4ZHQB

Crystal structure of tubulin-stathmin-ttl-mmae complex
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 176
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zhqB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zhqB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zhqB01
1Z5WA 3E22A 4XCQA 5EYPB 5J2TB 2RHJA 1TVKB 3JATB 4DRXA 5ITZA 5KX5A 3N2KB 5J2UB 2XKAA 5JQGB 4O2AB 4X20A 3UT5A 2XKBA 4TV8B 4I4TB 4ZI7A 4I50B 5LXTA 4U39A 1W5AA 5C8YA 4O4IA 5CA1A 5JVDA 3E22B 4EB6A 4WBNA 5M7EA 2Q1YA 4DRXB 5ITZB 1JFFA 4I55A 3JASA 5LP6C 5KX5B 3ZIDA 3VOBA 3VPAA 3HKBA 4TV9A 4X1KA 4X20B 1W59A 2RHLA 3UT5B 3VOAA 4B46A 3ZBPA 4TUYA 3WGLA 5LP6A 3HKCA 3M8KA 1FFXA 4ZI7B 4O4HA 3JAKA 4B45A 4X1YA 5CB4A 5LXTB 3WGMA 3HKEA 4IIJA 3N2GB 5IYZB 3R4VA 3RYCB 4O4IB 5JVDB 5CA1B 2GVIA 2R751 5CA0A 5MN4A 5LOVA 4WBNB 3JASB 2RHHA 4O4LB 3HKBB 5FNVA 4X1KB 5LYJA 1OFUA 4TUYB 4YJ3B 5LP6B 2R6R1 3HKCB 4U3JA 4EI9A 1FFXB 4O4HB 3JAKB 3M89A 4X1YB 5CB4B 3HKEB 4IIJB 4ZOLA 1RLUA 5BMVA 5CA0B 2BTQA 4O4JA 5LOVB 4ZHQA 3HKDA 3JALA 5FNVB 5LYJB 5IJ9A 2RHOA 2BTOA 4U3JB 4E6EA 5C8YB 3RB8A 4EB6B 4LNUA 5EIBC 1RQ7A 5BMVB 1JFFB 4I55B 1W581 4O2BA 2BTQB 4O4JB 5EYPA 4ZHQB 3CB2A 4TV9B 1TVKA 3JATA 3JALB 4YJ2A 3V3TA 3N2KA 5KMGA 5JQGA 2VAMA 4M8IA 3JAWA 5IJ9B 1Z5VA 5LA6A 3RYFA 4I4TA 4X1IA 1SA0A 5EZYA 3RYHA 4FFBA 3JARA 3RYIA 5EIBD 4O2BB 4HNAA 1TUBA 2VAPA 3VO8A 4YJ2B 5JH7A 5KMGB 2VAWA 3C8LA 3JAWB 5IJ0A 5GONA 5LA6B 4IHJA 3RYFB 2VXYA 4X1IB 1SA0B 3WGKA 4ZOLB 4F6RA 5MN5A 5EZYB 4EI8A 3RYHB 5MN6A 1W5FA 4FFBB 3N2GA 5IYZA 3JARB 3RYIB 3RYCA 5J2TA 3HKDB 1RQ2A 1W5BA 4HNAB 1TUBB 5J2UA 5JCOC 4EI7A 4O2AA 4KWEA 5JH7B 1FSZA 4TV8A 4O4LA 3WGNA 3WGJA 4DXDA 5JCOA 4I50A 5IJ0B 5GONB 4YJ3A 3ZBQA 4IHJB 4LNUB 4F6RB 3VO9A 2Q1XA 1W5EA
chains in the Genus database with same CATH superfamily
2IPNA 4OBWA 2X7XA 1P74A 3TGLA 1LK5A 4I4TB 4OUDA 4GL4A 4A8JB 2BWJA 4F84A 4Z9YA 4NC9A 2AR0A 3CEIA 3WPWA 3N2EA 4E2WA 3ZWCA 2WMDA 2LGWA 3ABMB 1QH9A 1YQQA 3CEJA 5FWYB 3FCEA 3QTLA 2ZUDA 1ZK4A 5EJ5A 3HKBB 4BYGA 4DLVA 4CM5A 3Q72A 1VQ9V 2O06A 5EUQB 2XAQA 1KMIY 4R16A 3HR8A 2A78A 3N5CA 3S2GA 3WQHA 1H22A 1V8FA 3RTAA 1J5EB 4ZZ3A 3ZX6A 1TAUA 1EFCA 1VQKF 3NAZA 1W46A 3V8QA 1JT2A 1ZN7A 3W7BA 2X0KA 2NUTA 2IH2A 2QTVA 2ABWA 4FKBA 3RH0A 2WTNA 5BVHB 1KDYA 1JEYA 2BLLA 1YB5A 1J95A 3FGPA 4R8MA 2VP0A 4Z7QB 4F6RA 3R5JA 5GVRA 3RWRD 1BQ4A 2APJA 1K9VF 1AH2A 5EIXA 3EDCA 4MQ6A 2BI8A 2P6YA 1Y6RA 3L75H 1JR4A 1JB9A 1P17A 5BQXA 5L7WA 3TVYA 2QPTA 3TCUA 4L9RA 1ZH0A 3G8YA 3EXHA 1KVSA 4R1OA 4C76A 4OUKX 5CVJA 1IPFA 2VJMB 2WWWA 3WQSB 1KNKA 1I6LA 1FNSA 2YVAA 1ZI9A 3NWJA 2JEYA 1I2DA 3M99B 1V16A 3T0GA 1IXBA 3CNOA 2HMYB 4DMKA 4LXGA 2BTOA 3K09A 4NX2A 3CGWA 2VJBA 4NJOA 2NR5A 2WD8A 4IR7A 2ODWA 1I5OA 4GECA 3LQ4A 4DK1A 1ZJ4A 4DEVA 2QUBA 4I8XA 1T8SA 2XYHA 1Q21A 2RK3A 3T41A 1E7QA 5HR5A 2WTMA 3P71T 2FPXA 4AZ3B 4EPVA 1F48A 3DO5A 1XMSA 4OV6B 2A3QA 1LV8A 4KE9A 3PN1A 3N0XA 4RAQA 1O1YA 2PKRA 1VKNA 1JLLB 3UO2A 4ZRNA 4JTCB 1J25A 3SMVA 4I7ZB 4NOMA 2HKOA 4PHCA 1ILEA 1EK5A 1Q1ZA 4UBKA 3EODA 2HJSA 2ZQMA 4UUAA 1H2NA 2HDWA 2WLLA 1BW9A 1FSGA 3ENNA 2FSVC 2IVZA 4YRKA 2VT2A 4HAUA 2DBZA 4MHTA 2GHQA 2A30A 4AZ0A 1H42A 1U28A 1NN1A 2NVOA 4DMMA 2QV0A 2HSJA 5FEMA 2CFRA 4UEOA 2YFHA 3IJ4A 3SQXA 1G21A 5ALSA 3PDCA 4LBZA 3OJ0A 1GH6A 1N6IA 1U2DC 3T95A 2C2YA 5DHPA 1N6RA 3QVJA 2JI7A 3L79A 2HWWA 2DMRA 5JS8A 3QZUA 1MD9A 1U97A 2GA9A 1HNWB 2FVYA 2NG1A 2E89A 2IEAA 1XDDA 1NC3A 3I6YA 2O7QA 2FN9A 3DCIA 1DQPA 2B30A 1VQLF 4MVJD 4MRAA 5JD6A 4PBTA 4GNKA 1KA9H 2VHVA 3PHIA 3M34A 5THQA 2OXEA 3P3NA 1ZISA 4M9UA 4GXTA 2A4KA 2O8CB 4HB4A 3U5ZB 1RWQA 4E88A 3HB0A 3TTSA 4EJ0A 1Y4SA 1P73A 1LX7A 4TPKA 2I5PO 2C4WA 2W8ZA 4JN6B 1FDWA 2PFKA 2HCRA 4HDSA 5C1DA 1ZR4A 2DU8A 3RC3A 3FOZA 2LGJA 4CS4A 2Z57A 1D1SA 3K6JA 2GPYA 2HRYA 1XRPA 4BO6A 1Q7CA 4RDXA 4ZOBA 2DKNA 2ZG6A 4Z7NB 4MRMB 5BOSB 1A50B 2QL7A 3NOVA 1U6KA 3MJ4A 1A4RA 2QGZA 1KYZA 2A1UB 3KKPA 2G38A 4YY3B 4JUBA 4NTWA 3VZBA 2PV7A 4G1VA 3LY8A 4P1ZA 6REQA 5TR9A 1VA5A 4RCZA 2F1RA 5LDGA 2X4DA 1NUTA 4UE2A 1RU3A 2FPLA 1L7EA 3E2EA 2EC5A 4IDAA 2YFYA 2IEGA 4GOJA 5L4NA 2QMQA 4K40A 1VYVA 5EMJA 2Q3MA 1D4AA 1VQNF 2QMOA 1SC4A 3B38A 5I4CA 1E79G 4FZ1A 2CXXA 2PQ0A 4NU5A 1KC3A 2FPWA 3CMCO 4LE1A 4B4DA 2CZGA 1X59A 1UMDB 1W36D 3TZKA 4XZ3A 4MVJI 3UJBA 4ZAZA 5GONA 2G0NA 2W93A 2H11A 3LX5A 3UNXA 1FRNA 4RPGA 4J1QA 3CJHB 4B6PA 3RIGA 4Z4IA 3QKIA 4OLBA 3GUVA 1YIOA 3H86A 5I7RA 2YOFA 4MWEA 3T9FA 5D3ZA 4MKHA 3LUFA 1Q1BA 1RPTA 2W83A 5CM9C 1M6VB 2LV8A 3RT1A 1QTIA 3OEHG 3GJ4A 5ITWA 1ENZA 4FEYA 1JHPA 3OHMA 3GRYA 1E1CA 1NY6A 2VA9A 2F1MA 4G0MA 4HX9A 2QGFA 4EW3A 1XZQA 4K1XA 3EVTA 1JA1A 4LMRA 5BW5A 1D4FA 4IT5A 1KU0A 3ZE6A 4KXRA 3M3PA 3OQVA 4RQAA 2O57A 5L95A 5A1TA 4UFZA 3V8RA 4Q4CA 5DEDA 4KN6A 1M1YB 2VLBA 2EINB 4R1QA 1KPIA 5AW4A 3KR9A 4YCNA 4X8OA 2HFJA 3QBEA 2B2CA 5FPHA 3HN6A 4DA8A 2EG5A 3EOAI 3TO5A 1SQ5A 1M1YE 4BMYA 3FUTA 1SCBA 2ZM6B 2JAXA 1WLYA 3ABQB 3O9VA 2RHBA 5J9FA 1R4MB 1NTOA 1NXWA 3KB2A 5NULA 1L8AA 3RK0A 3MWKA 2WJJA 3MQWA 1Z4LA 1WW2A 2DCMA 2JLYA 2D7JA 2XLBA 2FJUA 4OQQA 3DV0A 5HM6A 3A05A 1ULSA 2BJWA 3IODA 3WJ1A 