4ZHQB

Crystal structure of tubulin-stathmin-ttl-mmae complex
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 176
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zhqB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zhqB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zhqB01
4ZHQB 3WGKA 4XCQA 4B46A 5GONA 4U3JA 4EB6B 4DXDA 3JARA 3HKEB 4O4HB 2Q1YA 2XKBA 4KWEA 2BTQB 4O2BA 4TV9B 1W581 5LP6C 4O4IB 1TVKA 5EZYA 3JATA 5BMVA 3R4VA 5MN5A 4YJ3A 5JH7A 3E22B 4ZOLB 2R6R1 4DRXA 3RYHA 2GVIA 5KMGA 3JALB 5CA1B 1FSZA 5LXTA 5JQGA 3HKBB 4I4TB 4TUYB 4X1IA 5JVDB 5EIBD 1FFXA 4HNAA 4HNAB 1OFUA 3C8LA 3N2KA 3RB8A 4IIJA 3VOBA 5IYZA 5LYJA 3HKBA 3N2GB 3RYCA 3RYCB 5CA1A 3JALA 5CB4B 5IYZB 3HKCA 4IIJB 3VO9A 4ZOLA 1W59A 3E22A 5JH7B 5KX5B 2VAMA 5C8YB 4M8IA 1TVKB 5EZYB 5LXTB 3VPAA 2VAPA 3M89A 3RYFA 4F6RB 3RYHB 2RHHA 1TUBB 5LP6B 4U3JB 4EB6A 3WGLA 4B45A 5JCOA 3ZIDA 4ZHQA 4TV8B 3ZBPA 4O2AB 3VOAA 3HKDB 5MN4A 3JAKB 3JATB 4I50A 4O4IA 5BMVB 4TV9A 3UT5B 1W5FA 3UT5A 4LNUB 5EYPA 4X1YA 4O4LB 1RLUA 5J2UB 4LNUA 5J2TB 1W5EA 5ITZB 3JASA 3RYFB 4X20A 3WGJA 2BTOA 4YJ2B 4U39A 1Z5VA 5LA6B 3WGNA 5C8YA 3CB2A 2RHOA 1JFFB 3JAWA 4TV8A 5MN6A 4ZI7A 1TUBA 5LP6A 1RQ2A 4F6RA 5CB4A 1RQ7A 3VO8A 4FFBA 5IJ0A 5LOVB 1SA0B 3N2GA 3WGMA 5LYJB 4IHJA 4I55A 4X1KB 5CA0A 5KX5A 4X1KA 5CA0B 4I55B 3HKCB 5JVDA 4IHJB 4I4TA 4TUYA 4X1IB 5JQGB 2R751 4EI7A 4FFBB 5IJ0B 5LOVA 2RHJA 5KMGB 3V3TA 4DRXB 3N2KB 1FFXB 3JAWB 1JFFA 5JCOC 5LA6A 3ZBQA 1SA0A 2BTQA 4O2BB 2RHLA 3JASB 3HKEA 4O4HA 3JARB 4ZI7B 1Z5WA 4EI9A 4EI8A 5J2UA 5J2TA 5EIBC 2XKAA 4O4LA 4X1YB 4YJ3B 5EYPB 4O4JB 1W5AA 3RYIB 4WBNB 5FNVB 4YJ2A 3M8KA 4X20B 2Q1XA 5ITZA 2VAWA 4E6EA 5FNVA 5GONB 2VXYA 4I50B 3RYIA 4WBNA 3JAKA 4O4JA 5IJ9A 1W5BA 5M7EA 3HKDA 4O2AA 5IJ9B
chains in the Genus database with same CATH superfamily
4TPKA 1DIAA 1PWHA 1HDXA 5GONA 3RFUA 4BO3A 3NEJA 3OJOA 3EEBA 5C1PA 1GGJA 2O3QA 4BT7A 1ZA2A 6CHYA 2GLTA 3LKDA 3KZ1E 1OZAA 2RGWA 4ZV7A 2AMLA 2PXCA 3K31A 2FX2A 1M8FA 1PQ4A 3GVHA 3M49A 2EBFX 3R9XB 3CWQA 2FJ0A 5IUNC 3GTZA 1IXBA 1EZ1A 5AW5A 3G1TA 2XCLA 4PYQA 4XGNA 3CU5A 1V8ZA 1NI5A 1NBMG 2XYVA 1A5BB 1VQOF 1B0AA 3FFBA 1NXPA 3LDAA 3M6UA 2HU8A 2A5LA 1NW3A 3BD7A 5G0WA 2LO1A 3SC6A 3SZUA 3UMFA 4OLBA 2EHJA 3Q72A 2WSMA 4HNAA 2Y69C 1OFUA 4N0EA 1U1IA 1ZIDA 3ET5A 3U16A 4UXNA 2JDIA 1DRWA 4REQB 4OBEA 3ASOB 1NNLA 4MP8A 4WWHA 1W57A 1U0LA 4IH4A 4YRBA 5TPWA 1XQWA 4FYKA 4P22A 4H4DA 1LU9A 4BQOA 1NQVA 1JDNA 3J7TA 1C9NA 2Y1LA 1T26A 2Z5FA 3F2VA 4MKFA 2OPBA 1IE3A 2YINC 3JSNA 1TYBE 5EBWC 4AB1A 3AU8A 3V1NA 4C5CA 5KBYA 1UJ2A 2FUG6 3VBCA 1XNRO 1TLTA 2VRBA 3I6QA 2VUIB 4ZD6A 3DM5A 1LW7A 1MKYA 3C43A 1M0WA 1Q7BA 1KE2A 1PFQA 2P9BA 1A76A 1H6CA 4DM4A 4KQJA 4HGOA 4J9YB 1KK0A 1Q7EA 2XSZD 3BWEA 5K1XA 1U2EA 4E5KA 1OH6A 2JVIA 4OATA 2ZULA 4GMXA 4KQ9A 2BP7B 1V9LA 3VTIC 1I10A 5LQUA 4NUTA 3O3OB 1D5WA 3OZRA 1XD2B 3R8FA 3FOCA 2XAFA 1CR4A 2UUAO 4IMIB 4DCJA 4DIBA 3QX3A 4N03A 2FQWA 4LAFA 4B6RA 4C2BA 1L4FA 3ZXSA 3C3DA 1ZOIA 4EGCB 1KI6B 2E5FA 2JRCA 3ROXA 2VTKA 1PHPA 1XPRA 3T7RA 1DBRA 1N2OA 3LUCA 3PT5A 2BE3A 4QXQA 3NKFA 3LO5A 3I3FA 4ERHA 3PNPA 3NWBA 3AFMA 4I8IA 4MVXA 2YYYA 4MW9A 5F52A 2FWRA 4X1KA 5A3RA 1PJBA 2R44A 3QMMA 4NWOB 1A8SA 2VYFA 2R1TB 2JGMA 3BMXA 3FZGA 3HZZA 5A4JA 1R3LC 5JQGB 1WVGA 3GRAA 4ROTA 3HB3B 1UC9A 1K6XA 1G41A 2VJNA 1ZU5A 4O3FA 4RUKA 4ZI7F 1ZH0A 4D79A 4P32A 3SWWA 3PXEA 4ETMA 5BPFA 1Z7WA 2W90A 1YVRA 2WSSD 3EUEA 4XVHA 4KACA 1CDZA 1V45E 3VHXA 2X0DA 4WJLA 3UGJA 4EG8A 1MG0A 1PWXA 4V3CA 4WZAE 4PX3A 4UVBA 5DEOA 3QSYA 1LV8A 3ZDCA 4Y18A 4Q1VA 4RKWA 1UWCA 2W6NA 1UBLS 3O2QB 1W4LA 3SZRA 4YYZA 4G89A 4GAEA 2CLMB 4KE6A 4A0QA 4G5XA 1PF5A 2YXBA 3E9MA 5FA5A 5F3DA 3EWSA 4CV3A 2QBYA 1ESCA 3CUUA 2ZRIA 5B58T 2Y76A 1XZGA 1AZLA 1O8BA 1THGA 2OGSA 4KK4A 4OLJA 1ZC4A 3ZNOA 5DU2A 3VU3A 5BSFA 5KWEA 1NSTA 1UDCA 4BVQA 1MNAA 1N3YA 3EWNA 3AJ9A 3UOWA 4HDNB 4PFQA 3DD5A 1IWBB 1L7MA 4JLDA 3P9YA 1VZ3A 3O8DA 2CDCA 4YRFA 3KU1A 1D7OA 5KA5A 2BM1A 3LCVB 4W6ZA 1H5QA 1U2DA 2JDIG 4DR1O 3HFRA 5AW7A 4QNHB 1JXAA 5DW3A 5CCXA 3UPUA 4GKJB 3H5LA 1PYDA 2C4NA 2VP2A 3HO8A 3QWBA 4YV2A 2VCYA 3DOEA 1VJGA 2I5PO 2RHTA 1OTYA 4A6PA 3EZLA 3EDRA 1OBVA 4P54A 4CKXA 1YR1A 5JS6A 2EJ7A 5EAZA 4H1UA 4JKIA 1XF1A 4MIKA 3LVBA 1DLJA 1DKUA 4PAWA 3O4GA 3BJEA 1RWVA 2YN2A 2XUKA 4PI2A 1IATA 4YHHO 1WW8A 2HSZA 5AKGA 3RFXA 4CV0A 4C03A 1RXIA 3CUWA 2P9CA 1G6UA 1JR2A 2XGJA 4I6JA 3EC7A 1P9OA 2PBLA 2ZVPX 3MB5A 4JUBA 4J2HA 2V59A 1Y3IA 2PT6A 2ZJFA 4OF4A 3UYKA 1BMFG 3FTNA 3ELYA 1OCZC 1HGXA 5HG0A 121PA 1FSSA 3NDBB 1MRZA 3NUQA 1E6KA 1DBQA 4GDMA 4TXJA 5DNDA 1IBKB 4DR4O 3BMQA 2A5YB 1PNMA 1H2XA 1GN8A 4NV0A 4WCFA 2QTZA 4XQGA 4C7VA 1JHVA 2AFHE 3WRYC 3K04A 5ALNA 1QHHA 2EERA 3H1GA 3T5CA 4DQDA 2G1KA 4NVRA 1MBZA 2Z8XA 4FD2A 4ESOA 3ADCA 2JJ1G 4BRSA 4N47A 1IHYA 3EHBB 3HQ4O 4NWIA 4UAVA 3F46A 4TVSA 1VLZA 4GGOA 4MS1B 1CFZA 1DXYA 3AINA 3T7JA 3HP7A 1QU9A 1KDRA 2GAOA 2EP5A 1UBCA 3B3GA 2ORWA 4S0ZA 4ZXPA 2V7EA 3SSNA 3VU9B 5HZKA 4QUIA 1VLLA 1IL0A 4MA5A 1W41A 3MZ0A 1TF5A 4KLRA 1CQJA 2Z58A 3I1FA 3N9IA 5E0KB 2HX0A 3RYFB 1U9CA 3B6JA 3DP7A 5ELMA 3F6MA 4WFIA 3RTCA 4CUKA 