4ZHQB

Crystal structure of tubulin-stathmin-ttl-mmae complex
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 176
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zhqB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zhqB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zhqB01
4X1KA 5CA1A 5MN5A 5BMVA 4O4JA 3JAWB 4O4IB 4ZHQA 4X1YA 5JVDA 5M7EA 5ITZB 5LYJA 3WGLA 5EIBD 5GONB 5JH7B 1W59A 1TUBB 3N2GA 3HKEB 5IJ0A 2R6R1 2VAMA 5MN6A 3JARB 4X1IB 5KMGB 4EI8A 5EZYA 4XCQA 4YJ3B 4U3JB 5JCOA 1W5EA 4B46A 3RYHA 4FFBB 5CB4A 4TUYA 1JFFB 5LXTA 3JALB 3JASA 4O2BA 5CA0B 5IYZA 3JATB 3RYCB 4ZOLA 3E22A 4HNAA 1Z5VA 1RQ2A 4LNUB 3RYFB 3N2KA 1SA0B 4I55A 1FFXB 1W5BA 4TV8A 3HKDA 2R751 4IHJA 5LA6A 5FNVB 4DRXB 5JQGB 3C8LA 3V3TA 3HKBA 3JAKA 5EYPB 4YJ2A 1W5FA 4I50B 4ZI7B 5C8YB 2VAWA 2BTQB 1TVKA 5KX5A 3VOAA 3VO8A 3UT5B 3CB2A 4O4IA 2Q1XA 3ZBPA 2Q1YA 5IJ0B 5ITZA 5LOVB 5JH7A 5GONA 4EI9A 1TUBA 3HKCB 3HKEA 2RHHA 4X1IA 5KMGA 5IJ9B 4WBNB 3WGKA 3M8KA 4YJ3A 4U3JA 3RYHB 3RYIB 4F6RB 4I4TB 4EB6B 5LP6B 3ZIDA 3JASB 4FFBA 4O4LB 5J2TB 1FSZA 3VOBA 1JFFA 4EI7A 3JALA 4IIJB 5J2UB 5CA0A 3JATA 4O4HB 4X20B 3RYCA 3ZBQA 4LNUA 4TV9B 3RYFA 1SA0A 2BTOA 4O2AB 5JCOC 1FFXA 4X1KB 5CA1B 5BMVB 4KWEA 4O4JB 5JVDB 5LP6C 4ZHQB 4X1YB 2RHOA 3JAWA 4DRXA 5FNVA 5JQGA 5LYJB 1Z5WA 4M8IA 3N2GB 5EYPA 2XKAA 1W581 4I50A 3JARA 5EZYB 4ZI7A 2BTQA 3UT5A 3WGJA 5EIBC 4TUYB 5CB4B 5LXTB 2RHJA 2VAPA 4O2BB 4E6EA 5IYZB 4B45A 5LOVA 4ZOLB 4U39A 3E22B 4HNAB 1W5AA 3VPAA 3HKCA 2GVIA 3R4VA 3N2KB 4I55B 3VO9A 5IJ9A 4WBNA 3RYIA 5KX5B 4F6RA 2RHLA 4TV8B 3HKDB 4I4TA 1RLUA 4EB6A 5LP6A 4IHJB 5LA6B 3WGNA 3M89A 4O4LA 5J2TA 1OFUA 5MN4A 4IIJA 2VXYA 5J2UA 4DXDA 3HKBB 3JAKB 4O4HA 4X20A 4YJ2B 3RB8A 1RQ7A 2XKBA 4TV9A 4O2AA 3WGMA 1TVKB 5C8YA
chains in the Genus database with same CATH superfamily
3H1BA 1QAMA 2ZRDA 1IY1A 5CBKA 3QXGA 2GZLA 4OB8A 5JAZA 5T4BA 4QWWA 4FGKA 2FVXA 3U3OA 2J3MA 2G5CA 1GGFA 3PCTA 2L82A 3W7WA 2CV0A 3EF1A 5DSZA 2SKCA 4BO7A 1LJ8A 1IFXA 2ATKC 3WU2Z 1W49A 3OQJA 3TMYA 2BRUC 1PGNA 4H7HA 4P0QB 4HNQA 1K75A 3A9CA 2XGJA 2FOXA 1ZUD1 3T0IA 2QEXV 2IC5A 5LP6B 1JS1X 1WUHS 1FYEA 1NBAA 1NF2A 2WRZA 1RKVA 3T1CA 1YIAA 1BU8A 4JB3A 2ZINA 1D2HA 2IXBA 4DQKA 2WD9A 3SIRA 2QVZX 2G1AA 3HJBA 2IH2A 2EFDB 1CHDA 2GRUA 4UJ3A 3D0QA 1W3EX 2OHXA 3R6GA 4YMLA 1GR0A 1CR4A 1CU1A 3OCJA 4AI8A 2DECA 4OLJA 1CJVC 1T9KA 2GNOA 2VA9A 3IMCA 3CE9A 1Q74A 2XJ4A 2L42A 1I94B 1LDMA 3QBDA 4H3HB 2YCLA 2CE4A 4LIPD 3V4VB 4TMYA 2QRNA 4YUAA 1SUCA 1QHXA 2FWRA 1GTVA 1PWXA 4UUQA 1EZVH 1ZGBA 2G40A 3OOJA 5FUYA 1Z39A 4DT1A 2Z58A 4F3TA 3VVCA 4N5NA 1IB0A 1IXSB 4HB3A 3HEBA 5BNTA 3FTCA 3IRVA 1QIEA 4CEJA 1DQZA 2A5GA 5AK0A 4G41A 2OBXA 4IDFA 1C3VA 2LDBA 2CMFA 3L9WA 1JQ5A 3AG3C 1KARA 2EKLA 2J3EA 5JSYA 3FWYA 1GLVA 3B6JA 3MWLA 5LIRA 5L3GA 3P2KA 3VQTA 2RSLA 4PPYA 5B1SA 2IUEA 3UTDA 4LFBO 2B94A 3B85A 4RNCA 1DDGA 1H93A 1DT3A 3U6BA 3G88A 3KBBA 1YR7A 1D2AA 3C2QA 2C7BA 1Z0JA 3ANSA 3M4SA 1L4MA 2CT8A 5JEEA 4HYQA 1NW3A 3UGTA 4KQMA 4REMA 3GFOA 2AL7A 1B8NA 2GN6A 1IHYA 3GZJA 4RD4A 2Z3YA 5DXAA 3NHFA 1EWRA 3ZWYA 2WZCA 1UL1X 1QANA 3EA5A 3IQIX 1YHZA 4WCFA 4TLDA 2XXJA 2RIPA 4Q03A 1S1CA 1M6YA 1C7ZA 3FTNA 2WIFA 1J49A 1GM5A 4L4ZA 5H80A 2XUMA 3A58B 3A6PC 2P1DA 1UKEA 3RTAA 4GUDA 3QBJA 5DNCA 3A1DA 3G5UA 1X1CA 1L4FA 5DLDA 3FFQA 4DR2O 4F5YA 2DTDA 5INTA 2JRLA 3DXXA 1FFGA 3KYIB 2ZQZA 1FRNA 2AW9A 2ZSDA 3CW2A 3FDFA 5LZ5A 5F1PA 2XUZA 2HRBA 5E7JA 3DTYA 2B4AA 4CKBA 1Q90D 2GVNA 2GQ0A 3UMJA 2BGJA 4BIUA 5E0OA 4QYWA 4Q6GA 5CN0A 3OFND 3M84A 2ACWA 3B38A 4FYJA 1UT8A 2AJDA 5B58T 3M0EA 5F64A 5L4NA 3VBCA 3E6AA 4NQRA 5B37A 4KMMA 3OIUA 2IZZA 3AUXA 1CDZA 2A1TS 2IXEA 4DREA 3D0RA 5KVVA 3TR6A 3FUXA 4L8YA 4DBVO 3AP2A 5F2KA 3C3PA 2O8VA 4XUEA 4L07A 2I3DA 5I8ZA 1EX6A 4WXPA 1M6WA 4GPZA 1U0SY 2XDQA 4LFAO 4I99A 4WA7A 4P3XA 1W9HA 2QUBA 3NJ8A 1QR9A 5IDXA 3BCRA 4Q15A 4JNCA 3LTEA 4K0RA 1BS1A 4CKWA 2J59A 1CLEA 2VP2A 4KUGA 4HTFA 2O1XA 1U5BA 4TMVA 3E8XA 1E1QG 2DKFA 2X1MA 1HM5A 1ZC4A 3HKCB 1OWMA 2JHCA 5B55A 4N12A 4N9QA 1KI6B 2WHPA 2J5QA 1HLGA 1IXKA 3DVRX 3VKWA 3R40A 3Q9SA 4LF4B 4Y3UA 4MQMA 4HUTA 2ARHA 2PCJA 3EF0A 1LNQA 3LSTA 3VR1A 2EX3A 5FPKA 1Q3EA 1J09A 3AEXA 3LIIA 4BP9A 3D3WA 5KQGA 2CVHA 2EARA 4J0DA 2G71A 4D80A 2PZBA 1ZMTA 1XTQA 1WN7A 4MQFB 3PF8A 4HRXA 4CL3A 1U63A 4L8GA 1RNLA 4BAUA 5JAIA 3U4DA 5JD4A 3IP3A 2PSJA 4PO3X 1WCIA 3NWBA 1G9XA 5A9SB 3ZG6A 5D3MB 4A9AA 4ZHVA 3WRXA 3SPIA 4NEHB 4XIFA 3Q10A 3T3DA 3DD1A 1AGPA 1NJGA 3UOGA 2ZDQA 3O8OB 4EEKA 4YXWG 1U96A 4OM7A 3KVYA 1QFJA 3AFNA 4XVHA 5K4GA 4YAKA 1U02A 3QH4A 4XB1A 3M82A 4P7KA 5M04A 1YB7A 3SF8A 1JG2A 1NR7A 4R7GA 2P4VA 2M6RA 5KX5F 4ILEA 4ENSA 3HACA 1ZWLA 2J5XA 4YV0A 5JCJA 2PM8A 4NCIA 3G2QA 1R3KC 3NHRA 4EP1A 4JU9A 2D2VA 3SDLA 1V47A 3T7EA 4R51A 3PHGA 4KAFA 4XOUA 3OICA 3K2XA 2F3UA 3WJPA 4PA3A 3TLAA 4AN4A 2YFHA 4LK2A 2PI4A 1SXJB 1BWRA 5IT9A 1TKRA 4OGFA 5HZKA 1L7RA 4E21A 3PTAA 2QKAA 3FWHA 1UBKS 3KSAC 2QF7A 3OFKA 3A9WA 4LRWA 1Z7GA 1RAHA 3D3JA 5C7OO 4RE5A 2CUGA 1P7BA 3QKSB 2NACA 3FCEA 1P33A 4D0RA 3LYBA 1OFHA 4MQLA 2RGEA 1YNSA 4UBLA 2J32A 1OHHA 3PC8A 1Z8HA 3A0RA 4BMYA 3BWCA 5J5AA 