1IBMB 4CM1A 1DG1G 5CTJA 1XRLA 2IGTA 3FR8A 4FDMA 4KXNA 1P4AA 2IP4A 5SY6A 4LMBA 3HVHA 3PCRB 2Q29A 4XH9B 3DEYX 3WOHA 1I32A 2LE0A 2OB1A 1SC9A 1TKRA 4G5HA 1PLLA 2FMLA 2QA4V 1PJTA 4P31A 4Q00A 4Q1VA 4Y2QA 2VI5A 3UF0A 1XOIA 2BMAA 3QYPA 2ZB2A 1C3LA 5CD1A 3A3YA 3H1IH 3OOEA 5K3FB 2A67A 2HRQA 5IVHA 4Y9TA 4X63A 3N4ZA 3KHSA 2Q7HA 4QAJA 4Q37A 1QQTA 2GNPA 5B7GA 4P7FA 5I6DA 4Y6LA 3F3MA 1H2YA 4TN1A 3BMXA 5J4KA 4XIIA 2HS4A 4LFAO 2Q0QA 1PV1A 2OSBA 4YJHA 1CUAA 4OL9A 5IBPA 2OZPA 1O9HA 2WZCA 1T5HX 2CD7A 4IFEA 3AB8A 4HLDA 1E3IA 5L4SA 3WISA 1BMDA 1KQOA 4JLAA 2BE7A 5EZYB 4BKRA 4K88A 4TLEA 1HEYA 1MB9A 1VI6A 4JYBA 3VTZA 4MVQA 1B6TA 4XQ9A 1Z34A 2IOQA 2WUFA 1Y4MA 1GKIA 4GM1A 3OVMA 2PSSA 5T4BA 4L02A 3B2NA 3UTDA 3WFVA 3EXHC 4MPDA 3GOQA 5FBLB 1HY3A 1GP2A 3LLCA 4YHBA 4RTMA 1GADO 5JFGA 4MWTA 2QI9C 3AY6A 2JVIA 4DM4A 1DKOA 4OQXA 3CXCU 4MB2A 2O8EA 2OTCA 3ZHUA 3LQFA 3BAFA 3IHKA 4CT4B 3D4IA 3JSXA 4YBZA 1R37A 4KZKA 3W4IA 3FDZA 2BVNA 1HR0O 2PR7A 3VYUC 4OM8A 4Q7QA 3MC1A 2H3HA 3K09C 3KD2A 2H4YA 5EWJA 3JCMM 1YQXA 2GM5A 4Q3BA 1W36C 1G59A 1EZ4A 4F45A 4UD2A 4GPIB 3V3TA 1IUOA 3ETQA 3AKCA 4QRIA 4JJ4A 4BIOA 2HJGA 3WK9A 1NYTA 1M5IA 3S6JA 3E3OA 2DFKB 2WBLC 2PZFA 2P7HA 1FBNA 1YZHA 4II7A 1QZUA 2OV6A 2GA8A 5K8JB 2UXDB 1TF2A 3HEAA 3NVKE 3OMXA 5AJVB 4LZWA 4A10A 4H6VA 1RE1A 3TX2A 4F5YA 3KUUA 1P18A 2PUWA 4YLYA 4JLOA 3EQ9A 4F1WA 1TAGA 2YQZA 3QJGA 1JKJA 4BJ3A 2P9BA 1BWRA 1RWMA 2EBHX 1Z8NA 3M6LA 2C7OA 2KQXA 5A5EA 4OB6A 1O9GA 3I2KA 3BL8A 5AKJA 4FZ5A 1JJOA 3WHIA 3GUZA 3RRMA 1Z0AA 3C24A 3KOMA 1WSAA 4DZZA 3IPXA 3G2JA 3WGTA 1K08A 2CV1A 3U7JA 4TT3G 4G8DA 1CZUA 4DQXA 2INGX 1U3GA 1C8BA 4DYLA 4Q20A 2CK3A 1U43A 1ACLA 1MNAA 1U28C 2H4HA 2H1RA 4QQRA 4ZKEA 4YUYA 5F7OA 4C3VA 1V35A 1ODJA 5GJBA 2UYJA 1QBGA 3RGBA 5AK4A 3SEZA 2Q6KA 2NQ8A 2PGDA 5DO9A 1VRWA 2HHHB 4KTVE 5TQVA 1NQXA 3JVUA 1KHTA 2C4TA 1EA5A 1KOLA 1QIKA 1RFGE 5JCJA 3N7AA 3EMVA 3OT1A 4CM3A 4DR7O 2Q45A 1VL0A 2BEVA 5E8RA 4MJXA 5AVZA 5DBIA 2MSNA 4CEIB 4ZVKA 3U4MA 1XNJA 3EDMA 1KWGA 3TTWA 1KD1W 1CR6A 4NF2A 1OFTA 4DL9A 4ISBA 4H7IA 4M1YA 5HFJA 2P2LA 1FSFA 4DV3O 4FS8A 4AULA 4MMZB 1V26A 4F11A 2QRVA 2KE5A 2FZWA 3KS9A 3HPQA 4XWGA 4GKKB 3WJ2A 2FN8A 3O8LA 5C37A 1ZWKA 2F67A 3NTRA 4HMQA 1ZN9A 4URZR 1QDLB 1ND6A 5FLYA 2NGRA 4ARUA 2ZJ8A 1CJMA 4LTDA 4DUYO 2VTKA 1ECPA 3MTIA 1XTJA 4CIDA 3K96A 1QP8A 1T9KA 1UKBA 1MV8A 4DV1O 4HSGA 1RWWA 3EVZA 5J1SB 4KFSA 4KXXA 3QPDA 4N82A 3B60A 2QTZA 5A5DA 3CJTA 4EY6A 3SZMA 2ZS7A 5TX7A 4AN1A 5HBRA 1A9YA 3O95A 1JIXA 4C0LA 4EI9A 2PWYA 3DMGA 4MIKA 4KKXB 4CH5A 2D1FA 3NT5A 1RRMA 4MKIA 5CDHA 1Z0KA 5DNYB 4A73A 2QRLA 5C80A 1RXIA 5HKBA 1LVUA 3O7WA 1OX4B 3TQSA 4N21A 2G0AA 4C43A 3UMGA 1RWXA 3W34A 4UD6A 5AESA 5T5QA 4X92A 1MT0A 5IDJA 5KQGA 2IX9A 1EU1A 2CLIB 2G9QA 3VPGA 1E1MA 2WJPA 4MUNA 1XVUA 4BCCA 1RSZA 3DHVA 1VKOA 2W43A 2H2HA 4H7DA 3T1HO 3HA7A 3MERA 1WNTA 2QVXX 1SIWA 2FX2A 3MD0A 2EZ4A 1UBGA 4PS0A 2XB6A 3D01A 2A3RA 1V1RA 2YJ4A 1IVNA 5AJUA 3KPVA 5BSHA 5JISA 3AR3A 4CIWA 1TMYA 3WRXA 3E3AA 3OBWA 3HAXD 4KXYA 4ERHA 5BW6B 4FMTA 5KWIA 4F2PA 2PNFA 5JSZA 3D43A 3ISVA 5EC8A 4TMTA 1P44A 3JQGA 2RGYA 4NBKA 4Q18A 5BN5A 1FFGA 4LR3A 1U7OA 1C2YA 1TF5A 4YP0A 4ALKA 5LPNA 2WWVD 4Q01A 2AZ2A 2P9EA 2P22C 3PXBA 4UEKA 1W5FA 5FBZA 4G0UA 5IWCA 1WRBA 3IKVA 3GRRA 1GCGA 3P10A 2JFHA 4RA9B 3OA0A 4XIGS 5K3EA 3N2KB 4BNIA 3Q7EA 4TV8B 2CBXA 5A2QA 3E9DA 4FDUA 2HWUA 1VSQA 2VDJA 1C1XA 3K30A 1YFJA 4C6TA 2PKYX 4CEHB 1HURA 3TW4A 1E96A 2PZSA 4FQ7A 1GPLA 4EJ6A 2NSLA 1LPMA 1UPGA 2VNJA 1TOAA 2D13A 3WYNA 4IM7A 2Z1NA 4ZTUB 2A5JA 2HW8A 3RFVA 4Y1RA 4X65B 4YCMA 1AC5A 4WKBA 3MMNA 2WG2A 3JR7A 4LHWA 3GHZA 3WXMB 2R9IA 1IC6A 3ZZ1A 1DCTA 3EPLA 5I7OA 3DT6A 4JCOA 2EFYA 3LY7A 5CGQB 5HQ3A 3L8ZA 1W2BU 4YMWA 3DONA 1P19A 2I87A 3DZ8A 1MSDA 1V3QE 1XNRO 3BDIA 3WRVA 3K58A 1Y1KE 4G2KA 3K5IA 5CN0A 5ARCA 2CUKA 2WJIA 1N32O 5DP2A 3VSBA 4EABA 2A9KA 2QR5A 3KKNA 3L74H 1JAYA 3ZW9A 1LJLA 4IVRA 3SYAA 4LBEC 5CA1A 4LUCA 2AEJA 2DFVA 4F4FA 3BAAA 3CV3A 2OFFA 1I3KA 3VH1A 3N0TA 3GH3A 1J7JA 3G0GA 2GN4A 5DCUA 5JDIA 5AVKA 3MAJA 5G0TA 1ZYUA 1BVRA 4PJ0Z 1ZM2A 5CLLA 4D7SA 2HHJA 4ZKIA 3FIJA 2JLBA 1AJEA 1KYOF 3ZRWA 4KFCA 3VI4B 3NMUC 2IH5A 2OHJA 2J7KA 5B7PA 5DI9A 2FEKA 1G3QA 5EE5B 3H9JA 2BIFA 2B9VA 2CN1A 2JHGA 1GLGA 1H2ZA 2IY7A 3RFCA 4WH0A 4LXHA 2W11A 1N7HA 3A6PC 4G01B 4J9UE 1M56B 5FIUA 4YJDA 3S3WA 2F48A 1NW3A 4ESVA 5T3YA 4KB5A 1H2FA 3BRWD 3I6BA 2M6RA 1VQ7V 2CE7A 5IPFA 4O4LF 3PUZA 5I7UA 3DE6X 2NW6A 1HLPA 2HF8A 4AUKA 1OW3B 5HTOA 1KJQA 5DXJA 1H2HA 3JZIA 2QROA 4EA8A 3DM9B 1UZLA 5JSFA 2AYXA 3TBHA 1NBEA 2Y2UA 3W9UA 1KQNA 5C53B 5FNVB 4GQIA 2ZJ6A 3EXG2 3IBSA 2WSIA 4LOJA 2QX8A 2G82A 1E7KA 1E4YA 1V7CA 1IM8A 1N7GA 3BSFA 3NBQA 5LUAA 4A3SA 3D6UA 1CUIA 3RA6A 1XEWX 2J85A 4HS4A 3T34A 4MAFA 2AR7A 4W1QA 4ND4A 4ITUA 3T38A 1ZCJA 4GPTA 4OGFA 3FPEA 4EI7A 5AOVA 3HXQA 2IQQA 1FZQA 3B7PA 5FLXA 4ASUD 1EIZA 3ADPA 4O6VA 4ZVQA 4KRFA 5KSOA 2H9IA 2RHMA 3IEQA 1GWNA 2PF4E 4QBTA 1JSXA 2OYSA 1XC7A 5EMKA 4ZI7B 2HMSA 3DV2A 4D5GA 4G88A 2DECA 4JBXA 3WGQA 3LQ2A 1JJ2U 3M3DA 1C8LA 3W2HA 1FDOA 4KG7A 5DE3A 5LHGA 3TS1A 4HXYA 2AZTA 5F7ZA 3A6GA 2EKPA 2C5GA 1Y3IA 