5LQSA 1D1TA 2C3MA 2QWXA 3QMWA 1ZUD1 3AW8A 3LYUA 4GNKA 1WJZA 5EE1A 2CF6A 3MN1A 4GP6A 1PR2A 2J6BA 2E5LO 2V5VA 1MX3A 3O74A 1BHJA 2P2NA 3RVRA 4E7PA 3F7NA 4RMJA 3PA8A 2Q2QA 2CUTA 5IJ0A 1J23A 1SVOA 4U5QA 4WJKB 1JKXA 1Z5GA 3BGVA 4DW8A 2XZPA 3KP1A 4LJKA 3I04A 4MV7A 4PONA 3DHVA 2R47A 2BLLA 3T06B 3D54D 1NLUA 1RHMA 1ZLXA 2AG6A 4FYIA 1PW5A 4J3JA 4LOIA 4MW7A 4E12A 3I5UA 2WRZA 2WAOA 4YFYA 2SHKA 4GMKA 1ACJA 1N2HA 2R8YA 4PPQA 4F72A 1JA1A 2RHJA 5DP2A 1MB4A 1NURA 1OF1A 2JGDB 3F0GA 1S8OA 4OJKA 3P96A 3KOZA 1Y34E 5J2TF 3ZLTA 2IYFA 3H7IA 4RETA 4RK5A 1F17A 4DQUA 2XVMA 5HSGA 3Q9LA 2RHLA 5KCMA 4PELA 4LN1A 4NZPA 4C88A 2YC0A 3OFND 4BLTA 5K01A 1EQUA 1JQ3A 1QBKC 4Q1EA 2GN1A 2P3QA 3F3KA 4MMXB 1E62A 4UUMA 1SRQA 1ZGJA 3VH3A 4MVMA 1GITA 1K8QA 1VL2A 1CY7A 1XVLA 1Z17A 2NAFA 2OZEA 4JXJA 4RZHA 2Z43A 4GPZA 3DGEC 1VSUA 2DBZA 5AKHA 1TRHA 2A9HA 5I8ZA 5IX8A 2XIJA 4KWIA 9ABPA 1VP3A 3H5TA 2B3TA 5DTEA 5GJVC 4DQVA 3IMKA 1U0SY 4U1RA 4MVJA 1P6UA 2RFLA 1OBOA 5AYVA 2V1DA 1TZMA 3A6EA 1YZBA 1TQDA 1G0OA 2ZLBA 4G5YA 1VM6A 3BY6A 1CUCA 3RE1A 2EIHA 3SIPA 4CTJA 5L3CA 1FRFS 1UP4A 3CVJA 3CW8X 5BMVA 1EUCA 1KI7A 2ZIEA 4BMZA 4DA6A 1V3VA 1KECA 3FAVA 1Y80A 4RPJA 3U80A 5JS8A 3V4RA 3BGOS 1V8OA 4CIAA 1ND5A 3JWGA 4CG2A 4F4JA 1YS2X 2GUWA 4GBED 1N3BA 1XRMA 5EC8A 1QKJA 5H1YA 2O3SA 1VE1A 3O03A 2W8BC 1JI0A 2GSWA 2Q8QA 1RR6A 1VYVA 3A6DA 4RFSA 3RIXA 4DIKA 2BRUC 1YCHA 3VGJA 4DQ0A 2NU9A 3MDSA 1B1CA 4PA7A 1H2YA 1US8B 2FH5B 2OTMA 1FJGO 2KKWA 4H4CA 4YUWA 1BWQA 1GGKA 3ZJTA 3LMKA 3LUFA 1Z2OX 3CCSV 1N6NA 1NXWA 1ZD2P 2FPSA 2GO1A 1QHIA 2PZMA 3DEYX 5EKSA 4AK9A 4QIWF 3RJZA 1H0HA 2HF2A 5D86A 4B5KA 3F3SA 4FQ5A 4JQCA 3O94A 4CTNA 5H68A 4TL6A 1R0YA 4B6QA 4MYCA 1WY5A 1RSZA 2I4MA 2H1LA 2OY0A 3FCSB 5AVJA 4K7JA 1N6OA 3I09A 2CZWA 2GH1A 3G8AA 3A58B 4DMMA 1GFIA 2H65A 5IAOA 5ALEA 2RD2A 3LUJA 2OCAA 3RG2A 2HH9A 5IVDA 2IRWA 1C8BA 4TTRA 4HAUA 4YXWA 4BE7B 4B3SB 3H6HA 3QWFA 1X1AA 1OI7A 4REMA 2NZWA 2AFIE 1MFZA 3BIJA 4OB7A 4HNQA 3U4QA 2ZSFA 2JEXA 1EDEA 1CY2A 1KYWA 2MSCB 2XEDA 3IA2A 4ER3A 4GI2A 4Z3OA 1K8ZB 3SEAA 4H0LB 3FDZB 2J3MA 1G4HA 1NW6A 2MMGA 3HJAA 3X1ZA 2YXLA 2E85A 1X7YA 4UNPA 3ETNA 4PSKA 3S2YA 1Z08A 1P1HA 4B35A 4BMYA 2YIBA 1XZQA 1NQ3A 1IJFA 3JASA 3UT0A 1NF8A 3RKRA 1ZTEA 5JEEA 4RCVA 2QQ5A 1FK8A 3TLAA 4M9CA 5FP0A 4UM9B 4BZZA 3ADPA 5HRUA 1ONOA 3IKLA 1C3OA 3TTXA 4JXZA 4X94A 2RCYA 1HYBA 2ZRAA 1GAJA 4IOLA 4DJJA 2V1UA 3TLGB 1JN0A 1KZ4A 3VXKA 1GRNA 2C88A 3SXJA 5T6MA 2QRVB 1AB6A 1XTBA 1XYVA 2A9OA 2AYXA 3RUIA 1YJ9V 1L7AA 5ESXA 4C76A 1E8DA 2HNKA 1S2DA 1KXJA 3KTDA 4D97A 3I61A 1IWPB 1XMXA 3PUHA 4UHKA 1L5GB 4LC9A 1E1QD 1AY0A 2H8KA 3A14A 4MUHA 1D2RA 2PLRA 1XMQO 5LOVA 1TKCA 1HNZO 5LUAA 4W63A 5T4EA 1Q3EA 3DAFA 4OGKA 1XTVA 4HLQB 4MRMA 3RVLA 4J29A 4YRSA 3QE3A 2YXDA 2J0VA 1P2UA 1W4AA 2W4MA 4N12A 5BN5A 3VKGA 4O4JF 5GVSA 3C9UA 1M1ZA 5ECWA 1IBMB 3SGLA 1DX4A 2X4DA 4NX2A 1IHPA 3ONEA 3EA5A 1GZ3A 5FOTA 4N40A 3GQBA 3F6YA 5KNBA 2C9DA 3O0TA 4NBSA 4TMFA 1JXMA 3PJGA 5JFGA 3UPDA 4J6EA 1SKVA 4CCAA 2O48X 3H17A 1IV4A 2XXJA 3QF4B 1XVAA 4RIGA 4MUKA 1M6YA 4ACBA 4YUXA 1JJFA 3DMHA 1KSHA 1ISPA 2VPIA 2ZWVA 1PFUA 4KZPA 5DNAA 1DMRA 1Q16A 2BEWA 4Q6WA 4IHQA 2PUAA 1GPH1 3HNOA 3TCNA 3HRHA 1TL7C 4L8LA 5AW9A 5JJIA 2RQ6A 1GG2A 1TA4A 2P9ZA 4UDYX 5M34A 2H1FA 5HY1A 3DQZA 4LXQA 4XA8A 5C8ZA 1N9GA 2RJOA 4UU0A 3T9BA 2YJ6A 4EGAA 5AG2A 4ZEWA 1RZRD 4JI1B 2I78A 2DUUA 2HQBA 3EZ6A 1PVDA 4YDRA 5TGZA 4K9PA 3RF6A 3EPHA 4K3AA 2QM3A 1UFIA 1CP3A 1L8AA 2YZGA 4PRZA 4FDUA 5HOQA 4FTWA 2PMFA 1XEWY 1RM0A 2YQZA 2R1TA 3V2HA 4INOA 4JKOA 4QQ8A 3SEQA 4CCSA 1GXSA 4F04A 4WVFA 1NU8A 3DP9A 4Z8YA 4Z6KA 4Q1CA 1BMFA 3EC2A 1P2FA 4MQBA 4YQYA 4KIWA 3VH1A 1HO3A 2V6GA 4HKTA 4WNAB 3FSGA 4JEUA 1US8A 1PJ8A 3ZQJA 2WW8A 2D1SA 1J99A 3E22A 4TX1A 3IAYA 1ICIA 1N5DA 2XAUA 2ES4A 4XRGA 2WIDA 4MAAA 1DEKA 1IIBA 1TF7A 4BP3A 3A4TA 4XX0A 2LWIA 2ZTSA 4UNRA 4RQOA 2O5CA 3CCUV 5THKA 2CE4A 2NSLA 5FTNA 1PJSA 2OTCA 4A3SA 2IT1A 3L6DA 5D2CA 1SM4A 3E3NA 2G67A 5ICSA 4AJ9A 3USES 1N2CB 2C2GA 3H4IA 2Y27A 2UU9B 4YR9A 3WIDA 5DM70 4W5OA 4JC8A 5HS6A 3T5DA 3WIEA 1K27A 1IUPA 1TNDA 2XF8A 3I1IA 4H60A 3SBDA 5CFNA 3G0OA 1ZXLA 1H48A 1CQXA 4PCAA 1SG6A 2XTMA 1G20B 4FFDA 3UGQA 1SUBA 4PJ0Z 2ZCJA 4K8RB 4RA9A 3NC1C 2YIBD 5LUBA 4CJXA 4RTLA 3HA7A 3R3UA 1AGXA 5KQRA 1Z75A 3MBOA 3HV2A 2RG1A 1JVMA 3A9VA 3L0OA 4FDTA 5EG5A 1V3QE 2ECKA 2Q2NA 2R68A 3VPBA 4D9EA 2HRYA 4HAZA 1ISMA 5ALVA 4KLCA 2XHZA 4BT5A 3KCQA 3P2IA 4EZBA 5TY0A 2X58A 1QK4A 1I6KA 2D5CA 1I13A 2DULA 5ALHA 3MBMA 2BEVA 2IOYA 3PHIA 3WK7A 5EZSA 1YS6A 1XELA 3I4CA 3L7JA 4G0ZA 3ZLUA 1FVOA 3RC2A 1BRTA 2Y92A 2RCVA 4S0XA 4PYIA 2WAMA 5JLJA 2ZAOA 1JWAB 5AJTA 1R10A 1QYDA 2ZQYA 4NJMA 4C05A 4M98A 1TMKA 4BVRA 2B8NA 2DYRC 1MR3F 2XQFA 4A15A 2R751 4G2NA 1ODEA 2JEOA 5CJJA 2PUBA 2O0HA 1VFPA 2W2QA 2WOJA 1N0NA 3PJSK 4LJ7A 6ADHA 1QU2A 1AU9A 2RONA 4GQBA 5TX7A 1ULHA 1WWKA 1Y67A 4TYPA 5F7JA 1HQKA 4OIMA 1TM3E 5EWLA 4BTVA 4A0RA 2NZ8A 4LWQA 2W11A 4ZKDA 4TXHA 1XPUA 4BT6A 2OQ2A 1SXJD 4FZ5A 4O2BB 1FD9A 1WXGA 4FFKA 4XWTA 1DUIA 1CUFA 3DC5A 4MTOA 3ECSA 1BSMA 3CQ9A 5GQSA 1YHQF 4FBGA 1AKEA 3BEDA 4WLUA 2FN3A 2HJHA 2JFQA 2A57A 