3LLMA 1XCLA 4QLAA 3T5AA 1K1EA 4AS1A 1I4WA 5IABA 1FUKA 4Z9FA 1Z47A 1W93A 1N0UA 1BD4A 4QULA 3GLSA 1RKXA 1H8HA 1R1BA 3MUEA 3O84A 3OF5A 4R9UC 2FE4A 5LZ2A 2AN1A 1FD9A 4CZ2A 4RQOA 3GU3A 4BGDA 1W5SA 2AD1A 2QN2A 2RNBA 2DUWA 3ETHA 4FLUA 3OCVA 1CKEA 1NNI1 1HY3A 4RACA 1P7CA 2AXNA 2ET6A 5DP1A 4OQNA 1K6MA 1AILA 3ROZA 5AHXA 4EG0A 2O8DB 3I2IA 2XRYA 3M81A 5EWMB 3ZWVA 3V32A 5DMHA 3KL4A 4K3VA 1P7PA 1S2NA 4JBYA 1WABA 1EXDA 4ENQA 3DXZA 5EZSA 4C4RA 3ZWMA 2ENWA 1TF2A 1U98A 4JI6B 3NONA 4C4XA 3KSDO 2XODA 3X1WA 4V0NA 1ZK1A 3LKDA 4URUR 3VYVA 3REOA 2IK8A 4BY9E 4MV8A 1KYQA 4L75A 2P69A 4QUBA 3ZOZA 1QOPB 5F73A 1T29A 3ZGNA 5TQ2A 3KKQA 4DMLA 2OQIA 3ASZA 3JQAD 1AR1B 1ZVMA 1Q1QA 3AHDA 4K2HA 1QR8A 4M9RA 4ESHA 3CSSA 2XTAA 1TLLA 4F21A 1YB6A 4ML3A 3P8ZA 1Z4PX 4EITA 3PFHA 1YVRA 3VDNB 5DGHA 3FBGA 4BBPA 4KCGA 4WZAB 1TM1E 3L0OA 1VLLA 1L8OA 1XL1A 2QA5A 1XZNA 3TLXA 1VJ1A 4CE6A 1EN6A 1X3SA 1XZIA 3W4JA 3EVEA 2VCEA 3AF4A 1ZW6A 3UAYA 2WF7A 5HMMA 4K2AA 1UDCA 1FP4B 3QPDA 4UUNA 3TQCA 4M53A 3TG8A 5JJKA 3ZN2A 1HLDA 5ALOA 4LCJA 1IBLB 5EZYB 1RPJA 1SPBS 2HSWA 5FIUA 2F00A 1QCEA 2VJKA 2UXCB 4M1OA 3F5FA 4P4NA 2V7PA 4RUEA 1JIJA 4N6NA 5TEVA 3C16C 1K6IA 4MDHA 3LWVC 3KLNA 3RB8A 1A5SB 3JCMM 2XBLA 4NP6A 5E4YA 5KAPA 5B1YA 2QWOB 3K1ZA 5JSZB 3FSJX 4WXMA 2J7KA 4FT2A 1VQMV 2VOEA 1N4CA 1KAEA 4N3CA 2XHBA 3IKEA 2C4KA 2Q99A 1TF7A 4H4CA 1US6A 3L18A 3PPWA 4KIJA 2CW4A 2F62A 2WJIA 3QE4A 2HBZA 2Y67A 1NRJB 3D7SA 4OSPA 2O0LA 4RA9B 2DC1A 5GZ3A 1PGPA 3K16A 4Q7JB 3EBPA 3LT2A 3UANA 1EP2B 5CYGA 1G20B 1NH2D 4X6XA 3A6GA 3G2HA 3KKOA 2CCKA 2Y92A 1B3QA 2W6IA 5B1BB 3Q9UA 1EB9A 2XMQA 2ONYA 1UMDB 3ZEAA 2Q27A 5BURA 1VI6A 5B3AA 4DKXA 3MINA 3PL5A 4BMXA 4J41A 4BNVA 2QL6A 1E3SA 4IJMA 4RX1A 3C7KA 4U2GA 4FUQA 2D8MA 2P3LA 3H99A 3SYKA 2BI8A 2FEKA 4GPAA 4RGVA 5GONB 1QUFA 4PW0A 2DHCA 2YV2A 1XWIA 1JT9A 2V4ZA 2JLXA 2CYBA 3AIIA 1MXFA 4PZEA 2W2LD 4MVJH 4ZPJA 3EVAA 5JXIA 4OJKA 1WV1A 2VBGA 3PRJA 3VC7A 4ZZ3A 3FZEA 1EXNA 6Q21A 1QS0A 4BHTA 1XHXA 1JEDA 5DZSA 3OE7A 1ZR4A 3V6LA 4IR7A 3RLFA 3IUSA 2ZF8A 1A32A 2DOSA 4LVOA 2JH8A 2P1ZA 3P9NA 2HGZA 1N92A 4G4ZA 3ZI0A 3ESJA 2H4WA 3ACDA 4XRGA 3OOHA 1E1KA 2SCUB 3BMXA 1I7LA 1MOZA 5TF0A 4JLVA 4G1BA 4GOJA 5AIBA 3EPRA 2DWOA 2IJGX 4DAEA 3ZWWA 4QPDA 2WIDA 1MX1A 1FOEB 2JD0A 4BMOB 4F7DA 3EZ7A 5I4CA 4DW8A 1USWA 4RKFA 2C96A 4L0QA 2H3HA 2CLEB 1CNFA 2WP8J 4XCQA 2VDUE 3WMGA 3KPWA 4NEGA 4P7FA 4K88A 4H7IA 5AW4A 5HCIA 2RC6A 1ECPA 1IOZA 5GVSA 1GOTA 2PMBA 4F84A 2ZIMA 3TECE 4WEQA 3VXKA 1MVLA 4XQGA 1M2HA 2HJFC 3W7XA 4MRAA 4LBEC 4U8GA 2FUKA 3KD2A 3FTQA 2FLKA 2KG4A 1N8RH 2JIBA 4U6SA 5C4GB 3K8QA 1S4QA 2YIDA 1F4NA 3C5HA 3QYJA 4PVCA 2UVPA 2FPSA 1M56C 2WM3A 4AC9A 2RJNA 1G55A 4CLXA 1OPRA 4HS4A 1P0QA 1H69A 1Z2PX 4YCBA 1L5YA 3RWRD 4WHMA 2G1PA 3ETGA 3CC4F 3N8KA 2Q29A 4KBFA 4RSRA 4ZDJA 1IY0A 3TYXA 2O3RA 3PUJA 3KQHA 1CY2A 3N0XA 3P4XA 2FZWA 2YXLA 2FOIA 1Y3AA 2FX3A 3B3QA 2GFHA 5KOJA 1QJCA 1QWSA 2EKZA 3M5PA 4XYGA 1QJ4A 4CS4A 1N0VC 2WINI 1W76A 4BVBA 4KXYA 1C3OB 2VP9A 2NOAA 4I5EA 1WKCA 2A67A 1LD3A 1Y3CE 3U7QA 5GOZA 2C61A 1OLSB 1O2DA 3JCZA 1IQRA 5EK0A 3UMVA 1YULA 3VU9B 1WZ2A 3WLIA 1OXTA 2IGBA 2OV2A 4FD2A 2VHCA 2F3RA 3A4VA 1M72A 1L9KA 4YT5A 4M9XA 4FLZA 3GEGA 1FSSA 4JXZA 1H5UA 4HCJA 1V54C 2YY6A 4X62O 1MTOA 2FGKA 4Q9KA 1N8NA 1RXSA 4OAPA 2VT3A 4BNDA 1MO6A 1DG3A 3HN6A 5CLLA 3F73A 1N32B 4DLKA 4WADA 2FL4A 4OSEA 5BN5A 2R00C 4ZAGA 3WOVA 1UWVA 1TGOA 4BIIA 5IC6A 2CMHA 2JJ2D 4IZ6A 3A3PA 2O3JA 4E2XA 2DFDA 4D44A 4M0UA 4Z0PA 2RDMA 2GA9A 3KWLA 2B83A 5IC5A 3GG2A 4JWKA 4JP3A 3PHHA 4X91A 4R54A 4G4IA 3BDAA 2IE8A 2RKWA 2DR3A 5FADA 2C4WA 1OGYA 4E13A 5LP6F 4IIEA 3AR8A 3EW7A 1H65A 2VPQA 3OQIB 2WMYA 2Z5FA 1UDWA 3FGZA 5IMSA 5HQ3B 3EA4A 1LA2A 1IURA 2AGAA 3L8EA 1SBQA 1AGXA 2ZWIA 1KFBB 2O1EA 3OC0A 1Y5MA 3T9BA 1J33A 3ROGA 1S3GA 2HFEC 4TTPA 3K0CA 4AJ2A 1UFVA 1C1DA 3UW1A 4W5TA 2JBAB 1TVEA 1JEQA 3LECA 4LDNA 5L3SA 4PV7A 3KXDA 4FINA 4TRRA 3CTMA 4AM8A 1CX9B 4ZBMA 4PAQA 2I6GA 4FLMA 4GPIB 1Y6FA 3FUWA 2VXBA 4RENA 3AUKA 3E58A 2FC3A 4DV6O 4K9NA 1QB8A 3KZIZ 2DYRC 1WTCA 4X88A 2J9ZB 3BKXA 2QM7A 2WVHA 2LFSA 4ENRA 5JAPA 1P49A 3IUMA 2BFDB 1SDSA 1V96A 2GEFA 2BV3A 2DJVA 4TZ0A 2XT6A 3W1VA 4LCUC 3QLVA 2XE6A 2DCMA 4XSGA 3MBMA 4XX1A 1Q3KA 1HO3A 4AULA 4J0IA 4TM8A 3LTNC 4JDPA 4X8LA 2QUJA 4YCLA 3HBNA 3ZV3A 3EUEA 2MK3A 4XLZA 5EHZA 3B1XA 1QHIA 3IYLW 3GLGB 1EAMA 3UJCA 2Q8VA 4AD8A 5EC8A 5IC4A 4NE9A 4B3BA 3C3CA 2O7RA 5BSVA 4X1OA 4RDXA 1QP7A 3TTSA 3CYFA 1Q21A 4F3KA 2NWQA 4F9GA 1GPLA 3M1AA 5ICSA 3BD9A 4IJQA 3UG7A 2QUIA 3P5BA 1JPUA 3ZTYA 1K34A 3ZI7A 4OMDA 2WLSA 5DHPA 2CL6X 3L41A 2OTJV 3LCUA 3GDFA 1AZTA 4ITUA 3OWHA 5AVSA 4ND3A 1I7PA 2MYTA 1D6JA 4H7PA 5H70A 1LXCA 2E76B 1U2DC 1GQQA 4A0FA 1CUAA 4RSMA 4TUYF 4NE7A 4R5MA 2ZKLA 5EB0A 2VNHA 3URMA 2HIGA 3FX2A 2QXYA 4RHXA 4BASA 2B25A 5KSWB 2J0EA 4CM3A 4BFSA 3WB1A 3H9GA 1ZM2A 2EBWA 4GEKA 1GGJA 3O1JC 2GOYA 3GB7C 5B57C 5A3JA 2A3QA 1CR0A 2QLMA 3ABTA 2Q0XA 1EJ2A 2GHQA 1B6QA 2HA3A 3A1SA 3TQFA 2PUAA 1W88B 2UXBO 2R60A 2X7JA 3GA7A 3TNJA 4EPYA 3SBXA 3ZDXB 4E3ZA 2XSZA 3BBPA 3RAFC 4MVWA 1RTKA 2QJWA 4G1UC 3OBIA 4A73A 1L7BA 2ZYHA 5KTKA 4PC2A 1NYQA 