5IMSA 1NI8A 1A2QA 2XMCA 1HKUA 3W6ZA 1Q6ZA 3CCRV 4JJ8A 4Q6GA 3E83A 1U0BB 3I9OA 4MQLA 5AW8A 1VPEA 2JA1A 4HWGA 5G1PA 5AHWA 4COOA 1PZHA 2CSXA 2QRHA 3UJ6A 4R9NA 1H7MA 4F9TA 1YE5A 1ZCZA 1U0OC 1YRQA 5BSUA 4LRQA 3L6UA 4JL8A 2G09A 1KXJA 5EZ5A 2GTPA 3T4DA 1IBSA 3DZBA 4DADA 5AI9A 3FOWA 2PZKA 3SHFA 2IH4A 2WU3A 3CD6V 1RIFA 1G6UA 1TZJA 3TI9A 2WWYA 4ZYUA 2NUBA 3PNBA 3GFRA 3F6SA 1YITV 4HLNA 5P21A 3JQAB 2QN9A 3AEKA 2X6RA 1G1AA 3OTHA 3TIIA 4MR9B 2D54A 2R11A 3OP4A 2GCPA 4JGGA 4TMKA 2EFDB 4E94A 1ST3A 4FHZA 4QGSA 1PT5A 4IJ6A 4YT4A 3NASA 1LF5A 4RFLA 3SFZA 3WQRA 2GNOA 3AJAA 4Z0TA 2GTIA 4RFSA 4I1RA 2Q6IA 1P9WA 3C6ZA 3AZOA 3UBMA 5IXYA 4Y2GA 4D9HA 2QLFA 1PZGA 3ROTA 1WN7A 3NHMA 4PFSA 2BD0A 3GCGA 1DO2A 4UVHA 2X40A 5D87A 4LECA 4J42A 2H4FA 1B3BA 4YXFA 3TNJA 4NPCA 1H8EA 3OC0A 3JVHA 2EF0A 3PGLA 1GO1A 4KWIA 5KYKA 3W2EA 3TB6A 5CMLA 3TQCA 1P84F 2GAOA 1GZ0A 4X61A 4UHCA 4DNQA 1FRFS 3TMKA 4NOKA 2I2DA 1JE1A 4KW7A 5IWAO 3IMFA 1U2QA 1ONOA 1YIJV 4INJA 5TPWB 4EK9A 1II9A 2AI2A 4I0WB 2TECE 1PSWA 5JNSA 1CZHA 3OQBA 1ZEMA 2VUTA 4KLRA 3U7IA 3FPLA 4BRSA 4XM2A 4C0KA 2LO1A 3C6KA 1LBQA 4BASA 4YJFB 2WHPB 3B3FA 5AM0A 2HH9A 3LPNA 1XBTA 1RWBA 2ONYA 4PG4A 4C05A 3OD4A 2I6QA 1GSHA 3FNIA 2NADA 4GPD1 1VQ1A 1YRAA 5SYMA 1M5RA 4QUBA 4Z99A 3IERA 1OUMA 3LU1A 3FCSB 5JZSA 2BMWA 5EJAA 1Z4IA 1YQUA 4UEWA 3F0DA 5K6RA 2FKAA 2H0AA 5CURA 3FYHA 3H2BA 3Q9LA 3OWXA 4RHXA 4RULA 2C8JA 2W6MA 1SVUA 4QOEA 1L7QA 1EK2A 2GR9A 4CLEA 2I7DA 3DFUA 3A04A 4DBVO 4J49A 4L1KA 3WRXC 4OSPA 3WWOA 3MJVA 2OXCA 2P9CA 3T7CA 2R751 4S24A 5SY4A 2W5UA 2HK7A 3QEJA 3SS9X 5KVSA 1RWKA 1NW8A 3EGEA 5T57A 2PI5A 1SVKA 2EIMC 2XD4A 5TPZD 3CVWA 3ILXA 1O95A 3LWVC 2W6PA 3L2OB 4M2LA 3L84A 2VBFA 5H16A 2O4UX 1GN3A 2AXEA 3WGVA 1MW9X 1E3SA 4F60A 1QHFA 4QDJA 2JEOA 1K4YA 3QI7A 4K0KB 3L01A 3EAFA 3OETA 5FTNA 2E4VA 5IH3A 3FTPA 1N3YA 4BMCA 2PLWA 3L05A 1ULAA 3ZMZA 4Q3DA 3FKSG 3LWQC 3ROZA 3K9LA 3TQTA 2R2GA 3KQYA 2IHKA 4BV3A 3G0DA 1D5AA 2O2DA 4KUMA 3H6KA 4LWOA 1XN1A 2QL6A 1JHYA 2VDLB 4ARIA 3WGZA 4WLNA 4K35A 2RC5A 3IP8A 1WETA 1LWOA 2EJCA 2QVZX 3C3EA 4HFNA 1IBCA 2ZRMA 2L35A 3M6AA 4X9QA 3NC0C 3VJKA 4KFTA 2XHEA 4Q4AB 1PYGA 1TA4A 2JIDA 4KRGA 3IUSA 2ZJOA 2GF2A 2ZSDA 4RKQA 4RC9A 3O0DA 4NYMQ 4A6DA 3EDRA 4V0ME 4CM6A 1SQ6A 4A0FA 4ZQEA 4RD1A 2WSMA 2BFFA 1J0DA 5DYWA 4GZRB 1O5OA 1FLDA 1UBEA 2N9UA 2FGJA 4MUGA 3U0OA 1U8FO 4L87A 4LJ7A 3LH5A 1TA8A 4ANFA 3DXRA 1I6MA 4GFDA 2PKEA 3BB4A 2EBWA 2CHEA 2PX6A 3ROGA 4AJEA 3ROKA 2I66A 4XD7A 3E5NA 1CEQA 4DY6A 4XVHA 3C74A 1XLVA 1ODKA 5F2NA 1U0LA 1Z8FA 5K0EA 1YJBA 2B1JA 2NTVA 3U3KA 1AZWA 3AG7A 2UZ0A 1Y81A 1QLWA 1KDTA 4BKUA 2QG9A 1HC7A 3S06A 3V9AA 2RG1A 1U1IA 1PUXA 2PYIA 1GKYA 2BCGY 2OCHA 2ETVA 1XROA 1ZQ1A 2CY0A 2O5RA 1IY0A 4PIMA 5H0IA 4UHDA 3N0VA 3K31A 3KKZA 5IVDA 5FADA 4I8DA 4MCJA 1F0YA 3T4EA 3QVXA 1P1IA 4GI2A 4Q7KA 3M82A 3ASYA 4W4TA 2QKSA 2O0MA 7REQB 5DN6D 2PH5A 1BX3A 4C6SA 2QY6A 2WA2A 4X85A 1GQFA 1CVLA 5C93A 1RYFA 5AOCA 4ON9A 4LCEA 4YUVA 2ZAGA 4XUDA 3ZD7A 1L5WA 3WYEA 1K06A 1CNFA 1PG5A 4FUTA 1BWSA 2V3VA 3RVRA 4WNCA 2PJDA 3C3KA 5IYZF 3RARA 2QIOA 1M2WA 5ILOA 4N23A 3IMGA 2PJUA 5KAPA 2DWCA 1KP2A 3GH1A 2WWXA 1TNDA 3NJ8A 1N25A 3RWMB 1A9SA 1ZGGA 3MGAA 1G20B 2BEKA 3L7NA 3VNRA 2V1UA 4UCWA 3MN1A 3QE9Y 4FLFA 2IXBA 2ZWPA 1TMKA 1N2JA 1G20E 4KHPB 4YPVA 1QE5A 3T80A 2ZT7A 1IWOA 3BDAA 3HBMA 3CRVA 3PBKA 3BIWA 3NBFA 3UIEA 3I9V6 5LQRA 2P68A 1KQFA 4HDMB 1MRZA 2IBMA 1IUPA 2IHVA 1ZOIA 2JAWA 1ESEA 4BO5A 3LT2A 4UUOA 4YRDA 2UVQA 5BURA 3O2JA 3ONDA 4C7KA 3JYQA 1DAEA 2IYSA 1GDDA 3ZHRA 4LF4O 4YV0A 1FMFA 3E0XA 3MPOA 2QR4A 4E2ZA 1M7GA 3UVEA 3G8DA 3PHBE 3AP2A 3QVVA 4QDUA 1E6UA 3SDBA 4PRZA 3OE7A 4GGOA 3PR1A 2Q5LA 1P45A 2A5FA 2ET6A 1VMEA 5JE8A 2WD7B 4TXNA 4IKPA 3B9QA 5KREA 5HIJA 2LCAA 3AJ8A 2UXBO 4IYHA 4BVLA 5HG0A 4A16A 3V2IA 4UC0A 3BH6A 2R7KA 3TTVA 1NNLA 4KR3A 2GCEA 1GAQA 5L3FA 1RM3A 5JXWA 2I22A 5JLAA 3KWFA 4YJ3A 1I13A 1E6WA 3VYSC 1TD1A 4GM4A 2ON6A 1NVPD 3FZEA 3Q0TA 1GNQA 4AWAA 2EJ7A 2Q1TA 4XD7D 4WFAV 1J00A 4YCBA 3QWBA 3KTAA 2NUAA 2F95B 1EFTA 4OHKA 5JAQA 4F72A 2HF9A 1NRIA 4WX2B 4EA6A 3C3XA 5D3MA 5JBNA 5TMEA 1J2RA 1DT9A 2I2AA 1P49A 3RRFA 4G4JA 4BX9A 1J2JA 3RHTA 2FPOA 3Q3HA 4OPMA 3AVUA 5TQJA 4P33A 3ADCA 3FY4A 2D5LA 3HP7A 1IRXA 1UL1X 1XXLA 1EFUA 1YJ8A 3C5EA 3C43A 1A4IA 2RH4A 1K75A 2DGDA 2VPIA 1QLEC 1RSOA 4TYPA 4LXTA 2NSYA 4L4XA 1H8HG 2JIZG 2BM0A 5J2TF 3L0ZA 2FPUA 1T5LA 4TLLB 3D54A 1GO3F 1P3DA 2OPHA 2BT4A 2WTEA 4Q3LA 1R8QA 5HUHA 1TECE 4BNZA 3RCBA 4NQZA 4GXNA 1ZAYA 2HA2A 1NVGA 2GEJA 3A9UA 4IIJA 1J0XO 3GDWA 3LSQA 2BEWB 3DNPA 4BT2A 2AOTB 4QRHA 1KJJA 2EOAA 4TWZA 4D4GA 1W2HA 3R5SA 1F7UA 5A6SA 3O75A 3NDRA 4JQOA 5T6MA 1QYIA 1JFFB 4YXWA 1RQGA 3PD7A 1U0RA 2B9ZA 3IKEA 5ALEA 4YCJA 4FOSA 4A5OA 2XZTA 1S1CA 3E8MA 1Y42X 3FJYA 1JJIA 3CE6A 4N0QA 1ZGHA 3OJXA 1Z56C 3EVKA 3H1EA 3KTOA 3QIAA 2AX3A 4EKDA 2QR2A 3K08A 1XI1A 3ZH9B 1XHFA 3BIFA 2A7QA 3EGXA 2UYNA 1T43A 2AYYA 3TINA 4NXNB 1WF6A 1ESDA 3JRXA 1XCLA 3SP1A 4B43A 1RKXA 1EI9A 4UCSA 5E0KB 2OUKA 1YKSA 3C39A 2OL4A 4BO2A 1MKYA 5ALFA 4X64O 1C80A 3TL6A 1PFVA 3G9QA 4WBXC 3A4YA 4X1KB 4BT5A 3UFXA 3ZGLA 3Q85A 3KPYA 3AFNA 1TQ4A 