1JJOA 3IUJA 1VTKA 3TZ6A 2BMFA 4ZYXA 5ALLA 1F7UA 1H2ZA 2V74B 4UPDA 1EEHA 3TFOA 3U0ZA 2YWCA 5CDFE 1O8CA 2FZVA 4W8GA 1T3SA 5J4VA 4TZKA 5K5EA 4MSWC 2EZ9A 4PEVA 2ASVA 3ZX6A 2Q46A 3KVOA 3PJRA 3A6PC 2I2AA 1XBLA 3F6BX 3JZFA 3G4SV 2IYXA 4G9GA 4B31A 1TJYA 2HMWA 5T8KC 1RCUA 3IAFA 4UB6Z 1CW2B 1R15A 1XXHB 1EPUA 2V4UA 3I0MA 1TXGA 3OO0A 1L8OA 4M0EA 1NUPA 5K0EA 3TF5A 5FORA 4GC9A 2HBRA 1QG6A 4L5AA 4CT5A 821PA 5KYGA 2P4UA 1X1RA 2YVLA 1VJ1A 2C96A 3VJLA 3WNVA 5FEUA 1VQ7F 1GG5A 4D8YA 4XQ9A 2OCGA 3HXTA 221PA 1IJKA 4Q6BA 1QO7A 3IDZA 4CM5A 4QJ3A 1KQ3A 1NI4A 5BNWA 2GLXA 4FZRA 1T1IA 4H7HA 5IVIA 3TX2A 1X77A 4BX3A 2FZLA 2H2HA 1E77A 2XUHA 3DB2A 1GJRA 2FSUA 2FFRA 3AY7A 3KDPA 4LVUA 2QRVA 3A1WA 3I32A 1XQXA 2QT0A 1YWGO 3FSRA 2CXSA 3T7KA 4QQFA 4FFNA 3WB1A 3Q40A 1T8RA 4H13B 2FMKA 3MJHA 5JANA 2XDYA 4FOPA 1QYCA 2DUNA 2OFOA 1OI2A 4PN3A 4EVQA 5LU8A 1OBHA 3C5VA 3BRSA 2KLBA 1I2BA 3NX4A 4MI9A 1DKOA 1R50A 2G72A 2QLTA 4ON9A 1WE2A 3MCZA 2UYKA 2FWJA 2H8CA 4D81A 4BAZA 1NMUB 2BGUA 3FNIA 3L2OB 3JZDA 2N75A 1RLUA 4OV6B 3UN1A 3DHWC 2CGOA 4FJ2A 3NDJA 2OMKA 2D8AA 3BC1A 4JUAA 1L3CA 3OMIB 4JXKA 4OI2A 4QPDA 4YFVA 4EEKA 4X3MA 1XFAA 3O1IC 2HQSA 3TH5A 4LXHA 4PLCA 3ND9A 4F2HA 1OAKA 1P62B 4WPGA 3VPSA 3VO8A 3F6PA 3STLC 2XKJE 2QQEA 4JGBA 2B4YA 4MUEA 3E2MA 2NG1A 3PHBE 4JLWA 3CY6A 5IDVA 3HXKA 4RTPA 2QGZA 2IDMA 3HTNA 5LMNO 3AQIA 2AOUA 5HKKD 4NP6A 2P2CA 3RAGA 1IYZA 4P84A 2G88A 5A4DA 5A2QN 2G06A 3E05A 3Q1KA 1AT1A 1N2JA 5HUJA 3WXMA 2QJRA 5DLDA 4BGVA 4A2QA 4F92B 4IXDA 5HJ7A 2ZM6O 1PL8A 2EP8A 4LFBO 2VYCA 5T57A 3FZQA 1G6HA 4J3NA 1B73A 3SQDA 1GXSB 2H06A 2CD7A 4PV1B 5BPHA 1MA1A 2B4RO 4AJKA 5I7RA 3RC7A 1Q86H 2BMVA 1Y89A 3JYHA 1GRJA 2DF8A 1A88A 2PD6A 4NAHA 1Z2NX 1E2NA 2AUNA 1HNNA 1T8WA 1D4ZA 1CETA 5JCPA 3D1JA 4DC1A 4WF9V 1K5DA 1QGUA 4U2EA 1SHUX 2GGSA 3AIOA 1TLFA 4QE7A 4OHBA 4OJNA 3T6KA 1K98A 3DV2A 3W04A 2PUJA 2Z6QA 3NATA 3PLNA 4BNIA 1WB6A 2D0OB 3C70A 3I2JA 2PIDA 3NGXA 2A9PA 2ZBEA 3PYMA 1QCYA 1EGQA 3N7AA 3K73O 2AC7A 1QFMA 2XBMA 1P17A 2C2WA 3H8JA 3KK0A 4JLVA 4QBGB 1PRYA 5TRTA 2JIZG 2EXXA 2ENUA 3G0GA 3SYKA 4DZTA 4RVNA 1E2HA 4GOOD 2YWEA 1ITZA 3KKZA 4JP8A 2DWPA 4IKPA 4WGGA 4YDHB 4IEEA 4M49A 5ADVA 3IQFA 3L43A 4QA9A 1LS1A 2A5GA 2ID4A 2JZNA 4EJSB 5CNMA 3VAAA 5JCZA 3KM0A 4R6ZA 4BZQA 1L8LA 1CZKA 3HE3A 3PHLA 5GJBA 2APJA 1X1CA 2FPPB 3GLKA 1U81A 4DRXA 3H05A 3E8MA 3ZUGA 3COJA 5EB1B 2EGHA 5EQJB 3OJEA 1PNRA 3S68A 2GJ9A 4HCJA 4X8OA 4NTXA 1T0IA 1MABB 2XDWA 2ZUWA 2QW0X 3VSAA 1UKZA 1R6NA 3RAEC 4I36A 1ZOOA 4QTZA 2QUAA 2F1IA 2AA3A 2BBSA 1FLNA 2PKEA 1VK3A 3O75A 5ALRA 4O4LF 2YZMA 5B6IA 4M9RA 3IJPA 1ULSA 4RY8A 1XQ8A 4ICIA 3BPSA 3IO5A 3CKLA 2IZ0A 1AUQA 3QPCA 4P2GA 1ZKDA 1YDEA 2GZ1A 4L5JA 3COYA 1XHEA 2X14A 5CP8A 4W9RA 3M9WA 3BGSA 4NMWA 2CXXA 4Y1RB 1Q0LA 3WVNA 5D84A 3C8ZA 4WIAA 2JLSA 1K9MH 3BZWA 4Q37A 5E6SB 5ISMA 4K0RA 1K75A 4RTRA 2ODEA 2DB3A 2JIMA 1OT5A 2YFKA 5DYGA 2NUAB 4J7CA 4TSFA 1Z2DA 4ENPA 2OB2A 1DKNA 5DK4A 4RZ3A 4B9EA 2YH2A 4KPUB 4QNMA 1GYPA 3UAOA 5HUHA 5KYKA 2QTFA 3EBLA 3GR6A 4GPTA 1Y6GA 3GLUA 3W9SA 2I0FA 5J1SB 2C78A 2WNIA 3EOBI 4LBYA 4M9XA 5THXA 5EIFA 2QAJA 1V7QA 2XUOA 4MAMA 3DEHA 2P22C 3H1EA 2AFHA 3AG2C 5FO0A 2Q6IA 5JARA 1YR6A 2WF5A 4NPCA 3VR2D 5GZ6A 3CXCF 1L5KA 2XAQA 1U63A 3FPIA 1GL9B 2PUHA 4FKZA 3N7TA 4GVLA 2IIBA 2UAGA 5KOIA 2C4MA 4F86A 1GL3A 5I9NA 4GR4A 2QN3A 5E1BA 3TOCA 1LK7A 3FMFA 4HB0A 1HYEA 4QREA 4LRWA 1YA4A 2QLMA 4S2EA 4PD4F 1BU8A 1USIA 4BFLA 2XQJA 4US0R 3GLIA 2EL7A 4Q9LA 4PNPA 1YITV 2XZOA 2HTEA 2HPZA 3OUSA 2VJAA 2XECA 2ZQMA 3PEYA 1JE0A 2ZR3A 1TUGA 1HV8A 2R25B 5EWLB 3W3AH 3WGIA 3ZIAG 5ALUA 1YB6A 3W05A 3LZ6A 1FRZA 3F4KA 2FXVA 3ICCA 4HJRA 3LBYA 1K9VF 3OJCA 3CCMV 1PT7A 3WI7A 4D74A 1WR8A 1ZAYA 1J56A 2R6HA 4P33A 1ECCA 4XEHA 2OIGA 3F7YC 3FD8A 3WWEA 1QB7A 3O3CA 4ZZ1A 4NZZA 4BWFB 1TMOA 4FD3A 3S0HA 3Q4HB 3T1CA 1KAEA 1XU7A 3QPWA 5K1PA 1TCCA 4UUNA 1NI8A 2H4FA 4DBVO 4HUQB 2YC2C 1A4UA 2BTQA 1VJDA 4OQPA 3WLJA 4CS4A 4HDKA 4HPXB 1VI2A 5DBIA 1NYLA 3X2QC 2UUBO 1MC1A 2PMWB 4R7GA 4PLHA 1O77A 1ARZA 4WN9B 3ZIAD 1JJBA 2ZM5A 2W93A 4C7KA 2GM5A 2EILB 2WLHA 4JGIA 4KKXB 2WTAA 2HAEA 2F1OA 3CCQV 2C3YA 2N04A 3ON5A 4AO6A 4EMUA 2DMXA 3JWJA 1G8GA 1EHCA 3CF4G 4YV1A 2XYHA 3TLZA 3UYLA 3T3HA 2D3OW 1I7SB 5IDWA 5BT9A 2YFQA 1FX0A 3GEPA 3UOAB 2QK4A 5HKAA 1UT5A 1Z0AA 4PBTA 1F4VA 1BZYA 3LRPA 3RNOA 3K94A 2XF2A 1ZC3A 3BRWD 3HO6A 1I0IA 2B4KA 4A91A 2WIGA 2XTNA 5KYUB 2UYJA 1G7SA 1F12A 3ZN1A 1P7WA 2Z6AA 1TIPA 5BY1A 2NVBA 4D4JA 1FVXA 4L74A 5KNCA 4B40A 1AK2A 2Y1XA 1MO4A 3EJ6A 4LJ9A 4ZCLA 5BNFA 3FBAA 3NWEA 2I3BA 1P0FA 4B4DA 4C0LA 1Q86W 3AF3A 3ZCCA 3H84A 1KMIZ 2PGNA 4I5EA 5LNK1 1QAHA 1QGYA 2E6UX 4A8JB 1FFXA 1GZHB 2VYVA 1JILA 3TTVA 1SCQA 2GETA 3H5AA 1XZEA 5AJXA 4MUAA 4RIHA 1EVEA 2MYPA 3GJ3A 1ZH6A 2G76A 3ER6A 3OJLA 4ZU6X 4YTEA 1Z83A 2WC1A 5COBA 5BYAA 4MGZR 4HTFB 4AQYB 4FHCA 4E21A 3BPZA 5AW1A 1U80A 2WAYA 2HG5C 2OHIA 4L4UA 4TN1A 3U0VA 3BSYA 1RI4A 1NVMB 2O7VA 1YKSA 2LCFA 1V4VA 1BQ0A 4V39A 4RNDB 3TQTA 5JY6A 1BROA 3OZUA 1WB8A 4XBFA 2XR1A 1YQTA 4TSFD 2IODA 4QQNA 4ZEXA 3LTNC 1UFOA 2ZTUA 3DAPA 4MKRA 4E5NA 5IT5A 4NOJA 4QBIA 1J21A 1MV8A 3A6HA 3HWX1 