1CF9A 3PRKE 3EZNA 3GGPA 3JZFA 4O59O 3MGBA 1M3SA 1Z0DA 1NN3A 4RA6A 1QR6A 5HKOA 1FSFA 1RZ3A 3C8LA 4E5NA 3KKKA 2E5LO 1R9NA 3FPBA 1LLFA 5E2IA 2WJ6A 2A30A 1KZHA 1YA6A 2IHBA 3IBFA 4WLVA 4Q4AB 1TOAA 3D59A 4QGFA 2ZR7A 3NK6A 1G9TA 2NO0A 1HL3A 5C1OA 3W9BA 2IXGA 3JYHA 1SELA 5D3QA 4G84A 4X7BA 4Z99A 4H6PA 1BS9A 3KR0A 4P4LA 3L4EA 4LF7B 1DOAA 3SYTA 1ABEA 1DMSA 4ZQHA 3G0HA 1XEFA 2Z8YM 4XH9B 5KYVA 4UMEA 1D09A 2CNNA 4C76A 3G5AA 3C45A 2ZE5A 3AR4A 3WA7A 3TLGA 2G0AA 1HR0O 1ZMXA 3OPYI 1G60A 4ID9A 3E9QA 2EZOA 1ULUA 3PCXA 2KGWA 2EF1A 1VSQA 1RS0A 1EGQA 3FDXA 4UB6Z 2YOGA 4IXTA 1GN4A 2QW1A 4LN1A 3ITNA 3D54D 4CQNA 1CQJB 3O1IC 4B7EA 2VUUA 2B7BA 1GKIA 2HB6A 2MSNA 4MUNA 2Y2VA 4FONA 2KMLA 4A8JB 4EUNA 3V4LA 3NEYA 3FNQA 4OHUA 2FR0A 1JLHA 4WZ6A 3V8BA 1JX6A 2EGUA 4C0AC 1E2MA 1Z4NA 1I7NA 5ICGA 4KSYA 4GCZA 3D4BA 2F1MA 4YJGA 2QRMA 2H54A 4OA8A 2VNAA 1MSWD 4RESA 5FLEX 4M8SA 1XMOB 4ZT6A 2AMYA 4PPNA 4RAQA 1G1AA 2JIRA 2GZSA 3CU5A 4I5DA 5JSQA 1FFSA 4ZP1A 4HUQA 3WIOA 3TOXA 5J59A 2X0RA 3JU3A 4NXMB 2VAMA 1DRVA 2G9UA 4O3MA 5FNVF 2ZB3A 2V59A 3OC6A 2VPWA 3GP5A 2VOJA 4MW6A 1FFWA 4R83A 5K0LA 3A4NA 3TCNA 4CM9D 3IKMB 4L7QA 3W8EA 4PS1A 3LKVA 4WFAV 1KI9A 1VDMA 1NHGA 3HMKA 3I01A 4EYQA 3MT7A 4MUXA 1A9XB 4XJSA 3QLJA 2OECA 4MDFA 2OC9A 1GNSA 2Z43A 1YS7A 1VCHA 4XFKA 1KPGA 1AO0A 4D41A 3PXEA 4TMXA 1GTMA 2DLNA 1NXWA 2AI1A 4X1YB 1E92A 3N3AC 4GT1A 2H8KA 1KMHA 4TMFA 1UPTA 1XJ0A 4OHRA 3KJFA 3P9KA 4D56A 1J99A 1L1FA 3IURA 4JDUA 1QH0A 3U3ZA 1FYVA 3K79A 2E55A 4E2ZA 2VQFB 3NOXA 4GW3A 4M55A 4UHJA 5LL6P 1NT2B 3R3JA 1OX6A 3IVXA 1O6ZA 4B2LA 2PUHA 4L15A 5KTOA 1ZH8A 2FQQA 2HJWA 3VH2A 3UUWA 3SHFA 3UCEA 2E49A 4FEYA 3PP8A 1JDPA 2WJWA 5DMXA 2DFPA 3RUIA 5IWAB 1PUXA 1ZZGA 5KTPA 3SM9A 1X80B 1NA5A 4UULA 3CRRA 4L3OA 1L5RA 4X8OA 4M8NE 2C84A 1OAAA 2G04A 1FMCA 4A15A 3CYOA 2OHWA 4GI7A 4ESEA 2XITA 2AMTA 4MQEB 4Y2JA 3IUPA 1Q57A 3MS7A 2O14A 4W5RA 2NAPA 3IC5A 2ITDC 2BTOA 4YV7A 3GK3A 2Q5QA 3GUYA 3DGEC 3P0ZA 4BO2A 4V1CB 3W06A 4K6MA 3OJWA 2GZDA 1XRSB 4X63A 5KJ6A 1BXRB 3DZKA 5F9MA 4AWAA 5IULC 1N2SA 3I2GA 4FWIB 2G6BA 2OQRA 2R7AA 3JAMM 2NUTB 3LOUA 4LF5B 3BZUA 4QGHA 3I9KA 2JIZD 2DERA 1OV9A 2VYND 4ZRNA 3M1YA 1IN8A 5FLXA 4N18A 3DEAA 4CFZA 1D2NA 2UDPA 2BOCC 3DKKA 1KQSU 4YWJA 1QHHA 1Z3IX 4FILA 2ODAA 3G0CA 3E9ZA 5ED0A 4WXYB 2WABA 3TUJC 3KFLA 2WWWA 3E83A 1IEVA 1SXPA 4JXXA 3CIFA 2DSTA 3PUWA 3CF2A 2EIKB 2ZG6A 2QKSA 3QYFA 2PWPA 3SD7A 2WLKA 1BGVA 3I6IA 3W5JA 4EO7A 1A27A 4BOYA 1KKCA 2Q5CA 2W4IA 3WFZA 3F8WA 3K2BA 4M0KA 3MHPA 2G08A 3H1TA 4DRYA 1VPWA 4B2PA 5K0GA 2FRVA 4KO8A 5BRNA 2VJQA 3HZHA 2B5OA 4JJFA 3CKYA 1GZHB 3K4PA 4IL6Z 4DQ0A 1D4OA 4G8CA 1NBEA 3RWMB 2VUHB 3H2ZA 3QHPA 3UB4A 4AVYA 1NDQA 1IQUA 2PR7A 3FFTA 3AEZA 4AUMA 3TDMA 5JASA 2X86A 4MSUA 2VS1A 3SQXA 2YN2A 4EYOA 2YHIA 3U11A 5IEBA 1YK0A 4EHHA 5BSEA 3NWOA 3RYFB 3LFHA 2LQTA 5JC8A 4EEQA 2UU9B 1FNKA 1SZXA 2YHAA 3CCEF 1II8A 5LSAA 4U7PB 1NH2B 4S1OA 1BD3A 3CCVF 2FSPA 4C7VA 1JYSA 4QOGA 2COKA 3C41J 5HX7A 1GAJA 2C9BA 1SKBA 1JXAA 3KZMA 1M74A 3AB7A 5JSHA 2KSQA 3CTPA 4DBLE 3JYQA 5F2EA 2O2IA 1I3KA 3K06A 2KG7A 3K35A 1MC4A 1CE8B 3DCYA 2C99A 4TQAA 1O95A 1QHEA 3E23A 5EZYF 1AK2A 2EEZA 3MIZA 5CB8A 4MLCA 4CNBA 5IKPA 1KAGA 2P1RA 4PC7A 3C6BA 3V7UA 3K6SA 1JVMA 3IQXA 1SXJC 4JBNA 4IO1A 4DV3O 1J7KA 3AVUA 3N2GA 4D9HA 1SQFA 2IZOA 3VMFB 4XQ0A 3H9BA 3HB3B 3W9UA 4AY3A 4HDQB 5KVSA 4E03A 1QIHA 1GL6A 1XP5A 4PVDA 2FJPA 4XDJA 1ZXLA 4WF9V 3AH8A 4CQMA 2YBDA 3ZXYA 3AZQA 4PFQA 5JATA 2XDYA 5HCUA 2BJWA 1E2NA 4AJPA 5JNVA 1LK5A 2HJ9A 1H1DA 1GGKA 1RYBA 2WUGA 3BB3A 5DYIA 1YQUA 4MAFA 3TQQA 1U9YA 5A4KA 4X8MA 4KPEC 1ISIA 3FKSD 2AOVA 4HF7A 3L1JA 5EJMA 3NM4A 2C7OA 4D9BA 1AI5A 1OIVA 2DH6A 2OTMA 5DHQA 2ZLBA 2BKXA 4RO0A 2W2VA 2HD4A 2QSZA 1EEXB 3RYIA 4C0XA 3JS5A 4J9UE 2OXTA 1QORA 2JI9A 2DKOA 4BATA 1Z75A 4JC5A 4MR9A 1H6AA 1YJCA 4S2EA 5GONF 3HK2A 3IEWA 3BM5A 1A4UA 3DFIA 3RC7A 1NUHA 4MQ5A 1BX3A 4HNAA 2QGNA 4MS3B 1X3LA 1HOTA 4DLXA 3HXOA 4JY7A 4BS9A 3E8FA 1XLUA 1T0PA 2O2CA 3CEHA 4QJIA 2EX1A 3CJQA 3IEUA 1EK5A 5FD8A 1JDUA 3BHNA 3PXGA 4YI5A 3OQ1A 4F6EA 4F4DA 3T15A 4RVHA 5BV0A 2BFBB 3COSA 3RBZA 1BE1A 4PYLA 2R85A 2BE3A 2V1UA 2HBQA 4BVGA 3OE4A 3ES9A 1RR6A 3OZIA 4X5OA 4YUYA 1IXMA 1TZKA 4INZA 2JRIA 3D4IA 1RQRA 5HP8A 3EISA 1YU9A 4II7A 5ALVA 2XE7A 4R81A 1WMAA 3A1UA 3EGXA 1VFPA 1UJ6A 2QTCA 1YRWA 1GT6A 4F9FA 3PD7A 4PINA 1VG8A 2F67A 5F9FA 2RGDA 4CT0A 4ENPA 3ROEA 1V1RB 4O2LA 3KTFA 1BN7A 1HH4A 4IYIA 5AI9A 1IB6A 2CXUA 2ODEA 1E6CA 1WXDA 4HYEA 3F6CA 3MGKA 4UFNA 3EJ6A 4TLLB 2CXSA 2JDIA 2F3SA 5DNEA 4IVRA 3WNBA 3SGIA 3STHA 3VUFA 5G3YA 3SJQC 5CBGA 2XYQA 3DVSX 2OVFA 1UOEA 2HWUA 1F5NA 4OLHA 3C8DA 1MB0A 2X8WA 3PDWA 4HRVA 4NZNA 2H4FA 3HYRA 4MJ7A 3K5NA 2GK7A 4AB1A 2FMLA 5D01A 1N1EA 3ZMZA 4Q4LA 4S1WA 4INAA 5K03A 1C30A 1I3MA 1E1MA 4B7KA 4TMTA 1RACA 3CEMA 1XD2A 2JCBA 3T3IA 1XF9A 1A4IA 3L0SA 4G01B 4W4KA 4PXAA 4WFKA 4G26A 3PYMA 4RIFA 3KZCA 1Z34A 2C2XA 2GK6A 4IYRA 2Z9CA 4BLTA 5EPOA 3WSWA 4GUNA 2GXUA 4RVFA 4H0LB 4GDMA 3CX7A 2ZSBA 3Q7TA 3HWRA 3PT5A 3NNSA 1NJIH 4ZOEA 5AG2A 3C3JA 1U3WA 4MPTA 5A71A 1IYZA 4CTMA 4ETIA 2O8FB 1H05A 1MPXA 5LD2B 2BGUA 7ABPA 3FDZA 