5EE3A 1BZKA 2QRMA 3DTTA 5E2AA 1NI4A 2G72A 4JAUA 3GBVA 3KZKA 1ONSA 5DEIA 4M36A 1W4RA 5EI5A 4FE7A 5BRAA 3QUCA 2NPIA 3HDGA 2FB5A 1YDWA 1OI7A 1H2EA 1DUIA 1MHTA 5LQMA 5LNK6 4XYMA 1W1WA 3V2GA 3B1ZA 2XVAA 3BXHA 1DX9A 2ZINA 2ZRGA 4AQYB 1TO1E 1APBA 4JFRA 2EW2A 1QU2A 4TVKA 2PX0A 3P2OA 1SXIA 1T15A 4KIWA 5AIAA 3UUWA 4PI0A 3EGDB 5C5DA 3BWYA 3DZIA 2I4NA 4B62A 3AR5A 4KUHA 1TCVA 2WLSA 1VFNA 2JFBA 6LDHA 2ONZA 3EY4A 3LHDA 4MUEA 1Z82A 3FOBA 3N5KA 5IAKA 1XHLA 3L40A 2NVBA 5CBGA 2C99A 4KYVA 5B66Z 3PNLA 3RABA 1N3BA 1TXGA 4E14A 5FOTA 4DYVA 1YUMA 3EPPA 4QGPA 3JAWA 3C6MA 2VRNA 1N9KA 3R4CA 1WOYA 2E4AA 4D02A 3R3ZA 3DL4A 3GLGA 1KEWA 3OTOB 1VE5A 2NU6B 2VK4A 3KT8A 4HPWA 2A79B 3R77A 1U3PA 4Y2VA 2WQZA 5IE9A 1DEHA 1C0PA 4NOJA 4BNGA 2LW7A 1CR2A 3D8HA 3OQ6A 4AG6A 4LF9O 2GN1A 2NZWA 1OV9A 3TRJA 3HXMA 3OCZA 1DBFA 2HMWA 4K3AA 1GL9B 5DM4A 2F90A 2J32A 4EGFA 4FLEA 1ZN2A 1KDVA 3BEDA 4P0QB 4HNSA 1BKDR 3I6QA 1NVVR 1ZZGA 2B69A 4TWKA 3T4XA 1YACA 4ZVNA 3TLBA 2QM7A 4WKNA 4HWRA 2C2XA 1CP3A 3C6XA 4CM9D 4HPXB 4MVJP 2JFGA 1R4AA 4RE6A 1W55A 3HZZA 3KYBA 3TMYA 1DKUA 1EFPB 3LY9A 1IPHA 1ZUNA 5FBKA 4YHHB 4HNRA 4XB6B 1WL8A 1Y3AA 1DT5A 2WHQA 2O23A 3S28A 1UKZA 1DK1A 2BTUA 3TB4A 4EM6A 1N75A 2BBTA 4G4YA 5IJ0B 2H65A 1BEZA 4GWKA 1YI1A 1MFPA 3V7FA 1GA4A 1RJ9A 4JAVA 4DSTA 2I54A 3CW2A 1SD1A 3RE1A 3I37X 1V5WA 1P31A 1E20A 3NP7A 3I05A 4FS3A 2WUGA 4QU9A 3RREA 1WY7A 4GI1A 2GN8A 3CUUA 4X45A 4W82A 5A0FA 1CLUA 3VZPA 1GPDG 2D00A 1E7SA 2G36A 2WF8A 5BMVA 1FTQA 2BE9A 4ALNA 1MRSA 1AMUA 4QUEA 3ITEA 4MYDA 3BXOA 3SR2C 2X7HA 4BMVA 3UKJA 1N5RA 2V0CA 4DPMA 1R3KC 3CH4B 4AF8A 3H4VA 1A9TA 2AR9A 5HIMA 2C03A 1Q0SA 3WLAA 4LH7A 4OBXA 4YYEA 2J0SA 2P6MA 4H1HA 1E0KA 4BDTA 2PUSA 2QW8A 1KO5A 2X8WA 2FSFA 1Z6ZA 4PDRA 1SEPA 2JJQA 2ZR0A 3OOSA 3PQFA 4ZREA 1HLFA 4R2MA 1WU8A 1W59A 1NH2B 5A05A 2WD9A 2BJHA 5DKFA 4HGPA 2DHEA 3MWEA 4DV5O 5CB4B 2VWPA 3QVGB 2AKYA 3F5QA 5L7TA 2PS9A 1G19A 2MYUA 2R1VB 2PT7A 3MRXA 4QGFA 2HLPA 2G9VA 5JWRA 3OJWA 4ENRA 1FJHA 2IK8A 4OJKA 4C30A 2Q3DA 5FQNA 4B6SA 3ERCA 1OFUX 3KJJA 3KE1A 2XYGA 3DE2X 1MABA 5IF3A 2Y1EA 2L42A 1IV2A 3E05A 1T2EA 2JAOA 2IYXA 3Q88A 1HFJA 4XCVA 4ZVMA 3EARA 2DKFA 5LB2A 1EBOA 5EYPB 2H2GA 2HCTA 1Z35A 1D5CA 2NU9B 2R8OA 3MSCA 2WOOA 3TTYA 5EOVA 4BXOB 3VZRA 2OOKA 5IKOA 3KKOA 2OZLB 3K9CA 4E0BA 5JIBA 3HKCB 5FFFA 3KKQA 3QG5A 2O2CA 5BR8B 3CKYA 1NQAO 5LHHA 2HRZA 2XDQB 4DV7B 2QTSA 2FB9A 1RR6A 3OFVA 4B8ZA 2CFSA 1Y5IA 1W3EX 4RD3A 3HSKA 3BQMB 1ZCAA 1Q7EA 3RYHA 1AV7A 4TWJA 4G9EA 3EXIB 3KBOA 5PGMA 3VYTC 2W6JA 1JQLB 1NMZA 1IFXA 5FFNA 1RVV1 2I6XA 2JW5A 2HL6A 2O8FB 2K7ZA 3L7MA 2QN8A 5CLJA 4YRGA 2QW0X 1EVJA 1NXOA 3SX0A 1VQOV 3ZDAA 2FU5C 4TZ6A 1QQCA 3M4ZA 3C7KA 3ZMVA 4BGUA 1GGVA 1DZIA 5JD3A 4XJXA 3FF4A 2GWRA 4WBNF 2E5LO 1GEEA 3GWGA 3CT6A 2TRSB 4RK4A 5IAAA 3L93A 5JU6A 4MP3A 4GGPA 721PA 4V0LA 4AQ7A 2NO7A 4K3UA 1U0HC 4RTRA 4DIMA 1FFWA 3L77A 3VU9A 1IAVA 2Q49A 4O8CA 1QNMA 3WLHA 2Z8YM 1EDEA 4JDPA 2Z98A 1NLZA 2EWVA 1DIBA 2ST1A 3ZNOA 2DSNA 1NW9B 4F7DA 2X4IA 2XZLA 2YEVB 3W5VA 1EYZA 3JWGA 2H7XA 1P4GA 4YH1A 3AHCA 5HXAA 1SG6A 2JRCA 1V1JA 2PLAA 2QYTA 4NTYA 3ZDFA 3BS4A 4L5BA 4DLLA 1N7JA 4S1WA 1A72A 4DMUB 1T5TA 5AUNB 2GN2A 2AOWA 4KQEA 3IEWA 2ZSKA 2Y1CA 4E2LA 5E38A 4PZYA 1WHSA 5C4IA 3SOPA 3I55F 2AD1A 4DQDA 1R6VA 3KAQA 4CMBA 1TEHA 5IZCC 1ICEA 2GYUA 4ZEXA 3PQ5A 4FDTA 3P5BA 4MA4A 3G9TA 1EM6A 1CQJB 2GDZA 1NZJA 2OM2A 3PE6A 2QQ5A 2C4KA 2AVNA 3P7MA 2BHLA 4RKEA 1XALA 2GKOA 4XYBA 3LUPA 1EJBA 4IGKA 4KAJA 3LDEA 1PK8A 1YVPA 1ZUQA 3PUHA 5JJBA 4UB6Z 1XCOA 4FCCA 3AM3A 5CDFA 3TEMA 4JZKA 4X9XA 5I9TA 4DGSA 3BGVA 4MWBA 2PYJA 3ZP4A 5FUYA 1VF6A 1PJ2A 3QNMA 4J91A 1E2DA 3WICA 3QMPA 4E1BA 2OT5A 2W8BB 4XWKA 3N39C 4JASA 1KTIA 3DAYA 4ISCA 4K6FA 2NZYA 3S1AB 3RVDA 5K0BA 4TL7A 3VPDA 2PBFA 5THKA 1P2GA 3CRW1 3QBDA 1RFLA 2UYQA 3B40A 2XR1A 1SZXA 1AUQA 2DX7A 4BFSA 1U3CA 5LDHA 4PCAA 4OEHA 2XKJE 3FX7A 1KRXA 4RU1A 4PDLA 4ND2A 5TRTA 5HOEA 3MQFA 1NDQA 1VL8A 3ZLJA 3TFQA 3IPRA 4CV3A 1W0KA 1M2OB 1N5IA 1PGPA 3TYXA 4ZOLA 2BTQA 1EN4A 4FGUA 1YDGA 1E7MA 3D7LA 2P06A 5TQ0A 4XXHA 4D74A 2Q2VA 1VJ5A 1S5PA 4L3OA 4ZK7A 2FNAA 4M6WA 1NPYA 2J4CA 4KFMA 5ICMA 2Z5UA 1UAYA 4E5DA 4GMFA 3L4JA 5YASA 4XSHA 1PG0A 3ODPA 4BMDA 3SPIA 3ZDRA 4IRUB 2WKQA 4PPFA 2JGDB 2HM7A 3QE4A 1E2GA 5IC5A 1NJFA 5IBQA 4MV0A 1WXIA 4QYIB 5ELMA 2EW8A 4L9SA 1WTCA 1WB9A 4GPZA 1PZMA 2Y4NA 4YMVA 1VG0B 4DYDA 5TE9A 4DWOA 3N2GB 4DR2O 1T9GS 1QV7A 1B8VA 3CX7A 3LDAA 2V7BA 3PD1A 2FC3A 3W3AA 2PH7A 2GYYA 3WJ7A 1XMJA 3X1WA 1XG5A 3KTFA 5LMCA 2JKYA 2QD2A 4JHLA 4LV8B 2R87A 3RC1A 3ZY5A 5MGNA 1IOZA 3H13A 1XZMA 4LRXA 3E4DA 1Y3FE 3M6WA 5LD2C 5J4LA 4R6WA 4O25A 2QG6A 3GLTA 2IYNA 2BV3A 4DSAA 2PWPA 1U65A 1EIWA 3U3DA 5LJIA 3AERB 4D3ZA 4G09A 1I4EB 3ZD8A 4QTUB 1P2TA 2IHJA 3EGWA 1PN3A 4JAVC 2FW7A 3QBTA 4I50B 4HDOB 4WE3A 2ZRDA 2ZJ0A 4O4IA 2FQ1A 3ESYA 1X4TA 4NAVA 4QYTA 1JSRA 3SFVA 4K8RB 4X44A 1BU5A 2HVKC 5JD5A 1LEHA 5IARA 3F5TA 3RUIA 3IP5A 3HKEB 1GTJ1 1ECCA 3O21A 1WMSA 4X3MA 1EFVB 1FCJA 4FZJA 4R7ZA 1IY8A 2R1ZA 4EVIA 4Q7MB 3A9WA 2X1MA 2O5EA 2BGUA 5E95A 2JCBA 4N39A 1Z8DA 3MTEA 3R0IA 1QS0A 3VR5H 1J9ZA 1HLDA 3F9CA 3EBOA 3E03A 