4TZ0A 1CV2A 4PPYA 1UJMA 2CLDX 3ESZA 4QFMA 5E38A 4XYLA 3IV9A 3ZHQA 2HM7A 3HR7A 4B3JA 3O92A 1COZA 3G71F 3VR2A 4B7CA 1QHEA 5LZ4A 3JPYA 2Z1NA 4B3GA 3I92A 4FNAA 4GXNA 4DV2B 2HSGA 4D0SA 4N41A 1NQTA 1ENOA 2FCAA 3M2TA 3O8OB 1F9AA 3WGNA 1K0FA 3LWOC 2WD9A 1E9EA 4Y2RA 5G0UA 2AS0A 1QKIA 4LHEA 3WGZA 3Q7SA 2IV7A 4J6FA 3AR6A 4N7JA 1ZGGA 1QVZA 2M6KA 1ADJA 1G7RA 2VJLA 2W8BA 4G4SP 2PLAA 5HFNA 2BZ0A 2PUSA 5B2FA 3GNQA 1GPBA 1PVOA 2VHVA 2VDOB 5AVRA 1R2QA 2VHYA 4FEAA 4MP3A 3LMEA 4GP7A 3C3SA 3KT6A 1BSVA 2I6QA 4LI0A 1S9HA 2VUTA 4M9QA 5CURA 1WUKS 3GRKA 3NZEA 5EVJA 3TL3A 2PGAA 3GGCA 5FI3A 4KFUA 2ATVA 2BFBB 4RVDA 1TT5A 4B6GA 5ESWA 3DR5A 1IDSA 3VQXA 4DRXB 2GI4A 1J5EO 4X9QA 1XDSA 2QVZX 3OAAG 2QN9A 2ZWAA 5JO0A 2P6PA 1F9EA 4OEHA 3FWKA 3DYIA 3L7YA 3COVA 3ECAA 2ZJ7A 1FXVA 1E6LA 4BRWA 2UVDA 3KQUA 5DEDA 1RRGA 5EHIA 3W6OA 5IARA 4EUNA 3CXHF 2I6XA 2D0DA 5EIAA 4XUEA 4BZWA 2ZVJA 3P9PA 1XVVA 4KXXA 5AOBA 3NBMA 2BE7A 1GMGA 4LVCA 2Q3HA 3VI3B 2OCXA 2CUKA 5BSUA 4LF5O 3OVMA 1FTYA 4FNMA 2IV3A 1IV2A 1FRQA 3LP6A 2DUWA 4XDLA 4HAXA 4RIIA 3IEVA 4RTKA 2R1ZA 4GLOA 2R96A 2DFNA 1YEWA 4IHKA 4RF3A 2IH1C 2XMQA 1ZJ6A 4ZC1A 4CR7A 1E5VA 3TMAA 2F23A 3T80A 1ADCA 3I5MA 4DLKA 3VI4B 2II6A 2O8FB 4AURA 2Q1YA 3IEIA 1VQVA 1CJKC 4KL8S 4NH0A 3GEEA 3IYLW 1PQUA 2NXNA 4D9MA 3IKMB 1T0HB 2PD3A 4BN4A 1YRYE 2XA1A 1E1QG 4BVFA 2BUCA 421PA 2BSAA 3QRWA 2IEZA 5DHTA 2D74A 4MR8A 4RV9A 3AUAA 2NTNA 4H3KB 2C98A 1VJ5A 3QLVC 1W1UA 3TQQA 3KV1A 1SVIA 1JRLA 1C1YA 1ZG3A 4QRHA 4X92A 4OOFA 4OFXA 3DBLA 3P10A 3V7QA 3PQ7A 4WY5A 5FA8A 5JR3A 3I39X 3CCEV 3GLFE 3U61B 1KS2A 3TAHA 1YI2F 3MCQA 2FEMA 3C48A 3PQFA 2FPRA 3MQ2A 1N8RW 5BP7A 2QPLA 1P1BA 3VPCA 1I2MA 3IEKA 1Q81H 1HEIA 2OAGA 5C8DA 4JQSA 4NCJA 1OZGA 2MSWA 3A28A 1JPNA 2JA1A 4J4BA 3GLIB 4FE7A 4PZUA 3O73A 3OEHG 4KE8A 1H8EG 5GZ3A 2PCJA 2Q41A 1D2MA 3DBHA 4MIOA 4DA0A 2H48A 3DOFA 1U96A 4FLUA 2YS6A 1SUIA 4LGVA 1E1CA 3GFBA 5IW8A 4KLZA 4BDSA 5SZHB 4CEIB 4NXMO 3VKFA 1AJQA 4ZYYA 2PANA 5JCOA 2X7JA 3B52X 3HR4A 4R1OA 5DNEA 5HR5A 2ZZMA 5A7HA 1NBWB 4UAGA 1PR0A 2EKDA 2J4DA 2JK1A 2PXHA 3P0JA 2BT4A 3ZBUA 4DV1O 1NVPD 2P6MA 4X6LA 1X13A 2M2IA 3NEAA 5B3JA 1R1MA 1YKGA 3U1TA 1HZZC 2AJCA 5FPYA 2XNDA 2QZJA 3DFZA 3X2EA 3GGGA 3IL2A 2ZIGA 2DYSC 2VXBA 5LBIA 4I4IA 2EF0A 4RPGA 2XYRA 3RC1A 5FPKA 4M1WA 3CC2V 3HDQA 2H2GA 3QOWA 1IEXA 2PZEA 5LA6B 1IB6A 5CVVA 5BYBA 3ZU2A 4D42A 1W0CA 1ZCJA 1YZYA 5DNYB 4FMDF 3DDCA 3GT7A 4I55F 5KTNA 3SGIA 2ODTX 3GRPA 5LVAA 2J7PD 2NSJA 1GTVA 4Q9AA 3IA7A 4DYVA 2MIIA 3QVTA 4OUKX 3UM9A 3ZDXB 4FW8A 3Q4HA 4GPAA 4P9OA 4B48A 1PLJA 1Q6UA 3ZVNA 3QUBA 3PWKA 4K2AA 3RUCA 3U7EB 3DO6A 1ZW6A 2ODPA 5AVWA 1SIWA 2HHHB 4IIHA 4IO0A 2XB8A 1MAAA 4NMHA 4NR0A 1FMLA 2I22A 2PAAA 3W1EA 3ZVLA 3GP3A 1LI4A 3GO4A 3KNZA 3UEOA 1NGSA 2GILA 1D6MA 3IKJA 4G84A 1SQXH 3ZBQA 2EJWA 2XVXA 4Y8VA 3RR2A 2W58A 5FUYA 4TZZA 1QV9A 4FGUA 3PCXA 4NZOA 3CJHB 1DX9A 4B1FA 4EI8A 2MYNA 3VR6D 3E61A 1GG8A 4MQEB 4YRZA 1J5EB 3SF8A 3MMNA 4ZTUB 1YL6A 4KFSA 4KQIA 3A1VA 4TS1A 2I65A 1R00A 3ZWXA 5DO9A 3TZLA 3O8LA 4GOND 4PTLA 1XCBA 2MSDB 5GONB 4QBTA 3AVTA 2L82A 2Y6VA 4R9UC 5LD2B 5IJ9A 2F62A 1XZPA 2QBYB 4RHUA 3HY6A 5LJIA 3TWOA 4O08A 2ZBDA 1IRXA 3VH4A 4MOWA 2BMDA 3QE9Y 4CKEA 1T9DA 3I5XA 2QTBA 3HGQA 4G8DA 3H87A 3ABKB 2JEYA 3HDHA 2Q1UA 5ARDA 3CS5A 5J5AA 3HUUA 3SZLA 2WM8A 4MVJI 2XE7A 5CB0A 1L5VA 1GZVA 2O5RA 2R2AA 3D8UA 3P5BA 4F21A 4DR6O 3A6GA 3IUMA 4OYYA 3RK4A 4CT0A 4FZJA 3CW2A 3CWZA 3E9NA 1G8JA 3TB6A 4XOIA 5LKRA 4CMEC 2ODQA 3DXXA 1NT2B 4HB4A 3O8RA 2OCPA 1FUIA 4ZGWA 3I05A 4WA8A 1ZR4A 3MCVA 4JI1O 3KX2A 1O6GA 2VXCA 1R18A 5EOVA 1CF9A 4GC5A 3S1LA 2AOUB 1LK0A 1NE7A 1O9HA 2F9ZC 3S2UA 1I7PA 1NG9A 1I30A 2C5BA 3FIJA 2QUHA 2CBXA 2DH5A 2YHUA 2UVQA 4BFYA 3VO9A 4YC7A 1O6FA 5KPDA 5TQ0A 2K5UA 4X6XA 3JZAA 1I2CA 1Z2CA 2C1XA 3DVRX 4QG3A 4AKSA 1UKYA 1WG8A 3ZMTA 2WKPA 1EUCB 1H9BA 1PS9A 4HS9A 4J43A 4MWOA 4OTZA 1H0KA 4B3DA 4ZYLA 3B1ZA 2I6FA 4DIEA 1OH5A 4AG3A 2HKIA 4HTAA 3ZHSA 1JQ5A 4Q9IA 4BUZA 4R81A 3F1KA 2OFWA 4S24A 4MQ6A 4ZAVA 4ZIRB 3E3OA 2AVNA 2OKCA 3MQ4A 3O8OA 1MZVA 2IHBA 3DEKA 3HMQA 2UV8A 1Y6JA 3DOOA 3IHWA 1NQXA 1MZEA 5AQEA 1AF7A 4KXLA 4IP0A 3D00A 5CFMA 1V3UA 2UZAA 2OCIA 2HK7A 3NC0C 4FP9A 3WIVA 4EFKA 4WKGA 1YF2A 4O4LB 4DV7B 3IALA 1O97D 1MAHA 1M4UA 3PDIB 4PS0A 4ZVMA 3IO3A 2J5XA 3MCAA 4U6SA 5P8WA 2B8TA 3WMWA 2L18A 3LI2A 1OCRC 2LD4A 4HPWA 4AL4A 1G66A 5JYCA 2OHXA 5C81A 4V1CA 3TRJA 1WKCA 2AN4A 3CLSC 4JJKA 4PVDA 3WLRA 1G5FA 3U0OA 2CNLA 3EA0A 4I08A 2VSXA 2CDRA 3SF0A 3ABRB 4OVKA 3VO2A 4A6EA 4AWXA 2PE5A 4MKIA 5ALPA 3KT8A 4TKZA 1SKMA 3ULKA 3BIWA 2J7PA 1D4OA 2WUVA 5AJVB 3K70C 2XCQA 3N2GA 3N3BC 4MW5A 1PL6A 4Y2SA 1FUYB 3ZE8A 1M6HA 5ECYA 1DCMA 3RFVA 5LWHA 3ONFA 4DPKA 1TA8A 4KHZA 1W75A 4R16A 4TUYA 4L6CA 3B3JA 1G7CA 3BH6A 4BIOA 4M46A 2A7QA 1LV7A 2CNOA 4LE1A 2QVGA 4BS9A 5KMGB 5IXYA 4C4RA 3SS8A 1XQ6A 2WF8A 3RS5A 1SVNA 1CUBA 1ISJA 2QD2A 2XGSA 3AF5A 2HIGA 3E6AA 1NATA 2D1FA 1KF0A 4L78A 3EOZA 3OX2A 3UJPA 3VHRA 4BNWA 5TNXA 1SK9A 1OFHA 2CL7X 3HM9A 2I99A 2HXYA 2V98A 4C87A 1BMFD 4MV1A 3R8XA 1F2UB 1FNMA 1YIOA 4EUHA 2QIOA 2VDMB 4H1VA 4HH1A 4LI3X 4NOKA 4ARZB 4TWBA 1ECBA 1AR5A 