1XKXA 1UBOS 3TM5A 1YZYA 2IYVA 5HWEA 3ZV6A 1U7ZA 3MS2A 3GBPA 5CB6A 3MA0A 3NKVA 2GYYA 2PBLA 2RH4A 2GR9A 5LHHA 3T6KA 3F6YA 2R70A 4OLAA 1PYDA 3IKFA 2N48A 3WO0A 2ZYSA 3RUEA 4GMDA 4TVKA 4S0XA 3WLFA 1EUDB 5CA0B 1XCPA 2FG6C 1PV0A 5BUCA 2X9QA 1DXHA 5DM70 5H5NA 3CW8X 3QO5A 4BVSA 4N40A 3O73A 3WJAA 4JJKA 3RUDA 2AD5A 1XXHB 4AZSA 3S8EA 1IWOA 2X3FA 3D8BA 4FK5C 4XIYA 4LE1A 4G81A 3OT1B 1YB1A 3ESQA 1PR9A 1Y98A 1PNKA 1JDJA 1R4MB 4PQYA 5DEDA 3OKFA 1RBYA 5K20A 3VPSA 4XA8A 4TLBA 2X15A 1FNDA 1FJHA 1NZFA 4B6FA 3U0VA 1S2DA 1EFVB 3U19A 4AYTA 3Q4GA 2CV1A 5KVAA 3KZVA 2FW1A 3VTZA 3N4YA 1E1DA 1NBMA 1DX9A 4H17A 3AIKA 4XWOA 1YR8A 3PQ3A 2XWPA 1QAHA 2IZ1A 1T0IA 5KA5A 2R6GA 1RABA 1ZN8A 3L0YA 4OP1A 2WWVD 4LW8A 2WB4A 3JALB 3QXCA 1CERA 1H94A 2OAP1 1S2IA 1GGNA 2PBRA 5H1YA 1J0CA 4MV7A 2W37A 5BQPA 3G6EF 2WYUA 1VI5A 3TOSA 1MPTA 2DEUA 3FUCA 3LWRC 3U3DA 4RDCA 1FTGA 2VP3A 1AXEA 1ZI9A 2GO7A 3ETDA 4IIHA 3GVCA 5FX2A 2HDWA 2Z30A 2F43B 1XZDA 3TZLA 2FU5C 4ZANA 4IDAA 2IYSA 5TE9A 4C05A 1NUAA 3MCAA 3FB1A 1VIAA 1MA3A 1NQUA 1W581 5AKEA 2DQYA 2IA5A 4J90A 3KC2A 4IIYA 3AETB 1PL8A 1KJQA 5CMLA 4X6LA 4Y98A 3DDNA 5AW1A 1VLVA 4EA9A 4H3VA 2HF2A 3Q8MA 4V2UA 2DAPA 2BY4A 3OU7A 3G71V 5E4FA 2Q1UA 1SC1A 1ZLZA 4B3FX 1SB8A 5J47A 5LQJA 5FLKA 1QOZA 4URFA 2ZT5A 1HNWB 1EE1A 4HAMA 1R5BA 1JWLA 1BDJA 3FYIB 2GT1A 3CP1A 3K96A 4N7RA 4C7OB 1XU7A 2QV0A 5CURA 2I7XA 1N5RA 1ADBA 4CM5A 2CUZA 1JB9A 4PRZA 2LCIA 3DBLA 2X1LA 4RH1A 3OJFA 3M8AA 4JI0B 5TT1A 2XTJA 2ZRQA 4MXDA 5JVDF 3E89A 3S0HA 2HPAA 3VZCA 2HR1A 1EE9A 4G9EA 1XHZA 5FTWA 2AB0A 5SV2A 4I9FA 4I81A 4C0JA 1WX1A 3L7BA 2C4NA 1JAYA 1YSCA 5FWNA 1P1BA 4MRSA 1Q7YW 2J6CA 2QT9A 3P0EA 3PENA 3O3MB 2DQSA 2JLCA 2C03A 1QAQA 4OUKX 1BAPA 1H48A 4TTSA 3PYLA 4JAAA 4BU0A 1GRVA 4NBLA 2WSSG 4B3TB 1FLNA 3HL4A 4BQRA 2XXAA 2Q49A 2OWOA 1U8EA 4MTXA 2VDOB 1LDEA 4B3HA 3QW4B 2IHKA 3TG2A 3AFMA 3QJ5A 4Y2XA 3L02A 3ZNOA 3CT6A 1LDNA 2Q7EA 4RKWA 3EARA 2QR2A 1V7PC 2L26A 1S7GA 2VAWA 3L7OA 3OQMA 2UUBB 1VCOA 2IOFK 2AFVA 4Y8VA 4DV4O 4CI9A 3LMEA 3LX4A 3S06A 3DBHB 4NZZA 2ZAMA 3O8RA 1KYYA 5IT4A 2C1EA 2YWDA 2AYZA 4D3ZA 3T1HO 1W4ZA 3ECAA 2PS0A 2AZ0A 4DR1O 2C92A 2RE8A 1DCTA 1YFJA 1VJCA 2FSHA 3F5SA 1RJGA 1CJCA 2XCRB 4EQ6B 4JOQA 2DFKB 1XZQA 1MV5A 4C6SA 3K0AB 4FFPA 1ZONA 2JEXA 2UXDO 5JD6A 2OG2A 1KH1A 3K1AB 4K9RA 5DHSA 2ZJ6A 2VQ3A 2P9BA 2PIDA 4Y2RA 4LDZA 2HCRA 4CL2A 3V7NA 1BVYF 4WXHA 2JH9A 3OBYA 1U3CA 4UXHA 2PG3A 4QTTB 2E75B 3SJCA 4HDSA 1PD0A 2OD2A 4D96A 4CGZA 2TMYA 4LZPA 3D4PA 1KDVA 5H83A 1W6RA 4J7XA 3VC1A 3WYAA 1AQNA 4LY0A 3I9MA 1SKYE 2Y4OA 5CB4F 1FFBA 4FCWA 3GQBA 2QR5A 4FZ3A 5UKDA 4E4RA 1Z06A 4IHJF 3DMTA 1AZWA 1NI3A 3NUGA 2AHRA 2WIJA 1OA0A 1BEZA 1LI5A 1UFIA 4MS4B 2Y66A 3PRYA 4OKNA 3B7WA 3ZDRA 3IQHX 3W6PA 3IODA 4EM6A 5CBHA 2JFHA 2PDAA 4BCBA 4EPRA 4NOLA 3QVNA 4OPAA 1BHO1 4NZ9A 4BNGA 2Q3DA 3AR3A 4CUZA 3I4LA 1T2DA 2O57A 4D92A 1XZLA 5E1BA 3CZ9A 4O2BA 1GUZA 1C7FA 3P9QA 2CDRA 3UHFA 1PQPA 3SZGA 3AZOA 3M4NA 3UF0A 4CUKA 3DPIA 1VQLV 1YITF 4ENTA 5CYFA 4ZJUA 1PWYE 2QUAA 1I3NA 3BCUA 1L4KA 1QH1A 4CKXA 1XRGA 2I3GA 3NH9A 4HGNA 3WP0A 2X13A 2CDYA 1PI3A 2MYPA 5IY5B 4DC1A 4IM7A 4NDZA 5EWLB 1DC6A 3BHPA 3QLEA 4BP1A 3RODA 5BWLA 3SYQA 4R16A 4TLMB 5DLPA 1RE1A 3D4NA 4RTNA 4L2IB 4OXXA 1E4OA 3N5KA 3UWSA 4D8WA 1G4UR 3LZDA 1TDJA 4MUBA 2CY0A 4YUWA 2P0YA 5IDJA 2Y8EA 1Q0TA 3EZ9A 2IIVA 3TIIA 3RVOA 4Y9TA 2ZODA 2X6TA 3D8SA 4YQZA 4EA8A 1PLKA 4IXWA 2QQ0A 5KJFA 4IGKA 2IYRA 3CUUA 3TOVA 2H4ZA 4DC9A 1QZUA 3AUAA 2P7IA 3HA5A 4RABA 5KA6A 1FFXB 1WMDA 3CLSD 4GVPA 3DBRB 4R8LA 5EJ7A 3NRBA 2HQRA 1XTPA 2IEBA 4PDMA 2A9PA 4RKQA 5C8YB 1P31A 3ZCVA 1W42A 1R6AA 3NLLA 4PGMA 4UPDA 1ZCAA 4ZQEA 3UCXA 5AM3A 1PSWA 1V45E 4JLMA 2BL4A 3GH1A 1T4CB 2W0SA 3A7DA 1P0CA 3CMMA 3ZJVA 1ULBA 4MSWC 4UNQA 3JQCA 5AW3A 1YI0A 1C9KA 1DEOA 3EGDA 1CF2O 2WMNB 3GLTA 2VP6A 4ABTA 3C9SA 3UBMA 3THSA 3MB8A 5D7NA 2C5SA 1TZJA 4YRJA 2WWHA 3V97A 4BW0B 4J7CA 1GQSA 3VTIC 4P1ZA 2H8EA 4X20A 1CZUA 4BX9A 4B17A 1EMDA 2ID7A 4MP6A 2X6CA 1ORWA 1JLMA 5TGZA 5DTRA 3NV9A 3VSEA 2VDVE 2AN3A 3PXUA 4W9MC 3VAAA 2EWWA 4O1HA 3DULA 1USKA 3CNHA 1QFZA 3ONWA 2DYKA 1P44A 1P4RA 3G17A 3P32A 2EFEB 1JHQA 2HWXA 4A8JC 1XV5A 1H4SA 4FCVA 3JW8A 1DXQA 3WHIA 3Q6IA 3S1LA 4RGQA 2NZ2A 3BL6A 3OOWA 3H2BA 5TPWB 2BLLA 2J5KA 2EG9A 3DONA 1OLUB 3N7AA 5ARDA 4PGGA 1Y3HA 4DJFC 1Q0PA 1HG0A 2HLDG 1IPEA 1GFWA 2IT1A 3WWOA 5DIZA 2JGDA 5D8DA 2CJWB 1JTFA 1NNUA 4L8VA 3L1VA 4FCCA 3CJRA 2Z1UA 3M9WA 4JNKA 5F7OA 3MGCA 3Q9LA 2E1PA 4EKWA 2WZDA 5LUAA 3IXMA 3R2JA 1PM9A 2BO1A 3UV3A 2BCJQ 4J0QA 1OX5A 2AVDA 2A5LA 4ARVA 2C88A 5CEEA 1BL8A 2VLBA 2ZRBA 1BKDR 1YQWA 4LF6O 5C5IA 5K8TA 2PQMA 2QT1A 3M5CA 4OBWA 1XELA 2XY4A 4MIKA 2CFRA 2Z56A 1M1UA 3OX4A 1LRLA 1W4CA 2JEYA 1KMQA 4LYFA 1J20A 1OXXK 3ZR4B 5CJPA 3PS9A 5LXTF 4YXFA 4TV9B 1OAPA 3CSDA 4PAMA 4N48A 1OWOA 2O48X 2O2EA 5KYUA 1Y3BE 4GPEA 3RT3C 3VBBA 2B20A 3K9GA 5KZMB 4PZLA 2GA8A 4QO8A 3M9LA 1CZOA 2IYYA 1YJAA 1YIOA 2HQ1A 4TZTA 3VTKA 5DX0A 1W4RA 2WHRA 4HAYA 1TC1A 2H5JA 1TCCA 1WCYA 3CD6V 5ES3A 2ZZNA 1I6WA 3UENA 2GAOA 1R9MA 2BMEA 4JI4B 2V5UA 1W48A 3MWYW 1J9GA 4PYMA 3VPDA 2WJZB 5EWRA 3F6RA 1KEKA 3RABA 4MKFA 