5GJVC 3CRAA 3AP3A 4FLTA 3O74A 4XQ0A 2ILVA 1E79A 1M76A 4MVJF 3CCMV 1PEYA 3AFOA 1V8ZA 2Y1FA 1W2BF 4PQFA 5CYGA 3FPSA 4N3GA 3N28A 1ZL2A 3W5SA 4FR0A 1AG9A 4DW8A 3QO7A 1EKXA 1X39A 4L4ZA 1NNEA 1ZL8B 1HYEA 3UWKA 2JBAB 4C0WA 4MWDA 3OURA 2IW3A 3LUHA 3KEOA 3EFOB 4C4ZA 4OYYA 1PFYA 4F4LA 1A98A 1F51E 1NJ6A 1NUSA 3K53A 4YRTA 2QQ0A 3KCYA 4BFTA 4ETWA 1SVOA 1Y1TA 5LP1A 1DTWA 3QPAA 5A06A 1BWQA 3PJDA 3G0IA 3SDLA 3ELWA 4LE0A 2NUPB 3PPXA 2WJ6A 3MD9A 4YRNA 1J49A 5E6SA 2EIJC 4FEGA 3KZCA 4RZIA 4X90A 1LDNA 1SBCA 3FX2A 2OOSA 3PDIB 4JD5A 1K2WA 3D6TB 2PFSA 1JIKA 5AKXA 5DBEX 3U80A 3OE4A 2SNIE 2W2MA 3T1YB 1RRGA 1VA4A 3SNKA 1U3LA 2HEGA 4RGQA 4JL5A 4ZIBA 1MBZA 2W98A 3K8OE 2BW0A 4B3TO 4ZAVA 1NVUQ 2RJOA 9GPBA 3RYIB 4MWZA 4U6QA 4LOKA 2AWNA 4JGSA 1WXWA 4KO4S 4TLBA 3V4OA 1KOJA 4F71A 4IGEA 1K7YA 1O94A 2X3UA 2FPMA 2CFCA 2HLHA 1WCWA 4JLBA 4E5KA 3HYSA 3PZBA 4XGQA 5KDOA 1DQYA 4A6XA 4GL2A 4D6TH 4CM8B 3E9YA 4WD3A 5ECWA 4I55A 1C1DA 1G9SA 2X5XA 3RBAA 3UQ8A 3K0EA 4J03A 1K8AW 5J58A 1IMOA 3ZI0A 3DHNA 3H5LA 3BFJA 4DNXA 4G4GA 3GWOA 5EBMC 2PZBA 5K0JA 2I4LA 3VMMA 4Q21A 5IUNC 4TRJA 5I4KA 1JG6A 2K87A 2XA1A 2O50A 5BQ3A 4I5EA 1KRWA 2RK4A 3EIUA 4WDQA 5KTRA 4BEWA 3DLCA 3G1WA 1VHAA 1L7XA 4IOJA 2XWPA 3GN1A 2HUNA 2JFVA 5G1OA 3EJWA 4YRMA 3BFKA 2GPAA 2QRNA 3HUFA 4G37A 1R18A 3K12A 3FCCA 4ZXPA 1M1KH 1U4OA 3K6SB 4ZDWA 4WXMA 2GESA 1COMA 5B1BC 1K6MA 4IZ6A 5JQGF 4LGMA 4RXTA 1T0PA 2HS0A 1WDWB 2YRFA 1D6MA 2UYPA 3OA2A 5ANRB 1C9EA 2A9QA 4X6UA 2G1KA 4D3SA 4IZHA 4RCYA 4RH0A 3MAQA 3JQ8B 4P3KA 3RAGA 1W8IA 4TV9A 1S0VA 1IIRA 4PCVA 3LZDA 3ZE8A 4EQZA 4O3MA 4JEHA 1PK7A 1UPAA 2A0WA 1KARA 3PDWA 3U7QB 1PWYE 3A4VA 1JJ2F 2CK3D 3P5SA 4FI3C 1EUDB 3Q2KA 1U2TA 5DPMA 4CR8A 2EJWA 3QYAA 4NDNE 2C5BA 2O3RA 3E8SA 4WNYA 4D98A 4PZDA 3TRDA 4EUSA 3ND5A 2DOKA 2YZ7A 3VU3A 3WNDA 1QU3A 4UPVA 1GZDA 1SESA 5DNWA 1JP7A 1E2UA 3KAKA 4DDWA 2AIFA 5JCJD 1QOQB 1FOEB 4Q5IA 4B3FX 1S7CA 2V5AA 5LMZA 2IZ0A 4CF5A 1GSAA 4NYIR 2ZWMA 3GGOA 2AFHA 3QKUA 3HR0A 3EEYA 1E9RA 3R3UA 4PWYA 4RK0A 4HX5A 2ONKA 3ZDBA 4EKEA 3P9XA 4C6RA 1J2YA 3MCQA 1JR3A 4PCLA 3TZHA 2VDVE 1KSHA 3EPRA 1QH8A 5DHRA 5AVSA 1XVTA 2XGJA 3GAZA 1VQ6V 3ZWWA 1RJFA 3C3BA 5H3CA 5K4AA 4YRSA 4ZCSA 2MIIA 4AECA 4LTNA 3UN1A 2XWJI 3U1VA 3BYZA 5JWOA 2Q1SA 3VO2A 1U6JA 2JDIG 1W85A 4M8LA 4QRDA 4PR3A 4II3A 1NN5A 2CVPA 3FWKA 1YASA 1VF6C 2IU3A 1SD5A 4E21A 3O1JC 4EFMA 1PL0A 2CL0X 1J70A 5A1JA 3DEZA 3VC3A 4KXLA 5CW2A 3ZV4A 2QE6A 3UWSA 2OWDA 1DTEA 3VUFA 2SKCA 1Y63A 1LRLA 2UZ1A 3BRCA 4MVWA 1G55A 1I4OA 1YQGA 2VK8A 4DR5B 2H59A 1YKGA 3JQFA 1IBKO 1R6DA 4J3NA 4OSEA 5I7AA 4NS4A 2E75B 3GOHA 3ZWBA 3HBJA 5DIFA 2C1XA 4U2EA 3BCRA 3VISA 1MB2A 3KOOA 4LJKA 3TR0A 1NJ2A 4KP7A 1UZUA 1WPXA 4TTPA 3PVSA 1XD2B 5EUCA 3RS2A 4BPBA 2FTKE 3M6IA 1C29B 4DCGA 5HWSA 5LKRA 3AQ4A 2ADFA 4OA5A 3D6JA 5HGJA 3BXGA 3RSCA 1VARA 1FAFA 2HXGA 2AMJA 3TTXA 2QSUA 2AXQA 5JSYA 4R31A 1Q0ZA 4G2NA 2ZIXA 3N0RA 2ODTX 4BX0A 2VHYA 3AF3A 1HE2A 1D7AA 3MBMA 2LIPA 1W0JA 2DQ0A 2NNWB 4AU1A 1J7KA 1SOUA 1SBZA 1D5WA 3AK1A 3GD5A 2R48A 4IHKA 4HG2A 2FOLA 4PDVA 1AJNA 4B6RA 1OWMA 1JQEA 4X6XA 3E7FA 2MJLA 5AHRA 1KQ3A 5G41A 1UXIA 1BNCA 2VJCA 3FWPA 1TJYA 2NU7B 3FW1A 1DAOA 3CZ5A 2G1UA 4IHAA 3WDSA 5BV0A 4LWSA 1HM5A 1Y1RA 5AKEA 1SOVA 5TVGA 1UZAA 2HA0A 4YIOA 1AQNA 3N2IA 3VNQA 2GH1A 1W4ZA 3PPVA 1Y98A 3VR6A 2QZZA 3NRBA 3UOGA 4RTPA 3Q8KA 4XSVA 1I14A 1ZAUA 2L69A 1NKDA 3DDSA 2C2AA 1OI4A 2CNKA 4L8GA 4ZVRA 1DMSA 3MJCA 2XVYA 4Y7CA 3K14A 1GT91 2BSQA 2CB9A 1OCRB 5BYBA 2AA3A 2EHJA 2D8MA 5LU8A 5I51A 4PSAA 3SK0A 3P4XA 2QXTA 4RL4A 2G6BA 1I3NA 3EBLA 3TG2A 2YI9A 3QELB 4TKVB 1COWG 4JQZA 2WYUA 1QTQA 2I7VA 2GAIA 4J11A 3C6BA 4JC4A 2E3CA 2HU8A 2OCKA 4JI1O 4O02B 3AKEA 1DC3A 4WFGA 1NAHA 1Y48E 2VPWA 2G06A 5DGTA 1Q16A 2AF4C 4D3FA 5LWQA 2PG3A 3QY0A 3CC4V 3RRJA 3OEEG 4E46A 3K8ZA 4I19A 5KYXB 2D3OW 1N2EA 3OMAB 1UOEA 2CNBA 3KYJB 4HBGA 4ZQBA 3IAS6 5AD1A 4I5GA 5DXFA 3MZ0A 2QP9X 4IVPA 4E7PA 4C4OA 1E1RA 1Y76B 1DKQA 3AUYA 5LYJF 4P92A 1Y6ZA 1ADFA 3FTNA 4WFKA 5KHHA 1ULHA 2GPBA 2R72A 2YIBA 4HEJA 2VDOB 1B23P 2ZXWB 2QP4A 3HSYA 3GJTA 1OH7A 1MA0A 2FAXA 2ZK7A 3WTCA 4F7WA 1YD7A 4CH3A 3WL6A 1OREA 3A6HA 2Z3WA 1OR8A 3RN4A 4OKSA 2QKYA 4A0HA 4L6IA 3LUGA 1W9HA 1XQYA 3C15C 5BNWA 2P9JA 4I1UA 4LZLA 1AKTA 3B70A 2MYTA 2N1MA 3LOUA 1V25A 3BH7A 1MORA 1Y4AE 4QBIA 2D7CA 1MTZA 5BWBA 3UM9A 2HA6A 2X0NA 1XTQA 2ZUFA 3OFNG 1XD8A 1ONIA 4UHKA 2H5IA 3ASZA 1GRJA 3C5CA 3TZLA 2QORA 3ABSB 2H63A 1ORDA 3R0JA 1CUVA 5EQFA 3GUUA 3ETEA 2YWBA 3DZGA 3HZHA 3C9SA 2NZXA 3NPMA 4C1BA 4Q6WA 3UENA 1W0JD 2XOEA 4DBLE 4DVGA 1O94C 4I1SA 3CW8X 2OSVA 2BE3A 1BMTA 3HJGA 3K15A 1C7QA 2B4KA 1BXRB 2SCUA 3ZJ4A 4V38A 3CNNA 2Q7DA 3RQSA 2VF7A 1BCRB 4RVGA 4HK4A 2Z2KA 3F2VA 4NEGA 4Y9SA 3QK7A 4F9GA 4JJKA 3PQCA 3KZNA 3AM4A 4KR9A 5HF8A 2QEXV 1E99A 3L8YA 1P60A 4NR0A 1RXUA 4KYUA 4WFQA 1OLSB 3K5WA 3K0CA 5EBWC 2DPXA 4JVMA 3A6FA 1E4EB 3L8DA 3M49A 4C3ZA 1PJCA 1PJ3A 4U3JB 4UTXA 1N0VC 3PFFA 2YMMA 1FPOA 3IAM1 4TGLA 1M0TA 1P80A 2RKWA 5EN4A 3PA6A 5EK0A 5AFSA 1T3SA 5KTMA 1V54C 1WUKS 3R23A 2Q4TA 5IKPA 2AN5A 4G5GA 5LQUA 3GFGA 1N0JA 2VCYA 3R0QA 3KXPA 3A9RA 4AZVA 1KSJA 4ARAA 2LCIA 