3ZWWA 1G8PA 4D8UA 1ETUA 4I99A 5FNVB 1QK5A 2E7ZA 3AEQB 3SEZA 1E3DA 5K0JA 1HP8A 4L15A 5DISB 4YRJA 2AC2A 2N47A 3PT9A 2QAIA 3HFSA 3OPVA 3OZDA 5ALJA 1YRAA 2KMLA 2CL0X 2VZ8A 2OXTA 2YOGA 3QLUC 1RU3A 3FMOB 1GTG1 3WL8A 4CM8A 4DEXA 3OFJA 5AVQA 4CC5A 5IJWA 2NO7A 4EMBA 1SGWA 3EY4A 1AP5A 4IIFA 1UEJA 5IEJA 3GMSA 3EAGA 1X25A 1LSSA 4HHEA 3ZS9A 4Q24A 3Q8HA 2HFJA 1FP6A 1OI3A 3IKEA 5BUQA 4EVIA 1SVLA 1XRRA 4JLMA 4L72A 4EFLA 3FPLA 1JU4A 1AK9A 3CKKA 3PTZA 3TQHA 3WLAA 1XVTA 1XL1A 4DT1B 4PG6A 2R6AA 3W3AD 1SBNE 1YJAA 3TD5A 1EN5A 2LR0A 3NBYC 3KLMX 2P65A 5GM2A 3D6NB 2HWXA 1QJ4A 1ZI8A 3QE4A 2PYZA 1B04A 1YJWF 2VWJA 1RM3A 3P2YA 5B36A 1N8NA 2HY7A 1U5BA 1GO0A 4PRKA 2GWRA 4R1UA 3TMYA 4BNHA 5LQAA 1JVSA 3DDZX 1IXYA 3D9QX 3N05A 4BB9A 2PPLA 3D2BA 2NGRA 1QH1A 5LBQA 1F6BA 4YECA 5DGXA 5AJYA 1PTJC 1JIUA 3NYWA 7AT1A 1ZS9A 4I81A 2QM4A 1KAQA 1SHTX 2XAJA 2IHNA 3E89A 4EZEA 3ZWAA 2RC6A 1ODIA 2ANBA 3IFSA 3BXEA 3L8ZA 4PHGA 3GBSA 5LBUA 4DSAA 3JSXA 1FBNA 4DCVA 4QHSA 3M6WA 3WRXA 4Z2AA 2DBVO 2ZJ3A 3FR8A 4L1KA 3IXQA 2H3HA 3ISVA 3KBBA 4C4AA 2V3VA 2PZKA 2FPWA 2FFJA 3KPJA 4FEYA 5AUOB 4QATA 3GH1A 1KEUA 1FTQA 1W4RA 1JDUA 1STOA 2DR0A 3G1UA 1LPMA 3IGAC 1N0WA 2Q3BA 3UV6A 1MH1A 5IULC 2CK3G 3GLFA 5IVHA 4C4TA 3HU3A 2P90A 4KMMA 3INYA 3CJHA 3E9YA 3FDZA 3REOA 3SQLA 3MEQA 2IHTA 4W1SA 4B81A 2VHJA 1RYZA 3FG9A 4QUGA 3RC9A 5JV5A 4KPUA 1R4AA 2Q4RA 3FYHA 3R1IA 3W7TA 2D2VA 2PRSA 3VHXB 5K20A 3OJFA 3BDVA 1T2VA 2IKQA 4QKQA 1BFUA 1VYUA 5L4LA 4G5OA 2Z30A 4Q3AA 4Y6LA 1ZK2A 4DV0B 1N1GA 3UKMA 1VQ8F 4MB0A 5B1OA 1L7BA 4G25A 2HQSC 3RFFA 3Q8MA 4WNYA 3UM7A 2AI2A 4IJMA 1K7CA 3EIUA 4R9SA 2FW8A 4U7WA 4Q9KA 1KMIY 5D00A 4YMTA 1NPDA 2WKWA 4ER5A 4YPFA 6ABPA 4KN5A 2KQUA 3U5TA 2VR1A 1UXJA 1W6UA 2XCOA 4LY3A 4PG7A 4RFSB 3RBAA 2CXOA 3ZE2B 3RA5A 3AF4A 3WGUA 1FTNA 2LUOA 4FSXA 4HX9A 1Z0SA 3UFXA 3B9PA 4L7VA 1SOMA 5AH0A 3KFVA 1DU4A 3TNDA 1F7VA 2HA0A 4DLUA 2DHQA 3ZU3A 3FNBA 5CYPA 4NULA 4F8JA 5BZBA 2I33A 1KVSA 4ZOLF 3K08A 1U8UA 1ORIA 5FXMA 1Y33E 4ZCPA 1RABA 4E03A 1OJ7A 4NV3A 1IJBA 4PNEA 1QIJA 2MJLA 5J2UA 2CMKA 1ZNZA 4UBMA 2M6SA 3U7QA 3SZOA 1OXUA 4AJ2A 5K8TA 1U2TA 3U37A 3V32A 1OAOA 1GNTA 3H9EO 1P5JA 2O2YA 2VQFB 1ZN9A 3AWDA 3N1UA 4JX9A 4B7ZA 2G5PA 4CLHA 5JFTA 3WIBA 3J80N 3CMEF 3M7IA 4NAVA 4HGZA 1PDWA 1PZMA 2HYDA 4PLVA 4I8DA 4ZVNA 1E3SA 3NB0A 4FC7A 3TTUA 3HXPA 2JS3A 3INRA 5BQ5A 3JAMN 3W8DA 4E1VA 4Z54A 1KB9F 4D7TA 5FWNA 5BNZA 3H01A 3WGKA 4XTCS 4BO8A 1TQ6A 4HLCA 4ECAA 1Z36A 1BD3A 4KODA 2F90A 4UD2A 2GESA 4HY3A 4P98A 4QG7A 3U13A 3ZTWA 3A37A 1PLLA 2NVUB 4A7PA 1RWKA 2NU7A 2PS1A 3KKYA 4X45A 4WVLA 5HZHA 3MWJA 5KVVA 2H2FA 4UBJA 4DV2O 1O94A 2XW6A 3SJAC 3OPMA 1L1RA 4LCUC 4OHWA 4PIPA 4Z0TA 3ANMA 3B1FA 1A9XA 3EF1A 2XXAB 2OK8A 1NR5A 5AQ1A 5DTMA 2OO5A 1JQAA 4JL6A 1FBTA 2X2PA 4W82A 5B2ZA 4A03A 4EA8A 3KSUA 5I45A 1UXHA 5KA6A 2KQXA 1G2PA 1LQ2A 2AG5A 3ZCSA 5F98A 4OQDA 4WZBB 5KKCA 2RGAA 3OD1A 5CMUA 3Q8WA 3B9QA 4P3NA 3ZVRA 1A32A 1PG0A 1B3BA 1PS8A 1V41E 3FUUA 1WABA 1H8ED 1WTAA 1YHYA 5I7SA 2EVWX 3DL4A 4P3OA 1GRRA 1JNXX 1XROA 3HBNA 2NMUA 1X8XA 4CM7A 2X6TA 3E70C 2VP4A 3OJXA 4TS4A 2X6BA 4MPTA 3TNLA 3W2FA 2GBIA 4RF2A 2RJZA 3IAM1 3M4ZA 5AK5A 4CTMA 1S2MA 1FP4B 3P19A 3J81k 1EE9A 5E6RA 1NFQA 2LBWA 4Y7CA 5J9FA 4IFIA 1IMJA 1UMKA 3B6MA 1O03A 4C7OB 1C3LA 3K3PA 2GPJA 2ZGVA 1NBIA 3E7FA 1UPCA 4PSAA 4BP9A 4ZMRA 5F1YA 5BR4A 4MWZA 1A7UA 2H57A 1FPQA 1XCOA 2W2NA 1V9PA 1QDEA 2WDPA 2RJ3A 3HY4A 4IQGA 4OHFA 5F1OA 5L3QA 4HB2A 1HTTA 4HDOB 2C7GA 2A67A 1Y7TA 2K7FA 1IQRA 1EKXA 1UDRA 2MWMA 1H23A 1U0TA 2GYWA 5GAJA 3E7PA 2P1ZA 2QG6A 1QTRA 4KV7A 3K0GA 3DG9A 3I01A 3KB1A 4TYWA 3DTVA 2GCIA 1MTZA 4D9FA 1GNLA 3RVPA 4EA9A 1YB1A 1SNYA 2HN9A 4B6EA 3GYQA 4HLNA 2HIAA 1K5GA 1GOTA 1I3CA 5IT9A 3CMEV 4KXFB 1IN7A 1DC6A 2XT6A 3D4PA 2J45A 3F7TA 3FYSA 1YQDA 2B6NA 3PIDA 4TMVA 4UU8A 5ARCA 4EHAA 4DLTA 2VP0A 5GY7A 5D3QA 3S1SA 1ID1A 3H2YA 3MXTA 4P0TA 3FETA 4JC4A 4JGGA 3TNYA 2WLNA 1BWSA 1KH3A 3QQPA 1QCZA 2IOHA 2OORC 2OD2A 3WU2Z 5JOQA 5LNK6 4OA5A 1GTMA 2ADFA 4GS5A 1CVRA 5BYKA 1JFFA 1MH9A 2QRGA 2XWJI 3AM3A 4NBVA 3ZNQA 1KJQA 2JGLA 1XV2A 2WFLB 4MQMA 5BR8O 3T2MA 1G8FA 3ADOA 1K7FB 5HKOA 3OIWA 3HYCA 4BO4A 2Z1TA 1J2YA 4HWRA 4HEQA 4ITVA 5B3SB 1YS7A 3WB9A 3F90A 3GLGA 3C3CA 3LPNA 2IH2A 1VCMA 3GJ4A 5LOVF 3BA1A 5KWIA 5BQXA 2X23A 3II6X 1CZRA 1D3AA 2QVXX 3QOXA 5LC1A 2CHEA 3CCLV 3LBHA 1WB7A 2PX0A 5FFNA 2JNWA 2GZ3A 2QAGA 3DZJA 4QTUB 4BEBA 3UV3A 3R5HA 3Q5EA 3EXFB 3OIDA 2CJWB 4WZ6A 5CTJA 2DTDA 5U9CA 2GV9A 1F2UA 2EIMC 4MPPA 5JAQA 4IXTA 4ZQEA 4TXLA 3HYNA 4CIBA 3BTSA 3RFRA 3LGAA 1AV6A 4WOCA 2OV6A 1TEVA 3HR0A 2G82A 3C90A 4FYVA 1PQWA 4M0DA 4EAAA 2VS0A 1M33A 2N48A 1SVKA 4K46A 3V00A 1F4MA 2IPLA 1T2DA 1GY8A 1WCXA 4OAQA 4EQ6B 4YK7A 1HR0B 3SE0A 5CAEA 1ZRNA 1EK2A 1N5MA 4MLDA 2CL5A 4LZWA 1A7AA 4NIMA 4K9MA 4WZZA 4EL0A 2CNNA 4DDMA 1CRPA 5HJ2A 5L3SA 5DM2A 1IZ3A 1Y3HA 1KRXA 1X1BA 5GP1A 2HIMA 3AL3A 3BTOA 4N7MA 4AY5A 1AMUA 2R8RA 2BW0A 1X19A 3O47A 1HDJA 5CPBA 1HUQA 1L8XA 4PTYA 1RQNA 3PUZA 4R7ZA 4TS3A 2BEKA 1DTEA 5BN1A 1NN3A 4MTGA 3M9XA 4K1LA 1XTTA 1HG1A 2OVBA 4UMVA 2ZWOA 1KS9A 4MMYB 4DYDA 5IRCD 5GINE 2PUGA 1K7DA 1LVHA 4ALLA 