4YX9A 3NM6B 3FPAA 3NT4A 2AFHB 3GNSA 1SCIA 2XECA 2I66A 1ZQ9A 8AT1A 4C08A 4R6WA 3WBFA 4FD3A 3QVWA 4IJ6A 1W2GA 5COBA 2ZR0A 1ADYA 2VRBA 1DE0A 4EYEA 3NATA 3ZD9A 1U7WA 1FXHA 3EA0A 2PL9A 1RQPA 5A62A 3NWEA 4QTXA 4L5BA 2ABWA 2GXQA 2WUEA 5K3EA 1P3DA 4HQRA 3C5VA 2DR0A 5HZMA 4NU8X 3OJEA 3MMNA 4J9ZB 4AY4A 1K6EA 2DWUA 2VF8A 3INRA 4BGVA 4GBJA 5E6SB 4BCDA 1I32A 3FVTA 3HNPA 4M8KA 4FGWA 4L6AA 3ABZA 2ZRCA 3BXOA 3DL2A 4LVUA 1PZXA 4K6GA 1A72A 2LVBA 4B5LA 3JASA 3RREA 2NO7A 4DJDC 1HYQA 2WI8A 1OI4A 1EFRA 2EIKC 3IPYA 2I3ZA 3EVDA 5JQGB 3ZH9B 7REQA 2CUTA 1CJMA 1GN8A 5LGTA 2D5BA 5T41A 4F4UA 5KQMA 4WESA 4CN9A 5A4DA 2QWNB 4A5OA 1NRWA 2GCPA 1JFSA 5FBWB 1T4GA 4EW6A 3DAPA 3G9UA 4Q9NA 3SIXA 4CKCA 3RK0A 2WYVA 4ENUA 2HG5C 5T8KA 1D1TA 2AW3A 1TVMA 4B6PA 2ZIXA 2FEPA 4WX2B 1HE5A 2PX6A 3DGFC 2W6MA 2PEYA 2XWBF 4JROA 2IEIA 3RVDA 2HRCA 1RWVA 3C8UA 3WLEA 3NFRA 4BFTA 1CK2A 2OCCB 2WLJA 4CEIB 1QYDA 3BX1A 2CCJA 3GPBA 3ABRB 1KS2A 1NHWA 2IX3A 2EDAA 2CE7A 1QC5A 2CLLB 4G1FA 1TX4B 1ZSPA 1RRPA 3H5AA 4I14A 1RLMA 5F3DA 3CLVA 4D9NA 5BW4A 3HFRA 2YWCA 1DUIA 2NMVA 3N2EA 1GO1A 3AESA 4O4IA 1P6UA 3CISA 4E5YA 2QTAA 1PVDA 1EYZA 2FZLA 4F6RB 4G56A 3V4OA 1OSNA 1EFKA 6LDHA 4BTVA 3L0DA 1VIMA 2K7ZA 1C8BA 3SHQA 3UPUA 4KU4A 1S3FA 1FY2A 1SF9A 4WGFA 2WJAA 3GLKA 3SJ7A 1AGYA 4NBNA 5HXAA 1C3LA 4Y2YA 4ZT5A 3E9EA 4MRPA 3TGLA 4TS1A 3PNOA 5MFPA 1TO2E 1N2GA 4IY1A 1VQ1A 4AKSA 3TTTA 4LXGA 3GRKA 4NBKA 4DSTA 1Y1PA 1THZA 1A77A 1A9QA 3ILSA 3GLUA 3VV3A 1NVUQ 3EODA 4IMJB 1SVSA 1EVKA 3NYIA 2ZSJA 3VR2A 3C6QA 1L6IA 3O93A 4PYOA 2JK1A 4WINA 2P22C 5EQFA 1UODA 5DWVA 3RSLA 2C7PA 2OM6A 4TMKA 4Z1MD 3KCXA 3DZ8A 4Y6OA 2CLMB 2AKEA 4HVAA 1HZZA 1DFIA 4IEEA 2ZFUA 1UAGA 4F3CA 3JQBA 2F1OA 2HK6A 2ZWAA 4FLWA 1TEVA 1FUIA 3IPAA 3KM0A 1KKMA 5CEFA 3EFEA 4O1MA 5FOTA 4IO0A 1GO3F 1BH6A 1D5WA 1PQUA 4R69A 3AVVA 4RVGA 4OFBA 4ZZ0A 3B2EA 1ZW1A 2UYCA 1NOIA 4FYVA 2OPHA 1WV0A 2G9RA 4NMHA 3KR2A 2XLBA 2NZVG 3JYLA 2OLEA 2HP0B 4ZVTA 4G5XA 4U7WA 2XWJI 2J41A 1UMCB 3AJDA 4FM2A 2DFTA 4FSXA 3E7DA 1NULA 1G1MA 3CRVA 4CW7A 2V6MA 4IWYA 4GOLD 4KJZA 3WGOA 2Q1TA 5EZ6B 2AEJA 3WPXA 1FDOA 1TAEA 4IVNA 3AR9A 5CVCA 5CA0F 3W3AH 2Q0OC 3SE7A 2ZBQA 4QBTA 2ISQA 3FPGA 4V03A 2LIPA 2YMMA 2ORWA 1ZCFA 4R7CA 4DG8A 4DJEC 4J6EA 3PEEA 2O50A 4U3JA 4JR1A 1SURA 5EWJA 2W43A 1WHTA 1IM8A 2XOKG 1ONOA 1D4ZA 5D3ZA 2QEXF 4D9EA 3HHPA 4MVYA 2PQ6A 1QZXA 3CR7A 1U7PA 4TKLA 3SY8A 2E9SA 2ZDIA 4FDVA 5B4TA 4I1YA 2V7XA 2YRXA 2AQIA 2OXRA 2BUAA 1KK1A 1NOJA 4IEIA 1RAIA 2ZIEA 1F8YA 1U3FA 5FP0A 3FROA 3UAGA 3IULA 1KDZA 2QVXX 3AQIA 1Q8RA 5AJHA 1OB2A 4BGEA 2HA4A 3GUZA 4TVSA 1UDXA 1KEEB 1E1RG 5LCXA 1RPAA 4A6DA 1DV1A 3S29A 1KO7A 3L72H 3ZW7A 5HKAA 1DUVG 1YRAA 5T6BA 3DV2A 4PBRA 5E95A 1YTFD 2NYVA 3PQ5A 5K5EA 1Q0ZA 2X40A 1K4CC 5K3BA 3F90A 2ZRNA 2PANA 5DBGA 4YJ3A 2P06A 4XLLA 4JS0A 2FR1A 3TJRA 1XRPA 2DGDA 1U80A 3S2SA 1Q22A 3CVYA 4A5UB 5FTKA 3DJFA 4PU0A 1ZX1A 3KHSA 3KSMA 2P67A 4EELA 2QTLA 1VE5A 5K0NA 3VPBA 4F38A 2VDNB 1KYZA 3AFHA 4OX9O 2EP7A 1UP4A 2NQ2C 1KBZA 4KWHA 1G21A 5JAUA 4WKGA 4KTVE 1PEKE 4B0PA 3SXJA 4HBGA 3HJRA 1Q12A 1UWLA 3D8HA 4G2TA 1YNOA 4MI1A 1E9VA 4LJ9A 1FXKC 5I9NA 1BFDA 3EGWA 5ESRA 1JW9B 2PUCA 4YRNA 1T1JA 4BUCA 3GJYA 1RAAA 2NX2A 2ONZA 1MGOA 3FD8A 4OHCA 3NUZA 3ZYCA 3ORQA 1N7JA 2BAGA 1T8RA 2R8BA 1R8SA 2Q3JA 2J4DA 3X2QB 1VPLA 2VC2B 5LD2C 2UYKA 4BE4A 3BSSA 4PG7A 4W8HA 3P30A 5GANK 1CJUC 1ZJ6A 1M8PA 3ZQ4A 3M83A 1ZFNA 3ICWA 3U2QA 3V46A 3S2IA 1KQPA 3MTGA 1DBFA 2QRVB 4MIOA 1QVRA 2BGNA 3HDYA 3DQZA 2DXIA 5B1HA 2M98A 5DNVA 2VHWA 3WGVA 5MN4A 4KO1S 3VX4A 5DV9A 1V0JA 5IYCO 2KPOA 4HI0E 1CRZA 2HQSA 5EVJA 1PS8A 1UEXC 4ZCRA 2HVJC 4XVRA 3J81k 4JCCA 3OO0A 3DHVA 1K9SA 2I67A 3PHIA 4CNQA 3BFRA 4R50A 4B32A 1K5DA 3SYMA 3U3KA 3CNQS 1YOVA 2R1ZA 4Q48A 3QV1A 4ND2A 4R9VA 3CURA 2ST1A 3ZOKA 4HNGA 1TK3A 2PGXA 5TMEA 1Q19A 3E7FA 1EP1B 4J8PA 2WLMA 4FXOA 4PI0A 1XU9A 2C9DA 3EGCA 2QNBA 3VR5H 3H3XA 2P41A 2J67A 4DLBA 3L9XA 3K5LA 1WB7A 3KELA 4L9SA 2G9NA 5KU7A 1DU4A 1FP6A 2XQIA 3KLMX 5CXQA 4YFVA 1Z12A 1P84F 5ICMA 1J0XO 4QBGB 1COWG 2FE1A 4Q7KA 3R7FA 5AW0A 2BFMA 4FN4A 3K32A 2PJZA 3OZFA 5GIPC 4P9NA 1ISGA 2IH1C 3EQ9A 4O63O 1T5DX 4FJ0A 1TAUA 2I4RA 3C1AA 2PK3A 3R0VA 1JIUA 3CW9A 3I55V 5KJEA 5TARA 1Z7YA 4RZQA 1Q7RA 3JQDA 3VR4A 1UMKA 4EGAA 1R6KA 2C0CA 4YP1A 5FQNA 3HABA 3E3MA 3TCUA 2GCNA 1L1RA 1AUOA 3BFPA 4C0QC 1AF4A 1K0UA 1G3MA 2DHRA 3FAKA 1Y8QB 3G68A 4JKOA 4Q7LA 5KVQA 2C5EA 4I4TA 3ONVA 2WY2D 1T1GA 2R1TB 4IV8A 2CXRA 3V1LA 5EJ2A 1ENPA 3DT6A 4GYJA 4WTOA 3DE7X 5CX1B 4H7FA 5HRCA 2D3OW 3D3KA 5DBFA 2XB9A 4GOND 4YAFA 3CCCA 4DSOA 3GRFA 1E3QA 4NBVA 2XUPA 1BDBA 5G0VA 3D4LA 2IU0A 3ENQA 1RJFA 2ORED 4C7UA 4X3LA 3RHFA 3L8YA 5D7BA 5LQUA 2D5CA 2E4XA 2JD1A 2FY8A 3TNFA 3DZIA 2A9KA 5AJUA 5KNDH 4K87A 5CNMA 1J2RA 4OHKA 1XNRB 2ZI5A 1U3DA 1L6RA 3L4BC 1CTQA 2Y77A 3DJYA 1IN6A 2Q68A 1QRTA 4XI9A 3NUQA 3LWQC 2Q21A 2QBYB 2WYWA 1KMIY 4DSUA 3J81A 4FSHA 5DCYA 3CVJA 4OHOA 3PQDA 4O4HA 4PHGA 3SC2B 5DTJA 5CAEA 3I30X 5E8RA 4X8HA 3HVKA 2D8AA 5CFNA 4P4SB 1V5EA 2RGAA 2YV1A 1DQYA 3HXKA 3C85A 2G82A 3PL1A 4NNJA 1OILA 2YXZA 3EMDA 4C1BA 1GPNA 3AI2A 1Q6ZA 2VZ8A 3K9FC 3U39A 1AKVA 