQR D;  2MJ3 A;  3AE6 B;  3TEX A;  2DLB A;  3WCQ A;  1TYG B;  4NZL B;  1ZE3 D;  2JXT A;  5BMI A;  1SE2 A;  3FIL A;  5D7G A;  1JQ4 A;  3NVV A;  4HKZ E;  3BII D;  2HTM E;  3MC0 B;  4YWG G;  3AMZ A;  1XO3 A;  2WXI A;  2WLB A;  3IXS A;  4RNA A;  4Q2J A;  4HRO A;  2PVG C;  1Y56 A;  1TKE A;  4NAW B;  3GB1 A;  4N58 A;  2PW9 A;  4H2A A;  4RF0 A;  3GS2 A;  1E10 A;  1JWM D;  1JCK B;  2LFI A;  5BYR A;  3NUH B;  1UGJ A;  2R61 A;  1C4C A;  4KX6 B;  2V0G A;  3NZ3 A;  1ACC A;  2BS4 B;  2D5G A;  3BZD B;  4XWW A;  2JSV X;  2BB6 A;  2BT6 A;  1EU3 A;  4KGS A;  4WQM A;  3TSS A;  1MHH E;  1YNT E;  2N0S B;  2W3R A;  4TSS A;  1VDV A;  1RFK A;  2JYE A;  4TQ1 A;  4OZA A;  2OED A;  4JWU C;  5C3J B;  4MM3 B;  2WQY B;  3Q8C A;  1AYF A;  4RCO A;  5BMG A;  3NVW A;  4HJG E;  1MI0 A;  3SFD B;  2WXP A;  3AE5 B;  2ZW1 A;  1L4D B;  1J7A A;  1YJI A;  1GPX A;  3AM9 A;  4ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...