1KEKA 4OI0A 3BXZA 3O4IA 1EFUA 1RPZA 1OGYA 3CD6F 2IZ7A 2P7TC 4ZEMA 1AUPA 4RDHA 3L6UA 2A78A 2XNCA 3B6EA 4KIJA 4RVOA 5IAGA 4BFCA 1GN3A 1XMOO 1RYNA 2F3TA 1XK7A 2ZSAA 3M6LA 4W4LA 4G0NA 3M1LA 5KTKA 4X3OA 3K6JA 1SOVA 4LZPA 4GLFA 1I5XA 3LUTB 4V0MA 4EG3A 3JQFA 3SS7X 4KVFA 3LYLA 3PC8C 2HO5A 1KP2A 2AW9A 2H3EA 4NYJQ 4FLVA 1TZBA 1XVIA 1XV5A 4K9KA 3LPMA 3PDIA 1FXHA 5D6NA 3QYAA 3HDVA 1T1JA 1CG6A 1N5LA 4DDTA 1GTRA 4LK3A 2V0GA 2C0CA 3N2YA 4R69A 4CN8A 1D1SA 4Y2XA 2OZKA 3PRYA 4JZYA 1R6DA 3P1JA 5KHHA 3KR2A 2NOAA 1E5TA 4OLFA 4QJ4A 3ZXIA 2YV2A 4DAOA 1HW7A 1GYQA 1Z5UA 1ONIA 1UADA 2FWMX 1BX1A 2OR3A 3G49A 1E1RD 2AXPA 3LT4A 1EHYA 5LZ5A 5IHPA 3ESXA 1NZFA 4MVJG 1WZUA 3NMUC 1P4JA 4QYIB 4CM9D 1EX6A 3AETB 1LDBA 1YZHA 2G9RA 2J0EA 4U2FA 3W7XA 1VMKA 3H2KA 1DDOA 5HXZA 1MJNA 4JNKA 2NAPA 1MMMA 4L76A 4ZIBA 2ASEA 1EINA 1M90W 1JJIA 4GP9A 4Z4QA 3K8OE 3AG6A 3EXG2 1E9FA 5TGTA 1NT4A 1S72V 1PJRA 2Z4SA 1QCEA 5I3CA 4F4LA 5T5QA 3NRCA 3S8YA 5C8XA 1S2IA 3EY9A 4JBXA 2CFTA 1QFZA 5AOVA 4UXIA 2IY9A 3LPCA 1GPKA 2PSHA 2Y0DA 2ZRKA 2GM3A 4ZN6A 2FLWA 1V11B 5JXGA 3GFGA 5DGDA 2EX1A 4V0QA 16PKA 4K6FA 2PF4E 3V4FA 5KDDA 3PCRB 3IQWA 1NYQA 1FFYA 3G7SA 3H65A 4I1IA 4F8YA 5LIRA 3T4EA 1RWXA 2A9QA 4F2PA 2VJMB 2Z83A 2YXZA 4YJ3B 3BYQA 2WNHA 1X3SA 4CI9A 2X9NA 3R75A 1N75A 2HP3A 1VBKA 1WM1A 4LECA 4JHLA 1KI8A 3N74A 4CWAA 4XUDA 3B4SA 4KWCA 1LDEA 5FNVA 3F1LA 3I2IA 3WHLA 4LSZA 5B30A 5JO9A 2B94A 1Z4NA 5GTIZ 4ZRDA 1UAYA 1WETA 3KSRA 4XCQA 1CRZA 1JFTA 2FQXA 4Z9BA 2RK6A 3WL6A 4DMRA 4BLPA 3TRIA 2CNWD 1OCEA 3QU4A 5EZYA 3D54A 3EH1A 1BO6A 2ZIZA 5INTA 1QUFA 3Q2IA 2DLNA 3R9WA 1QRAA 5AI0A 3KQKA 1RFGE 1JKJA 2FUNB 3G3EA 3G7UA 4GZ6A 2VHXA 4NICA 3UB4A 3EWIA 5G41A 3AKEA 2G25A 4PZ0A 2ORVA 3UA4A 4C4SA 2FDXA 2NWQA 2PT5A 1RYYA 3OCWA 4H6PA 4JOSA 4M1ZA 1ZOLA 4GECA 4UUOA 3UUWA 4YCJA 4MPRA 3H5WA 3GVCA 1WPRA 3P4XA 1Z82A 3WWYA 4RVGA 3PTAA 5A0VA 5FQNA 3L7BA 2R9AA 4KGDA 3BFXA 4QOHA 4ZP1A 5TR9A 3ZOZA 5C7LO 1M1XB 2JH9A 3EMDA 4GWKA 1COWA 3OFNA 4NFYA 4BECA 3FFWA 4R8VA 5DF1A 4E08A 5A02A 3ZEAA 4P83A 5AI6A 1KI6A 2LGWA 1OA1A 2XLCA 3CPWU 1T10A 3KPYA 3QI2A 2HLDG 1B2LA 4OKIA 5AJUA 4EY7A 1NP6A 3GLSA 4TVKA 1FQJA 4OHYA 1RLTA 1D2EA 1J0XO 1JG1A 4H1HA 2M6YA 1UAGA 2GA9A 3QG1A 4QJFB 1JAZA 3PVCA 2ZUTA 4LJSA 1KBHA 4QJ5A 5FPTA 4WQMA 3WYBA 1LVGA 3O1HB 1RC8A 4TT3A 1H1LB 4KU4A 2DYRB 1ECLA 1RE0A 3UK6A 2XWPA 4DW0A 721PA 2D2EA 4Q1DA 1ZM4A 3AK4A 1BA3A 2JIBA 4J0JA 1AIPA 1MVOA 4Z4FA 5I5GA 4CG0A 3ZGZA 1YZVA 3L4EA 4L16A 4D96A 5KAPA 4BW0B 5JNSA 1GAWA 2NIPA 5L3GA 1F4PA 3N2LA 1I5OA 2W6JA 4W1QA 2I2WA 2DHCA 3UMVA 3VR3A 1QFXA 1RXUA 5CB8A 4MDFA 2JLRA 2VNJA 1OROA 3L0PA 3X0DA 5GPBA 1U28C 6AT1A 2AT1A 5KVAA 3HCPA 4D25A 2R8OA 2UUCB 1Q12A 1S2OA 2JJ1A 3E23A 3FZEA 3QUCA 4L4YA 3IEUA 3JCZA 2W6IA 1X15A 5E79Z 3KLOA 3OY7A 1E8MA 3ZW9A 3P9KA 2IHKA 4CDMA 2KS6A 2J08A 3WP1B 1A8PA 2GD1O 2YHIA 5BRNA 4MH0R 3I9KA 3DOCA 3V8RA 4D57A 1MDBA 3QKRB 2HRBA 4B82A 2N1BA 1Y76A 1KQSU 3VV3A 4QPZA 1HE1C 4WTOA 4PA4A 1UBUS 3ERNA 2N1MA 4FLYA 3MRTA 4N54A 3FIUA 1U0GA 1WMAA 4JHXA 4EJ2A 1OB2A 3BJRA 1T5DX 3NUZA 2QS9A 3NW9A 4ND5A 1UINA 3AR7A 4FUQA 4EKEA 1LKZA 1M67A 2V1XA 1G55A 3GFQA 2W2KB 4DLBA 3ZHTA 1JHMA 2XPCA 3ZWMA 2O2CA 3FMGA 4U9HS 5IC5A 5JCOC 2FX5A 5DKFA 2GBCA 1A96A 4A6DA 3DBLB 4ZK6A 5BORA 2AK3A 2JAOA 3R3SA 4NCKA 4YY3O 1ZMBA 2QHXA 4IUYA 5G0SA 2FGKA 2Z6VA 3GZJA 1HEYA 4P9NA 2CJWA 3AUXA 3ZNPA 2GFHA 5BSRA 3FAKA 2ZJ8A 1E6WA 1INLA 2DCMA 1MQ8B 4X1OA 2WUWE 5HQJA 3THWA 3LUBA 2D2FA 4C7BA 2H1CA 4FX2A 4B73A 1H5UA 3N58A 5TC4A 3ASOC 1JEJA 2BFFA 3GUZA 4G23A 1D5AA 2VF7A 3WGQA 4F12A 5B12A 2C7QA 2HS0A 2MT9A 5TSDA 2Q69A 4XDYA 4CN9A 2BYTA 1OKKA 1M6EX 4IFTA 1VP9A 3AG4C 3EAFA 3PEWA 1COWG 4NCNA 2C99A 1Q1AA 5FBZA 4BT3A 5IYBO 5CVCA 2FPLA 2B98A 1YTFB 2H07A 2J6CA 1M83A 3TECE 1D2DA 4OP2A 4ZOLB 4NI5A 2Q7OE 3RO7A 4QPJA 2YJ4A 3DV9A 2P78A 4L87A 4QOGA 2QUIA 1S01A 2VRZA 3ZJZA 2VJCA 4M0FA 5EA2A 5IY5C 1KEZA 3W77A 5EL0A 1M5TA 1RWQA 1XVUA 1ZVMA 1E79A 2AK2A 4B5LA 2QPTA 3OTWA 1YDHA 1Y42X 4GSLA 4M0KA 4BHTA 3DXZA 3SC2B 4ZJZA 3OCZA 4ZYWA 3A1TA 1COWD 1O58A 2X8BA 3Q11A 5IM5A 5G1PA 1HLFA 1Q1EA 1SCUB 1L7PA 2FPPA 3OW2U 3V7FA 4EP1A 3PUKA 2DHDA 1Q0SA 3KELA 5CLIA 1ECJA 2IS6A 2IW1A 5EWJB 1JZQA 2A0YA 3L77A 4D3XA 4V0OA 5LXTB 4EATA 3LK6A 5K99A 2Q45A 5E4YA 3AG3C 3MK31 4CBVA 4TWJA 1EK5A 3WTBA 5FX2A 1IVSA 1OLUA 1PM9A 3U4GA 3AY6A 3GLTA 3CHYA 5WRFA 5IH3A 4K9QA 4B3MO 3CPEA 2FG5A 3LC1O 1NC3A 5ANRB 4XGIA 2QTVB 4IGKA 1AMOA 4LMBA 2Z4RA 3GGOA 3GOQA 3WOHA 4B2IA 3WV5A 2HRUA 1U43A 4GO1A 2CVQA 2ZVZA 2IUTA 4QXMA 4H7EA 1FMFA 5ESRA 4DAEA 1IEWA 2W6JD 5E6UB 3G2KA 3VR3D 2CUNA 3MBIA 4F6EA 4GXRA 3VJRA 4KQHA 4J1QA 4OH7A 4DV7O 1RHJA 3OEYA 4B3IA 3DBHB 2HMSA 3C3KA 3KFXA 4OK6A 3VVCA 3LUDA 5C3MA 2D54A 5B66Z 5J43A 1NN1A 3OWOA 4AECA 4QSMA 3A4VA 5D1NA 2IY8A 3CN7A 3TO5A 3D0OA 1R0ZA 2G38A 4QLOA 4BGUA 2A86A 2Y1FA 5JYEA 3IP9A 3QVJA 1QQ7A 2NLOA 3KUCA 1TMYA 2LP4Y 4NENB 3RWOA 4RH0A 1ZUQA 1JY8A 2HADA 1NJGA 4G26A 5JMTA 4F38A 4UBIA 1TMGE 3S0YA 2HREA 3AERA 5DN6G 3VR0A 3VR4A 3CVWA 2HK8A 1HT1E 1Y4MA 1ECGA 3AV0B 4R40A 4F84A 3SYRA 1TD1A 2DWUA 1Z2EA 2HNBA 3IB6A 4J4HA 1RZVA 4NCXA 4CIVA 4GW3A 