4B40A 1HPLA 3O84A 2FWPA 3KD3A 1GNSA 2P7TC 1L3BA 1A9XB 4QGGA 4YECA 1OXSC 1W87A 3WNVA 1NQWA 3A1TA 1PHPA 4OXSA 2R79A 2VDNB 2O8BB 1YC2A 2J3IA 2DR0A 1NVMB 2OMKA 1KZ7B 1JN1A 1L1FA 2H54A 3WIOA 3AR4A 3TEFA 4U7FA 1VYTA 2YQ5A 2IEDA 1VYHA 5ITSA 1VCMA 3H42B 2Q3BA 3TAXA 1T0KB 4KQCA 3UA3A 4LNAA 3PEYA 2C54A 4FGKA 2I4TA 1XPJA 1LBTA 3VPHA 3G0OA 3CYQA 3W4JA 2HSWA 1FFTB 4BNTA 3ABUA 3WMFA 1PNTA 3I52A 3ZVRA 1Z8HA 5LLSA 3L4BA 4K86A 3ZO8A 1I4DD 1L5HA 5JWHA 4ZCTA 3ZVNA 3Q3JB 3BAZA 3NKFA 3I45A 5E4FA 2G4LA 2R6HA 3IHWA 4KVFA 2LDBA 1XMOB 3O85A 5J5CA 3E23A 3NWBA 4GPBA 3RIHA 2O3UA 5F2VO 2FWBA 1VFPA 1XTSA 3FH0A 1GGEA 3UAWA 2QI2A 3NHYA 3RKSA 2AS0A 2N75A 4NV3A 3ZW7A 1IDOA 1Q84A 3N2YA 1PVOA 2QTNA 4ZAYA 3TFOA 3NC1C 5CBPB 5K45A 2Q4DA 3ZQ4A 2QMEA 3LWBA 1DAKA 2FPRA 2J08A 4WERA 2OAQ1 3BEOA 3WMGA 2ONCA 1FFSA 2J09A 3HZOA 2FZGA 4PX3A 4FIPC 3CF6R 2R7AA 4FGSA 4F3NA 3AVQA 2NYUA 2M2IA 1FTGA 3HV0A 3S8EA 3EHEA 4WDRA 4B35A 4MKZA 1YDHA 1P0QA 1T3HA 1ORRA 1V95A 2A9VA 5DECA 4EB3A 5B4UA 5DGDA 1H8ED 3M5PA 2Y67A 2YIVX 3VHQA 4BLRA 1PIWA 4MWCA 2ACVA 3JQFC 2OHOA 3HGTA 4CU5A 4RAIA 2ZNIA 1PFUA 4E7OA 3KVOA 5JDIC 3VIUA 3Q5GA 1UMKA 4DG9A 1JH9A 3DJYA 3CR3C 1R16A 1PJZA 3ZCCA 1I6WA 1CIPA 1D1PA 2XVZA 1AQUA 3GVCA 4WJKB 3UAZA 1A04A 1DJMA 4DCSA 4BJHB 2YQ4A 5IDYA 4R0VA 2O8DA 4JDUA 5FBQB 3K2EA 3F67A 5I45A 2KM1A 4OM7A 4IEFB 5BR1A 1MJFA 1MIHA 3FTEA 1CEZA 4WFJA 3WG7C 4R9VA 3ZY3A 2Z1DA 1DIRA 3NHPA 3LUJA 3ZCTA 5F1KA 2OG2A 4Q39A 4XVQA 2W2TA 4QATA 5B37A 4D79A 4FFBA 1JG2A 3PXXA 1LLCA 4FOLA 1XLTA 2IV2X 3OIVA 2XQKA 2I1QA 4JV5O 4IGIA 2DTDA 1C7JA 4O59O 2P90A 2VTDA 2WIKA 1YCFA 4ZFNA 2AT1A 1NKVA 3MB8A 3UXEA 3ZI7A 2WTXA 5JQWA 3RVOA 1KNJA 4PBSA 5FRDA 3HCBA 2BC9A 1W49A 3I39X 4BE4A 1YU6A 1N5DA 4TYQA 2PCLA 4WCEV 4J8PA 4KRXA 1E61A 1SXJB 2BMDA 4CFSA 3B5EA 1O95D 3DA8A 4IHQA 2D1YA 2BFBA 3WK6A 1CRZA 1EMDA 3Q4GA 3LY5A 1TU3A 4GOMD 1YS9A 2PWBA 1X6VA 3QUQA 4Z7OB 4ZAGA 1ARZA 5AW3A 1SXJE 4QOIA 4D80A 1TGYA 4XM1A 2BOCC 5A6VA 3GG2A 1VIDA 4IQGA 3OZDA 1KGSA 4QG7A 2XE7A 1T26A 3N58A 3U62A 4CL2A 4YJ2B 3LC7O 2BMEA 4GZ6A 4X89A 3SHVA 3EHBB 3V3KA 3T3PB 3QM1A 3D2BA 3DL7A 4FFWA 4EF5A 3NGLA 4LNUB 1QYCA 4Y8VA 1DO0A 4G26A 3K79A 4LF5B 4TVSA 3L72H 1HT2E 3WKCA 5MDHA 1JDVA 2JGEA 2J3JA 2CDAA 5BSWA 1JHDA 3WK5A 1YCIA 5BN4A 4A0RA 2NXCA 3EXG1 1YE8A 1AURA 3CPQA 4LX0A 3ENVA 5LXTB 1W6RA 3FROA 1NHGA 1A4UA 2FEWB 4S35A 2I8AA 2JA2A 4FXOA 2YJ3A 4DR6O 4CL8A 5B1YA 3GGGA 3L1UA 3WA6A 3OX3A 3AK4A 2BUCA 4GLOA 5HK8A 4RDHA 3TSWA 2FWNA 5GVSA 5KVAA 5CLQA 3WR5A 3VKGA 3P8ZA 4KV7A 4PWTA 1JQJC 1GYQA 4QEZA 5A5GA 1U5AA 2ZSFA 1TVMA 4EHJA 2R8XA 1LDBA 3TQIA 2GO1A 4N5LA 5GWXA 1ZOPA 1N36B 3F8WA 4WKCA 3I8XA 4QHTA 4GBMA 4JI5O 2PYZA 3PFKA 3ABKB 2W37A 1RA4A 4F2GA 1Z2EA 1IURA 2CB0A 4H6PA 1JPXA 3OZIA 4MSWC 2KTUA 1KVRA 3UEOA 4EAQA 5EL0A 1K97A 3TETA 1XL0A 2XZDA 3ISTA 1JJ7A 2Z95A 3LA8A 4W5JA 4NZZA 1FW8A 1Q6HA 3LO5A 1PCXA 3HKDA 3ESBA 3VTKA 3CCEF 2WM8A 2JI8A 4OAQA 2WNSA 1WBJB 4FNAA 4FYYA 3U40A 5E9QA 4C7BA 5JJNB 4G07A 1LLFA 2UYGA 1H2SB 3IUJA 4QELA 1EP2B 3SDSA 3E15A 5AYVA 4EB8A 3G2MA 1Z0UA 4YIKA 2WHEA 5K8CA 1OSNA 3C1UA 4K7JA 4B44A 3K16A 5J4YA 2GPTA 2V45A 1XBLA 4BEBA 3UHJA 2BSAA 4WOJA 2YDYA 5BORA 1EK0A 2HP8A 1CS0A 2QMHA 4PD4F 4R01A 4FWTA 4D43A 4I5SA 5KUTA 2OHGA 2HB6A 5KA5A 3E9CA 4DEXA 5DT2A 3JD0A 3BB1A 4LDRA 2F1KA 3B3JA 1P0CA 2VJLA 3H4MA 3LQRA 1EUCA 2Q9AA 2IUUA 1R3JC 1IHPA 2AMVA 3WSWA 4JZYA 4GUDA 2ZTVA 3GWKC 1K7EB 3K0CC 1XVIA 4MVJH 2G9UA 4F8YA 3OZAA 1IUNA 3M1LA 1EG2A 3X1JA 4HRAA 1FEZA 4UVBA 4P4NA 3GVHA 3DZCA 1I2MA 1YVEI 2Z9BA 4K6KA 6AT1A 2TMDA 1RP3B 2B21A 1O0CA 5LA6A 5CBHA 4G0NA 3JYCA 2PY5A 3IPLA 4ZIRB 4X88A 3H7IA 3EH1A 4BT6A 4U7NA 1JIQA 1RQNA 2FMKA 3ENKA 4LPKA 5C7OO 3V8VA 3PC3A 1FXKB 3DOCA 2ISQA 3Q0IA 3DTVA 3BICA 1EWQA 5IEJA 4YASA 2PWAA 4YMGA 3GFQA 4PFQA 4MPRA 2E74B 1KXZA 2OHXA 1GGHA 3PEFA 3ASVA 1KEVA 1O95C 1D09A 4R1TA 1JT9A 1OJHA 5TF4A 4IMIB 4UTOA 2I3DA 4WLFA 3CMEV 5J9PC 3TLZA 4DIKA 3NH6A 2IH3C 3AB7A 3OE7D 4RVUA 1G3IA 4OB7A 3SQDA 3ID6C 2FMHA 1AUVA 2EILB 5E4TA 1L5KA 3SSMA 5TSDA 4DLBA 4L8VA 2ODQA 1S3FA 1IHDA 1PJBA 1QP7A 1YE3A 2E2WA 1FP4B 5BWMA 3COWA 2EAUA 5CNIA 1DC8A 2P2ZA 2RGGA 4M22A 4MLPA 4MRSA 1GO2A 4JROA 3G6EF 3P19A 3CGGA 1D2AA 1PTJA 4LJ4A 1CY1A 2QX9A 4IHJB 3KQVA 1BXKA 5LM3A 3RBXA 2EL7A 3H8VA 3HR7A 4AO8A 1OXXK 2Q3HA 2Q6OA 8MHTA 2GGSA 5JSKA 3R1IA 2IDKA 1JA9A 3SY8A 2NN3C 4FMCF 4WCVA 3MRVA 4PICA 6YASA 4BB0A 1EK1A 5B1HA 3AI7A 1QWSA 4CKYA 4QFMA 5LP6B 2FPGB 1MZFA 2B3TA 2LDXA 3EVFA 3L3BA 5JW6A 3H9CA 3IE0A 4NFLA 4JU8A 4E08A 4LFCO 5K1ZA 5AP9A 4RKFA 4XD2A 1QRSA 4BBJA 1CQIA 3SE0A 1SC1A 1N6OA 3CVYA 1SHTX 1XAIA 2P5TB 1GTG1 3MJSA 4CS3A 2YWEA 3SPXA 3C9TA 1HMPA 3F96A 3ENWA 3D54D 2IV7A 4PC2A 3OC6A 4HUQB 3MUFA 2XLCA 5C35A 1ST2A 1KSFX 2IOFK 3DPUA 1E6EA 4F5EA 4BQRA 1YA8A 3PI6A 1T8WA 1Q6UA 3RT7A 3SJ7A 3B13B 3UWMA 2H4JA 1MJHA 4GZ5A 1GZ3A 2RAUA 2V58A 2E37A 3SZUA 2WEKA 2AZ4A 3NK6A 3L6BA 3QEAZ 2VTBB 1VGRA 1VLZA 3QH4A 4D82A 1YJ9F 1PO7A 4U02A 3IR6A 2WJWA 3FFBA 2NWQA 2ZI9A 2G1AA 4O33A 3MJEA 2DY1A 2H1LA 3OPNA 3UPTA 4KEAA 2OCCC 4YXWD 3C70A 5FA5A 1PR4A 4G1FA 2C9BA 3P52A 4LF6B 1MAVA 2GFQA 4AY6A 4CKWA 