1UADA 5C8YF 1HLFA 5MGNA 2PX8A 2QYTA 1R64A 3OUFA 1JEYB 2XYPA 3OZDA 4RKYA 4KN9S 4R2MA 5LQDA 2NNWB 2REOA 4KKXB 1CUGA 2IYAA 1SCNE 1S2OA 3MTEA 1AGRA 1JDVA 4JF3A 3DSRA 1OGIA 3VHXA 2QQ5A 3LUBA 4KVZA 1H4VB 3QG1A 3PFBA 4AF8A 2PZJA 5ED4A 4B09A 3COJA 1R3UA 1G16A 3IMEA 1IY9A 1KY5A 5D86A 1W96A 2JFPA 4PTYA 3U13A 4P9PA 3CCJV 2AZXA 4QARA 2I76A 2CNOA 5A3SA 4S24A 4AMZA 2M32A 1ACMA 4CMBA 1YMUA 1LUWA 4GWKA 2WU8A 1L7DA 3BL8A 1G6Q1 4NKGB 2NVOA 1D2EA 5IPFA 5ECDA 1K9MW 3OQBA 4WZBB 4F1JA 3GT4A 4RH3A 3JQAB 3NEJA 3COVA 1KRXA 4UATA 1E3MA 1X19A 2I2DA 3BH6A 1E2QA 1RHJA 5BN4B 3ZOPA 5IEJA 1QRSA 3MCQA 4EIWA 5E79Z 1L5KA 4M4SA 1BKSB 4W5WA 1SULA 2ESRA 2ZJ0A 3TXYA 4F2HA 2JKYA 1Y74A 2E0IA 1FVFA 3CZPA 2UZIR 1Z5ZA 3Q88A 4KAAA 3FHTA 3JQFC 4CLRA 4QQ8A 1L3BA 1PWHA 1Q5PA 3O5AA 4HP8A 1FTSA 5L3DA 4EDFA 4L02A 3Q3CA 3KWFA 5TIIA 2CTRA 1T34A 1EI9A 1WXQA 4DEYA 4IMRA 2BELA 2HHHO 5JJLA 2QSAA 3HYLA 4DQXA 4TV8A 4MYHA 4YRTA 5IY5C 1E2DA 5JHGB 2VRCA 2BSAA 4WFQA 4M1EA 4R6ZA 3TL2A 1QBZA 3J7AR 1F0PA 4M36A 1Y80A 3WE7A 3H11B 3BH7A 1X9HA 2G83A 4N65A 2Z08A 1GRJA 4I9WA 1P6QA 2R66A 4DYDA 1W4LA 2R1VA 1CRQA 1XHLA 2BEWB 3DV0B 3VDMA 1J4AA 4TV9F 4BNTA 4X95A 5E9JA 1M90H 1QRUA 1JHOA 2R5FA 1DJPA 4JASB 3TLMA 5A02A 1FSGA 3PQCA 1TE2A 4ADSG 3NTUA 1RXUA 3HLYA 3DLAA 2MMCA 4YTEA 3MQ2A 4GKVA 1O89A 1PAUA 2BP7B 3P27A 3HDVA 3Q1LA 3OJCA 1VLZA 1E1YA 1JEJA 1P7YA 1HEUA 2IXTA 2NVBA 2OEPA 4M1ZA 3RC9A 1AKQA 4Z9BA 4LE0A 4OHFA 1GUYA 4DBZA 3CCQF 2ZVPX 1Q17A 1VQMF 1DB3A 1SR8A 3OEHA 1TM5E 3N2KA 3LQYA 2PMEA 2PZGA 1EESA 2OCBA 2A3NA 5T64A 1RQNA 3DAHA 3DMGA 4B3SB 2R47A 2WSYB 1RLIA 5ENZA 4BC0A 1E3JA 4LJ7A 1OBCA 2Z2XA 1ZU5A 2YI9A 1EZZA 2GM4A 2LP4Y 3TH5A 3R5HA 2GWHA 5K8IA 3DG9A 3Q6NA 1H8EG 1RRVA 5A05A 2ZXWC 3D7RA 2D7JA 2IPNA 4EB8A 3STLC 5CM2Z 5A7GA 3WHLA 2PLAA 4DVJA 1HORA 2FMIA 3N8IA 3N70A 2IIBA 3GT3A 4I9GA 4FFWA 1A2BA 1JQBA 4Z3KA 4Z7NB 4GNRA 5TC4A 3GD5A 2PHZA 2NP6A 4EH1A 3EXFB 3IELA 4TLEA 2IW1A 5LA6B 4I3FA 1J42A 2GCOA 1G8KA 3G3EA 1RQ7A 3E8MA 2JLYA 1KFCB 4XJXA 4MV9A 4F2WA 2B34A 1NV8A 3ESCA 3L7YA 1KI4A 1W5EA 2CL5A 3V4ZA 4Y1GA 3RKRA 3ZGOA 5EC1C 2FTKA 4BP8A 4WD3A 3IJEB 5JJEB 3FYEB 3ELYA 1V55B 1KMNA 4D81A 4QE7A 2DJIA 1GZ3A 5F33A 1SUDA 5JQGF 4KP7A 3EVBA 1EU1A 2E3CA 2BJHA 1F3LA 2XUFA 2EFJA 3HB1A 1ZM3A 4TXJA 3E48A 5AKLA 2C8JA 3I53A 4L8LA 5FB3A 4WK2B 2OZEA 5FFNA 1TGYA 1TZMA 5SY4A 1VLQA 2Q4PA 2JNWA 1L4NA 3SQLA 1JD1A 1ARZA 2GEJA 1XALA 1R6DA 1YH3A 2VRZA 2HL6A 3WAKA 5DHAA 2V9PA 1HEIA 4A8HA 1R2QA 3O38A 2QMHA 2YEVB 2XF8A 3KFXA 5HE9A 2WT9A 2IBTA 1Y7LA 3PPXA 1HQDA 5DI3A 3B48A 3V42A 5FNZA 3VHLB 1Q0HA 2A0FA 5AFSA 4RSGA 2JIOA 1AHNA 3O91A 1GR1A 1C9EA 1EQUA 1NYRA 3F78A 1UDAA 4Y6LA 3ON1A 3Q7RA 4HNVA 4XRRA 1CUBA 3R5TA 4RETA 2UZ1B 3KEGA 2UKDA 5HP7A 1PP9H 4BO0A 5DX1A 1AJPA 3RDPA 4Q1VA 4X64O 2F8MA 1J90A 4CDNA 1ODKA 1Q1GA 3KKEA 2HC9A 3HJGA 3NWPA 2A9HA 2ZCVA 1BJRE 3U1BA 3LC7O 4BBJA 2NT4A 3OAAD 3CCLV 2I91A 1EQAA 1OROA 1NR1A 4YBZA 3T3PB 1ZCJA 2ATVA 3FKJA 3T1VA 1CQIB 1Y7TA 4KXVA 4AQDA 3RBVA 3S1AB 1HK7A 4TPKA 3VM6A 5B2EA 1KGDA 1B6RA 4J16A 2GTSA 2AEEA 1M0EA 3M6IA 3HDQA 1L5OA 2HO5A 4LRUA 3RSSA 5B2ZA 4EVIA 1O4WA 1WZEA 4BO9A 2I62A 2GPAA 2Z4RA 2UV8A 1BMDA 4FS8A 2G88A 1BHJA 1QVWA 3CRCA 5FF9A 4TT3A 3KT3A 3HU3A 6ABPA 1BSVA 1J5XA 1QE5A 4R31A 3NGXA 3V55A 3N58A 1U0OC 2ZIGA 3SMVA 3V4FA 1MAUA 2RAFA 3CG6A 1KMMA 3FPCA 1PFUA 2V96A 4JYYA 4Y2PA 1DXOA 4LRQA 1TUEA 1AJQA 2MSKA 4RTOA 2LE0A 3NS7A 4U6QA 1THMA 2QU8A 3H5IA 5AI8A 3F67A 3VPAA 4Q6BA 4GX0A 4NL4H 5G4KB 3V8QA 4BRUA 3BF7A 3BWVA 4ID3A 4DV7B 5FOQA 2HZBA 1NXSA 4U5QA 4YT8A 3WPWA 3K0FA 1ZL2A 5LYJA 4ZYWA 2Q6OA 3AVYA 1FXKB 1U43A 2P7HA 2XQKA 4N3BA 1ISJA 1NLUA 5KLVH 2Z9BA 1XNJA 1HE4A 4TZ6A 1YTFB 4FQ8A 1W5BA 1J22A 2JJMA 2PLNA 2OGUA 5BVGB 4C30A 4ZCSA 1LCIA 1UK9A 2P0AA 1NTRA 3K1JA 2VJMB 4B6GA 1F12A 4Q9AA 4C5CA 1SKVA 1EBBA 1JQLB 4BFUA 1OFIA 2XUJA 4QBHA 1CUJA 2ATCA 4KOAA 3NH6A 3I32A 2A78A 2JAQA 5D1HA 1EKXA 3LX8A 4P4GA 5REQB 5DJ5A 4M9CA 4PA6A 1YF2A 4BKPA 2V6GA 2ZUDA 3WTCA 2OXEA 2OCCC 4W4LA 4JUBA 3WJ7A 3AF6A 4X24A 2PUBA 4ER5A 5I9SA 5IVIA 3U5TA 3TIFA 5B12A 3PG5A 2BHRA 1VCIA 1B3RA 3TSAA 3MJTA 1N33B 2HSEA 1P4AA 2CDAA 4NV3A 3DLTA 2C3MA 4LECA 4JIGA 3JZAA 2ZOVA 5I3CA 1G5HA 3NCHA 1NJ6A 5GTHZ 1S6YA 3VKUA 3PLRA 1VQ7F 5BSTA 1N2CB 5K6RA 4D74A 3IOEA 2FSSA 5G3ZA 1P5FA 3I0NA 3FI9A 5AM1A 4BFXA 1DK1A 3GLRA 1SA0A 3SHVA 1PNVA 4LFCO 3PHBE 3T7SA 2E6UX 4BY9D 5B7PA 3K0SA 3KQLA 3HCWA 2N04A 3IERA 1LTQA 4I1PA 5HXZA 4FE7A 2MINA 4KDEA 3LHFA 1SXHA 1PNRA 3HKBB 3T7DA 2V0NA 2NUAB 1W25A 1OWPA 3WAGA 1Z6PA 3C70A 4C0KA 4RPHA 3EFHA 4OBXA 2RGNA 1EBUA 3SEAA 4DXWA 2P2ZA 4GPTA 1O8CA 1JIVA 1P3Y1 2QW0X 2EKPA 3TLJA 4OX9Y 4FK8A 4Z54A 1BOOA 1BW9A 3KQMA 1CB7A 1E3LA 3RIEA 1PQYA 3KUUA 3WGYA 4CGYA 3OP1A 4D57A 3RS9A 2CFIA 3R3VA 2WZBA 5HPYB 2OTJF 1XMPA 1M1XB 3EXHB 3NB0A 3QXJA 4E2FA 1TT5A 3PVCA 3SHOA 2I7VA 5L3RA 2PRZA 2SNIE 1NN0A 2C82A 3OMNB 4JOCA 2RGGA 4KGVA 2CBGA 3SXUA 2UZ4A 1B8PA 1YDMA 3KAKA 3AHHA 4QNHB 4EKDA 3MJHA 3TRFA 1S9DA 2AHOA 2ZVDA 4NR0A 2P5TB 5BQOA 3UTCA 2XMPA 3EEQA 1K86A 3H4TA 2PMPA 4CDGA 2PR2A 3KDSE 5KEIA 1X38A 2JCVA 1Z13A 1DCFA 3IIIA 4BZWA 1M76A 1IEXA 2EC5A 