2VOJA 1LPOA 5LA6A 1WA8A 2AGVA 3LF1A 5DHFA 1NLFA 1W40A 1KHTA 1TQ4A 1JPVA 2PHNA 2CLEB 1H65A 1SBZA 2PX3A 5D5QA 2W4IA 1KBQA 2Z9DA 3EOAI 3MYYA 3K71B 5D3MB 1YJ5A 4U9IS 4MTFA 1WB5A 4UC0A 3PHHA 1NVUQ 5CLFA 2O50A 5KTTA 1H0SA 5KS2A 1Q0TA 3P2MA 1LPNA 1IUOA 1A9XB 4B3TB 4JBIA 2E89A 1DQZA 4MUFA 2IHUA 1A5TA 3I62A 3PD7A 1DOHA 2QZ9A 1RCFA 4ZCMA 2ATKC 4LHYA 3PX3A 1ZD5A 1JDZA 3C3MA 4UDXX 3RN4A 1FOEB 1L0LH 4XW2A 2YY6A 1GT91 2HF7A 4EHJA 3T9CA 5FJIA 4OGFA 1YMUA 2B9VA 3AK2A 2I6SA 3CCRV 3B7GA 3H7AA 2LXNA 3PCTA 1YA8A 1K4CC 3FVTA 2AEFA 5FL3A 4ZVQA 2FJUA 1FKAO 1D0VA 5DNWA 2CE7A 2XT9A 2B34A 2P79A 3PGKA 4D1YA 3HEMA 3FNQA 2D4HA 3M4JA 2GN9A 1CQZA 3WO0A 4R3NA 2GPTA 2O7QA 1BNCA 2AKYA 1WSAA 3N86A 3SHOA 5JAMA 3E9RA 1THMA 3LQYA 4CUZA 2FUKA 1GDHA 1H2WA 4JBWA 3CRAA 5A7GA 5CW2A 4KXNA 1GV1A 3N2KA 4R50A 3HACA 2GOYA 1KK1A 4JJAA 4QUEA 5CH8A 3ZW7A 4G0WA 1E66A 3C39A 3UK2A 4DWVA 4EELA 1T2AA 1U4OA 1L5HB 3WLTA 1ZJJA 4YJHA 4G1FA 5BVGB 3CLTC 4DMCA 2BFAA 3ZI7A 2P5SA 5C35A 2WJYA 3IEWA 1CJBA 1I51A 1X3LA 1BCRA 3A2KA 3QKIA 5SYMA 2X4GA 1MB0A 1MORA 2KLHA 4DR7O 1UBOS 2WABA 1FFDA 4W1RA 2VAPA 3ZIUA 1AGRA 1TJ3A 3BGIA 2XUIA 1P5HA 2ZXFA 2H59A 4QRIA 1BYIA 4XQCA 3SC3A 3IXMA 4A4DA 8OHMA 3HN7A 1Y3BE 3GVIA 3WISA 1BE0A 6REQA 1OWNA 2XUMA 3GEHA 1HKUA 5F51A 3T5GA 4BNJA 2JHAA 4JEMA 5DK6A 1AQ6A 5KREA 2PKQP 3BILA 2NTJA 4P1ZA 3T3NA 1MJHA 1LTQA 1JSCA 3SYPA 5KQGA 5DHAA 5ALWA 4AX8A 5I8WA 2X77A 4JT8A 1PZEA 5H2FZ 4DCOA 4UEJA 1T5HX 3B3AA 4TLBA 1U2DC 2XQKA 3I2KA 1RRKA 1V96A 4G1MB 1KJZA 2R7LA 4OBXA 1LX7A 3TZEA 1PD0A 3EFBA 2QE7G 3T94A 2JNBA 3VTFA 1YI2V 3PNMA 1EXNA 3JAWA 1P3DA 3HUEA 3O3NB 5H3HA 1T25A 1ZFNA 3VSEA 1OAPA 1EBBA 3QPDA 5HTOA 4M1OA 2IYOA 3ECCA 2NTYC 1TW2A 2Z2IA 4MUIA 4OP1A 1C9KA 3HYRA 1KD1W 3WJQA 2WUEA 3H5IA 3KSZO 3BE5A 1XHLA 1L0NH 2PR7A 3OPNA 1E3JA 3A9RA 1DTWB 5HE8A 1JEQB 1BEZA 2KHZA 3USCS 1PZNA 3RS4A 1VP7A 4EB0A 3U3KA 1QD9A 1O7JA 2MYTA 2Z08A 4RVUA 1T29A 3TOXA 4Y6RA 3OLZA 2YY7A 3C5CA 1MO3A 4Q4HA 2NSHA 3A31A 3W3AA 1VHQA 3R7NA 4DNFA 3FMIA 2EWWA 5B8FA 2ONKA 3CYFA 1C4XA 2P8JA 2QJTA 4WEOA 3VNSA 1JR4A 3NAGA 3MTBA 3PQDA 4KXYA 2RAFA 2CFCA 1BDMA 4URYR 8ATCA 2JIPA 1WTCA 3AFHA 1VHWA 3EIQA 4MZXA 4TLCA 3PUVA 2O8NA 4O4HA 1J49A 3R2JA 4IDFA 4OKNA 3T7IA 2JJ8A 4LFAO 2XCSB 4CKWA 4I4TF 5TEWA 3ZDDA 1VLJA 1G2IA 1G21B 3PYLA 1UZUA 2FSFA 2LRHA 2EBOA 2BKUA 3DMYA 4Q18A 5BV2P 3OCJA 3R7FA 4AJEA 3C6MA 4HV4A 3ZGLA 1VJTA 2A84A 1OSNA 3SHQA 2ZSHA 2YOFA 3PSHA 2ZYGA 2ZE7A 1BQZA 1XN1A 3DZKA 4GU5A 3VNUA 3HKDA 4TSFG 1UOQA 1Z6YA 2E4XA 4I1RA 4OHKA 1L7DA 1TD9A 3VSCA 3IR9A 1WXWA 2OBLA 3OQBA 4D3SA 4FE3A 2OO5C 2Q5EA 1E7SA 3KR0A 4GLJA 3AHFA 1LLDA 5JLAA 1WV0A 1J7JA 3MB8A 3E1SA 2P5YA 5DI3B 1U65A 4IUCS 3EIOA 3WMXA 2OQRA 2YYEA 5K8IA 1Z3IX 3BBPA 1YNOA 4MB2A 1AI7A 2EOAA 1SD1A 1ZH2A 2NU6B 2H85A 1A1VA 3E2PA 3HFGA 3RYHA 3T1HB 2H5JA 5DDIP 3DJFA 4PAOA 4XSHA 5E7MA 1CJUC 4TRMA 1TC2A 2WT4A 3RU2A 1V7CA 5HY0A 1P19A 2AN9A 2QORA 4KTVE 2O1SA 1UR5A 4JVNA 2P06A 3OY2A 4L95C 5EWJA 5JRDS 2O2JA 1C3EA 5A7FA 1MIHA 1ZH8A 4GLXA 3SVZA 5C7YA 2J9XB 1BCSA 1FXSA 2GBLC 2QTRA 3VYUB 4B4UA 1XHZA 2O20A 2E0IA 1KSJA 2ZJZA 1I2ZA 5CK4A 2PWYA 3L9DA 1K5SA 2A4MA 3M4XA 2H54A 3OTHA 4N6NA 3JTMA 4LXXA 6PFKA 1MC5A 4D46A 3A36A 2KWIA 5A6SB 1JEYB 4ALIA 2V45A 3MFQA 4C21A 1HT2E 3QVKA 3QEAZ 3S2IA 3A4NA 4PBRA 3IKFA 4RGBA 1QG4A 3CPSA 5AM0A 4J16A 1Y74B 3M89A 2HD4A 1T8PA 5I01A 4MKZA 5GM1A 5GINC 1A77A 3MGCA 4LEIA 4BY9E 4DHWA 1S9DA 1Z6ZA 4LF9B 1PKEA 1TAGA 3O1LA 4RY0A 1NJ2A 2OQIA 4P93A 2BHRA 3LPAA 2VF2A 5BMVB 2JB9A 3TQOA 3TR5A 1YL5A 4TV9A 4UV8A 4FDAA 1UFYA 1NY6A 4FMPA 1P5ZB 4QYWA 5KVSA 3UT5A 1N1DA 3C6ZA 3CH5A 3FROA 4ZBMA 4PDLA 4RZQA 1FW8A 2QMOA 3PXDA 2DBQA 4AIRA 4DCSA 3P30A 3EGDB 4NTZA 4U2CA 3LX4A 1OMOA 2CJXA 3Q3HA 4GM1A 1QHYA 4WHMA 2Q3FA 5AVKA 1U5AA 1I0HA 1G3UA 2NQ8A 4QELA 3WV4A 3ETHA 1CDOA 1TE2A 3ZWKA 1U04A 4D8WA 4GFDA 2OZVA 1I9CA 3C16C 3E9ZA 4Y2JA 1T9HA 5BN5B 3SX0A 3FHOA 3UHPA 4F4IA 3RIHA 4AJHA 5MN6A 2W42A 4NNOA 3SYTA 4R9RA 3ZN2A 2ZYTX 1RVV1 2Y99A 2PRYA 1ZZEA 1X7DA 2QL5A 3M6XA 4R98A 4A0FA 2XRZA 3U19A 3PTLA 3A6ZA 3P8ZA 1O95C 1UFKA 5KX5A 1XCJA 2B7LA 3CX6A 2DFDA 3C14C 2VHWA 3ORHA 2JGDA 1TZCA 4LHVA 4DOMA 1DT5A 4URUR 1H6DA 4ZCQA 4REQA 3AHHA 3E0XA 1VKRA 4IS3A 5C7OO 4ND4A 5LLTA 1J00A 3B8EA 5CLJA 1JFLA 3KFLA 3IEMA 5F35A 3KVVA 3DCIA 4YI5A 2P2DA 3TOZA 1Y3FE 1MV5A 3M1YA 4R2LA 1TM4E 2CUZA 1ZLYA 2PGJA 3BF7A 3QIVA 3RHTA 3RUPA 2Q0OC 2LKCA 3PVZA 4KBYA 4FK8A 2PYJA 4K03A 3IVMA 3B5IA 1MIOB 4YB8A 3WWOA 3ZD8A 5DB4A 2IH5A 4WX2B 5COQA 2HBYA 3GW8A 5AK0A 1RZRA 4NK4A 1GR0A 2QA5A 3R4CA 4ENQA 3JQEA 2J41A 4TM8A 4AF8A 5DN9A 3THWB 1GUYA 5A62A 2YVUA 4HS4A 5IBPA 3SHFA 3EFHA 5BOSB 4MX8A 3LJKA 3OG9A 4MVJD 1K5QA 3LQKA 4O6VA 4J90A 1YE5A 4NEGA 4QGBA 5E2IA 1UAAA 1T2CA 3WK4A 2ZT9B 2VT6A 2HF9A 1L4UA 3BWCA 3LQ2A 3ELWA 4ZJUA 3PE4A 3AM5A 4X54A 2GZLA 2LZ0A 4PSVA 1KY5A 4PF1A 5LQMA 3NKVA 4EGJA 2WZQA 4PC1A 1MB9A 3BFVA 3NIWA 4PLFA 1DKQA 3RIGA 4D9CA 2C7PA 1SRRA 3IUSA 1AZSC 1E98A 4FZVA 5CYGA 1UXKA 5KMGA 4YJHB 2M6RA 2QRNA 4D8XA 4Y1RA 1VHTA 5FWXB 3C3YA 2DWEC 1Q0ZA 3GD5A 4HXYA 2HA3A 3N28A 2YFHA 3O9MA 1L5ZA 4C01A 3QTYA 3ANYB 2Q1SA 