2QDXA 2Z1MA 4QXAA 3UWDA 3OQ1A 1E58A 3LBYA 2LFRA 4KSCA 3SX2A 2UUBO 4JOSA 3S27A 2XDWA 3CEAA 4MVSA 3AVPA 1XLTC 1YFKA 3NV9A 1EM8A 3UV7A 1GGFA 1MQSA 5IVPA 1DX4A 3LOPA 2I71A 3GLSA 3GB9A 3HU1A 4AYWA 1I7PA 4GLBA 3PRKE 5T4FA 1P4JA 1NMUB 1TVKB 3NWPA 4B6QA 4C06A 5HRAA 2WQ6A 4BMXA 2F17A 4CTMA 4Q4DA 4ZQFA 3AVXA 2PUGA 4FN5A 1EHCA 2C1EA 2RG7A 3HYCA 4LYYA 2XXJA 2NT4A 5CB6A 3OPVA 3GEIA 1INLA 3Q2IA 2QUIA 3PWTA 1XNQO 3BFRA 4EHBA 4MAAA 3H1JH 1X74A 3RV4A 1HOTA 1JE0A 3LC1O 3WZ2A 5EE9A 4C0AC 4NE9A 2QAIA 3FBWA 1E89A 1XMPA 4YK7A 4YPFA 4AAYA 1N34B 3FCAA 1WMEA 2ZI6A 4TUYF 4YRRA 3K5OA 4UM9D 3VNVA 4H7EA 1UBKS 2CCGA 3GT3A 1UK6A 4PRKA 2VAMA 5EHGA 3B4SA 2FG7C 3T1TA 4B32A 3SWWA 3E4CA 4RH3A 4TQDA 1F7YA 1Z6GA 1F8YA 4PC1A 4OJQA 1QHIA 3B6EA 3WAGA 4BO9A 4U4AA 5U9CA 3J81N 2ZODA 2YRXA 4MGZR 3SM3A 2J5RA 3CUVA 2C9YA 2OORA 1WQ1R 4DA4A 1XTKA 3NWOA 1TW2A 1FUUA 2Q7XA 3M0EA 4KGZA 1G1MA 2XUMA 3Q1LA 5K2MA 4CEJA 3WFIA 4OXXA 3SC2A 2HFEC 2CHSA 1GZ5A 1O5TA 4F1JA 3GXOA 3N7TA 1URFA 3UJDA 2SECE 5EERA 4OKNA 2ZUCA 1R0RE 3BRSA 3L0PA 5DM6V 3EAGA 3CJQA 3G5UA 2BO1A 5B57C 2CXOA 2NXWA 3OHSX 1ODIA 2DFTA 1P9OA 4R7CA 4ZHQA 4HLCA 1WBDA 3STXA 3ORQA 1C7IA 3MINB 2EARA 3FD6A 2Z2ZA 3A8TA 3IKLA 1UM9B 4C7OA 3O8QA 3PEEA 1Z6QA 1H5NA 1JJFA 2HPHA 5IN5A 1U3FA 2J1LA 1WCXA 4NBUA 2JH8A 4Z1VA 1Q0LA 2JH9A 2J7PA 2WFLA 5ALRA 1XMIA 2Y77A 4ARZA 3L07A 3PEVA 1DC4A 3T5TA 1KDRA 1WW3A 1FSZA 1BXZA 2JIMA 4BMOB 3DOIA 5L53A 4LYJA 1KKUA 2B34A 1U2PA 4DRZA 4EG5A 5HW0A 4KXUA 3D7KA 2CNLA 3QKTA 3CXCF 4R8KA 4E30A 3GDOA 3O7MA 3EIOA 3PNYA 3LNMB 3PT9A 3TVDA 1YVDA 3L46A 2UUCB 1UOPA 3ANMA 2C98A 1FFXB 1ORTA 3E7PA 5B53A 1R15A 2G76A 2GZHA 3GMDA 1BYIA 1WUJS 1WDLA 1I0HA 4UTRA 3GEPA 2GPNA 1HRDA 1B6RA 2QN6A 2ZUBA 4HXFB 1M57B 3ICXA 2QJRA 3FYTA 1YZNA 2P1RA 2NO1A 4LXXA 1WDKA 1FP7A 2VSFA 4HMOA 4I9WA 1SU4A 3GLRA 5KYWB 2BI7A 1UJBA 1SHKA 3KJIA 4A5UB 4A03A 1YL6A 3R9IA 5GTHZ 2P8JA 4BU1A 1V55B 4ZDJA 1Q5PA 1AXGA 3FAKA 2O2EA 1ECJA 4GKVA 2GZSA 1R73A 2MR6A 2YXEA 4HNUA 2P9YA 3K3PA 4Q3EA 4ZQHA 1Q82W 5LUBA 2ZSEA 3CLRC 1QGUA 3DSQA 5FOQA 2HP0B 3K9HA 4ZEOA 1AJQA 4F5ZA 1S8FA 4P82A 2RCNA 2A7XA 3ENZA 1AP5A 5M34A 5BSVA 5LOVA 2P9TA 4UATA 1R6NA 3LWOC 1F2TA 3EQ8A 4MV1A 4WF9V 2KQUA 2OLJA 2X3YA 2PGLA 2ZCEA 2BKXA 1NX6A 1XKLA 5EKXA 4BS9A 1KI7A 5DASA 2QM8A 1PYOA 2C5EA 3AEIA 1IK6A 3KBBA 1WSWA 4PLYA 3ZHBA 4DV6O 1LU9A 4JT8A 3W77A 2E4UA 1G2PA 1OVMA 2FMTA 5A02A 1JEDA 4QJBA 1K3UB 1HE5A 3IVAA 3SC3A 1SXPA 3OR6C 4AYXA 2ZWIA 3W3ZB 3R0PA 3QEBZ 4QO8A 1NR7A 4IUBS 3DDUA 4U63A 4CMEA 1MIOB 4MARA 2P4EA 4XDYA 1UJMA 4HP8A 5FI5A 1T8YA 4OJNA 1DRVA 4QTXA 1CT9A 3T99A 5JRDS 4BLQA 4H33A 1OOEA 4JJZA 2OCDA 3HG7A 3T1NA 1NY5A 4EF6A 2I34A 1TPYA 1HGXA 1PFQA 2NO4A 3IALA 3NNDA 2QRGA 3G2HA 4TLAA 1LY1A 2JHAA 1C3OB 2NMVA 4TL8A 1YV9A 4BO8A 5ADUS 3HEMA 3RS5A 4B31A 3CCJV 3BMQB 3GCWA 2ZR9A 3LUTB 1MMMA 1YUNA 3DMFA 2EKDA 4E1AA 4RA6A 1W0CA 1PTJC 4IH9A 4XDZA 1NRJB 3HM9A 1OA1A 2HIGA 4UW9A 4TRNA 1SZQA 1JLHA 1VQ4V 3WGGA 1F0NA 1SCJA 5IYCO 1EAMA 4DV2O 4H0LB 1TQHA 4ACAA 2H0RA 3D3IA 8LDHA 3GFTA 4RCVA 3KU4A 4NATA 5HS4A 2JLAA 4POAA 1Y89A 2CLOB 2KS6A 3AIKA 1ZM3A 4G9BA 1J22A 4P30A 2QAGB 3PIIA 4NMMA 2P0AA 1S72V 3AEZA 2WWFA 3QPVA 5CM8B 2VOJA 3I23A 4KX5A 2ENWA 5F52A 1XTBA 4Z4EA 2YXDA 3R5TA 3PUIA 4LF8B 2IOHA 3PZRA 3APQA 3EUWA 3T7IA 3OM0A 2H5EA 3RUFA 1UPXA 5AHKA 2FA9A 1OH5A 2B99A 1BDIA 2W6JD 1SQXH 1S2LA 4Z0PA 1S2GA 1OXVA 1ODCA 1H4TA 1OF1A 3FMGA 5L3SB 4JU9A 2XY4A 1FDRA 4C87A 1CETA 5IDVA 3IHTA 4FQ8A 1FX1A 4ZXFA 4ZZ1A 3O94A 3DVQX 5BPHA 1RI4A 1CULC 3OICA 3W78A 2FSPA 2A5LA 4QNRA 3SHWA 3C6YA 2SICE 3JZAA 5EE0A 2AQKA 1JR6A 1R1BA 4ITVA 1DIAA 1IEQA 4ZZ2A 2VF4X 4JA2A 3V80A 4FDAA 5KX5B 5A0VA 3RC2A 3JVVA 3MK31 4XEUA 5KSZA 4K6CA 1O58A 2WJVA 1Q7RA 4NH4A 2IEYA 1UOQA 3K7EA 3PD0A 4BNDA 1FF9A 3LFHA 3STTA 1W29A 2PS1A 1Y3DE 3S40A 2O6HA 5HPYB 4COKA 3G5MA 1AV6A 2WT8A 1PJ8A 3KFVA 4DMHA 1TGOA 2R4TA 1R0WA 2EQ5A 3LBFA 4RD0A 3V6LA 4GI5A 3V4ZA 4GSYA 1WHTB 5CT8A 3TW6A 3TXSA 2GI4A 2HRRA 2VIIA 5FWDA 3NEYA 4B82A 2C57A 1NUPA 1CFJA 3QFFA 3HYNA 3QW2A 2XUGA 4U2KA 3VAZA 3FYCA 2AN4A 4IJ5A 4B3BA 1B2RA 3COYA 2EX4A 2OD7A 3O3OB 1RBMA 1L5YA 3G82C 3PYXA 3BMOA 5AKYA 1FYEA 2YX1A 2ZJ1A 2HBRA 4XARA 5J2UF 1MFZA 4D3DA 1DWUA 1RC1A 4X1YA 1ZI6A 4L57A 2YV5A 2R65A 2XI4A 3P9CA 3GLQA 4NV1A 1G0NA 3Q6MA 2X8AA 1FJGB 1BQEA 2MOKA 2Q0HA 1AVTA 1CN7A 4FMDF 4YJGB 4XWYA 2V4UA 1GJRA 2MR5A 2Z3VA 4C2BA 3QTTA 1GGNA 3B6JA 3UK6A 1HNXB 2Y1XA 2FW6A 4KOAA 2RCYA 1M90H 4IXWA 1YJQA 3B85A 4EOGA 1TUBA 4JEIA 1CUWA 1BA2A 3NBZC 1T1GA 1ZG3A 3G2OA 2W4QA 4KI7A 3RYCA 3P9NA 4CGYA 1B1AA 3PTAA 3JQCA 2OORC 1YRYE 3AGKA 3T1VA 1BCCH 2YXZA 2RHJA 1TIBA 1RW4A 5K3SA 3M9WA 4CF4A 2NTNA 2Z1FA 1GAEO 4B0PA 3T3OA 4LC9A 4XRGA 3W1VA 4IWNA 1KEPA 2XXAA 1W0KD 1XZCA 3FYUB 3OEHA 3RR2A 1K7SN 2WUEA 4UMFA 4R83A 3PE3A 2VGNA 4JIGA 2DQSA 2ZAMA 3QA9A 3D6NB 1B00A 3PCTA 2JEXA 1QHHB 3AUSA 3ED5A 2DWDC 5KYUA 1FK8A 3I6IA 2WAYA 4Y2HA 2ZR8A 4QL3A 1NU1H 2PY6A 5LGTA 3ESAA 4H0CA 1JQBA 4N7JA 1VPVA 1B16A 4F1KA 2QI9F 4YUWA 3U49A 1N1GA 5FKJA 5JALA 2PO5A 2NSDA 1HE1C 4TQUS 2ZVPX 3ASNC 1T29A 2FDCA 4MVMA 2IU4A 4ENUA 5FF9A 1ORIA 3FUUA 4Z3DA 