4X97A 1AK1A 1WMBA 1E6MA 3HN2A 4PSKA 4DPMA 3DDWA 2XB6A 1GTSA 2R84A 1JDSA 3PQ6A 3WFVA 1N6LA 1YI1A 4KYVA 4XYMA 5EY5B 3HSSA 4LC9A 4ZDKA 1LEHA 4Q4HB 4WLEA 1Z36A 5IJXA 4D4GA 4N03A 3MBOA 4YAGA 3E9DA 5A4FS 3KWJA 3RK4A 2H18A 2XGSA 1UQRA 3Q12A 1NR5A 5ELXA 3IP1A 1M1KH 2FAXA 1JSLA 4M8IA 4RJIA 1V2GA 1JQJC 4TYNA 3UFBA 1T8WA 4LZZA 2OO5C 3DZDA 2GD1O 1VQOV 4TTAA 3EHBB 1HFEL 5JXWA 4MB2A 4WKNA 3L7MA 4A6PA 3DL0A 3L7AA 4L4SA 4NTWA 1B8OA 1TYCA 4JJIA 5FO0A 5HY1A 1ZX3A 4EYKA 1SCUB 3ZLUA 5IU6A 2GF0A 4NY1A 4X1IB 3L77A 4HLUC 1AVTA 1GCUA 1HT1E 1QRRA 5KTNA 1BS2A 2LGQA 3RRBA 1GZ7A 4KPUB 2JLWA 3IVCA 1OAKA 2XH8A 1AD2A 4G0NA 1FBTA 3H5VA 4CEHA 3Q2IA 4MS2A 3L0IB 4FX5A 2XAFA 1SQGA 1F2TB 5IW8A 5CK5A 2P9HA 3MUOA 3TL6A 4X0EA 1KY3A 4XVQA 4FBMA 3CN7A 4F04A 1VP3A 3OCXA 3ML1A 2ZI3A 2VQDA 2XCQA 3NALA 1TA9A 4JYBA 4CR7A 2WJ4A 4BIOA 1LPPA 4PR0A 4J1TC 2OBBA 2CH7A 2GRAA 1TVKB 4BP3A 4WFJA 4ZK2A 2EINC 1VB3A 2KYRA 1M1NA 2BF4A 1E4YA 2H59A 1A0OA 2K1EA 1RSOB 2ZJAA 3ADPA 3DAYA 3FBWA 3IILA 1MR3F 4ZV4A 3GPIA 2D59A 3W0LB 2FW8A 3CXUA 3X1KA 5B5SA 4BVJA 1IHOA 1Q7BA 5B2FA 4MEJA 3HR4A 1RP7A 3X2QC 3HM9A 2D0PB 1WVIA 2Y48A 3CH7A 2AG5A 2X9LA 5C1DA 2YJ6A 2VS0A 1F4PA 4QDJA 4IJ5A 1X9IA 2C3PA 3HO8A 1QDUA 2V3WA 2DT8A 4RELA 3NAQA 3C87A 4BQPA 2XNDA 4TXHA 4F5WA 3D81A 1KYVA 3LRTA 1NQAO 4II3A 3FN4A 3BQNB 4WY5A 1D8TA 1IIBA 5K3AA 5A4AA 1P1JA 1WEKA 3QHQA 1JBQA 1M33A 3O82A 4ALIA 3PE3A 4LZJA 3EXIA 3W1EA 1RLJA 1Y9DA 1R9JA 3EIOA 3TW8B 4L8FA 2GPTA 2PWAA 3MJRA 1TW2A 1E4EB 2FDXA 5FPSA 4GQIA 3QVGA 4KQ9A 1N0NA 1RMYA 4X60A 3B6KA 1TQ8A 2G5TA 2CB9A 3KDPA 2QVBA 2G8LA 3ZBUA 3C6XA 1M73E 2N0SA 3KQKA 2J9FB 2PXCA 5JCJD 3O4FA 3GEIA 2EKBA 3VNUA 2CNBA 1QNFA 3K0EA 5CT5A 3ST7A 5KKAA 2B2NA 3ZCSA 5BO5A 1GU0A 3RC3A 4WN3A 4K6KA 2J31A 1GDHA 4RK0A 5FWXB 1B0PA 3SSAA 1G6HA 1ZLXA 2I6TA 3NAGA 4CIVA 3DZGA 3ZU5A 3VH3A 5AWFC 3M1XA 5HQTA 1PR4A 2EV9A 5DF1A 4KO3S 1G3UA 3FR7A 2X9VA 3U3RA 3LSYA 3EG9A 4EUKA 2O8EA 3ICPA 1OHHD 5PNTA 1QGAA 2GGSA 1UEIA 3RANA 3KO8A 4FIPC 1P7ZA 4P31A 5ITZA 4F96A 3CRAA 1ZD4A 2V9CA 1Y9AA 2HNAA 2ZXWB 4FNGA 1HWYA 4W6QA 1G291 3USES 4FFBA 3UWPA 2GXAA 1X1EA 2Y1KA 3COPA 1L8AA 4ECEA 4ZVOA 1H8HD 1I10A 5E2BA 2C8VA 3X1YA 4AT1A 4DEVA 4KXFB 4RNDB 4J0FA 3ZGYA 5JJBA 4ALMA 1XK6A 3P19A 4HS9A 1NVKA 2XUAA 3GPCA 2O2YA 3HJUA 5BYAA 1H2GA 5DK4A 2R8ZA 4KH1A 4YMTA 5JWHA 3H1PA 1Q77A 3DUFA 2B4TO 4ZAZA 4OU5A 3STWA 3CLSC 1QIJA 1GNVA 3GJRA 3OEEG 5A1TA 3FNHA 2NPFA 3HKEB 1F4VA 1J2TA 4FHDA 1ZY2A 3I1FA 3RFUA 3K05A 4EJSB 2NZWA 1NY6A 3K1TA 4GQAA 4QQNA 5CLIA 3DLCA 5K0TA 3JWIA 1C0KA 2IFTA 4D3DA 3IOYA 3MJSA 5L7WA 4HTAA 5HF9A 3SBEA 4QC2A 4PD4F 3QELA 1NBME 1DAPA 1FU7A 5G1NA 1KE2A 1RYEA 1UI9A 4B6RA 2ZROA 3HR8A 4Z8YA 4FNMA 2OXCA 1XQVA 4N76A 4Q00A 1A88A 2JA2A 4Q1FA 5B3KA 4V24A 3AR5A 1SHLA 1T0JB 1MG0A 1VE7A 13PKA 1X7PA 3CZRA 1ZSYA 1NRIA 4QSMA 1WB4A 1R15A 1QU9A 1RE0A 4I50A 1TUGA 2JI6A 3ZHOA 4YYEA 4KR0A 4DR4B 3A05A 5IYZB 2K1SA 1UEJA 1AF7A 5CT9A 4R40A 4UZFA 4B83A 1WBDA 5FORA 2BEUA 2WTBA 5CA1A 3VVMA 3ADBA 1REQA 3VOTA 2JK0A 1CY6A 3Q3JB 4OIFA 1M2JA 4GSYA 2BVNA 3LUTB 2FHSA 3D8NA 1L5HA 1RLTA 2UYNA 3F8TA 1K4MA 3O94A 3DZHA 1SWWA 5TQVA 3OFSA 1TQHA 1Z2EA 3NIBA 3LWDA 1EP3B 1X42A 4U7GA 3AK3A 3DFFA 4R2KA 2ZITA 4QQFA 4ZI2A 3JQRA 4YASA 3DM5A 1PQ4A 1QHTA 2QLTA 5FBLB 4LF9B 2OUKA 3OX2A 2GZAA 2FPWA 4L28A 1XTTA 2XGMA 1XP8A 2V7QA 3RYHB 2YKGA 3FCOA 2EJ7A 1BIFA 3IA7A 3I3OA 4L51A 2GJKA 3E1GA 5C1BA 2P9YA 3PZBA 5AQ1A 2V7WA 4YYZA 1ZK0A 2PY5A 1AI6A 4DKJA 5EXXA 1SC6A 1D2DA 3K12A 3A3KA 4WKBA 3U3JA 1ZMOA 3PPYA 1FDTA 5B6IA 3M6UA 3QYPA 3CUYA 2ECQA 4QPNA 1LDYA 5CT4A 2EWCA 2C58A 1L4LA 3S4YA 4JI5O 3NBYC 2DY1A 4GKKO 2X8JA 2BH2A 4QBFA 3BGDA 1UOPA 4CMAA 5JS1A 1QMPA 2GEDA 1BN6A 3I56V 1NFFA 2AK3A 2CW5A 3M7IA 1U0BB 3NBQA 3VO8A 1E1NA 4QEKA 5DT2A 1N34B 1PG5A 4AWXA 5EINA 2IDZA 2W6ID 4EF5A 4LHEA 4QJFB 2BCGY 4DYHA 4C3UA 3KAQA 1CD5A 3DDSA 4HNSA 4I4NA 2AOTB 4B4DA 3WISA 3OECA 3I3SR 4N39A 2JFGA 1WXEA 5HIIA 4F8EA 3NZEA 3VR3A 3RVZA 3V4RA 1C1XA 4U8HA 1IZ0A 1JMYA 3PHCA 1OF1A 4M7OA 2Q3BA 1ZI8A 1AKYA 5LU9A 2VWGA 4I1VA 3KQVA 3H7IA 4YMIA 4PA4A 3OM3B 3GX1A 1NMZA 4V1CI 1AXRA 1Z0UA 1P80A 3GNTA 5FO1A 3S7ZA 4RTMA 5LQNA 3G5LA 5LLTA 3N28A 4OK5A 3ZLJA 3OE7D 4G4XA 3V7YA 3PNYA 3BT7A 4KDCA 4FHEA 1EHCA 1S3SA 5G53C 1Y3DE 4P2BA 1GAXA 4DARA 1MHTA 4Q1AA 1OI2A 1B26A 1YVWA 4YRSA 5DISB 4CM6A 4RV5A 2PH5A 1I4EB 4X65B 1JIQA 3NTOA 4PO9A 1GPAA 5EP3A 1QQAA 1UBGA 2V65A 3WWPA 4AXXA 1E2JA 1SBNE 1M2NA 5C37A 3OEYA 5K4AA 4YUVA 4FPXA 3VMMA 2AXPA 4EHNA 2XDWA 3MHSC 5K6AA 4N01A 2G76A 3DBIA 4I9QA 1FBNA 4FYIA 1P2SA 4EENA 5I7SA 1AKWA 2RBKA 1EE2A 1F2DA 3SBOA 1K33A 3UKMA 4GGPA 1Q6IA 1KQSF 1UKYA 1VYVA 1TMGE 1MAAA 2Y05A 3OOSA 3CNOA 5EIHA 3AVWA 1R8XA 1AI7A 3DMHA 1Z5UA 2VHVA 1FMTA 4F72A 2FPKA 4IIFA 1FS4A 1BNCA 1RQXA 4D1YA 3FYDA 3LM8A 3A2LA 1Z5NA 1AMNA 3LYHA 4UJ5A 3DMDA 5BSGA 3O2SB 4WERA 1ORVA 2XZDA 3B1KA 4MVCA 2UVQA 3U4QA 4PWTA 2YJ5A 3GEPA 2RHMA 5U9CA 5F2VO 4MKIA 2IHTA 3WA6A 5B58C 1GQ2A 1PX2A 3FTFA 5HIAA 1EXMA 2Z5GA 1PHPA 3RVRA 1CVRA 4C7JA 1EVJA 4CLHA 4UHCA 1YBHA 2I6DA 1HYHA 4AZWA 3IKJA 1J25A 1XPUA 2C57A 2YFKA 4GRDA 4KFTA 3WQSB 4GSKA 5HXUA 