1T6BY 4NYMR 4RY2A 3LUHA 5IXJA 3SP1A 1NI4B 3N2GB 3G8DA 1Q82H 1B41A 1O4WA 1B14A 2H16A 2ZTHA 4MULA 4IZHA 4RANA 1P4HA 5IAKA 4GZLA 3VKHA 4L85A 3N2NA 5LA6F 2LGJA 3VPFA 4CM4B 1W46A 4JLKA 3EMKA 4BNFA 3PVSA 1KTIA 5EEHA 3TJZA 2QWNB 4M8IA 1H2RS 4M8NE 4Q7MB 3NLLA 3ZBTA 4NBLA 1GNSA 2YZNA 3ICPA 1XDGA 4EB6A 1EFKA 1W1IA 3AWIA 4M55A 4EDHA 3ZLBA 4FFMA 1M8PA 5CYOA 3UQZA 4N5HX 3PWTA 3RBVA 3QEKA 3FLBA 4MVOA 5KHOC 3LNNA 4ODIA 2AXTZ 1QHNA 1N0JA 1T4CA 1XMIA 4Q01A 1JKMA 5ICFA 3R76A 1DWUA 3S1AA 3AUSA 3V80A 3ZZTA 1GP2A 2G09A 4HDNA 5SYAA 3BWYA 4D02A 1J97A 1Q95A 1VSQA 1HURA 2BISA 2BFFB 2SICE 2XD4A 3K2IA 4JY7A 1B15A 5BMVF 1E2QA 4Z86A 4G1VA 3N8DA 2J9YB 4BVSA 1HORA 5BRAA 3WFVA 2WNSA 1HE4A 3DFMA 1W93A 4OHUA 3KV3O 3D8RA 2GYYA 3FNEA 3JQDA 4JBHA 4YLEA 3G6BA 1UPBA 1RAFA 1BD4A 4GKKB 2GKOA 3GMIA 3ZV5A 4P31A 4AG5A 1CRQA 1W49A 3QELA 5KYXA 2JG3A 3PX7A 2B20A 4L9RA 5A4KA 3CLKA 3VHQA 5H9WA 3BVPA 1DG9A 4QLBA 5CA0A 1CPYA 1MXFA 4Q3LA 4UEWA 4RPCA 5BOVA 1RQGA 3W4IA 1HRDA 4OI4A 4DEVA 2ZIOA 2XAHA 1VCIA 1W0JD 7ADHA 4F9FA 3ENNA 2XCUA 3M82A 1Y48E 2C2BA 3CJTA 3JQFC 4OA8A 1MAVA 1OFGA 1YTLA 2IU4A 2V7TA 2X5NA 4O59O 4QUKA 5HEKA 1L4MA 2XITA 2C1ZA 4HGNA 6Q21A 2ZZNA 2UUBB 2FW9A 4H18A 1M73E 2BI4A 4IVNA 1E9SA 4TLAA 3ZE9A 2AJBA 4D7AA 3VO1A 5A4IS 3S02A 2P8SA 3L92A 4Y2QA 5SZKB 3VC2A 1UKEA 3ZCUA 1P0QA 3LKVA 3F3MA 3WFJA 4UUJC 1B1AA 1CXZB 4PAQA 4LUCA 1OZ0A 1QS0A 3KZVA 1OIVA 3E35A 2EG5A 4QDKA 4TUYF 3U62A 1C7FA 4AZVA 3AK3A 4ETWA 2GHRA 5HJ5A 3P0HA 2PMCA 1A9TA 1PK9A 2Q5OA 5DI3A 3IURA 13PKA 3JVEA 5EWMA 2QVBA 1DF4A 3ZO8A 2ZUSA 4M1QA 4MWBA 3AESB 1C5KA 4L4RA 5JUWA 3RU3A 2ICAA 3OE5A 4CDNA 1DKRA 1HE5A 3HA2A 4O33A 2IS2A 5F73A 3PGMA 4UVCA 1PDOA 4W8OA 5G3ZA 3KXPA 5A6VA 1QP7A 5I9LA 1SETA 2H2AA 4ROSA 5JH7F 3QBVA 4GE3A 3RFTA 3OT7A 2X4IA 3PC4A 4IUBS 4RV5A 2K87A 5E6SA 2X76A 5F7XA 1Q6ZA 5TDHA 1E3IA 1K3FA 4OOEA 1O97C 4Q3KA 4A2CA 3GLGB 4UB8Z 1XEFA 4P8RA 5C31A 4EPRA 5JBIA 5A9SA 4PE5B 1ZN8A 1Q91A 4UTVA 3HA5A 2R62A 2IEAA 2ZSKA 2ZKLA 3GI1A 5KIAA 4EQZA 1K8AW 1LW6E 1V55B 2PS9A 3SVTA 1CULC 1U5BB 1UPTA 5AJWA 1DDIA 1NA5A 2B1JA 2I4IA 1D6NA 2YWJA 1Z38A 3PXBA 4WRRA 5HKBA 1BL8A 2XYPA 1JA0A 1DGSA 4Q4HB 1PR6A 2EATA 4U2DA 4UHJA 4TVBA 2DEUA 4LVNA 2E87A 3D3EA 2EWVA 3QVLA 4PINA 2V6FA 4RU1A 3CISA 1EK6A 1P7VA 4MXDA 1TM2A 1WAZA 2W0MA 3EVFA 1KEVA 2KPOA 3HKCA 4DR3O 4Q3EA 4E5YA 5LU9A 1X94A 1FYVA 1W59A 4FLZA 4QJBA 4D4GA 5GADl 1AN9A 2DQZA 5EB0A 3OZEA 3DE7X 1AXGA 5HWSA 3THRA 1AKVA 1DC7A 2PI5A 2D6FA 3H97A 2VP3A 3PQ3A 4IIJF 3A27A 3SYMA 1LNZA 1OPXA 2J7KA 3F5DA 3JQ9A 4O2AB 3K72B 5F2EA 3H75A 1V43A 2O1EA 1K6MA 4LSWA 3DL0A 4GPEA 2W98A 3FPCA 1A5AB 1A9SA 2A3RA 3E1KA 2UYCA 4HD8A 1X59A 1XEXB 5EFOA 3WHKA 3G5LA 2W2LA 5FULA 4ZAFA 3SR3A 4LYDA 5CT6A 2QI9F 3A9UA 1MOPA 3THYB 4DEYA 1Z4IA 3WK8A 2OT5A 3K5HA 3CRMA 3IR6A 5DM4A 4II7A 3WR5A 5CXUA 1N77A 3M81A 3HB1A 1HEUA 1JR3A 3AG1B 4YJ2B 2X15A 1Q14A 1XQVA 2PUTA 3PFHA 2BGMA 4O1MA 5T64A 4JU9A 4C6RA 4ZJYA 2G9IA 3PZRA 1EBFA 3KLBA 4RJ2A 3FTEA 2I4NA 3PE6A 3R5JA 2ZBGA 2YICA 4N21A 2C9MA 2CVFA 1OOEA 3HVHA 3O4VA 4FT2A 3QGMA 4GYJA 4Q4LA 4ZTBA 3FTQA 5LQDA 5A0TA 2A7XA 3AZPA 1G9TA 4LCKA 1BCSB 4JZGA 1J2EA 3RV4A 2AOTA 1DAKA 1M7BA 2WJGA 1KL7A 1NBOA 2H6LA 2HRZA 1MNQA 1IBMO 3COZA 2REQB 4GEGA 2QVCA 1G42A 4NG4A 5ILQA 3VYRB 4II3A 1BE8A 4BQPA 3FNFA 1NRJB 2WLJA 4OCZA 4BPBA 2R87A 4ZZ3A 1H8HG 2OFFA 3NETA 2ZTMA 1XTUA 1XSEA 2XGGA 4IPTA 1CN7A 3KEQA 4RMHA 2O8DB 4LOHA 3S8MA 4P7BA 1CUYA 1QLEB 1JBQA 3BWDD 3TNFA 5IDXA 5JS7A 3FB6C 1JIIA 4R8CA 4J16C 2OM2A 3FGPA 3BCSA 1BHO1 1XL4A 2AQ8A 3G5AA 3TQSA 3BA6A 3JARB 4JENA 4TTAA 1XNQB 1IQ0A 1CK2A 4RJJA 1DDGA 1FXKC 1XEWX 3FDFA 5BN4B 2JD1A 3Q7IA 2COEA 2O0KA 3ZCQA 2Q07A 4MW3A 3IOEA 2WWYA 3UJCA 2G08A 2Z95A 2K6GA 4RXTA 4DE5A 4ETIA 4AJPA 1W36D 1K0UA 5KUKA 3VYSB 3IQDB 4QULA 2ZD9A 3F5TA 2RSLA 2AIRA 2WJJA 5DW0A 4CQLA 1AKRA 2R7NA 3MWDB 4D41A 4Z4GA 2P6RA 4EB6B 4MR9B 5ES3A 1RQXA 1UIRA 4MVWA 3AB8A 3L1JA 3TG8A 1LRLA 3DOUA 3HM2A 2HP0B 3HCBA 5F5LA 3CINA 1ZK4A 1A9YA 1GKYA 1ULAA 2EW2A 3CC8A 3GF4A 4MEAA 1QLJA 3U3JA 1HF3A 1A95A 4WSOA 1QANA 3B6NA 4BUCA 4DZRA 4HR7A 1YBHA 1KK3A 1VIAA 5ELLA 4ZC8A 3U9LA 4ATNA 4DNPA 3F67A 3H1FA 3CSSA 1MVLA 3MTEA 4G37A 4UXHA 3M5PA 2Q21A 4WESB 4C4YA 3I8XA 1LPAB 2NN3C 1VL0A 3EULA 3VOUA 4XCXA 5IN5A 3S7TA 3TSZA 3GPLA 5F9FA 2IYTA 1TADA 4IMRA 2JJ1D 3UXMA 3F78A 3M70A 3BDIA 2QLLA 2RHRA 2W6ID 4FCTA 1LTKA 4U2KA 4JR2A 4ZVRA 1E3EA 1TLLA 2ZREA 3Q9NA 1W9MA 4K9RA 2ZI6A 3GV0A 3OLYA 1SXQA 1OUMA 1SXIA 3I6IA 3MWLA 1KWKA 4ZVLA 1GM7A 4PO1A 4NJOA 5HX7A 3GFFA 2E82A 2JVDA 1KXZA 3LQQA 5HDBB 3ZX4A 4C6TA 4JI6B 1MO2A 4N7RA 1M5RA 1KHHA 4UFZA 5EZYB 4N39A 2ZRJA 1AKYA 3VPAA 3JQAA 3K0CA 4ZZ0A 3R77A 5J4LA 2GARA 1K8RA 1JS1X 3WGLA 4J80A 4CMKA 3A1EA 4XVQA 3S8EA 1MA3A 3JVIA 4K81B 4CIWA 1WCYA 3TL6A 1S3FA 4NNPA 5BUSA 1GN9A 4KMOA 1U7WA 2G9NA 2KW5A 1KEEB 2DU8A 2GR9A 3CBQA 3B3FA 3NH6A 4NDAA 1V55C 2HCTA 3MLEA 3KJHA 4HDMB 4MYUA 3RT1A 1OBCA 1UBEA 4AD8A 4BIMA 5K2OA 2IX3A 3FZNA 1OHHD 3PGXA 2CNDA 4FC6A 4XQ0A 5A2QM 2ECFA 1JEEA 5ITZB 2NSYA 3N70A 4E1AA 3T1NA 3L7QA 1O6CA 2V7QD 2D7DA 4DV6B 2V4ZA 4YEDA 4M0PA 1JR3D 3QMPA 4G4ZA 1UFQA