3DBHB 1S2OA 5U1PA 3C3AA 3HYLA 4X20A 3EIXA 2BFEB 3LDUA 3WO0A 4P7KA 4Z5XA 3J7AR 3X1XA 3UHPA 2WIJA 5DGHA 2W2NA 5EPUA 1MA1A 3CN7A 1U0FA 4RFVA 2PMPA 3ZZUA 5KIAA 3W3AD 4ERXA 2OWEA 5AMXA 3I58A 2QOEA 2GD6A 3M6VA 3I32A 1SG9A 1R8YA 2VWHA 1DEXA 4P58A 1QNFA 2K1SA 1Q0QA 1P8AA 3HXPA 4NCIA 4UAJA 1K3TA 3R0ZA 2JHFA 4QX6A 3L0IB 3ZWVA 2ZYHA 4D4MA 2CF6A 3AEYA 3P2MA 3QVUA 3EG9A 1XEFA 4BY9E 3TNDA 4F2HA 3T2MA 3PJGA 2H1FA 5BWCA 1C30B 3IV9A 3ZXIA 1HTTA 3ABLB 1PWEA 4OJTA 1TD9A 2IGBA 1N8RH 5JMPA 1EX9A 2P65A 4RD6A 3GRUA 1SVIA 5AO9A 2QM4A 3AL2A 1FYJA 3ROEA 4F91B 4O4HA 3UH0A 4OSOA 3ESQA 4F8JA 4NONA 1HP8A 1MH9A 1W76A 2Y0IA 3VR1A 1H69A 5EIEA 4HT3B 4LF7O 5SZJA 2JARA 2V96A 5COQA 1U99A 1UM8A 3OT4A 1ADYA 3HU5A 4YMHA 1T0IA 3E5RA 1DBRA 3B6MA 1JX9A 3K6KA 2DYYA 4XE5A 1F4VA 2Z4RA 1E79D 1KIAA 1CEYA 1AGRA 2GPJA 4QUDA 2W58A 3LHIA 3NS7A 2AFIB 5KTKA 4ARCA 2JFWA 1OCOC 4MQFB 4B4OA 1OU0A 3KO8A 2G7ZA 3GLIB 8ADHA 2ZIEA 4L75A 4OPHA 1AE1A 4KQFA 2ETNA 4CMEC 1JQAA 2AFIE 4IO1A 2GJ4A 3T4ZA 2C7BA 5DMXA 1IJBA 2F2TA 4JEUA 2ZLBA 3V55A 4PGGA 5BWNA 3DBRB 1P7YA 1BQ0A 3GLIE 4JJGA 2XBUA 4FYIA 1C8KA 3B6KA 4MJ3A 2C2ZA 5KAFZ 4K46A 2Q4EA 3PYLA 1NASA 1RM4A 3L8EA 2O52A 4YUXA 4D8TA 2Q0OC 2CC2A 5CPBA 2VF5X 4EENA 3CS5A 4WQMA 5AH0A 1BU8A 1FTSA 4PZ9A 4MIEA 2ZE6A 2BP7B 4I08A 5JNVA 5IVKA 5B1AB 3H2YA 2JJYA 1CNMA 2P8SA 3VV2A 3KOWA 5ADWA 4M60A 2WA4A 3AX6A 5I7EA 1XYVA 3G7NA 5DGIA 1EWVA 4ZEVA 3URMA 3FM9A 3AONB 2AWOA 2KYRA 2JIBA 1O94D 3FFXA 1IWPB 3QG1A 4GHWA 1RE0A 4PPNA 2QTFA 4CMGA 4ER6A 2H4XA 4C22A 1H48A 4CN8A 4TKUB 2CXHA 3WK8A 2GOYA 3ABOB 1OU4A 4CETA 3AWDA 2GHTA 2P11A 1NT2A 1F5SA 5GONF 1NMQA 1M6WA 3FCOA 4RGVA 4BJ1A 2ISSD 5AM1A 3SZLA 1U3VA 3GLFB 4YMTA 3E1SA 3PPIA 5C31A 2DQ4A 3BXPA 5LIPA 4ZMSA 2YUTA 1PEAA 4XVUA 1P2UA 4MYCA 4TT3A 3TW8A 4V1CB 3GLFE 3FWHA 2R6CA 2VT6A 3EQZA 4YEDA 5EHZA 2FH5B 1Z6YA 2ZRQA 4BJ6A 1Y5NA 4GT1A 2O8NA 1Z88A 4RQTA 4HZGA 2JNBA 2QYSA 3F78A 4GS5A 4RBNA 3D8NA 4G0OA 3NR2A 3M2TA 2ORYA 3X44A 5KWEA 1TEXA 1RQ2A 3I6MA 3P9YA 4RUKA 1VCNA 4BWGA 4AK9A 2F1HA 1OFHA 1B76A 4JKIA 2YTZA 2YIMA 4BVEA 2AJDA 1WPBA 1PR5A 1WDTA 5ADHA 4RM2A 1TZMA 3L73H 4R2WA 4JK3A 2DR2A 3EQ6A 1DE0A 1TCAA 5CDGA 2MSDB 4DARA 4R98A 3B8MA 4FLUA 2ORED 2XUPA 4WXHA 3MMXA 1LUVA 1MOSA 2IYUA 1TT7A 4HXGA 3NI2A 3OCVA 2EU8A 4TLMB 1UAGA 2ORWA 3BD7A 3AF2A 2CMKA 4MLDA 3O47A 2BFCA 3W5JA 2Q2QA 1MOPA 1P9NA 3I0MA 3PXDA 4FHGA 2D1SA 4NECA 5D5HA 3RVJA 1FXVA 3NQ41 4HTFB 1YTFD 4GF5A 3GCXA 1DQZA 3Q11A 2C83A 4P3XA 3J81M 1V4BA 4CT5A 1C9NA 4W63A 3WGNA 2XCQA 2FMFA 1YC5A 1PGQA 1DAPA 4LCJA 3E22A 4IAOA 1ZGCA 2Y05A 1L5SA 3T9AA 1UKYA 1QF9A 4WL0A 1N2XA 3DYIA 3UGQA 2HU2A 1JR3D 2A14A 4J41A 3CB4A 2KSQA 2OV4A 2CLSA 3BTOA 5EJ8A 3GP5A 1V9PA 2H57A 1WNSA 1T36B 2XUAA 5EJ6A 5K03A 1A2OA 4GX1A 1VSUA 4OK5A 4W9NA 4G8CA 4OKIA 1M2GA 1A5AB 4BNKA 1Q90D 2QU7A 3SC6A 5C8YB 3TNFA 3DZFA 4MV7A 4Y7DA 2CUNA 3CWZA 3PNOA 3OP1A 3NHBA 4CBCA 2EBFX 3H11B 4D4LA 2GZMA 5L9AA 3HDQA 1A9QA 3PQEA 5AM3A 2IAFA 3FZGA 5ISMA 3IC5A 5FOUA 3CNEA 4MEAA 5I7FA 4BEJA 4DWVA 2QVCA 3NUGA 1Y3CE 2I03A 3NMUF 2DTXA 2WTAA 2HX0A 1KS2A 2KSDA 1FX0A 3JCZA 4BZXA 4YRCA 5CA3A 2R9VA 4GLLA 1ZX3A 5L3VA 1FUIA 1IHUA 5HZMA 2XF2A 1Y7HA 1G63A 5AOAA 1PX2A 4IIGA 3O8CA 3HH8A 4BZZA 2BSKA 4UHBA 2ZYRA 5CA0F 2WF7A 1N4AA 4EGCB 1S2DA 2GT1A 1QR6A 2BHTA 4YLEA 2X9LA 1WAZA 3HADA 5KNBA 4CG2A 5AKHA 4LK3A 5A5FA 1AOXA 4LHYA 3HVRA 2C2MA 1XLWA 3GGPA 2XTZA 3QTCA 3IDAA 4RIFA 3WKEA 2UUAO 3VKVA 1YR1A 1TLLA 1GR0A 4JITA 5KYNA 4FFNA 3HUTA 2EZ8A 3UXYA 2GJKA 2QRZA 3IUBA 5LZ9A 1L4UA 4JBHA 2J9FA 2VXCA 4PG7A 2QMUA 5JG7A 1YTUA 1USWA 3VO9A 3FVQA 4NJEA 3G7UA 4MITA 4BNJA 3K0KA 4OB8A 4WA7A 3PNVA 1EUQA 1T9GR 1HNZO 4CH6A 5JECA 2YY5A 2CMDA 2VQFO 1GG2A 5DLDA 1P0PA 3VR6D 4HBNA 4ZRDA 5DM60 2J3EA 1IEVA 2NZUG 4DN6A 1P3Y1 4Q19A 4MP6A 1T3GA 1IPEA 4UHHA 6ADHA 1EVZA 1KK3A 5JS2A 4MWSA 4GDMA 6ABPA 1Y1LA 1XKQA 3DF7A 3QIVA 3A0RB 2MHCA 4OXRA 5T8KA 4J94A 1MO4A 4QE9A 3F74A 1Z5GA 1YVUA 1TA9A 3VH3A 4BNUA 1EX6A 1Y5RA 1NLUA 1X52A 4WXRA 2Q3JA 4C0QC 5B1DA 4HQKA 1HFEL 1DDOA 4M9RA 4U2GA 2R8YA 3JD3A 3KVYA 1YCDA 1I1OA 5CAEA 4L4SA 1GFWA 1F8GA 5TEVA 5CFRA 1ZD3A 3ERNA 5CVUA 5DF1A 2JGKA 3U4QA 3OJLA 1M83A 2OWOA 4M9SA 3IMKA 1NYLA 2D5IA 4D41A 5F9FA 2FP4B 2OCBA 4LVUA 2C42A 4I6EA 4M3NA 1YK0A 2G4VA 2PL5A 2NOAA 4CG3A 1JDJA 3SYPA 4KK4A 3ZBHA 5DHUA 3JYPA 3C8HA 3KHNA 4NBTA 2CLCX 4ZPXA 3AUXA 3RWOA 3FJ1A 3F0TA 1CZNA 3T3EA 4IDGA 2E0IA 2HZBA 2XMZA 4MQ4A 4KU4A 7GPBA 4TZKA 3MRSA 2CUGA 2XCIA 3P2JA 3ETGA 1MV5A 1MJNA 5HFAA 2IPOA 1E1RD 3O8DA 2HU5A 3IKJA 4UUPA 2XNDG 1V47A 2FSIA 2PMFA 2W2KA 2AL7A 3M9XA 1GUAA 4QGHA 2PZ8A 4WINA 4R6XA 2YIBD 1FE8A 1HE4A 1F0KA 1RPJA 1E1QG 3NK7A 5F3DA 3ZC3A 3W6OA 2RGNA 4IL6Z 3L5OA 4WECA 3AKZA 1VQKV 2H29A 2PEYA 3UAOA 4EA7A 4BX2A 4HGYA 1HZJA 3RVPA 1JRLA 3T61A 1OXKB 4OX9O 2PO7A 3M6MD 2J3QA 4PF1A 2J6IA 2HDOA 1D8AA 2OLKA 4X62B 3CKMA 4C5BA 3RS0A 1KBZA 4R0MA 2D4HA 3D81A 2C00A 4HAYA 3M8KA 2W9XA 1DOAA 1N33B 1J23A 3AG1B 5KS2A 1NQTA 5H5JA 4LEIA 1L4YA 1WJZA 3CLSD 2VHZA 1GQSA 5AT1A 4C8GA 4K9SA 4LVOA 3MT8A 1M2EA 4D4JA 1MX9A 3H1FA 1JILA 3K0FA 5AKKA 1ZSYA 3EJ6A 4TXMA 5KNCA 2CV2A 3S4YA 2RI1A