5GJVC 3W05A 1P5JA 3F4LA 3Q3GE 3ZO8A 3JWJA 4OMFG 3IBYA 2X3YA 5ALQA 3ITKA 2WPDG 5EKDA 2GN8A 3CKLA 1V55C 1Z7EA 5F4BA 3PIRA 3THYA 4W1SA 4AZVA 4EB3A 1LRKA 2HJDA 2R8YA 4BX3A 3ZY3A 3VKGA 1GV0A 3FUVA 3OZUA 1MNGA 1ZHFA 3SX4A 3TZBA 3JWPA 3LF1A 1MORA 4KR9A 5B3JC 5CDFA 3LRPA 1P91A 3YASA 2YWBA 3AFIA 3C1UA 1E96A 2ZSAA 5BR1A 3OMAB 5IDWA 4BT5A 3L7JA 2V03A 1RJDA 3IEKA 4IG4A 3IJRA 4X71A 3X2SA 4R8SA 2XUQA 1OFTA 4JJZA 2ZTUA 4H77A 1TCAA 3R3ZA 2MDTA 1MOPA 3OD5A 3AG2C 4NSNA 3DPSA 2BFNA 1FTYA 4ZA2A 4S3MA 5EG5A 2EHJA 4LQ4A 2DPGA 2IWRA 2O2ZA 1L5NA 1UPGA 2UYOA 3QKRA 4DT1B 2NU6A 3CZAA 4HGZA 4Q02A 3JR3A 1ORQC 1ELOA 3IDZA 1S3IA 4CEJB 3V5NA 3UJ3X 4FFDA 2I1VB 1XZEA 721PA 4QM7A 3SKXA 2O0KA 1VQ4V 1O96A 2I8AA 1T8SA 4LJRA 4MK4A 3IJPA 1Y48E 2B35A 4HDKA 4JI8O 3QE0A 5JI3E 3TZEA 1ONIA 1G8FA 1X6VA 4CF3A 3AR2A 5CLQA 1XMQB 3SLRA 1WB5A 2NTEA 4Q7MB 4QIWF 2VZ9A 4JYMA 3NYWA 3QNWA 2K2WA 3JZMA 2C9CA 3HWX1 3VTFA 2AS0A 3GRZA 3MN1A 1D1QA 4FZ1A 2OKGA 1JG3A 2NU8A 3F9CA 3ETJA 2VK4A 5C32A 1OCZC 3OPVA 4QAQA 2J3HA 1R4NA 2HJGA 2H5LA 2K87A 4UNRA 3OIFA 3G71F 4EFEA 1YHNA 2WF6A 2REQA 1KO5A 4BE7B 4ND7A 4WCFB 1QCDA 4L50A 3TS1A 3U7RA 4DV1O 1J8FA 4Q0MA 5JZMA 1B76A 1RM0A 2IXAA 1V4VA 3V9PA 1O9HA 1TYZA 4I0XB 1GQOA 2PPLA 4ZU6X 4V02A 3RSOA 3QU5A 4YDHB 1XKLA 4BNJA 3G02A 1RIIA 2I4NA 3RGWS 2FX2A 3ASVA 4FE3A 4INOA 1GRQA 3NTRA 3BGIA 4HQNA 2HHJA 3TVDA 1VKRA 3JSNA 4BQSA 2GPWA 4UUBA 1NC3A 5DK6A 3ER8A 3NOQA 4AJ4A 1PWEA 2HCFA 2LKDA 5LIPA 4QIHA 4KN5A 3EYAA 1OIWA 1D2GA 3DO8A 1B0UA 5IAJA 4YLEA 1VKZA 2EINB 5J4KA 1G19A 4XPZA 3PIDA 4JL5A 2LGJA 4CKBB 2W0MA 3ZVKA 3L49A 5CGZA 5MN5A 1QDEA 4KFSA 3LOQA 3BB1A 4JCOA 1A8IA 2WEKA 4DVGA 4AP6A 3G8BA 3IJ4A 1K8YB 4G5RA 3EB9A 2WAYA 1G7CA 1AS3A 2ATXA 4NYJQ 3TSWA 5CCBA 2Q9UA 4GQBA 1QU3A 4HYTA 4RPJA 2W22A 3LBYA 3MJDA 2XYRA 4I2NA 6PFKA 4U7JA 3O75A 1L5ZA 4FYWA 2AXTZ 1UC4B 3OBWA 5JS6A 1Y1SA 2UYPA 4GM1A 2DQ3A 2QL5A 2PT5A 3UH1A 3MJVA 4DBLC 2M1XA 1PNQA 1Q82H 1GA1A 3MAQA 1A2KC 4JT4A 4EHKA 1ESZA 4QUIA 2XDQB 4HUJA 4X66O 1GWNA 4A3SA 2XSZD 2HDNB 4YQFA 2XCTB 2VT6A 1XCBA 2OBYA 1V9CA 4KXRA 2EAUA 3GDHA 2PMDA 4U9UA 5IT9M 1FXWA 1JE1A 2W83A 4QNNA 4CKWB 2RI1A 4HTFB 1M57B 1U5BB 4FFNA 4N4AA 3VNQA 1VQ5V 5KTSA 2HGSA 1QOQB 3O85A 1CG6A 3H42B 3BDVA 2C7RA 3SR4A 3EIXA 1MABB 1BDIA 5GOTA 2WHPB 4BFYA 3CZCA 2CDCA 3E3OA 4R8RA 3VZDA 4FDMA 1R37A 3P2JA 2WW8A 4NOKA 1MIOA 1VHJA 1Q0RA 3MGGA 2G28A 5P21A 2CYAA 3RIHA 4YP0A 3IVMA 4BKQA 3K14A 4UB8Z 2ZGVA 2XT0A 1QK3A 4IUCS 4EA7A 3TETA 2XRMA 1Z0SA 4DW0A 1Q20A 3JWEA 4IFEA 5M29A 1ZL8A 2LIVA 4RM3A 3D3WB 3Q41A 4RHFA 1NMSA 2YMPA 3IDFA 3ZDZB 3PNSA 4BKOA 1SERA 2YC4C 4MLZA 1U0FA 3FSEA 3SWWA 2JJ1A 3S3TA 2ZVZA 1TJPB 1JG6A 1E9DA 3FRHA 1WCIB 3PJSK 3DOUA 3RAPR 3WK4A 2CJYA 5FTLA 1TNDA 4CU2A 4MKGA 2YN0A 1DJLA 4DXAA 2O52A 1W0JA 1VE3A 1PYGA 4Y6SA 2Q0AA 2C83A 4X1KA 4H7DA 2RN9A 1U7OA 1MC5A 1B15A 3B5IA 1NVXQ 4JZYA 5HDBB 4WXEA 4OYYA 1UJBA 3I5YA 3HI4A 5L4SA 1OV6A 1G2QA 4JC0A 2YBEA 3SF8B 5C31A 4YIKA 1DOHA 3MMSA 4DNOA 1BEEA 1ZQ1A 3HUDA 5FH9A 5L95A 3LWPC 3EXHC 3D36A 2DF8A 1NJ5A 4X92A 3RS5A 1DGQA 1AQYA 3L06A 3BMOA 1ZPDA 3Q8HA 1H2RS 4Q3EA 3L71H 3P96A 4OHZA 1SG9A 3E2IA 3MC1A 3N87A 2W6JA 3WJQA 3LC1O 1OZ0A 2RGBA 2VSOA 1I8TA 1XD9A 3R7DA 3MT9A 4RS3A 4YIPA 4S35A 2F64A 4IUDS 2XAQA 3FNFA 3LFTA 1I24A 4TQFA 2CK3A 2P78A 3SI7A 5GM1A 1HMPA 5IDQA 1PNMA 4QOEA 4B4OA 4WCDA 2G1UA 3LK6A 2X8LA 5A5VA 2PZMA 3MRVA 2AHYA 1MRNA 1OCCB 1E6LA 5JALA 5H9VA 4ZZ2A 4JITA 2X0FA 2PX4A 3A0RB 2NG1A 1H2NA 1V2HE 4PONA 3MWDA 3GCDA 1I0LA 3RG2A 5EN4A 2ZVQX 3RA5A 4CT4B 1W87A 2AUTA 3TTVA 1UC5B 1JKIA 4DUYO 1PQWA 2Z3WA 1JFFA 5E4JA 4BMPB 2A7WA 1PO7A 2IZ5A 3QA3E 4R1QA 1ECLA 3GVPA 2X4IA 4IF6A 5KYXA 2PLWA 4C20A 3IUEA 4Z1VA 3GZNA 3QOXA 1VP7A 3RE3A 4EL5A 2Y1CA 5ABPA 2QENA 4LJLA 2C4HA 4CQLA 4W8OA 1EDBA 2ZVJA 1EP9A 3CCUV 5BV8A 4FKZA 1Y5IA 2YMLA 4E31A 4IDNA 1KBHA 3AM1A 1T10A 4DHEA 5CDFE 4MVMA 1V8BA 3B2EE 4BN4A 1JJOA 5IZ4A 1EWYA 4FWTA 2WTXA 1HDEA 3V8RA 1EIZA 3SK0A 1MMFB 1U3GA 2FRDC 1ESMA 1LKZA 3LK7A 1I2ZA 2HS3A 2WP0A 4R1PA 3LP6A 1N1MA 1P0FA 2IDKA 3OTOO 1SOAA 5TQ2B 2WIBA 5BPFA 4NOJA 3SHTA 1HPLA 4M1TA 2PCLA 1LLUA 1VIDA 3U4HA 3W6ZA 5IAEA 1PJSA 3PT9A 3LBIA 3CRMA 2J0UA 3ZCQA 3EXEA 3H2SA 1EK0A 3LBHA 3I9V1 4IICA 4UEWA 4ENWA 4BNUA 1WDMA 3NEAA 1EGVB 1VIVA 4ZODA 2ADQB 3LMKA 1H3FA 1FU4A 1RW4A 3MD0A 1SZJG 4LCBA 2QTGA 4P84A 3O0TA 3K2QA 5K8LA 1BQ0A 4UVDA 3HJHA 1FS5A 3ZXXA 5DASA 2BPOA 4OV6B 4DMCA 5CG1A 3GLHA 4K8OA 3TW0A 1ATZA 2R4QA 2I80A 2VJYA 3PVZA 1KQFA 1RC8A 1ESEA 1OFUX 1VL5A 1H2XA 2QK4A 4Q18A 2J87A 6AT1A 5IASA 2RHTA 4CHTA 4ZO4A 1KJZA 1VOTA 2H6EA 1WOYA 2ZRAA 1UDBA 3H0KA 3DBVO 4BEVA 2GYVA 1X4TA 2FZ4A 1ZM7A 5C8VA 1JR9A 3PJEA 5KAFZ 2OILA 4FEGA 5I47A 4GOKA 1X0XA 3A4IA 1L7NA 4HMQA 1Y5RA 3WMRA 3V33A 2DG2A 2HFJA 1RD4A 3GR6A 4TS9A 3T0GA 2HRZA 3WZMA 4N5DA 4HN4B 1B8UA 3N1UA 3DBOB 4NWIA 4BN0A 4NPHA 3JRXA 1N2XA 4MVUA 1X7XA 4TYYA 4D5EA 1H5NA 2B8JA 2BJVA 1EH5A 2V8OA 5CJ2A 5IYZF 3EFBA 2GTPA 1JR6A 4JI7O 5IYBO 2YSUB 1ZJZA 1FL9A 2Q0QA 2XBMA 1CUYA 1FUUA 4FZJA 1RWWA 4KQXA 4F71A 1SXIA 4ZVKA 3TM4A 4LVNA 3CD6F 3D6HA 5JCOA 4G4SO 3CSXA 4IH4A 1FQWA 1XE3A 1KF0A 2EOAA